3IEVA

Crystal structure of era in complex with mggnp and the 3' end of 16s rrna
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
302
structure length
302
Chain Sequence
HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein era
publication title Structure of ERA in complex with the 3' end of 16S rRNA: implications for ribosome biogenesis
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Nucleotide binding protein/rna
total genus 99
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3ievA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ievA01
2ONFA 2QPTA 5FI0B 5FR2A 5JFGA 5L3SA 1P7CA 2C99A 3PQCA 3WMGA 5KDLA 4Q9HA 3LA6A 2HXYA 3QJYA 2WIBA 4YMVA 3I61A 1JECA 3FE2A 4DV2C 4PANA 1YZQA 2ZS8A 4MITA 3OZXA 1Q22A 3C4JA 3ZYCA 2PZGA 4GI7A 4LJ7A 2F3RA 121PA 3KTAB 1CF4A 1BYIA 1Z0FA 4JI6C 1A5TA 4CEJA 3K9GA 2JGNA 4DVGA 2QMHA 1N33C 2FMXA 4II7A 4M1KA 4LJYA 2C98A 5BXQC 1T8TA 3W8NA 2W6JD 4BZQA 1IHUA 1UBCA 2WSMA 3UATA 1YKSA 5B58C 1X1RA 3TE6A 2Z83A 2IC5A 2ASBA 3A1UA 5TARA 3U3KA 2ZVQX 3N70A 2IYYA 1FPMA 4PPGA 2HYIC 1KSJA 4GRAA 4CEHA 3T34A 5BYJA 1XP8A 1ZAKA 2ATXA 1JNYA 4QGGA 4DSUA 4TT3D 1UEIA 5J40A 2JLZA 2ZUDA 4XWKA 1GTVA 1LF5A 1Q1EA 2GBLC 4W7SA 1XNJA 2JLVA 2NGRA 4EQ6B 2JEOA 4JYAC 1N6IA 1P9NA 2ODWA 4KODA 1MO3A 2BC9A 4WZ6A 5KPJA 2IXGA 2H1LA 4IXMA 1IXSB 5JECA 5ANRB 1DAKA 3R7WA 2OFOA 2PT7A 3WNDA 2I1VB 1LS6A 2IA5A 5DYGA 1ZB8A 2FZLA 3BOSA 4PC1A 2XGJA 4M21A 2AK2A 3AVWA 3WBJA 4CZ2A 5JEDA 3OTOC 5C18A 1AKEA 1QF9A 2NO7A 1P60A 1N6KA 2BOVA 4AIIA 5DI9A 1MT0A 2F43B 4QBHA 1P4SA 3T1QA 3RRMA 1OHHD 3BH0A 3K0FB 2ZUCA 2JLXA 1Z63A 5L3QA 5C46F 6Q21A 4Z54A 2XJ4A 5L3VA 1TF5A 5KSOA 4V0KA 1P6XA 4BLTA 3TMKA 4E07A 1WP9A 1DAHA 3C14C 3RVBA 4HAVA 1S3GA 2IXFA 1YZKA 2JIZD 4WW0A 4TQ9A 4D4KA 1KI4A 3FYHA 3WRYC 2R6CA 1TEXA 4R7ZA 5HZHA 3UG6A 1Z6XA 3LFUA 4IDNA 1P62B 2BVNA 4DCNA 1NKTA 1ZINA 1UFQA 2REOA 3LW8A 4KAXA 4C0QC 4A82A 3VKGA 1QHYA 2ZVPX 1I2DA 1G8GA 1G8FA 