3IEVA

Crystal structure of era in complex with mggnp and the 3' end of 16s rrna
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
302
structure length
302
Chain Sequence
HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ERA in complex with the 3' end of 16S rRNA: implications for ribosome biogenesis
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Nucleotide binding protein/rna
molecule keywords GTP-binding protein era
total genus 99
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3ievA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ievA01
1FMJA 3W90A 1FP6A 2YOHA 4M0LA 2QSZA 2BHRA 1ZM9A 1H8HA 3FB4A 1KO4A 1E2DA 1E2IA 1IXRC 4M1MA 4Q9LA 3D7MA 4KYUA 2WWGA 1WA5A 4QRHA 8OHMA 5AR1A 2FEOA 4NP6A 5JRZA 1E2HA 3QVUA 1NJFA 4Q1DA 4LPSA 4IOJA 4Q9KA 3GJ6A 2RAPA 1A5TA 3BB4A 2CHQA 4URWR 4R2HA 4ESVA 1IY2A 4CT4B 3FGNA 4MRRA 4U7DA 4HB2A 4BECA 2WJGA 5LMNC 1F2UA 2GXAA 2GNOA 4Q4LA 3AF3A 2E9SA 1C1YA 2JJ2D 3CPEA 2V4ZA 2QRNA 3P4YA 4WZAE 4DUGA 2GBLA 1ZNWA 5C2JB 2NMVA 4US1R 1EFRA 1E99A 1XBTA 5FR2A 4EPXA 2HCJB 5DH9A 1D9ZA 2BKEA 2ZSDA 3TIFA 2O8FA 2J87A 3PR1A 1U2RA 4KFTA 3MMPA 3RVBA 3U7EB 1H8EA 1JPJA 1QBKC 1H8HD 2YV5A 2ZEJA 3O8DA 4WZ6A 4CEJA 4LF9C 4DV0C 3BGWA 1E69A 1Q1EA 4TLAA 2PX3A 1W0KA 3U60B 4PHGA 1C4OA 3Q9LA 4MKHA 1Z0IA 3KX2A 4GP7A 4L5BA 2JLXA 3WYAA 2CHVA 1WRBA 1UJ2A 1NN3A 2WSSD 4PPFA 5D3MA 3R7WB 1MABB 1JR6A 5TV2A 4JI5C 4OJQA 1R5OA 2ATWA 5FLXD 1VG0B 5KNBA 2ASEA 3BIFA 3DO6A 3U3KA 4QGGA 2BMEA 2JJ2A 2OZEA 1S9HA 3ZS9A 4MDEA 2PL3A 3DMDA 1ZB8A 3T1HC 1HV8A 1ANKA 1KI6A 2ZRDA 4HZUA 2Z6VA 5HCNA 4ZI2A 4OQLA 2ZRFA 4S35A 1KKGA 3RSLA 421PA 2D62A 4G5OA 4C0KA 5H8WA 1FW6A 2X2EA 2ZQ5A 4XVRA 3K0AB 5KPDA 4MH0R 2HXYA 4B3GA 1G6OA 3FFBA 4M4SA 3DOFA 4GKKC 1VCIA 2HYDA 2OEPA 3NBYC 3ADKA 1FJGC 2WMOB 4WIAA 1U8AA 5L3QA 1H8ED 4B3SC 2GDJA 5AJZA 5EXTA 4C7OB 3LFUA 1YZKA 2NGRA 4GBMA 4J0QA 3K70B 2DCUA 3WHKA 4N0DA 1FTSA 3P26A 4DLRA 1JEDA 3U6BA 1G64A 4QGHA 4ESHA 2PT7G 2NO7A 3SJZA 3TMKA 1XP8A 1N5IA 3QXXA 4DUGD 4OHZA 1I2MA 3DM5A 2VL7A 4UNRA 1M7GA 2V54A 4BRWA 3FHOA 2VP5A 2QBYA 2J0UB 4PHTA 4LV5B 5JBQA 3KQKA 3I5YA 1QF9A 2ZRLA 3QKSA 2JIZA 5LD2C 2G6BA 4UKDA 4YMSA 2G0TA 5JI3E 2ONKA 1ZUIA 2LWIA 2F43A 2HV8A 3R20A 4TSFD 5FL7D 4DDUA 3VKGA 2IYRA 3LVQE 5E7JA 1VCNA 3HPRA 5AUOB 1BIFA 4BLTA 3TVTA 4KCGA 4OHYA 1AS3A 1SVMA 4DLUA 3BFXA 1N5KA 2CJWB 2FSIA 1JR3E 3AKDA 3OIVA 4YDSA 2E5LC 1JNYA 4ZDKA 1WBDA 5EE9A 1A1VA 2PLFA 4RD3A 4RD0A 1RRGA 1R8QA 2YWHA 2O8EB 1Q20A 3WBJA 4AKIA 1TQDA 4P33A 3K0CA 2UXDC 4LHXA 3TJZA 2RCNA 1FP7A 3NWJA 3QENA 2VP9A 2REXB 2PLRA 4HDCA 4II7A 2DWQA 4OI4A 5FI1B 1LV7A 1Q3TA 3CIOA 4C9BA 1YZNA 2EFCB 4RD6A 5G41A 4BLRA 4BEJA 3EARA 4RZ3A 1PA4A 4XWOA 2Q6TA 5B2ZA 1G8HA 5LD2B 1GM5A 3BC1A 1EG7A 2XR1A 4JJKA 2P5TB 1VHTA 2E8FA 3JVVA 4YDHB 2EFDB 4JLKA 4MGIR 4ZKEA 2CCGA 1OXUA 1P62B 1QVAA 3OIUA 1L2TA 2FGKA 1FPMA 1OHHD 3QEOA 3MCAA 2NIPA 2IUUA 3M4YA 4NYIQ 3TQFA 3NC0C 1II9A 4D4JA 5SZKB 2WWIA 4GSYA 3TW8B 2VP0A 4I99A 4ASUA 4JLVA 3WBKA 5FPYA 4Q7KA 2O0HA 1ZJ6A 2J41A 3AF1A 4XWKA 2IC5A 3LVRE 4EPWA 3EPHA 1CULC 2JATA 3CH4B 4I81A 2VF7A 3I8XA 1MT0A 4JBXA 4DB2A 4JL6A 3IQXA 4TMZA 5JWOA 1DG1G 1AS2A 1ZNZA 2VP6A 4KHZA 4DRZA 3GFPA 3AVVA 1ZD8A 4HLQB 1PJRA 3CH5A 1GAJA 1IN4A 1OXSC 2DFLA 4H1UA 4RD2A 1OKKD 1XMJA 2ZRGA 1MH1A 5CK5A 4AYTA 4Q03A 2GF0A 1NBME 1XJ0A 5BW8A 1GKIA 4QL3A 3K0CC 2QMEA 2QTHA 3TVDA 1Z22A 2WKPA 3E5HA 2ATXA 2GKSA 4Q1CA 3KKPA 2IW3A 2HCBA 3I3SR 3SNHA 1NI3A 1Z28A 3CPHA 1XWIA 5EE5B 1HNZC 4DV6C 1MKYA 4BLPA 1DAIA 1X1RA 5FOWA 1RZ3A 3U6KA 3GD7A 4QC2A 4C0QC 2GEVA 4KVGA 5EP2A 2YWFA 3WMGA 4YONB 4IW3B 3EG5A 5C4GB 2R6FA 2GK6A 2R62A 3K9NA 3W34A 2A2ZA 2JCSA 2IUTA 4B2PA 1Q3HA 3NIBA 4HSEA 4QGFA 3OAAA 1J2JA 4K46A 4O0MA 2DWOA 3AVYA 1MOZA 1XXHB 1CRPA 2IYQA 3AGQA 4NDZA 5CDFE 3ASZA 3L0OA 2Z4RA 3LBHA 4O3MA 4PPGA 1ML8A 2RGCA 3EPKA 4MYHA 4AWXA 4G1UC 2GBLC 4DV5C 3LAWA 3LY5A 2OHFA 3FMOB 3RS2A 4IXNA 4D26A 2BMDA 1COWD 1OFTA 2XOKD 4A2PA 3CNNA 2QORA 2QTVB 3EZFA 1E9AA 3AVXA 3DOEA 1KO8A 4Z1MD 2P65A 4Q9HA 4HAWA 5JFGA 3CR8A 4AI6A 4DLSA 2VF8A 1SQ5A 4KFUA 2XEXA 4ZKDA 3TUIC 2J59A 2LKCA 4RZ2A 3QVVA 3U3OA 3VMFA 3PG5A 3SDZA 3QKRB 4LJ6A 3ZD6A 4HEJA 2F4VC 3LWNA 1T9HA 4LRWA 4D82A 5KOYA 2OAQ1 4LBZA 1JI0A 3B13B 3RS3A 2IYVA 1F2TB 4M9SA 1NIPA 2OBNA 1X8LA 3CF0A 1W1WA 4TMWA 4Q9IA 3A8TA 1W2GA 4TL9A 1J8YF 1VYVA 2CLSA 5JCZA 1FUKA 1G8YA 3ICEA 2WPDD 2OPLA 4E5UA 2GJSA 1L4UA 5AJYA 4UQOA 3U44B 2ZUDA 3NHAA 1U8YA 1N6HA 2YOFA 4QNMA 5KHOC 1KJYA 5SZJA 4CEIB 3NBZC 3W9YA 4R9UC 2N1BA 1RVDA 1S1MA 1SHKA 2WJVA 5AJVB 5DGXA 1XZPA 5CM8B 5BN4A 3OHMA 5L8VA 1KO1A 5E7IA 4LY6A 4RCZA 1K6MA 2HF8A 3CRVA 5JI2E 3BERA 2BEJA 2J46A 3MWLA 3GKUA 4V0KA 3KL4A 3O8CA 2PBRA 1N0WA 5BQ5A 3VFDA 2X8AA 4Q21A 5C18A 4JLAA 2P6RA 4DUZC 3T1QA 2XJ4A 3VU9A 1KZ7B 2QP4A 3F3YA 3T35A 3UMFA 3NEYA 3TAUA 1PLJA 1KI4A 4A6XA 3B5JA 3TE6A 3U3MA 4CIDA 1P61B 2FPMA 4F4CA 3G0HA 1E1QD 1VIAA 2QE7D 1ZUHA 1E79D 4HAXA 4P3YA 4JI7C 5BXQC 3EXAA 2GXSA 2G1JA 5J5CA 1DE0A 3TUZC 4A36A 1GSIA 3G82C 4IDPA 1CIPA 3CX8A 3L82B 2KI5A 4LJ9A 3KQUA 1F6BA 2WAXA 3CKLA 3IDQA 4DR3C 2WJYA 3SJBA 2FPKA 1OFUX 2VP4A 5L3QB 2IWHA 2GCPA 4TTPA 3W5IA 