2HXSA 1XJCA 4ZCLA 4FCWA 5LD2C 3CX6A 1K8RA 5LMNC 3OIYA 5E3HA 4UXJA 4HB2A 3AF6A 5FTLA 1NRJB 3CH5A 1FTNA 1HH2P 4DV5C 3SJZA 2BKUA 5JCPA 1UDXA 2IEYA 2X1VA 4OHZA 3T1HC 4JLOA 4PR0A 3SE0A 2OAP1 2VHCA 4FIDA 4EFNA 4JZKA 3I5YA 3U4QA 5J4HA 1XEXB 4GKJC 3LLMA 1BMFA 1EXMA 1WRBA 2ZYWX 1ZUNB 2GF9A 3E1SA 4MKGA 3LBHA 2Q9CA 2QY9A 4Q7KA 1TF2A 1FNMA 4Z1MA 2HLDD 3WXMA 3FKQA 1RFLA 5JEEA 1NVVQ 2JATA 2KI5A 4DLZA 4MYUA 2CLSA 3PJRA 4UJ5A 2AD5A 3N5CA 4QBGB 4S2EA 4DCUA 1KY3A 2A78A 4EPYA 3BD9A 4OYHA 5HKKD 1E9CA 2NO1A 4NYMQ 4QNRA 4F4IA 2W2XA 2VF8A 3Q9LA 221PA 5TY0A 3LLUA 3QPWA 2QZ4A 5J4LA 1KKGA 1ZM4A 2J45A 4GMXA 1QHSA 5G40A 2ZRDA 3FKSA 4Q4AA 4NYIQ 3X1YA 4QC2A 1AK2A 3SFVA 3NEYA 2QQ0A 2WMNB 3MCAA 3K09C 1WCV1 2QTFA 1UDWA 1FP7A 3MUFA 4HATA 4D4LA 3LBNA 1R2QA 1JOSA 1AZSC 2KSQA 4YHHC 3T1OA 4Z8XA 5JWRA 4DR3C 1E0JA 4RVCA 1KMHA 4JJZA 3CZPA 4NYJR 4NCJA 2ZR7A 5EJEA 4OK5A 4B3GA 3RS7A 1B23P 1E9RA 2ZYTX 2ZYUX 4Q9KA 1DG3A 2DWPA 4LBWA 1QZXA 1GRNA 1NN1A 3SNHA 4DIDA 3FHTA 4OI1A 3NTUA 5AJWA 1CXZA 4Q47A 3EIQA 1EGAA 2W6ID 4JI5C 3PUZA 4LWZA 3LH5A 3TLXA 4BFVA 3EPJA 1VECA 3UPUA 1T91A 3LVQE 4KSBA 5P21A 1PUIA 4Q4HB 5G3ZA 4BWYA 1NVXQ 3ZD6A 3LNCA 1IBRA 1Z0AA 1XTKA 2BEJA 4ERNA 2GF0A 1TQDA 2CE2X 4OK3A 4DR5C 2ZR9A 3VU9A 4ESVA 1XPRA 2B21A 2QAJA 4DLSA 4A6XA 2FX3A 1RJ9B 3KB1A 2HJVA 2VP5A 8OHMA 4YONB 2HYDA 5L3SB 2ZI4A 3RAPR 4Q1BA 1NSFA 2HT6A 3K0CC 5E95A 3U3RA 3ZLJA 4GL2A 4JI4C 1KI3A 2BIFA 1VCIA 3QI2A 2IYVA 3HPQA 2IX3A 3CWZA 1TU4A 3TR0A 4PX9A 1P2TA 1GVNB 1E2IA 2ZRHA 2CHVA 3A58B 3EX7C 5SZHB 3P4YA 2VP0A 3WHKA 2ZIAA 5TMPA 2QBYB 2GVZC 4CEJB 1J90A 2P67A 4Q7MB 4KI0A 5DO9A 4BQSA 2WWYA 4LHVA 1YR9A 5JHGB 4D4MA 4JLVA 1XFAA 1JJVA 4B3FX 1VYVA 1Q3TA 1HQYE 1U8ZA 1XZPA 1JXMA 1DO0A 1XMIA 2NOAA 2VO1A 3NXSA 3ZD7A 4ILEA 4NBSA 4DIEA 1XBTA 4CEHB 3FOZA 3QBVA 1AZTA 5GJVC 2J3EA 4WIAA 1WF3A 3CRQA 1UPTA 4JLJA 1YR6A 2RB4A 1VYUA 4Q00A 2F9MA 2DFKB 1JEEA 4C7OA 3D3QA 3ND9A 3IO3A 1GAJA 2ATVA 2J87A 3UG7A 4TYQA 