1KK2A 5EUQB 2WBLC 4DCNA 1UKYA 2N42A 5KDDA 1YE8A 3FHTA 5CITA 1Q1QA 2FX3A 1G21E 1H65A 5EJEA 1VG1A 1XX6A 3KKNA 4DEXA 2FSGA 1TU4A 1KI6B 4HZUB 4N0EA 2NO6A 2V6JA 4G5GA 4TQAA 3NBFA 2OESA 5AK0A 1E4YA 2BBWA 1ZW6A 2FV8A 5FTMA 3VR1A 3QF7A 4LHYA 4C0BA 5GJVC 3MAAC 1Q1BA 4EJSB 3SJAA 3Q72A 2UXBC 5C1BA 721PA 1OF1A 5CB6A 1JXMA 4TLEA 2ZSFA 1CKEA 1G18A 2AR7A 2N46A 3TBKA 1BYIA 1KIMA 1DAKA 2JGNA 4BPBA 2QQ0A 5BWMA 3UATA 3RS5A 4PZZA 2CLDX 4HATA 1W36D 3CR7A 4N1AA 1GL9B 4FW9A 2ZRNA 5FUWA 1J90A 5FUYA 3EX7C 4GL2A 2V7QD 2K5UA 1FOEB 4ON9A 3GPLA 1E2FA 1DAEA 3BBPA 2PEYA 4TL6A 1G5PA 2DB3A 2OPLB 1Z0FA 2CE2X 2W00A 2GXUA 1SKYE 2I4IA 4B75A 4BFSA 4MGYR 2ODNA 2ZRAA 5FOUA 5JEDA 4RJLA 3U7GA 4OI0A 4FWIB 4ACAA 4FI3C 1E9DA 3BXZA 4KSBA 4I1OA 3VHLB 3SE0A 5J4YA 1PLKA 2WWYA 4B6FA 3HU3A 1LNZA 2OAP1 3QG5A 4DSTA 1U0LA 1E9EA 3WNCA 4EJSC 1P2TA 2WKQA 3K0FA 4D4KA 221PA 3RLFA 2OCYC 1G3QA 2QAGB 1HQYE 1HUQA 2O5VA 3THOA 2XB4A 4RFVA 1N5JA 2C9OA 1U0JA 3DPUA 3IUYA 4M1TA 4NCIA 3WP1B 4Q5IA 3QF4B 2ZRIA 2BMFA 5H68A 1BYUA 4X8LA 2XX3A 2ZTSA 1OPXA 2GTPA 3L8YA 4B3XA 3I8SA 2VO1A 5FPHA 4LFCC 1KDRA 5KNCA 3MJHA 1TEXA 2P67A 4MYUA 3PIRA 2ZYVX 3GJ4A 4CW7A 4A92A 2FDCA 4GZMA 1US8A 1W47A 4M1SA 4WXPA 3ZZUA 2HXSA 3DDCA 1XB2A 3KKQA 3MG9A 1COWA 2XOKA 3L0PA 1LS6A 3EASA 2C98A 4Z51A 2RH5A 4IVQA 1PUJA 3Q85A 4GOKA 1XMOC 2JJ1A 3EIHA 4MA4A 4DDTA 3CX7A 4W5JA 1HT1E 3LNCA 3CRW1 1USPB 2WJJA 1RJ9A 3REGA 3X1ZA 1CBUA 4PQYA 5CIQA 1Z08A 2CK3A 1TQ4A 2A3RA 3GCGA 4G01B 2P6NA 2ZI9A 1M7BA 5KPJA 3BOSA 1SHZA 2O52A 4YMWA 1U8ZA 1D2MA 3BB1A 4DR7C 3WNDA 4EPRA 1M8PA 3GEEA 5JSZB 1QHXA 2J0UA 1SKYB 4BASA 1GFIA 2JDID 4RKEA 2KBEA 4LBWA 3U2QA 1JPNA 4AIIA 2X19A 3LX5A 2GILA 4GZLA 2D74A 3B1ZA 4D4MA 2ZVPX 2D2FA 2D4HA 4X65C 1HE1C 1XZQA 2X1VA 4TT3A 1NP6A 2B92A 1YR7A 3IGFA 4LJ8A 2WPDA 1ZYUA 4EIWA 2BM1A 2FFHA 1P72A 3MUFA 1KJWA 4MUAA 1WMSA 1CJKC 2FMXA 2FPLA 2IS4A 3B1WA 4JLJA 1Z07A 1IAQA 2VQSA 1UKEA 4JLNA 4OKSA 4V02A 1F5NA 5FBWB 5KNDA 3ZVNA 1R5BA 3A4MA 5JJLA 3D31A 1KMHA 4B74A 3P32A 1DS6A 1G5TA 2QGNA 3FE2A 5LPNA 5M04A 3EAQA 4IOKA 3RRMA 1YVDA 2D2EA 3GLIA 4M1KA 1E2PA 2ECKA 3HR7A 3GJ0A 3A1VA 1ZNYA 3UG7A 4DCVA 3BE4A 2RGDA 3KXLA 3BH6A 5HKKD 2EFEB 3BFVA 4FCWA 4DV2C 1AIPA 1G7CA 2HLDA 5LBIA 1M74A 2ZM6C 1GNPA 4LF6C 3P27A 1XTQA 3Q7QA 3PQCA 4YLGA 1MRSA 1Z6YA 4B3BA 4IKEA 1EXMA 3THWA 2L0XA 4M9QA 2R65A 2XZOA 2ZE7A 2QU8A 3VR3A 1OH8A 2X2FA 3K09A 4NTZA 4ZDWA 1MO3A 1VDZA 1KMHB 4RFSA 1QHYA 1YRAA 3FMPB 3MGCA 1CU1A 1R5NA 4LJ4A 4W5HA 2P6UA 4Q7LA 2WOOA 1NSFA 1OB2A 3X2SA 4JZKA 4BFXA 1IBLC 2KE5A 3X1DA 2FG5A 2YC4C 2F6RA 1OFHA 2WZQA 3WYFA 4RVCA 3VX4A 3QPUA 4BQSA 2W2VA 4M1WA 3HP1A 3DL0A 4Q01A 4JI0C 4OK6A 3VX3A 4LBYA 4JVMA 2VBCA 4AKGA 1U94A 4BLOA 3KZ1E 5HKKA 5A4JA 3DKVA 4TZ0A 1W36C 1ZM4A 1S3SA 1G20E 2ORIA 3IIKA 4Z54A 2O8BA 1KDOA 3FFAA 1E4VA 5DYIA 2BVNA 1QZXA 4JYBA 1XTRA 2UUBC 2W2TA 1PLLA 3TSOA 2QZ4A 4B43A 3UK6A 2WKRA 4XWAA 2R2AA 3J80D 4C2UA 2HUPA 3ND8A 4D6PA 2CLCX 5DN6D 4MH4A 3KB1A 2VSFA 4TLCA 3SU8A 3A1TA 3TK1A 1Z3IX 1D2EA 4CEIA 4OI1A 4PC1A 4CGZA 2BJVA 2XTZA 3FPAA 4GOXA 1NY5A 4PAOA 4BLQA 4X8MA 3NXSA 4L4UA 2ZI4A 4ABYA 4LK2A 4NCKA 2KZFA 2C04A 2WIBA 1T3LA 4FMBB 1AM4D 1OIVA 1J8MF 1R8SA 2FZ4A 2QP9X 4KXFB 4IJMA 4Q7MB 3R9WA 1OH7A 2WWFA 3QQ5A 1ZC4A 4W9MC 4B76A 1XTKA 4C3ZA 4I1VA 5HZKA 1P9WA 3J81k 3C16C 4JT2A 1GRNA 2ZI5A 2PMDA 3I73A 1KAGA 5IT9D 5DI3B 4GPTA 4K0KC 1TQ6A 2ZANA 3B78A 3Q8XB 3U3JA 3VR2A 4KO8A 2RMKA 4YXWA 2GAAA 4FIDA 1P75A 1N2CE 2FH5B 2EGTA 1IN7A 2PT7A 1DG3A 2ZRBA 3QKSB 2V3CC 4JI1C 1XCMA 4B44A 2SHKA 4HYYA 4DT1A 5KYKA 3MWYW 3QUSA 4YMVA 1JQLB 3B9QA 1GRRA 2IYWA 4C4PA 4JV5C 3JZAA 2IS1A 2WSMA 1ZUNB 2BV3A 1XF9A 5FUVA 5F2EA 1QHGA 4OBEA 2BDTA 4YXWD 2DYJA 1G6HA 3PUWA 1XXHE 2QPOA 4BFTA 3PV0A 4GOJA 5SZHB 3TR0A 3SFVA 3TSWA 4KLNA 2ORWA 2QENA 2VPPA 1AKYA 4MGKR 5KU1A 1G4UR 1WXQA 2HF9A 2BKUA 2BOVA 3AKCA 4CT5A 1N34C 2OUKA 4PC3A 4RFSB 1II0A 4OHVA 1E0SA 2AL7A 2ZETA 5CIWA 1W0JA 2VQFC 5CLLA 5EE1A 5KSOA 4B34A 2DWPA 1SZPA 821PA 4NKRA 4HLDA 3QKTA 2WTUA 2W2XA 3F5FA 3KJIA 3V00A 4CDGA 3QIAA 4Y0VA 3ZIAA 4Q4AA 1KDPA 4HI0E 3IILA 4TWZA 3GFTA 2HYIC 3BH0A 3ZD7A 1C9KA 1GIAA 1VCMA 4LSGA 4DSNA 4URUR 1NBMA 4LJYA 2R6CA 1YR6A 3EIEA 1KOFA 1IM2A 1LQLA 4JMPA 5HE9A 1Q22A 1UKVY 4KFSA 5L3RA 3ZDQA 1TNDA 2AD1A 4LF7C 2P3SA 1E2NA 1RRCA 1LB1B 4M9XA 1QG2A 2IA5A 2ZI3A 4TTRA 4A0HA 3THYA 2IYLD 2VIIA 4PSKA 3R8CA 3ZJYA 2UKDA 3HJNA 1HY3A 1TX4B 5B30A 3PVSA 1K5GA 3SBDA 5JHGB 1NVWQ 1ZMXA 3VR6A 3OIWA 3AUYA 4DCSA 4B3CA 1IOZA 1GNRA 1CS4C 1NL3A 2BBOA 2QNRA 1A4RA 2ZPTX 2V1UA 1RRPA 1X86B 2VHUA 4W7SA 3NTUA 3UMRA 1BO6A 2EVWX 3GLGB 1EFUA 4QJ5A 3T34A 3AKYA 4QKQA 4OL0A 4XSHA 3SQXA 1IBMC 1USPA 1DEKA 1XDBA 2UZIR 4MQBA 4A1FA 3IHLA 1GL6A 3I07A 1MV5A 3NDBB 3QF4A 4B48A 2A7QA 1IY1A 1E1QA 5TVKA 1KMQA 1WE2A 4NYIR 4Q1AA 4FMDF 1A7JA 1OE0A 3GLFB 1NVVR 2XSZA 3FKSA 4NE2A 4TMKA 2CCJA 3T61A 1RFLA 2NG1A 5JCPA 1AQUA 3H4MA 2WJHA 4OQFA 4F7WA 2FN4A 2I1QA 4DCUA 4CF7A 1XEXA 1ZM2A 5FH9A 4DV3C 1WH9A 4UNPA 2ONJA 1W0KD 3GJ7A 3K0AA 2ZREA 1YZUA 2OT3B 1F60A 4V0OA 3RHFA 4C0LA 1XMVA 5B64A 5L3SB 2OFWA 1KZGB 2NPIA 5KDOA 1XMSA 4JLPA 1NRJB 4KVAA 1W49A 1U0HC 1NG9A 1AZSC 1SXJB 1GTVA 4P4TA 