4I99A 3AH8A 4JLMA 3B82A 4FWIB 3OHMA 1XTQA 4YMWA 1HR0C 1R8SA 4LC1A 4GZLA 4ZDWA 1KJYA 2OCBA 3BK7A 3FWYA 3L0OA 2QP9X 5H68A 3ZVMA 3OAAA 2F3TA 2R8RA 3GEHA 1RKBA 3GLHB 4ITRC 4N3NA 4L9SA 5AJYA 1G291 3KQHA 1W36C 2CNWA 3BC1A 1GNPA 1YE8A 1HQCA 2GCOA 1ZRHA 2ZRBA 4GBMA 2ZJ8A 4KFSA 1DE0A 3H1TA 1Z6TA 4HLCA 4TMZA 2V6IA 1E94E 2OAQ1 2WWGA 4LFAC 1XMOC 1KSHA 5CLQA 5TDHA 4XSHA 2FGJA 1XD8A 3U7FB 4G5RA 5L3QB 5C4GB 4KBGA 3NIBA 1HYQA 1KI1A 1E4YA 4X8MA 2NMVA 3FPAA 1T8UA 3AGQA 4LF4C 3J81k 2IWHA 1ZIOA 4NKRA 1D2NA 3KL4A 2WM9B 4TMXA 4BLQA 3LO5A 4AYWA 4EPRA 3AKCA 4U5XA 3GJ0A 5HR5A 2QAGA 2UUBC 1N2CE 4JYBA 4NU0A 3AP1A 3GJ3A 1OIXA 1LQLA 1XJ0A 2YJTD 2P6NA 2VEDA 5DHFA 1KNQA 4F92B 3OIWA 3R9WA 2B6HA 2FSIA 5JSZA 4D0GA 3VAAA 1ZUHA 2JDIA 3R8FA 4QBFA 2V7QA 4KCGA 1GFIA 2CHQA 4H9GA 4HLUA 4TL8A 1W47A 5JJKA 4D80A 1DOAA 2FU5C 1E2DA 3BFVA 4WZAE 1UF9A 4XX2A 1R6BX 2FA9A 3ZVLA 3PVSA 3W6OA 1XMVA 2WJGA 5D3MB 4Q21A 3U4QB 2GJAA 4RFSA 4ZV4A 5JI2E 4I1UA 4A0RA 1XTJA 4HB3A 4KFRA 4GNKA 5BYKA 4OHVA 3B1VA 5CYOA 3SR0A 5J47A 4AWXA 4CRWB 1S2MA 4EUNA 4MKIA 2GKSA 3SHWA 4LGMA 5EXSA 3Q3JB 3QG1A 1CJUC 2BKEA 3CWQA 1F6BA 3GJXC 5CDFA 3THYA 1KOFA 2DB3A 4US2R 2YVUA 1BMFD 4WOPA 2GDJA 3LY5A 5A0FA 4BGDA 1HE8B 2DY1A 1W44A 4NXMC 1MO5A 4OHYA 1E79A 2WJYA 2YNMA 2ERXA 3TRFA 4DDVA 4Z1MD 2QEQA 4PSKA 4Q4AB 4MRRA 1LB1B 3ZVNA 2OXCA 4QGAA 2QM7A 1UKVY 1XTSA 2SHKA 1KDRA 4D4JA 3AVUA 4B3SC 5KTYA 4OHWA 1H8HA 1E9DA 1P2UA 2E8FA 2R6FA 1EWRA 1XCGB 4EIWA 4B71A 2GBLA 4NCNA 4Q1AA 1KIMA 3RS2A 3SI7A 1Z2CA 1KO5A 1KMHB 3KDSE 1XD9A 2GILA 2BMFA 3PUVA 4B44A 3B9QA 4TN1A 5CYPA 4P0TA 5F9FA 4OQMA 3GFOA 4KITB 2FDCA 4LHWA 2CCKA 1XRJA 3FHCB 4M9SA 4CDGA 3JAMD 4QJ4A 3R8CA 3GFTA 3QKUA 2A3RA 2A2ZA 5D3QA 4ARZA 3NH9A 2C77A 3CPJB 1AQUA 3ZZUA 1GSIA 4GP6A 1UBEA 3CZQA 2NO9A 2QRZA 2EW1A 2RH5A 3REGA 2RGEA 4M0LA 1NG1A 1PLLA 2RCNA 1MH1A 1AQYA 2FFQA 3X1XA 1CP2A 1KO1A 2WPDA 2ECKA 1K6MA 2PEYA 1P75A 3VU9B 3ADKA 1LS1A 4DRZA 2XOKA 3GJ4A 1XCPA 3KTAA 3TK1A 5F3WB 4OJQA 3SJCA 2GJ9A 1ZC4A 2B7CA 5EP4A 3TH5A 2VIIA 3JVUA 1DEKA 3SU8A 4C2UA 4QJ3A 2O8FB 2WSSA 2XITA 3KQKA 1QVRA 3JZMA 4LV5B 3W5JA 4D6PA 4IEEA 3G82C 5ELXA 1OJLA 2AFHE 4F4CA 1ONBA 5CB8A 4B2LA 4OBEA 2V6JA 3CONA 3QF4A 1JPJA 3DMDA 4HZUA 2C03A 1ZB9A 5FTNA 5TVKA 3HWSA 1CLUA 1E0KA 2MSDB 4JS0A 4KFTA 2E7GA 4GZMA 1XF9A 3CF2A 2XXAA 4CT4B 3EC1A 1HT1E 1S0UA 2VF7A 1ANKA 3K1JA 2Q9AA 2V8OA 1TAGA 3B9PA 4DCTA 1NSTA 3K70B 4L16A 1YRBA 3U3MA 1GWNA 1NL3A 4XJXA 5J4VA 1NIPA 2Z4RA 4TLDA 5B30A 3VKWA 1G3IA 1D9XA 3EC2A 1NIJA 3VHLB 721PA 2OESA 4BZPA 1XEFA 2W00A 4ZKDA 3SHFA 3WBKA 2VH5R 3ND8A 4DDUA 2ZPTX 1GKIA 4Q9LA 2CY1A 3K70D 2JLQA 1FUKA 3K0FA 5LMUC 1NLYA 4IDPA 3VTKA 3LXRA 3WYAA 3K09A 1QDEA 2V54A 1U8AA 2J41A 2PH1A 3BIFA 2GCOB 2RKOA 3Q85A 3NBFA 3RDPA 3ZS8A 4BSZA 2PLFA 4IFBA 1R7RA 3AVOA 5LB2A 2O52A 4K8OA 4LF5C 3WY9A 1G4UR 4MKHA 3UMSA 1Z07A 1J8YF 1CU1A 3A1WA 2Q3FA 4B33A 3GLGA 3OFNA 2GAAA 4XVRA 2JLSA 4QGHA 2CJWB 4QM6A 2CNWD 3C5HA 2NTYC 2Y8EA 1A4RA 3K0AB 1N32C 5HCNA 1EX6A 5UKDA 1Z47A 3CRW1 1IXZA 3KXKA 3U5ZB 3SQXA 4DCSA 4US1R 4JLDA 3NHAA 3QXCA 1EESA 2VHJA 1S4QA 4B3TC 3E70C 2XX3A 2JA1A 4F93B 5A2QD 4FXPA 1HUQA 3E2IA 2GRJA 2QM8A 1NN5A 1C1YA 1GNQA 3PCRB 5JBQA 4GOJA 4QFMA 5M04A 1CIPA 5C4MA 4ZDKA 5EUQB 2B8TA 3F5FA 1EWQA 3KB2A 3K0CA 4RFSB 3TNFA 4JLBA 4LDJA 1UKZA 2YZ2A 3BWDD 4QOSA 1WBDA 1FL9A 4DUGA 4JYCA 3EXAA 3FB4A 3AVPA 2JDID 3P1JA 3G0HA 2V7QD 1SVIA 3B6EA 2ONJA 3AVYA 3F8TA 4HZIA 3RYTC 2Q9BA 2ZRIA 3SQWA 4OI2A 3T06B 1Y3AA 2XTZA 5IRCD 2VPPA 1RRGA 3U3OA 1W0KA 2ZAMA 1AS2A 4URXR 5LPNA 2E87A 2H92A 2IF2A 4PXAA 3FMIA 2E5LC 1IONA 1XMSA 1Z06A 5B64A 2VYFA 1TF7A 5F9HA 3W34A 2BV3A 2DHRA 4TMTA 1Y63A 3QXXA 4C0SA 1PVOA 4LJ6A 3IPYA 3TUIC 3DMNA 2VL7A 4I1VA 1DAFA 2ZJ2A 2IS1A 1NMXA 4CGZA 4NONA 4QGFA 1DVRA 2FSFA 3IEVA 3T1VA 3R9XA 1DAIA 3HPRA 4RCYA 1NMZA 3SYNA 3CUEF 3NBXX 3QUSA 3IQWA 2OM2A 4DEXA 2YOGA 1LVGA 2LWIA 2QGZA 1E79D 2ZE5A 2DFNA 2O5VA 2OHFA 4JV5C 1GP2A 4C3ZA 