5FL7A 4URXR 3WHLA 4EQ6A 2XGJA 5IT5A 3SBEA 1W7AA 2ZRKA 4HAYA 1KYIA 5DSZA 1F3OA 1R10A 2ZJ8A 1BH2A 1OYYA 1JR3D 3D8BA 3C15C 4GI7A 4JLDA 5F9HA 4ZO4A 1OKKA 2XITA 4TN1A 1VHLA 1ZAKA 1G17A 5IRCD 1GDDA 2O0KA 4CEHB 1UEIA 1XEXB 1ZIPA 2OE2A 4RZXA 2H8KA 1OSNA 2REBA 2NO1A 5EP3A 3ADCA 5TXGA 5K8UA 3EA0A 4X62C 1Z6XA 1I4DD 4DR5C 1N36C 1TADA 1HH4A 4B71A 1RC8A 2ZR9A 2OLJA 2GJAA 1EFCA 1RE0A 3C5HA 4EDHA 1YRBA 4DV1C 4BSZA 4NCHA 2ZS7A 1W5TA 4DCTA 3EA5A 4JI8C 4P0TA 4LWZA 3VR5A 3FYHA 3THYB 1Z47A 5BYJA 4LZZA 3LLUA 2EYUA 5CJ2A 3W6NA 2IYSA 1RIFA 2R6DA 3QXSA 4H9GA 4QBHA 2J0SA 3ETLA 1QDEA 3OEED 2JLQA 5CB8A 2QM7A 1E2LA 3U7FB 1JALA 1KNXA 4CYMA 4PC2A 3A6PC 4CEHA 3EC1A 5AUPB 3RDPA 4OQNA 3GLHB 3AF2A 3GLGE 5KO2A 2QQEA 1OT3A 2ZXUA 2OG2A 1FQJA 1T0JB 2B7CA 4Q47A 3QOFA 2VHJA 3O8RA 3GEIA 4LYFA 5AUNB 1ZBDA 1XTSA 3B82A 4P32A 2NO0A 4BE7B 2DFNA 3P20A 4ERNA 2JLZA 2JEOA 3L0IB 5G53C 1E2KA 3U4QA 4PHFA 4CVNA 5BR8C 3VKHA 4A8JC 1QRAA 5AJXA 5GJWC 2VA8A 2C77A 1KO5A 1AA9A 2RGNC 3CRQA 3D6TB 2O8EA 4A8JA 4TMTA 2C03A 1J70A 4ZIRB 3R9IA 1N6IA 4PFSA 1D6JA 3EW9A 1XRJA 2AFIE 2FOLA 3M0EA 4FD2A 3H86A 5JECA 1X1SA 1N32C 3Q3JB 2IL1A 3UG6A 1Q12A 1IBRA 3SZRA 2J45A 5FL3A 3GLHA 1CF4A 4KBGA 3S1AB 2QA5A 2IF0A 5IHPA 4G5SA 4TYPA 3GEHA 1FUUA 4DT1B 3THXA 1SXJD 3A1SA 1II8A 1P7CA 4RD4A 1T0HB 2PMKA 5ANRB 2A5YB 1N0VC 5JJIA 2CCKA 2ZJ2A 3OZXA 1ZINA 2XB2A 4GKJC 2J1LA 2ERYA 3IIMA 1L2FA 4A0FA 1WCV1 3QPVA 4FMDB 3IPYA 4BLSA 3KQNA 2YOGA 3SFZA 1SVWA 4PR0A 4DDVA 2AK3A 1TF5A 5CYOA 2F1JA 4G5RA 3EC2A 1TUIA 3CNOA 4IOMA 3AGPA 1NKSA 3SC3A 4HDOB 1F48A 2B8TA 2GJKA 2G88A 2GRJA 2DY1A 4TSFA 2H92A 2GK7A 1LVGA 3I4LA 4NCNA 1HYQA 3DEFA 1B0UA 2KJQA 4FWTA 2IUSA 1S3GA 2CL6X 3CRRA 5HCIA 4Q4AB 4M9ZA 5DN6A 1X8KA 4B3RC 1N25A 1CR4A 3T5DA 4B47A 2NO9A 4QBGB 2BBSA 3EIQA 4QHTA 3ZVLA 3H2YA 4A4DA 2EW1A 1R0XA 3AVWA 3HYTA 4OX9C 4OK3A 4WXRA 1E0JA 5EP4A 1NLZA 2ZI6A 5A5GA 3CNLA 3T1TA 1YZLA 4NYMQ 5IK2A 2ZR7A 3AF5A 3VR4A 4IDOA 4NCJA 1FZQA 2FFBA 2G83A 1G41A 1O87A 4CRWB 2QSYA 3FHCB 5E7MA 3QKUA 3KKMA 1NLFA 1ZVQA 4E03A 3K9HA 2WVJA 4UNSA 1NVXQ 1G3UA 1DO0A 2QAJA 5C46F 3BB3A 1Q1ZA 1NSTA 5FTNA 1CR2A 2W6ID 2CVHA 4DZZA 5LMUC 3ASYA 2FWRA 4LJ7A 1Z0AA 2XSZD 2ZI7A 2AKAB 4AKEA 4B2LA 4PSVA 2IYXA 1M2OB 2IYTA 4U00A 3T06B 1ZM3A 1T4GA 1AJEA 2ORVA 4TQUS 4LYHA 2QI9C 3UIEA 1SVOA 2CEAA 5FFMA 4B33A 1NN5A 1ZNXA 2GEUA 1ESMA 3MRSA 3K9GA 3OEEA 4URZR 1JOSA 4JT4A 1Z6GA 4MYCA 1G3IA 1ZP6A 1VLAA 2J9RA 2HHHC 2QMHA 3CUEF 1G19A 4JKIA 4ZIRA 3U7HB 2IX3A 3PXGA 4PPNA 4XVQA 4TQ9A 3KUCA 2CHGA 1Z83A 1EX6A 3QEJA 2UVQA 4A0GA 3GJXC 4C30A 4DC9A 2QT1A 2W6JD 4OHXA 3THXB 2R8RA 5JJKA 3SI7A 1JXOA 2NPFA 1XJQA 3H1TA 2AXNA 4HUQA 1RRFA 1N6RA 5F9FA 3U3RA 121PA 1P2SA 3CM0A 4MUBA 3MWJA 1JBKA 1MRNA 2ZIAA 1J5EC 3EPJA 1Z2AA 3UPUA 1UKKA 5IF9A 3CLVA 1G7TA 3MFYA 4Q4HB 4QBIA 1HEIA 5P21A 4IFEA 3RANA 4DEYA 1IJEA 1OH5A 1UF9A 4LOAA 1S9DA 1G3MA 3CF2A 1ZM7A 4NZYA 4NXNC 4JLBA 3AP2A 1JAIA 1S8FA 1TPZA 3KFVA 4YMUA 3VTKA 4BGDA 2JLWA 2W6IA 4LBVA 3V9PA 2IYYA 2JA1A 4Q19A 4JKYA 1XD2B 3SS8A 4PQFA 1OYWA 2GF9A 4KI0A 4KHPC 1N6KA 4JIMA 1T3SA 4MYTA 1FX0B 1P9RA 4KODA 1W5SA 2WIAA 1AGPA 1QHSA 2QN6A 2YINC 4BFYA 1OHHA 2WV9A 3WY9A 1XPUA 3JZMA 4JI3C 4JI4C 2VHCA 1ZCBA 3AV0B 1AQYA 2O0JA 3V4FA 4TL7A 2GCOA 2ZS8A 2Q3MA 4FINA 3B2EA 3W3AA 3GLFE 3LQQA 4DR4C 1QHNA 1X3SA 3A36A 2DYKA 3K0SA 3SR0A 2BEKA 4KBFA 4LV6A 3U44A 4A15A 4BFVA 2O8FB 3TKLA 4EFNA 3R9XA 4H1VA 4EJSA 3TGPA 1CJUC 5FPKA 1Y3AA 2FSFA 4QGAA 5FUXA 4GNKA 4UXHA 4OI2A 4AC9A 3RS4A 5KSZA 3THWB 3KDSE 3OF5A 4F91B 1BS1A 1AN0A 2JDIA 2ANCA 1SVSA 2BM0A 2VRWA 1N6LA 2MMCA 3KQHA 2OO7A 2J5XA 4I1SA 3MSXA 4HB3A 1E1RA 1WBBA 1CRQA 2JASA 3OFND 4NYJQ 1M7HA 4AG6A 3REFA 1Z6TA 1TU3A 4D0LB 2BC9A 1YZQA 4QJ3A 2V9PA 4QOSA 3IEVA 3EWSA 5FTJA 1GL7A 1GG2A 4ITRC 1PV4A 4TLDA 4DDWA 3AUXA 3AF6A 4DIDA 2FGJA 2ZROA 3F0TA 1Z06A 1KY3A 1Q0UA 1Z5ZA 2C99A 2OBMA 4QJ4A 2E8EA 4K8OA 4M21A 3WYGA 1R0YA 4D0GA 1FNNA 2IS6A 1UBGA 4ACBA 4GMDA 2P2LA 2A9KA 2VEDA 3ZLJA 4JVSB 4XH9B 3ZGXA 3B6EA 3NDPA 1M6NA 4DSOA 4B3TC 5HZHA 1L4YA 2ZJBA 2VSOA 3BWDD 1S96A 3EZ7A 2QT0A 2P0EA 1VMAA 2D06A 1N33C 3B1XA 2C95A 5DHFA 3R8FA 4C0SA 1OXVA 2CK3D 1E2EA 4ZDJA 4U5XA 4C0JA 4KITB 4YHHC 4LF5C 1J7KA 2NQ2C 2REOA 1VG9B 4MKGA 3W6OA 1VECA 3KUDA 3H84A 1J99A 1EWQA 2I1VB 4IEIA 1V43A 1G8FA 3GP8A 1IXZA 3B8HA 4MDFA 3PENA 2Z0MA 2ODWA 3FVQA 3PUYA 2PJRA 2JLSA 2WSSA 2PT5A 3OEHA 4L16A 2C96A 4X8HA 4KLZA 3K1JA 5BYKA 1XMIA 2C8VA 4FCTA 4LF8C 1ODFA 1Z0DA 3OE7D 6Q21A 3AP3A 1QHHB 4OHWA 2HLDD 4OQXA 3VNVA 2O8CA 2NZ8A 1SGWA 4EPVA 1EGAA 4O25A 2FSHA 2W0SA 1HURA 1Y63A 2AK2A 4XOIA 5DYGA 2D7VA 4EUNA 1P4SA 2ZRMA 4WAUA 1CJTC 1CJMA 3N2IA 4XTCS 2V1XA 3UWKA 2ZE6A 3GQBA 1HNXC 3DVLA 4X8OA 2ZYWX 4LFBC 4LCBA 2JJ8A 4Y0AA 4HUQB 2ZSBA 1GNQA 3KJHA 3C41J 1JB1A 1XEFA 2Q9BA 3I62A 3OTOC 4LX0A 3BK7A 4AQYC 4IHQA 1ZRHA 2PJZA 1Z2CA 1E9FA 2BMJA 4Q66C 2IXEA 3VKWA 2JLYA 3ECCA 5E95A 1LW7A 2F7SA 4F93B 4PO9A 4V0NA 1T91A 1IJFA 5DO9A 1G4AE 1KSJA 2J7KA 3ZQ6A 1CTQA 2GCNA 4E07A 4P31A 3CWZA 1Z63A 5GADl 5IWAC 3O8BA 1LTQA 3W6PA 4W5WA 4Q00A 1T6NA 1G9XA 2QTFA 4DLVA 4URYR 4P4SB 4PC6A 3N70A 4QFMA 4UXJA 2OCAA 2XTNA 2HJVA 2QRZA 2F43B 5FPTA 4LYJA 4CEJB 4DSUA 