2AWNA 4TL9A 1RRCA 2CXCA 4DB2A 3RLFA 1IOZA 3F3YA 2XZLA 2FF7A 5KSZA 5JRZA 1XCMA 4FW9A 2PEZA 4LBZA 5A5GA 2ZRNA 1H8HD 1JEDA 1TUEA 5FL3A 4CEIA 1EFHA 4DSTA 3LQQA 2P3SA 2OV2A 4ARZB 5KOYA 2NZ8A 3QIAA 4XWOA 1RJ9A 3DKPA 3TUZC 2DYJA 3T1YC 1JALA 2IT1A 3GD7A 2OT3B 2OPLB 4DB4A 3QKSA 1E9FA 4BFXA 3PIRA 4NHOA 2J0SA 2X8AA 1N5LA 1G8PA 2Q3MA 3F0TA 3NEJA 2YWGA 1JJ7A 4FCVA 4PC6A 4M9XA 4UNSA 1G7RA 3T15A 1F2TB 2BWJA 1WA5A 1MABA 4DV3C 1AIPA 2FPLA 2IYWA 1OXXK 1P2VA 2HV8A 4KLNA 4MDEA 2FN4A 2QBYA 1KTVA 1M2OB 3TBKA 2IYTA 4DLTA 1W0JA 4YQFA 2EWVA 2AWOA 4GDFA 1ODFA 1FJGC 3IIMA 2VP9A 5GVSA 3GQBA 2GHIA 2GWHA 4IXNA 1XU4A 3CR8A 3N2EA 5FPYA 4BLPA 2F1IA 1VHTA 2FZ4A 3A1VA 4JLNA 1II8B 2W0SA 2D7DA 2GVDC 2WPDD 2F4VC 1OF1A 1OW3B 1S8FA 3D7MA 1E99A 5LD2B 3KFVA 1OH8A 3NDPA 421PA 1FQJA 2XOKD 1E32A 3CX8A 3NHBA 5G53C 4EPTA 5B57C 3T1TA 4TTPA 1KO8A 3QF4B 4MRVA 2ZUBA 1E2QA 4HAWA 4HZUB 3QQ5A 4NE2A 2FPMA 5FTJA 1Q21A 4DSOA 1XTIA 1TX4B 1F2UB 1OIVA 1BYUA 1G20E 2VP6A 2CL6X 3K0EA 1IY2A 3L0SA 1RPZA 3A36A 1X8KA 2WSSD 3VQTA 3U44A 4PZLA 2XXAB 3DHWC 1ZMXA 2QA5A 3QENA 2CMKA 2FFHA 1X6VA 2J7PD 3B1XA 2DYKA 4GMDA 3MJRA 2QL8A 4MGYR 3HYTA 4BFZA 4PSVA 2ZI6A 2IYSA 4IJMA 5JLJA 2BDTA 2O0HA 4QHSA 1GM5A 1SZPA 3PITA 2UUCC 1ZD1A 1CRQA 5TV2A 3GLHA 1FNNA 4C30A 1HEIA 1XNRC 2CXXA 3J81D 2EGTA 2QROA 3RSLA 4BFWA 3AKEA 4DLXA 2C9YA 4ACBA 3C15C 4JSYA 1KJWA 1JPNA 1XEWY 3ZIAA 1KJZA 2BMEA 4P33A 1N6OA 4LX0A 3V9PA 3L8ZA 3N2IA 3BAFA 5KNDA 2A5FA 2N46A 5FBLB 1KO4A 1WH9A 4PZZA 4DUZC 2ZSFA 2XNSA 1G18A 2OCPA 4C4PA 5DSZA 2J0UB 4Q03A 2EYQA 5G3YA 3FVQA 1ZVQA 5DH9A 3EA0A 1CR1A 2PMDA 3AKDA 2IF0A 2V4ZA 3I92A 3QG5A 4KLZA 3BGWA 3KJIA 3THOA 2QT0A 3OE7A 4LRWA 4QXAA 3Q72A 5FOXA 1OFUX 4W9MC 4FWTA 4F7WA 4JVMA 5BQ5A 4NTZA 4P31A 2GJKA 2ZE8A 3GLGB 4DLWA 2XSZA 5J4KA 2IK8A 5AUNB 1ZM7A 3CNLA 2AHOA 3EIEA 3IHLA 5EE5B 1G1MA 4PC2A 2VRWA 3ICEA 2R6AA 4JI3C 2RGXA 4X64C 3UMRA 2PL3A 3I4LA 3MLEA 3KQUA 3AF0A 1GIAA 2J0VA 2RHDA 4NOZA 2GJ8A 