2YYZA 1R2QA 1BOFA 1NKTA 1OJLA 5EE3A 1EK0A 3FWYA 1E2MA 4LYAA 3ADDA 2YNMA 3K0FB 1SXJA 5G3ZA 3AEZA 2VTKA 2GXQA 3AF4A 3K70D 4KV9A 2V6IA 5FBRB 1NG1A 3X1YA 1E96A 4AK9A 1G7SA 3Q5DA 4NXMC 5K8TA 1KTVA 4A8JB 3E2IA 3RC8A 1DPFA 5CJPA 4HAZA 3N5CA 3PEWA 4QHYA 4PHHA 5GJBA 4FMCB 2A78A 3CWQA 4HLUA 4F4IA 1E2GA 2FA9A 1QHIA 1RYFA 1E9SA 4HAVA 1N0UA 3WXMA 4AD8A 1SXJC 2G3YA 1GILA 2WMNB 1Q57A 2QL8A 2IXFA 1YR8A 2VLIA 4UNQA 3S1AA 4EFMA 3CRMA 4KJZA 1M1YE 3TH5A 5JMTA 5EE0A 4P4UA 1A82A 1Z6AA 2QPAA 3KXIA 2F3TA 1U81A 3CW2A 4PPQA 4NPHA 4US0R 4WZBE 5FR1A 2B21A 2CNWD 3KJGA 5J4HA 3LUSA 2ZSAA 2IHYA 4F4JA 1DVRA 2C78A 4BEBA 4PTLA 4ZDIA 1HH2P 2CMKA 2JLRA 5FBVB 2V8OA 1S2MA 1QHHA 5KUTA 5LDDC 1U98A 2WWWA 3NKVA 2YWGA 4DR2C 3LXXA 1BKDR 2C9YA 1NLYA 3DZ8A 1QVRA 3IQWA 4DIEA 2BWJA 2OILA 5JEEA 1DAGA 1OXTA 1R7RA 3GLIB 2PCLA 2FZLA 4LV8B 5EXSA 2D7CA 2IF2A 4UJ5A 4OK5A 1IXSB 2OM2A 4IDNA 3V4RA 4OQMA 3W5JA 1DADA 4DLXA 3VAAA 2HT6A 3A1WA 3QKRA 2YJTD 3BFKA 5CDFA 2ATVA 1TUEA 1MO5A 2OBLA 3L8ZA 1FX0A 1NMYA 2EU8A 4POAA 3CPJB 5DIFA 3U4QB 4Q4JB 4DV7C 5FOSA 4A2WA 1W48A 3L0SA 2UUAC 3WMFA 4BRUA 1B23P 4DXAA 5TDHA 4Z1MA 4Q9JA 4QM6A 3CZQA 5AJWA 3C8UA 2JLVA 4AURA 3AQ4A 1TTTA 2IWRA 2GJ8A 2AN9A 4C0AC 1N6PA 4MKFA 3FDIA 4E22A 1LY1A 3PITA 1KK3A 2OLKA 2BBTA 3AH8A 1DBSA 3LRPA 5HE8A 4OJKA 4XD7D 2ZUBA 5DNYB 1KSHA 4JSYA 3KXKA 4KAXA 2QM8A 4YY3C 1XD2A 3KTAB 4MRPA 1HT2E 2IEYA 1JJ7A 2XJ9A 1VPLA 2GZHA 1WF3A 2KBFA 1KI9A 2QY9A 3PUVA 1L8QA 621PA 4AKHA 2ZSEA 3NC1C 3P1JA 1GOTA 5DI9A 4BUJA 1NNEA 2JLUA 2NTYC 1W4CA 4XJXA 4NONA 1LF0A 1G7RA 4BZXA 2QP3A 2LCFA 4BWYA 3Q7PA 1EFRD 4RY2A 2ZJOA 4DKXA 1XNJA 5DISB 5DI3A 4B3DA 1TMKA 2QBYB 1DAMA 3SN6A 2C9CA 1RKBA 1G1MA 2ZITA 5DHAA 1R4AA 1TL7C 1IONA 4Q1EA 1EWRA 2PH1A 2WWXA 3PJRA 4WVFA 4A6PA 2ZE8A 3IBGA 1FMLA 1VTKA 3KTAA 1IQPA 2UXCC 1OV4A 3ADBA 2E8CA 2B7BA 2FU5C 2GVZC 4DLZA 4M22A 4NOZA 4JLOA 3U5ZB 5E3HA 3TQCA 3UMSA 1SVKA 1VKJA 2VHTA 5J4LA 4O2LA 1I4TD 4GDFA 4LF4C 1XNRC 3RS7A 3BAFA 1W0JD 3CF6R 1O3YA 4LC0A 1F2UB 3NEJA 4N3NA 5J4KA 1DO2A 1IBKC 4M8NE 2QG6A 4AYWA 3NHBA 1P3JA 4DLWA 4HUTA 4IFBA 4F38A 2QROA 4AYXA 1PUIA 3IKJA 4IOLA 2F3RA 3OEHD 3ONWA 4ZCLA 4TMVA 2AWNA 4LUCA 4HZIA 5GJCA 3MWKA 3KQLA 3HU2A 5D3QA 1TF7A 5JS7A 1JR3A 1AKEA 1KY2A 1KJZA 1IN6A 1W2HA 1XPRA 5JLJA 2ASBA 2OFOA 2QGZA 4RD1A 5H70A 5JHHB 2CJWA 1N6OA 3LD9A 1SVLA 2ZR0A 5TB5A 2VQEC 4Q4JA 4JL5A 1ZCAA 5EQTA 1DOAA 2CNWA 5A0FA 1T8TA 2HT1A 1HTWA 1N6NA 2QMUA 2XXAB 1GP2A 2ZRHA 1D5CA 2PZFA 4KSCA 1JJVA 3G5UA 4MKIA 4QM7A 1ZU5A 5C4MA 4G3XA 4PSAA 3CB4A 2JAQA 1NN0A 2ZAMA 3NG1A 1SVIA 2EFHB 3T1OA 2BCJQ 2ODBA 3BH7A 2V55B 2DBYA 2XZPA 2PZEA 4JL8A 3B9PA 1MO6A 3BORA 1KNQA 3A37A 1RW4A 2D7DA 4ARZA 5EUMA 4JS0A 4FN5A 2Z5FA 4WOPA 4XD7A 4HLUC 1E3MA 2CY1A 3IPXA 2ONFA 4C7OA 1ZC3A 2QAGA 2G77B 2ZYTX 3L2OB 3LW7A 1NF3A 5FOTA 1UKZA 2ZM5A 2EYQA 2O8BB 4PAQA 4RCYA 5K8IA 3D3QA 2Z4SA 4U02A 4Q4HA 4DR1C 4Z8YA 5FBQB 4DBLC 5A2QD 1NMXA 3EZ6A 2QAGC 3K70C 2ODEA 1UDWA 4KYIB 4K81B 3X1WA 2WOJA 1QG4A 4NL4H 1GUAA 2EFGA 1UADA 4URVR 1G8PA 2PCJA 1HNWC 4OYHA 1GWNA 4A0RA 1KHTA 5HPYB 2VYFA 3FMIA 3IO3A 4LFAC 4LHVA 2HEIA 1W4BA 2ZJAA 4PO1A 4JBYA 5B58C 2GHIA 2GETA 1EESA 1E2JA 3RNLA 1T5LA 3GJ8A 4L15A 2H7VA 3EZ2A 2YZ2A 3QBVA 3B1VA 4D4LA 5JZVA 3J81D 5HTKA 4PC7A 4DLTA 3GJ5A 3LDAA 2FFAA 4IDHA 4L9SA 3R7WA 1G16A 4RSGA 1RJ9B 4HLCA 2XZLA 1ONBA 1F2TA 1UBCA 4R98A 1P6XA 2F9LA 3LBIA 2GEDA 2ZS9A 4EAQA 4LHZA 5LB4A 3BJIC 3A58B 1G3RA 2G1KA 3ICQB 5FOVA 3ND9A 2EWWA 1PZNA 5FBLB 3AB3A 1V5WA 4I1UA 2A5GA 1PVOA 2P5SA 1I94C 1D8TA 3I32A 4NBSA 5L3SA 2H18A 3LW8A 3F8TA 4JYAC 4LPKA 2IYZA 1YHNA 3LBNA 3TRFA 3ZYCA 3QSYA 3QE0A 4V0LA 4X66C 1P2VA 1P5ZB 3GLGA 4B73A 4C2TA 4D25A 2W58A 3LA6A 3TLXA 3W3ZB 1ZIOA 4MRSA 3RABA 4QHSA 1XFAA 1SXJE 4EQ6B 4LHWA 1U9IA 2ZRJA 4LJAA 1Z0KA 1FNMA 1X8JA 1UPTA 1EX7A 2X77A 3RS0A 1NVUQ 2Q21A 1P60A 4KFRA 2XNDD 3T1VA 1VG8A 5J47A 2BIFA 4WBSA 2ZVQX 1LF5A 4C0HA 2CXXA 3RC3A 1KO7A 5EZ5A 4IVRA 1RYHA 3IIJA 4NYJR 3LO5A 3OAAD 2O8DB 3RRYA 4M53A 3LV8A 1JEEA 5J40A 2XNSA 2VH5R 3HYRA 1MO4A 2D3WA 1KI2A 2EWVA 1SULA 4Q1FA 1T8UA 4TT3D 2Z43A 2IYUA 3BS4A 4JJZA 4A2QA 3QG1A 1UEJA 2IHBA 4DB4A 1YJ5A 2OFXA 3UXMA 3K8YA 2GAOA 4JYCA 5F98A 1E98A 3E70C 2ZJYA 4M2LA 5FOXA 2C5LA 5UKDA 4UJ3A 1K0RA 1GKYA 2YHSA 1FFHA 3QY0A 4TMXA 5CM9C 2KB0A 1NMZA 3CBQA 5BN5A 3RYTC 5EXPA 1XCGB 3AVTA 1DTSA 2R9VA 4D0NA 4V0MA 4B35A 4YC7A 5JSZA 2VP2A 3GLIE 4MRNA 1Z8FA 2RGGA 4NMMA 5IDVA 2H1LA 3EWAA 4PX9A 4DWJA 3AVUA 3VQTA 2O8DA 5TARA 3TUJC 1HE8B 1P9NA 1NY6A 1VYUA 2MSEB 2RGAA 1NIJA 2RKOA 2FF7A 1DARA 3PFIA 3ZIAD 4M1OA 1OH6A 3A4NA 1GZSA 2FEMA 4ZCMA 5FTKA 3IEUA 4QXAA 1XTJA 2IBMA 3OIYA 2HJGA 2FFQA 4S2EA 5G3YA 1Q44A 521PA 1FL9A 5BN3A 1E2QA 4L8GA 3FMFA 3JVUA 4DUYC 1IN8A 3UANA 3EERA 2BCGY 3VU9B 2RGNA 1TF2A 1KI8A 1E32A 3FKQA 3TW4A 1S4QA 5FTLA 3OE7A 1BMFA 1CXZA 3WRYC 3UWOA 3QI2A 4DLYA 3MJRA 3PEVA 5L3VA 2GA8A 5IK2D 4AY2A 2A5JA 2XTMA 4DHEA 4ZI3A 1CEEA 4WA7A 5TMPA 3I92A 3IBYA 4BFWA 2CE7A 3IHWA 3CX6A 1UAAA 1CR1A 4F92B 1XD9A 1A2BA 4Q02A 2YVUA 3DHWC 5GVRA 1VIYA 1P2UA 2QL6A 1U99A 2ZYUX 4JBWA 3AM1A 3PUZA 1I2DA 3KFXA 4R7ZA 5G40A 5KTYA 2DHRA 5KSPA 3RRZA 2OXCA 3ZQJA 1TEVA 3SOPA 3HWSA 2IT1A 5D3MB 4JSTA 2J7PD 4WW0A 1GKUB 4IDQA 2GCOB 3ZZTA 1XEWX 5DLQC 3C5CA 3ZVRA 2DFKB 1U90A 1XD8A 5AWFC 2OSBA 1UFQA 3DKPA 3A4LA 2AHOA 2AKYA 4GT1A 3AVQA 3QXHA 4JVNA 5H1YA 2E1RA 2NOAA 3W8RA 5JWRA 1N5LA 4HB0A 4IVPA 4Q1BA 3PEYA 2AXPA 1NYEA 1SKQA 2KSQA 3BD9A 3T12A 4ARZB 1G5RA 2VHQA 1RPZA 1YZGA 3RRNA 2AFHE 2Y8EA 4AG5A 4HDQB 1Q21A 2UUCC 1G291 4GRAA 2Q0HA 2PN2A 2FJUA 1E0KA 1E0AA 2RGXA 4NHOA 1HQCA 2O8CB 2W6JA 3B60A 1W4AA 4HAUA 5CYPA 5SZIA 1NVVQ 4MTNA 1K5DA 1OW3B 1QWIA 2EQBA 2OXRA 2MSCB 2HDNB 2CDNA 3T5GA 3FTQA 4V03A 3EPLA 2MMGA 3CJEA 2DR3A 2LKDA 4B2IA 1D2NA 2GZAA 3SQWA 1ETUA 1HR0C 2R6GA 2ERXA 1XPOA 1XEWY 3MLEA 1XTIA 1E9RA 1WDTA 4XSGA 3VNUA 2Q3HA 2A5FA 4PAMA 1MABA 4DV4C 4LI0A 2Q3FA 2JJ1D 2FNAA 1YKSA 1AZTA 2QE7A 2WWHA 2GWHA 1UM8A 2I3BA 2R44A 4FXPA 3Q5EA 2XNDA 3T1YC 2H5EA 3HDTA 1YZTA 1UBFA 2Q9CA 1TQ2A 3OESA 3EZ9A 3I72A 4EPYA 2NZJA 5JRJA 3GFOA 5E4FA 4GFDA 2RGEA 2G9NA 4TYNA 5TY0A 3SHWA 3NH6A 4BFZA 4B3FX 3QXJA 1T3HA 1W4RA 2C2HA 4XIGS 1N2FA 3GLHE 4GMXA 1US8B 4D2IA 4Q7JB 3AKEA 4LC1A 2ZJZA 1D9XA 2Z83A 1KGDA 1WP9A 5K8LA 2RB4A 3PCRB 2J0VA 1R0WA 4EKDA 3IO5A 2OCPA 1TAGA 1NJGA 5JWHA 4TTQA 1P73A 4IEEA 4NH0A 4X64C 2W0MA 3KJEA 3B7GA 3K09C 3RSOA 3SJCA 1OFIA 4MRVA 4Q18A 3QBTA 1YU9A 5CK4A 5EZ6B 5HR5A 3HR8A 3L43A 2CBZA 1U9IC 4RKFA 4ZPXA 4EPTA 2YWEA 3W8NA 1T5IA 3C4JA 4D81A 1KAOA 2QUZA 4JLMA 3CONA 2J3EA 3MD0A 4R2IA 2F1RA 1NN1A 1YR9A 3TNFA 2QMOA 2B8WA 1KKLA 3QXCA 4G5QA 4QBFA 4US2R 1W46A 2ZRCA 2E7GA 4IXMA 2CL7X 3ZS8A 2R6AA 1DAHA 3M6AA 3TAHA 2YCBA 1E9CA 1FQKA 1DELA 2J0QA 1LS1A 1GVNB 4B32A 4BZPA 2WAYA 4ASUD 2Q9AA 3PUXA 4DJTA 4YMTA 1CR0A 2YKGA 5ELXA 2GESA 3M1IA 1KSGA 4QNRA 3JAMD 1R0ZA 4LDJA 1AK2A 4BZQA 4ZCIA 2ZE5A 2XXAA 3SEAA 1VCOA 5J4VA 2BJWA 3AF0A 2CVFA 3FKSD 1NBMD 1KI7A 4RZUA 1KK1A 1N3BA 3A1UA 3CZPA 3DM9B 3RAPR 3H0KA 3AVPA 1S1CA 4XTRA 4XVUA 5F3WB 5LB2A 1JAHA 3BRWD 1EFHA 2A30A 4O2RA 2F9MA 5CLQA 2ZU0C 2BJOA 1ELOA 1M34E 2RHMA 1II8B 3FOZA 2ZUCA 4KU4A 3K9LA 2ZAOA 1BMFD 2G0NA 3O47A 2W83A 1Z29A 2AWOA 2AD5A 1OB5A 2GVDC 2IS2A 1XU4A 1A2KC 2GZDA 2MSDB 3KB2A 1GITA 3K53A 2WHXA 4TYWA 4JI6C 1KI3A 3U61B 5DE3A 2FE4A 1CLUA 5AUQA 2UU9C 3AP1A 3C7KA 2PX0A 1JECA 1XNQC 5FI0B 2F55A 1XCPA 4FCVA 5KSYA 1ZD1A 2PEZA 3LXRA 2ZRPA 4BFUA 2YC2C 4PXAA 1ESNA 1KK0A 2PZGA 4ILEA 1KDTA 4A82A 4CZ2A 3N2EA 2JIZD 4ZV4A 4NU0A 1CP2A 3KKOA 2H57A 2F1IA 4TZ6A 1OIXA 2AX4A 4EFLA 4JI2C 1E6CA 4IRUB 3OFNA 4HB4A 3PEUA 3I61A 3X1XA 3HU1A 1ZD9A 2IK8A 2ZU6A 3AVOA 3UKDA 4UNNA 2TMKA 3LQRA 3RWOA 2GJ9A 4Q48A 3LLMA 2XAUA 3P4XA 4L9WA 1KKMA 2V7QA 1WQ1R 4LJ5A 4QG7A 3TR5A 5JS8A 4MGZR 1JQJC 3QNUA 2IEZA 1IY0A 1MR3F 2QEQA 4FMCF 1EFTA 4PZYA 1DAFA 1LFDB 4V0ME 4UXIA 5FPSA 3DZDA 1W36B 4E09A 2WM9B 1AS0A 1S0UA 2JMPA 2E87A 1UDXA 1VYTA 2A5DA 3ZH9B 4PANA 5B57C 3WMEA 4DR6C 3NBXX 4DVGA 3RWMB 3C14C 3SYNA 3WRXC 1OLOA 3K0EA 1XMQC 3B85A 3LX8A 5KDLA 4JVLA 3DMNA 3I5XA 4TYQA 1XJCA 2RGBA 2CXCA 4PZLA 3TSZA 3ZZ0A 4TL8A 4XX2A 4Z8XA 3WP0A 1KSFX 3NVAA 4GP6A 3SYKA 3GMTA 1IN5A 1CJVC 4A9AA 2H16A 1R6BX 4TLBA 2ZJ5A 1ZU4A 4G0NA 4I4LA 4M1YA 2ANBA 4YQFA 1Z0JA 2UZ3A 1WB9A 3B1YA 3QJYA 3SYLA 3GJ3A 1IHUA 1GRQA 2J7PA 1E9BA 1E94E 2DPXA 2OV2A 3LH5A 4P4SA 4PQRA 2CL0X 4R71A 3HPQA 1FTNA 3CO5A 1G8GA 2QPTA 5EP1A 4B3MC 1L7VC 1OXXK 3WNBA 1HA3A 2H17A 1W44A 1XXHA 4D80A 5EXXA 1AGRA 2F1HA 3E1SA 5GVSA 2WICA 4PO8A 4LGMA 2IXGA 2RHDA 1I4LD 1E79A 3SHFA 1X6VA 2OCBA 4B6EA 1K8RA 2KWIA 1UBEA 4NYMR 4MITA 3T15A 4TYYA 1KI1A 3QPWA 2VSXA 1OIWA 1ZB9A 2B6HA 3NH9A 3VHXA 2DFTA 3I1FA 3ZVMA 3GLFA 1E1RD 2WJIA 1YQTA
chains in the Genus database with same CATH superfamily
4FUQA 4J2HA 3W90A 4CMAA 2HLNA 1FP6A 2QSZA 3IDSA 3NGMA 4YALA 4TROA 2AMFA 1OLSB 3JR3A 3NHFA 5DTJA 3IVMA 5KQRA 3WSTA 1E2DA 4R2JA 1IXRC 2D5BA 4WESA 4Q9LA 5CM2Z 1ID8A 1VKHA 1CLEA 4KYUA 4QU0A 2WWGA 4QRHA 1NPDA 3N54B 2HOQA 3L6CA 4GECA 1EAYA 1HLFA 1KRHA 4NP6A 3LGXA 1SHLA 3V4PB 5L45A 1R18A 5FO1A 2HA6A 4LPSA 4QUIA 5CVJA 4AT1A 4JX9A 2PS3A 3WQSB 1TQHA 2Q1UA 3FETA 3R3SA 4CE6A 1AUXA 1N8KA 3LOUA 4QXQA 2ZQZA 2BZGA 3EFEA 2W11A 1XNGA 3PUHA 2VUHB 5DHTA 4CT4B 3FGNA 5DM4A 2AQKA 3BL8A 4MRRA 3PC2A 2X13A 3V97A 1JSXA 3KVNA 2QN9A 3WL8A 2AMJA 2Q41A 2R86A 2Y9PB 1M8FA 4TKUB 4II3A 4Q4LA 3AF3A 4UVEA 5CCXA 2GXAA 2QRNA 2HSDA 2AOUB 4BO7A 4GC5A 5C2JB 4PVCA 13PKA 3PXEA 1XBTA 2QLJA 3IAAA 4EPXA 1IAVA 2HCJB 4YCDA 2BKEA 1YL7A 5IANA 1Y6ZA 2XUFA 3MTJA 4ZANA 2O8FA 5A4FS 3IUPA 3PR1A 1U2RA 2IZ6A 4WK0B 3GRKA 1E6WA 1D3AA 2ZEJA 4LWPA 1H8HD 3O8DA 1K08A 3ACBA 4CEJA 3BWCA 1ZGAA 4W5NA 4TWJA 1N2XA 1Q1EA 3HV0A 3CT4A 3IPCA 1GJRA 3TOVA 4G1MB 1FYWA 4OJYA 3ONVA 1XZDA 4MWBA 4PYOA 3L1VA 3GGCA 4GP7A 4L5BA 1WEHA 4NMWA 1WRBA 1Z37A 4EGCB 3FMVA 1GGFA 3R24A 1JR6A 3DAHA 4RHXA 1YS7A 5TPWB 5IDXA 3ND5A 4IQFA 1X80B 3UJCA 1VG0B 3BT7A 2LBPA 1L1FA 2WTAA 4RSMA 5JI3E 4QGGA 2VATA 5IT4A 4MW1A 3NVKI 1KOJA 1RAHA 1T2EA 2QW1A 1ZQ1A 2OZEA 4DW8A 4GPEA 5EYPA 4JU9A 1ZB8A 1HV8A 3FVRA 4HZUA 5F33A 5ALXA 2NV6A 5JCOA 5AW8A 1OBVA 3W06A 5KOHB 3D1JA 2PZJA 1XHJA 3RSLA 3EVFA 1FW6A 1BE6A 1NE7A 1H2FA 2DQZA 1BNCA 5I8ZA 1ISFA 1K63A 2A9RA 4YJHB 4K87A 4M9CA 1RQXA 1G6OA 2P1ZA 3Q41A 3QI7A 2NXEA 5F21A 3FFBA 3ILSA 5K2OA 2WIDA 2YQ5A 2Y1WA 