2QE7A 1R0WA 1YZGA 4H1VA 5D3MA 2ZI5A 3J80D 4LF8C 1X8LA 2WOOA 3OFND 4EKDA 2QMOA 3GEIA 1ZYUA 3ZDQA 5HCIA 2F9LA 1GG2A 3BERA 4HYYA 4L5BA 4MUAA 3B1WA 1RYHA 4M9ZA 2JLUA 4C9BA 5BR8C 4Q4LA 4U02A 2HUPA 3THWB 2Q3HA 1S96A 3LX5A 1NVVR 3PEVA 4Q02A 3HU2A 4P4TA 4B74A 3QSYA 1WE2A 3O8DA 2E8EA 1FP6A 4GFDA 4BLSA 3VR3A 2UUAC 2FH5B 1KKLA 5F2EA 4LOAA 4TSFD 4E22A 4JBXA 2WJVA 1K5DA 1Z2AA 2QTVB 5FUYA 2G0TA 1Z6YA 2ZJAA 1TQ4A 1TUIA 3EZFA 2YC4C 4MTNA 2ZI9A 3FGNA 4Q7LA 4LF7C 4GP7A 3WYGA 1N6HA 3UANA 2EQBA 2ZRAA 4HLQB 4PPNA 4DR1C 1FX0A 1U98A 4OI4A 4EPWA 2FGKA 1G8YA 3L82B 3WMFA 1CRPA 1UM8A 4BE7B 4DUGD 1O87A 4F91B 2KE5A 4LJAA 3IIJA 2D7VA 2GETA 3C16C 3EERA 1E2KA 3ZQJA 1XTRA 3CO5A 1JI0A 3MMPA 2H7VA 2VSOA 2XB4A 5FBRB 3SYKA 5FOVA 2HHHC 1CR0A 1QWIA 4OQXA 2FNAA 2EYUA 1T6NA 1W0KD 2CCGA 2H57A 4EFMA 4DV4C 3NG1A 3NVAA 4G5QA 2ZRLA 1FUUA 3MGCA 1AS0A 1DAEA 5E7JA 2XJ9A 1DO2A 1NY6A 4WVFA 5FPSA 1KI6A 4NYJQ 3DO6A 1GITA 5JS7A 5KU1A 1DPFA 1I4TD 521PA 2GXQA 4NCHA 4ASUD 2P2LA 3H84A 4R9UC 1BIFA 1AN0A 2CK3A 2H8KA 4NZYA 1W36B 3LVRE 2B7BA 2FSGA 4MA4A 1IN6A 2A5GA 4CEIB 1OFHA 5J4YA 1W5TA 3CB4A 1FQKA 3VR4A 1WB9A 2ZANA 4Q7JB 2ATWA 2A5DA 4L4UA 1US8A 3A8TA 4GOKA 1LW7A 1W2GA 3OIVA 1J2JA 1W2HA 3QPUA 5EZ6B 3HJNA 3KKQA 3MWYW 3QKSB 4EPXA 2GAOA 5HE8A 4GSYA 1OB5A 2UXBC 1TU3A 2IWRA 4DDTA 2O8FA 2IEZA 4EFLA 4ZDJA 1KK0A 5IHPA 1IBKC 1NVUQ 4QG7A 4HSEA 1XD2A 4US0R 1W36D 1MABB 4Y0VA 4AKHA 4AY2A 4RD1A 3NDBB 1CJTC 4NPHA 4LC0A 5K8LA 1SGWA 2PX0A 2E8CA 1T3HA 2RHMA 3T5GA 1YZTA 3SBEA 2G9NA 4LBYA 1M6NA 2ZJBA 4C0AC 3E5HA 5EP3A 2C78A 1FFHA 1OLOA 1ZUIA 4MH0R 1N6PA 5EUMA 3BE4A 1RZ3A 1ZNZA 3QVUA 4LYJA 3U2QA 3W6PA 5FH9A 1NG9A 1O3YA 1KI9A 1U90A 4Q18A 1W49A 2ZU0C 1HA3A 4UNNA 4XTCS 3NBYC 4X8LA 4PZYA 2GZAA 4IKEA 5GJWC 3TGPA 1FTSA 3RRNA 1W0JD 1CR4A 1G7TA 3EA5A 2ZI7A 3FFAA 1U81A 3GLHE 2AXPA 3LWNA 5CJ2A 4KJZA 3H86A 1R0YA 3SEAA 2A5YB 3U44B 3RWMB 3KKOA 5FOTA 2VHTA 3WYFA 4DLVA 5LDDC 3O47A 1WQ1R 2ODBA 4LHYA 3DZ8A 