1Z5PA 1IB0A 4M4SA 2C8LA 3DOFA 4MPPA 2HYDA 1QQ6A 5C5IA 3QX9A 3ADKA 4WIAA 2FPIA 3AETA 4NOKA 4UU1A 1F0YA 3X44A 2GDJA 4BMDA 4BMZA 5L3QA 1XDSA 3IKLA 2Y0DA 4GBMA 1JVBA 4G1VA 4J0QA 3DV0B 5HSGA 5IXSA 3T54A 4IRXA 3K70B 1UFVA 4N0DA 2DLCX 3P26A 1H0HA 1JEDA 3LRTA 4M38A 3RF6A 1G64A 3TLEA 4EHKA 4ESHA 5C5EA 3VYSB 1KRXA 4E33A 5TPZD 4J1TC 2YVKA 5KWSA 1A76A 5ALGA 4OHZA 4KPFC 4G0XA 5K0TA 1M7GA 4JYZA 3HACA 5JQGA 1L4NA 3SCZA 3O4IA 3U7QB 1H1DA 3D5EA 2H06A 3BHJA 1PIWA 1LGYA 5EMLA 2JIZA 1XAJA 3FTPA 5JNTA 4L51A 1BRMA 3AI1A 1M10A 1N2GA 1ZUIA 2LWIA 1JHXA 1ODIA 3PDWA 5FL7D 5DLEA 2IYRA 2W8BB 1TYDE 3B53X 1SU7A 5TQ2A 1L3IA 2EEPA 1E63A 2O3UA 3PWTA 4X5OA 1UP4A 2V45A 1EBUA 4BLTA 4KCGA 2RK3A 4OHYA 2IU0A 4DLUA 2YJ6A 4Y6GB 4FU0A 4AVYA 1HE5A 2FSIA 1N92A 1JR3E 3AKDA 4I8XA 1BMTA 4B8YA 1RJFA 1BJTA 2P2DA 3WLNA 1A1VA 1Q2UA 4RD3A 4RD0A 1RRGA 1R8QA 4KC0A 3BCSA 1Y9JA 5ARCA 3RLIA 4Q3EA 2WPNA 2D8MA 1IE3A 1Q20A 3IHTA 3MB8A 4FC7A 5COQA 3WQHA 1V6AA 5C8YF 1WHTA 2WUVA 4EGFA 4H2DA 2ZPUA 1DKQA 2FUCA 1JQ3A 2GX6A 2VP9A 3AW9A 2REXB 4OAOA 5HGJA 4B7ZA 5IWCA 1N7IA 3UCXA 4R6XA 3CIOA 4C9BA 4RD6A 2FMHA 3QPCA 2P6MA 5B2ZA 3L7KA 3AY0A 1NXWA 2D1SA 2GOYA 3BC1A 2XR1A 4TKMA 3U49A 5K45A 3EJ6A 4YDHB 4JLKA 5AW1A 1VKRA 4ZKEA 1RQ2A 1W85A 2CCGA 2XYGA 3OIUA 2FGKA 3Q2IA 1Y1TA 4FC6A 4XI9A 4BV9A 2QRUA 5AVOA 3BXGA 3NVDA 5JXWA 1H22A 3M4YA 4F3TA 3GZTB 2WWIA 2WU3A 4AY6A 1X80A 1QH9A 4UQLA 4S12A 4ASUA 1LJ8A 4JLVA 1SCQA 1T2VA 1ZHHA 5FPYA 1E3SA 5BVGB 2J41A 3HCFA 3N6XA 2GAIA 3AF1A 1TEZA 3MTIA 3CRNA 3LVRE 2HQ1A 2AUMA 4Z2AA 3F71A 4I81A 2CJXA 3EPRA 4PCUA 1QYRA 4Q12A 2PZAA 3GNSA 4V0QA 4MAMA 4Z53A 5KOHA 4DB2A 1WZIA 3F9CA 5LZ8A 4DRZA 1T3GA 1PN3A 2ZJ4A 1P2BA 4L2ZA 1PNTA 3FZGA 3GFPA 2QJFA 3CH5A 2XDWA 1XLUA 3UV3A 3N2NA 2Y92A 4H7FA 2GKOA 3CB2A 1OKKD 1MH1A 3H1PA 1XHLA 5CK5A 2TMYA 2GF0A 5H81A 1CQIA 1MHPA 4JEHA 1M2KA 2IXDA 3IAS6 1TAUA 5T7BA 2FWAA 4C4RA 2E0IA 4Q1CA 4RBNA 2GKSA 3KVOA 4M3NA 1LBQA 1FUIA 2GK4A 1RACA 3KKLA 3SNHA 5A0TA 3Q6NA 2VK1A 2A3NA 4MW4A 1HNZC 1U9JA 1XQ6A 4D8WA 4BLPA 5ITWA 5MDHA 1DAIA 1INLA 1YKFA 3GFFA 2CUNA 4KR9A 2Z3ZA 4FB5A 1YI8A 4NJMB 4EVQA 1XAHA 2H2FA 4EHNA 1JVSA 1UANA 4LE1A 5EKXA 4KVGA 4W82A 2P90A 3WMGA 3DE1X 1WB4A 3D7SA 5C4GB 2R6FA 4GKKB 1DQYA 4ZC8A 3R7BA 3K9NA 3L7BA 1PR3A 4E70A 3W8DA 3OLCX 2WJPA 2IJGX 5G4KB 1RLIA 3EFBA 4HSEA 1XKLA 4BKQA 4R8MA 5C7IO 3UHPA 5IHXA 5KVAA 2O20A 2D6FA 4DQ0A 3OAAA 2PKRA 4K26A 4F2PA 1ADCA 2DWOA 4K28A 1MOZA 5CX1A 1H3FA 4WZBB 2IVFA 3AGQA 3GUCA 3ASZA 3KPUA 3UPDA 2CD7A 3AW8A 4I4TA 4RU1A 1V2HE 4WERA 4FBMA 2YRFA 2VZ8A 2E0GA 4ZOLF 4ZV9A 3V46A 1YVUA 2O6HA 5C4IA 2FLWA 2W98A 1TW3A 4AWXA 2Y0BA 3D64A 4PS0A 4BUZA 3OFVA 1NT4A 4G1UC 5CB4A 2GBLC 4DV5C 3GGOA 1NOKA 5FAKA 4IXNA 4ES6A 4LTDA 1MXBA 3CNNA 4DSZA 2QORA 2QTVB 4JX8A 3AVXA 1NURA 4QBKA 2AOUA 3CT6A 1DLJA 1HFEL 4WK4B 4EEXA 1RPTA 1EGVB 1TTHA 2P65A 2HJRA 3MTGA 2BUCA 4EBBA 1W5AA 2Q5IA 2KM1A 3T9EA 4C6RA 4ZEMA 4CI0B 3QV1A 5A0VA 5BSUA 2DSTA 4ITUA 4KFUA 4XZ3A 4ZKDA 2G9RA 1EA5A 3HBJA 4E31A 4B6RA 4C2BA 4MYDA 4RZ2A 1ZITA 4C06A 1IQ0A 1EFVA 2QXTA 3UYLA 4BP3A 5F77A 4JJGA 4PM4A 3AFHA 2MHCA 2NCLA 1K88A 4YJ2B 1MV8A 5G0VA 3ZWCA 3IKMB 4JODA 3ZD6A 1TRKA 5FTWA 1T9HA 2I1LA 1JHZA 4A03A 3USZA 3NYRA 3IAS1 2B9VA 2R4TA 3LHIA 3HCEA 2OZVA 1C0PA 4DBLE 2E48A 3GT3A 3AQIA 5AW7A 1VSBA 3IP9A 2IU6A 4S0XA 3JQDA 4TMWA 5IUNC 1ZISA 1Z75A 4G5HA 4TL9A 5L7TA 4W6QA 4KVFA 4G2TA 4IF4A 2WPDD 2WF7A 3UKJA 4E5UA 1RU3A 5AJYA 4BNYA 2P9YA 1L7BA 4FEEA 4LXXA 4JUIA 4UTNA 1QLHA 1MA0A 2IUYA 3U44B 2H6EA 1E59A 1I1HA 4CT0A 3KZOA 4QNMA 5AE3A 4YCSA 4DABA 4UZSA 2D0PB 3NBZC 2ZZKA 1S1MA 2VRNA 3QLJA 5AJVB 5L3ZA 1GQQA 3NTLA 5CM8B 5J58A 2NU7B 1KO1A 1PR5A 1NVAA 2FQYA 3MCVA 4HDSA 3VYVA 1K6MA 2DSNA 2HF8A 3A10A 3BZUA 5JI2E 2FXIA 4GEGA 3DUWA 5ESWA 3OTHA 5T6BA 1A8HA 1P0MA 2I7VA 3DV0A 2JKYA 3E3AA 3ENZA 3NAGA 1J8VA 3F1KA 5C18A 5CA0B 2IEDA 5ICGA 1U02A 3TZBA 4YV2A 3JYPA 1G0NA 1OWPA 3VU9A 2FPUA 4YGXB 4BP1A 4M6WA 1R6DA 2GFIA 3DUFA 3B5JA 4PLGA 3U3MA 2FPMA 3DDHA 3B36A 4RIFA 2X0KA 4U7JA 1DXHA 1B8VA 1JXQA 1E1QD 1VIAA 2ACWA 4EHAA 5JQGB 1N9ZA 1YS9A 1ZG3A 5EKTA 1E79D 4CQNA 2ZXEA 1VLMA 3BICA 4RTKA 1QKIA 3FUXA 2G1JA 3LCVB 5DX0A 1RWPA 3WB9A 3TUZC 4XLZA 2EBFX 4YP0A 3TSYA 1CIPA 4FFBA 2KI5A 1F6BA 5LWQA 1RKXA 3WL7A 2JNWA 1NNI1 4DR3C 2WJYA 2VP4A 1QYXA 1T8YA 3A9UA 3ORFA 1LLUA 4KBYA 2P4HX 1G60A 1V5IA 2WTNA 1PDOA 3ZKAA 3LHKA 5D8DA 2WBLC 2Q6LA 1YZHA 4DCNA 3DNMA 3AHIA 4S2UA 3M34A 3CZCA 1U0SY 3LVFO 3WIVA 1VBFA 2NVWA 4BNFA 3FHTA 1B14A 1Q1QA 2GN2A 2FX3A 4R7TA 1NZJA 2MSWA 2YVLA 4K9QA 4MVJI 2RJNA 1ID1A 4GOND 3QTBA 4WCFC 2RFLA 4DEXA 1GL3A 1OLXB 2FSGA 2R8OA 1KI6B 3JQ8A 1QYCA 4Q3KA 3K8OE 4N0EA 4EFKA 2ZYIA 5JVDF 4LF7B 3Q8LA 2LPMA 4TQAA 3ETGA 2FV8A 4C7MA 1ZW6A 2ES4A 5AVQA 1B0ZA 4PLWA 5GJVC 4KP7A 4N5NA 3SJAA 1XV5A 2EGGA 2PU5A 1OF1A 4IJ6A 3UWSA 1ZGBA 2R5FA 4HR7A 5CB6A 5HX7A 2ZSFA 4WQMA 2FSPA 2AR7A 2DWCA 3VAZA 5DOZA 5JNWA 1DAKA 4WFQA 2JGNA 1WMDA 1V39A 4MS1A 3UATA 3RS5A 1UXGA 4FYYA 5I9NA 2E2WA 4IFIA 3NWEA 4L73A 4MV3A 3OJFA 3OQ1A 5HP4A 1IL0A 1FOEB 2K5UA 3OVMA 1D2AA 3F74A 3GPLA 2DMRA 4QTUB 3LT0A 2PEYA 1CQPA 4KZKA 2GLUA 3GFVA 3NEPX 2W00A 3NNDA 3C3YA 2DB3A 4LDZA 2GCGA 