1SHZA 3H4MA 1NP6A 1VPLA 2FOLA 1CR2A 5DGXA 3DM5A 1L2FA 2VQFC 2J9RA 3ZVRA 4JI1C 4E03A 4B3DA 3QXHA 2C96A 1X86B 3IGFA 1SVSA 1COWA 2YYZA 4E09A 5HPYB 2YINC 1PLJA 4LF6C 4RFVA 2DPXA 1ZNYA 2OSBA 4P32A 4DWJA 2CLCX 1UKKA 1KI7A 3HR7A 2W58A 3QXJA 2UZIR 4G1UC 1AKYA 2JJ1A 2Z6VA 2XZPA 5LB4A 2V1UA 2ZRKA 4F38A 3VKHA 2HF8A 2YOHA 2CJWA 2JLYA 4KV9A 4TMVA 1R5BA 3TSOA 1DADA 2ZRJA 1U9IC 1SVLA 2IBMA 2ZREA 2QNRA 4DR6C 5KNCA 2DWOA 3K0AA 4Q1FA 2OBNA 3ZIAD 4DLYA 5FBQB 3ZQ6A 3RS4A 2FV8A 2JLWA 4AKIA 2QQEA 3IO5A 2XAUA 4O2LA 1AGPA 1R8QA 2C9OA 2OLKA 1T9HA 1U0HC 1IN5A 4EPVA 1VIYA 5EP2A 3V00A 5CJPA 5FOWA 1VCMA 2UXCC 4A36A 3OE7D 1R10A 3HU3A 4MYTA 4WZBE 1E2JA 4ZCMA 3Q5EA 2FJUA 2ODEA 1YVDA 2JCSA 4RSGA 2OO7A 1AS3A 1OIWA 3L8YA 4JL8A 3BH6A 2PBRA 1W4RA 1Z29A 2H18A 2XSZD 3TAHA 1J5EC 2O8DB 2HT1A 1XNQC 3GJ6A 4W5WA 2NZJA 1NBMA 4V03A 3MWJA 4DC9A 1I4LD 1U8YA 2V55B 4O25A 5IT5A 3RANA 1QHNA 4MGIR 4EJSB 3GLIA 3O8CA 2VP4A 2AFIE 4J0QA 2QE7D 1G64A 2RGNC 3C7KA 5KDDA 1KI2A 1KAOA 1WXQA 2BBWA 1L8QA 4B76A 2IUUA 4AI6A 1G9XA 2BBOA 1L7VC 1ZU5A 1NKSA 2QP3A 2D74A 3IILA 1G5RA 4V0LA 2ZE7A 5JWOA 4PSAA 1TQ2A 1LTQA 1QHIA 1NN0A 4YDSA 1PZNA 3M4YA 2HEIA 4M1SA 3RS0A 1OH7A 4PPQA 4ZDIA 2RGAA 2O8CB 2F1JA 3C5CA 4KO8A 3ZS9A 5EE0A 5GADl 1U2RA 3SC3A 1GL9B 5JJIA 5AUPB 4UNQA 2IYQA 2ZTSA 4MYHA 5KPDA 1J7KA 1Q44A 1FX0B 1SHKA 2BCJQ 3GJ8A 1XB2A 4CT5A 5CB6A 1N36C 2EVWX 2A5JA 4B47A 1XZQA 5JJLA 4MRPA 4XWAA 4IVRA 4C2TA 2FPKA 2ZITA 1VDZA 4K46A 1II9A 2GXAA 2UU9C 1G3MA 2J7KA 4Q4JB 2F1RA 4XH9B 5EE9A 4HB4A 3CPEA 3KJGA 3I07A 4RKEA 4ACAA 3SOPA 4DDWA 1X8JA 5FTMA 1LY1A 5IK2A 5J5CA 1Z3IX 3PR1A 3QPVA 1MR3F 2FE4A 1KI6B 3EZ2A 2GTPA 4TYPA 5DHAA 3I62A 1T3SA 2OPLA 2WZQA 2IYUA 3AVQA 5AUQA 2YV5A 4NCKA 3CJEA 1SKYB 1IJEA 2A30A 4V02A 4HUTA 5KUTA 1RYFA 1D6JA 1F2TA 2C9CA 1KDOA 2HF9A 1QRAA 2J1LA 2JJ8A 4EAQA 1ETUA 3S1AB 2I3BA 1GRRA 2G77B 4W5JA 4ZO4A 4EJSC 1US8B 3KJHA 4JBWA 5DLQC 2IS4A 1N5KA 4BFSA 3EWAA 1VYTA 4KHZA 3CBQA 3QE0A 