2Y6VA 3COYA 3NCTA 4MUIA 4RJLA 4OCZA 2Q2VA 1FDWA 4BS9A 2CMFA 4OI0A 5IS2A 3RSFA 5ALPA 3BXZA 4PTZA 1EFLA 4MV5A 3ZDBA 4KSBA 3DFKA 4RQTA 3L41A 1V26A 5J4YA 2WWYA 1PLKA 2COKA 5DNCA 2Z98A 1WXDA 4JT9A 5K3FA 3SR3A 3GJRA 1BOOA 3G0CA 1UK9A 2WE7A 3ZXYA 1FSGA 1H2XA 1P81A 2XYHA 4UBJA 4EJSC 1VXRA 5BNWA 3WAJA 2J0SA 4CR6A 2C2MA 2WKQA 3E22A 2XVMA 3EGVA 2OCYC 4DR2B 1HUQA 4ABTA 1BWQA 1WF6A 3NWPA 5CA0A 4M1TA 3WHIA 3ZWWA 3WP1B 7YASA 5AIAA 5AVUA 5F7ZA 5K6RA 2B30A 4GNRA 1H05A 2NLOA 4X8LA 4YASA 2XX3A 1KU6A 2HK6A 1AMUA 3L8YA 3NT2A 4FKMA 4FOLA 5EQDA 4J9VA 1PGJA 1XMQB 4LFCC 1KDRA 3T3OA 2R00A 2WB4A 3KJXA 1L5HB 1F3LA 3B12A 1L6IA 4OP2A 4MYUA 2ZYVX 3WA6A 2XUOA 5IP5A 3IA2A 4A92A 4OV6B 1MNQA 2GPJA 1X7HA 1US8A 1XVIA 3AILA 1Z8HA 2HQBA 3ESZA 2JIRA 3TCNA 2BAGA 4J03A 1IHYA 2JANA 4JOQA 3W2GA 5IDQA 1COWA 1LK0A 3UT5B 3EASA 3IR7A 3MZ0A 2R1UA 1PUJA 3Q85A 3UV7A 4C5BA 2JJ1A 2UXBB 2QU7A 3EHEA 3MS7A 3P0HA 3GLQA 1H9CA 1U3TA 3FSGD 2ZR8A 3Q87B 5ESRA 5IAJA 3REGA 4N03A 1NE2A 2NACA 1T35A 5GV8A 2XB2A 1Z08A 2CK3A 5IAEA 4KOEC 4E5KA 1ZVKA 2X0DA 2ZI9A 2PS1A 1U8ZA 4ZOQI 2X9QA 3R7NA 1IHDA 4CR7A 2IODA 3BB1A 4IIJF 2WT4A 3OZRA 3S2FA 1GTRA 2BH1X 4HY3A 2VDLB 2COUA 3OBIA 4IGAA 4Q3DA 4BASA 1GFIA 3H11B 1Z56C 2C9DA 2MYTA 1YR2A 2E4YA 2ZUUA 5LQSA 3RC7A 3U2QA 4EL0A 2GRAA 3V4SA 4AIIA 5JBNA 3LX5A 1M6XC 5HILA 4FHCA 1AGXA 1IHOA 4EG7A 2ZVPX 2D2FA 1H6CA 1WW3A 3AEUB 1HE1C 3B6IA 3Q1KA 3FVTA 4ND2A 4NOJA 4TT3A 5J1TB 4AZ0B 5I8PA 4C4SA 1NP6A 1HOXA 3HCWA 2WPDA 5LLTA 1UP6A 1ZYUA 1FK8A 4XGNA 3M6MD 3IA7A 3I64A 2WI8A 3KAJA 1H4VB 1NNLA 1XMPA 1LDGA 1GO2A 2FMXA 3PBKA 5CT5A 1D1SA 1CNFA 3ASVA 3HTXA 2QPLA 4E1VA 1BVRA 1HFKA 1O95A 2D5CA 4CCYB 1R5BA 3MS2A 4OHUA 4G4SO 2OV1A 3LS2A 5D5PA 1DS6A 4BTLA 4MK4A 3FE2A 4WEQA 5M04A 3DQQA 5KU7A 4CU2A 1YVDA 1XTBA 2D2EA 5CH5A 6YASA 2HIHA 3OY7A 4PZDA 1E2PA 1QH0A 3Q40A 3OTOB 1S6YA 2HXGA 1L4EA 4LKOA 4X91A 3R6TA 5DGTA 5BSFA 5T4FA 3UAGA 3H5VA 2PX2A 1XVUA 2WZCA 1T2UA 3OZEA 5BORA 3RASA 5LP6F 2RGDA 1UZLA 3DWIA 4Z0HO 2EFEB 3BFVA 2W2PA 1AIPA 1CB0A 4KQJA 1M74A 1JAXA 1K7XB 4FHGA 4U5YD 3E22B 1O1YA 4RPHA 4E46A 5EGSA 1ZBQA 3THWA 1EXMA 5BSRA 4M9QA 3JQGB 4CMBA 2AMLA 2R65A 3L6RA 4RTQA 1Q0TA 4FW8A 1CUIA 2QU8A 4PNPA 5C8YB 2C2ZA 1J5PA 1PNQA 1NXQA 1BEEA 3K09A 4R2LA 4K0BA 1FPQA 3LSTA 4Y6QA 3WZMA 1W52X 4RFSA 3R5SA 1QHYA 3BSFA 4NENA 5EQFA 3DUFB 1ONNA 4KNWA 4O5OA 1GSOA 4D9JA 1R5NA 4IIJB 4KH0A 3OF3A 4BFSA 1OVMA 2I6FA 1FJGB 3JALB 5JROA 1UT5A 1I3KA 1D0VA 2WTBA 1NA5A 3X2SA 3D3WA 4JZKA 4MMZB 2HTFA 3OM1A 2JFFA 2YC4C 4LVOA 2E5WA 4QPPA 3EVNA 2ADFA 3L1IA 3BM5A 4X6YA 4R7GA 1LLDA 3VX4A 1VKZA 5EZYA 4BQSA 5CNMA 4OK6A 1I3MA 3EFOA 4FYVA 1NZDA 1WVGA 1TJ4A 1YDFA 2F3PA 1IZ8A 2HRZA 2SKCA 2XYPA 2VSYA 2GMWA 4OKNA 5AKXA 1J21A 3B7PA 3RYIA 4AKGA 3ZBTA 3QA9A 3KZ1E 4YPFA 2B0JA 1VOTA 2R48A 3DKVA 3SX2A 4XPIA 1VM6A 1XQWA 3HR4A 4XJVA 1ZM4A 3RFUA 1O7JA 5IG2A 5B4VA 1VE1A 1OLUA 2EQ5A 1E4VA 3FFAA 4GGPA 4IJVA 5DYIA 2WZDA 2Z57A 3PC8C 4RF4A 1DX4A 4C7KA 3DBVO 3IJ5A 3UK6A 1AUPA 3ZJ5A 4UPEA 4R8SA 3B70A 3J80D 1Q11A 1HNZB 2HUPA 3QEKA 4G67A 3KYJB 3HXOA 1GQOA 1M2HA 3GFRA 3HBNA 4QTYA 2CLCX 2I7CA 3UOWA 2ZDQA 3H97A 4MR7A 2FMUA 1FCJA 2ORED 4Y9UA 3KLPX 3KJNA 4YJDA 1LC3A 2VSFA 4AZSA 1MVNA 1WCJA 1FS5A 1H42A 2NTVA 1D2EA 2BEVB 3NTVA 5JASA 1Y8ZA 4JFRA 1HTBA 1R12A 3HABA 4PC1A 3NDJA 3TYXA 3AYXB 2BJVA 4ZK6A 1CUUA 1P5JA 5FQOA 5GWXA 3WJ2A 4DANA 4G24A 1TB4A 1UJ6A 1LQ2A 3LK6A 4YAJA 5JC1A 3A6JA 2UYYA 3REQA 2JZOA 3LXUX 5TS2A 4DMRA 2XYVA 5ALDA 5L6LB 2VDWB 4P7JA 4FMBB 2BDUA 3DFUA 4BU0A 1OH7A 5IKXA 1HNWB 3QQ5A 3URKA 3F8WA 4C20A 4W9MC 4C3ZA 5LJLA 1ZOPA 1XNRB 3ZTWA 1P9WA 4KQIA 3C16C 3W8RA 1B8OA 5YASA 5K51A 4DDHA 5EJMA 4PTYA 3I73A 5DI3B 4K0KC 2WV7A 1PP4A 2HB6A 1FVXA 3CVUA 4JJ4A 2OVBA 4YXWA 4P5EA 2FH5B 2PRJA 1IN7A 5JQWA 2PT7A 3QKSB 2V3CC 3H4TA 3N74A 4JI1C 3TE7A 2VTEA 2A14A 1CVRA 1PR0A 3HDJA 3NKFA 4UUBA 2PUJA 4DLPA 1ISRA 1L9KA 1U8CB 3ANSA 5ECYA 4TS1A 2VZ0A 3PXAA 2WWRA 2JGDB 4X54A 4JV5C 4DWOA 1LWNA 1FF9A 2JZNA 1ZUNB 2A1IA 5F2EA 1WHSA 4WZZA 3IP7A 1JKXA 4OBEA 1L7NA 4KPEC 2ZCJA 4TLMB 5IARA 2UYQA 1XC7A 4LXIA 4EJMA 1J00A 1YB4A 2HIMA 4ZICA 2QPOA 3PSHA 4UM7A 4GOJA 3KEFA 3AHFA 3HVJA 5SZHB 3SFVA 5ADZA 3TR0A 2EJTA 4KLNA 1KYTA 3HA5A 2VPPA 5IAAA 3V8VA 1VI5A 1VP9A 1Y4AE 2NO5A 1YJQA 2J09A 2OUKA 2XE7A 3OT5A 3PC8A 1VSTA 4PC3A 1LPSA 2YBDA 1UBKS 1FUGA 3EMBA 5CIWA 5CLLA 5KSOA 2VQFC 2C20A 1W93A 5EE1A 1CZRA 2C92A 3NDIA 4RZQA 3ZU3A 4HMOA 4D0RA 3WK7A 2WTUA 1Z82A 1N2OA 3F5FA 2I66A 4O4IA 4KQKA 4OA5A 4XDHA 1QYVA 4ENUA 4N76A 1UEXC 1XELA 3EVTA 4ND7A 2WU0A 4HI0E 3IILA 3IUJA 2I4TA 3MNFA 3GFTA 2HYIC 4TRNA 4FR2A 3ZD7A 1C9KA 2A9VA 2RHBA 2DUJA 4URUR 1NBMA 1SU8A 2DQ4A 5G1OA 1ETHA 3MMNA 1DKPA 4JMPA 4KFSA 1UKVY 5A1IA 2AD1A 1CT9A 3HZOA 4MEAA 5AI4A 1E2NA 4BMXA 4M9XA 3EGDA 3AR8A 5DGIA 3D4BA 1QG2A 3L6UA 5CA1A 3DMHA 4TTRA 4QT0A 1S3FA 3THYA 1KFJB 3WGLA 1G66A 1SIUA 2UKDA 2YN2A 1HY3A 2XRYA 3C3PA 1XR3A 3W79A 1IDN1 5HM8A 1GLVA 3R74A 5JHGB 1NVWQ 1ZMXA 2HHAA 4YRFA 2QWXA 5FX2A 1HDEA 1JGTA 1EX1A 1KJ8A 2Z5VA 3IULA 2DFVA 1G0OA 2W71A 4KGDA 1QXSA 2PAAA 3BK2A 5KJ6A 3ZWBA 4BVBA 9MHTA 2BBOA 1LU9A 1Y9ZA 1DV1A 1A4RA 1XZMA 3A9VA 2QSJA 3G2NA 3ZD8A 3IV6A 4N7RA 4E6PA 2ZPTX 1X86B 2QQGA 2VHUA 3I30X 3NTUA 1BO6A 2EVWX 4FK8A 4NV3A 5A3JA 1EFUA 5ADHA 4MYRA 1F17A 3T34A 4QKQA 4ZYTA 2GPAA 3F2VA 3I0NA 1IBMC 4IUCS 4OL0A 5T4EA 1USPA 3FOBA 1NUPA 4KFCA 1LDEA 3K5HA 1SC4A 1XDBA 2IPLA 1DZIA 3HC7A 3L4BC 4IHAA 1IC6A 4JITA 1GL6A 2PA0A 4BMCA 4GE3A 1H1LA 1PVDA 1QJ4A 3QF4A 2GAFA 3RK4A 4BZQA 4N3CA 1WE2A 3LTNC 4NBNA 2CXSA 4NYIR 4R3WA 1BCSB 5FWNA 1DKOA 1G98A 3GL9A 4RMGA 5EJ8A 4LVCA 2P1RA 4PSUA 3H4MA 4MPDA 5HW0A 5FV7A 4CF7A 4J3FA 3FDZB 2JLCA 1ZM2A 5FH9A 4DV3C 4R83A 3ZC3A 1WH9A 1L6RA 4UNPA 1EVEA 2EF0A 3GJ7A 3JAKA 3O2QB 4IMPA 2J6BA 3MPOA 5GZ6A 1IUKA 2FMFA 1E77A 2NSJA 2OFWA 2NUBA 4LIPD 2HADA 4IJWA 1QZ3A 4JLPA 4KVAA 3UB2A 1U0HC 1ZOIA 3P9RA 3UH0A 1X2EA 2HHLA 4WEOA 3VTZA 1I6KA 1YOVB 1JPVA 1D2RA 1SUIA 3GWGA 1BXGA 3UUFA 1V4NA 1S7GA 4A7PA 1PK9A 3H3JA 3S5JA 5A9RA 4NK4A 4R01A 4K6KA 4ALIA 4RDIA 3MHTA 2XGJA 3V3KA 1S2IA 1OI3A 3KXWA 5TPWA 2H0AA 3HA7A 4W9NC 5DBIA 3S2GA 1CUJA 2ZJ8A 2Q6IA 5FB3A 3SMQA 3VPDA 1QGUA 2PMBA 2BSXA 3C3AA 1ZX1A 3UMBA 2JFHA 2F4VB 4KQFA 3C15C 2J3LA 2IXAA 4I55B 1V3VA 1VIVA 5HQ3A 3ZE1B 3J80A 1NQVA 3M4XA 4GLLA 1GDDA 4K0RA 2O0KA 5CHEA 5IRCD 2L18A 1UEIA 1XEXB 1P4EA 1JKJA 1KVRA 1ZIPA 1ZK0A 2G9QA 3I6MA 4RZXA 3X1MA 4F71A 1QRTA 2H8KA 1OSNA 2IITA 1V1JA 2NSYA 3CX3A 3D54D 2NO1A 3KYCB 4IG4A 5EP3A 4CFZA 4L85A 2WKWA 1J06A 3OQIB 5TXGA 4DBLC 4AKHA 3F78A 1N36C 2JLBA 4WACA 3BMCA 3DE0X 2AJLI 3A1FA 4S1PA 2AF4C 3UUGA 1GRVA 3KE9A 2R1TB 4FGKA 3FOCA 7MDHA 1Q77A 3K9BA 2VZEA 2ZS7A 4DCTA 1P9LA 2I4RA 3CYFA 3EA5A 4DXHA 3VR5A 3HSKA 1DGQA 3THYB 3R7DA 1U0NA 2HK8A 1URPA 1EVJA 1Z47A 4MQMA 5K3DA 4LZZA 3NOQA 2VDPB 2EYUA 1JIXA 5CJ2A 4R4JA 2ECOA 4ZU6X 5CCDA 1B41A 3JARB 3MWDB 3OEED 1BS2A 1ZICA 2QB5A 3AEKB 1KNXA 1MXCA 2W93A 1I7NA 4PC2A 4CYMA 3LCCA 4WKOA 3EC1A 4UUOA 4XB1A 4M98A 4B2IA 1RNLA 3AF2A 4R05A 5AW5A 1I4WA 4RTRA 3L95X 2QQEA 1OT3A 2ZXUA 1SXHA 3ENWA 2WW8A 3QOFA 5EINA 4KK4A 5DCYA 3N8HA 5AUNB 2AG6A 3B82A 5EZQA 2JG3A 4PFKA 1U1IA 1ISGA 5DTRA 1WV0A 2ZK7A 1ZWKA 5G53C 3PQ5A 3LCMA 3S8YA 2BFFB 3L7AA 4EYSA 3QTLA 5ADWA 2C77A 4XUEA 4YYEA 3IC5A 2EWMA 3CRQA 1MJ5A 5BQOA 3ZXIA 4ZV7A 5KMGB 4IICA 1S5PA 4OMUA 1N6IA 3EGEA 1U3WA 2ILTA 3FOFC 5E6RB 1U1DA 1LI4A 5EHGA 1ZRNA 3KL2A 3ZWDA 1Q12A 5CEJA 1A9TA 3SZRA 3GLHA 1FS4A 1YJAA 4KBGA 3S1AB 2QA5A 5IHPA 4IQ4A 1H2AS 4BNLA 3DSRA 4A5SA 1SXJD 1I1NA 3RSQA 2DKOA 3PT9A 5ADUS 1TM5E 4IBOA 1P7CA 4RD4A 4BU1A 1T0HB 5ANRB 4JC5A 3ZK9A 2IHKA 3EB9A 2A5YB 4EWLA 3K73O 2O7VA 2CCKA 1XQYA 3OZXA 5EWLA 3V8MA 4GKJC 2ERYA 1UWVA 2H0QA 2J1LA 2AC2A 2CNOA 2PXHA 3OC0A 3I8OA 3L6EA 3MT7A 4QEZA 1EXVA 3E8SA 4HMQA 4LOLA 1BA3A 3ZDRA 3V8RA 3QPVA 4FMDB 3IPYA 4BY9E 3ICOA 2PYDA 4HN2A 3I1IA 2V7UA 3TL2A 3D3JA 2H5IA 1R27A 3FYCA 4H77A 4LK3A 5DULA 3CNOA 5D5HA 3EMVA 5D1NA 4M8KA 5FWYB 4KIGA 1ZHOA 4HDOB 1C7RA 1Y1PA 4JQYA 4NWIA 4TSFA 2AG1A 3TPFA 2KJQA 4FWTA 1W76A 4B4VA 2CGEA 1WXIA 1XLVA 5D01A 2XW6A 4P58A 2GASA 4JEUA 4U8HA 1TJYA 4BQEA 3OZGA 4M9ZA 1T4CB 4PUHA 1V9SA 4DCOA 1F4VA 3T1HB 1M0TA 1Z16A 1DJNA 5KOIA 1OGJA 3BQ9A 3D2LA 3WSWA 4KGZA 4Y6LA 1DC3A 1JDTA 3DE6X 3BMCB 4LGYA 5EG5A 1R0XA 3KR2A 4OK3A 1Z62A 1RTKA 2QLBA 4YBRA 1O6FA 1WPXA 5FNVB 4BNWA 3NASA 5IH3A 5EP4A 2ZI6A 2C4HA 3TW8A 1DT5A 3CNLA 1KH3A 1LWOA 1IG0A 4HNAB 4NYMQ 2PK3A 4PRYA 3FCOA 4ZU3A 5KYNA 4IDOA 2P5UA 5JSKA 5T4HA 4FFDA 5AHXA 3Q2OA 2HJHA 2XLBA 1OX4B 1ZVQA 2VF5X 4RHFA 1DJQA 1LTHR 4ZT2A 2GM3A 1LVUA 3RHSA 3W9UA 3ZJUA 5FRDA 4DMHA 2ZXFA 3RS8A 3I0MA 5F73A 5C46F 1QGDA 2ZB4A 2RG7A 3BB3A 3F9RA 1Q1ZA 2MTBA 4DZZA 5LMUC 4LYYA 5E6UB 5M3BA 2FWRA 2B1GA 5BMVB 3V1LA 4H7KA 4R1SA 2QTBA 5BR1A 2P4EA 4R51A 2XUPA 3EPPA 3W2EA 4BNUA 2IYTA 4K6HA 4PYNA 1JJAA 2DG2A 1GCGA 4F6CA 1AMNA 1X2BA 4TQUS 4QU8A 4NDNE 4DR7B 1T9GS 1B6GA 1GAQA 3PGLA 4B33A 4BP9A 5B6JA 4Y2SA 4P84A 5C35A 2GEUA 1O5TA 1PR1A 2QQFA 2GDZA 4DYHA 3K9GA 3OEEA 1NU6A 3RK0A 3ZE7A 1VLLA 3COJA 2B3TA 4URZR 4JUCA 5EHNA 1ZW1A 1FB5A 1PJ8A 2GHRA 3DTVB 2J9RA 4ZIRA 3ON5A 4XYGA 1OBFO 2VK8A 5K2MA 4R0NA 2CHGA 4HAOA 3BSWA 4P9NA 2O6LA 3GZNB 2VXBA 1C81A 3QEJA 4ZAGA 3WTBA 4OHFA 5LC1A 3U9LA 4LW8A 2V65A 4C30A 4DC9A 3BL6A 2HPHA 2W6JD 3A2MA 4OHXA 3ENQA 3WWZA 3THXB 3I23A 2IKQA 2FSUA 3SI7A 3SS7X 3TS1A 5K0JA 3HYSA 4FEAA 1U31A 1Y5MA 3H1TA 4R8LA 4R8VA 4TWAA 3D8HA 4GO1A 4X3OA 2HLPA 5EMNA 4UC0A 4G6ZA 121PA 2P69A 2VQFB 3MWJA 1T36A 2ZIAA 3EPJA 4GYYA 3UPUA 1M1UA 4H35A 4DR4B 4RWEA 1JMKC 1WDWB 4KACA 4N8SA 1JQAA 4BMYA 1G7TA 5IVPA 2C2GA 4QBIA 3I39X 1IJEA 4ZO6A 4PN7A 2Y1CA 3R0VA 4CLDA 4K7JA 2O3QA 3N2YA 3MTDA 3LXMA 3GVCA 5TQVA 1J7JA 4AXBA 3A32A 3C8MA 3ORQA 2BRUC 3KFVA 1TPZA 5KNLA 3IP3A 5JS2A 3A05A 1FP1D 8ABPA 4LBVA 1UBLS 4JLSA 3WIUA 3CY6A 1QV7A 1E3QA 5ADVA 1MIOB 2BGTA 2X0JA 3AT1A 4G56A 4PQFA 5ILOA 4KI0A 5K3AA 4XIIA 3FI9A 5ER9A 2W6QA 2JGFA 1T3SA 3SZLA 2DJ5A 4X1KA 4PBSA 2CDRA 3LUCA 1P9RA 2WIAA 4HN4B 2VH1A 4ZVUA 4XPIB 1AGPA 1GAEO 4LDPA 3SBXA 4RWZA 4BFLA 5CD9A 5HKBA 3DLPX 5DCLA 2AT1A 2BZSA 1N2BA 3AV0B 3LDFA 4YAEA 1EXNA 1C7ZA 3DCIA 1ULUA 4MP3A 3RI3A 3EWIA 1YDHA 1DFGA 5BN5B 5CDGA 5H4HA 4W5RA 2Y1OA 3O8NA 3OT4A 3QWFA 4ZHSA 5CXSA 3ELWA 1Z74A 3C48A 4IM7A 3SR0A 3P9IA 3MWEB 4GYJA 2BEKA 2WINI 4NFSA 4PFJA 3F4KA 4LV6A 1CC1S