1UBFA 4G3XA 4FD2A 2H5EA 4R71A 5EQTA 5L3RA 2FG5A 4KVAA 1II8A 1XD2B 1NYEA 1ZD9A 3X1ZA 2CK3D 4PFSA 5DI3A 4D0NA 1R5NA 1VCNA 3C41J 3K8YA 2EU8A 3O8BA 2J7PA 5KNBA 3P32A 2XNDA 3HYRA 4DT1A 4LFBC 1D8TA 3GJ7A 4OL0A 4R2IA 1LV7A 3GPLA 1P61B 2MSCB 4Q1CA 2QTHA 1G6HA 5FUVA 2CEAA 5AUOB 1E2HA 4B43A 1F2UA 1HE1C 1HNWC 1Q57A 2OLJA 5IF9A 3AVVA 2EWWA 1Q1ZA 2G88A 2D4HA 3HR8A 4FMCF 4URYR 2P65A 1N5IA 1XMJA 1XPOA 3AVXA 2R6DA 1T3LA 1UEJA 4MH4A 4RZUA 4BLRA 4DV1C 1N6NA 2RMKA 5K8TA 1MO6A 1EFUA 2Q6TA 4JSTA 4A2PA 1E9BA 4MGZR 4KU4A 3DOEA 821PA 2IUTA 1OV4A 4FI3C 1T0HB 3PEWA 2KZFA 1UKEA 2A7QA 1DARA 4PHGA 1B0UA 1PA4A 2NIPA 3ASYA 5CIQA 4RCZA 1HV8A 1TNDA 4M1YA 2J0UA 5IWAC 2F7SA 2CBZA 4XVQA 5FUWA 3H0KA 1IM2A 2WBLC 1AJEA 4FMCB 4C0BA 1YZLA 3ECCA 1D2MA 5E7IA 1EK0A 4RKFA 1OH5A 2MSEB 3IUYA 2WJIA 1E2MA 3MWKA 1KYIA 3MAAC 4JI0C 4A2QA 2GZDA 3K53A 3FTQA 3X1WA 1ML8A 3KFXA 1CJMA 3U7GA 4I1SA 4TL7A 3M6AA 2PZEA 3AF2A 4HDOB 1JR3A 3QY0A 5FL7A 2J5XA 1COWD 1RRFA 1ZU4A 2VTKA 2ZJ5A 3GEEA 3SJBA 1ZW6A 4UXIA 3JVVA 3RHFA 5C2JB 4HUQA 3M1IA 5DN6D 5JI3E 2O8EB 4FMDF 5DE3A 2WMOB 3T12A 1H8ED 5JRJA 3QNUA 2JJ2A 2JJ1D 1E2LA 1SVWA 5CM8B 3SS8A 3IHWA 2WKPA 1NLFA 4A8JC 2BBSA 3D31A 4TSFA 1BOFA 1E1QA 1NBME 3LAWA 1PJRA 1PV4A 1IJFA 4JVLA 2PLRA 2CDNA 1XDBA 3DPUA 3AF3A 2OILA 4ZPXA 3GLIE 4B3MC 4MRSA 1G4AE 2WWHA 4HB0A 1KMQA 2VSFA 4RY2A 3THWA 2AL7A 4Q1EA 2F1HA 1N2FA 2FSHA 2QN6A 4P4UA 4MDFA 4TMWA 3QVVA 2D2FA 2WIAA 5CDFE 4URWR 4KXFB 3AP2A 1OYYA 4PC7A 3FFBA 2HCBA 3LD9A 1TADA 2OEPA 3AB3A 2IYXA 4QL3A 4IOMA 3W3AA 4YMSA 3GLIB 2YWHA 3LXXA 2Z5FA 4KVGA 2LKDA 5E4FA 3KUCA 1Z0KA 1JXOA 5BN4A 2DWQA 3DZDA 4KBFA 2LKCA 2C5LA 2CL0X 3AVTA 1N5JA 4QJ5A 2QPAA 5EE1A 4IRUB 3TR5A 2H16A 3D6TB 4G5OA 1E96A 1E9SA 1HT2E 1NBMD 3QKRA 4IFEA 2W2VA 3TVTA 4B75A 1ELOA 5F98A 4TYWA 2ZEJA 1Q20A 2W2TA 4UNPA 5KSPA 3SYLA 1DG1G 1Z22A 1E9AA 2OBMA 4LCBA 2K5UA 1I4DD 1JB1A 1E1RA 4PHHA 3A1TA 1A7JA 4RZ3A 4DJTA 4ASUA 4DR2C 2XTMA 2ZM6C 4PHFA 4M53A 4M1WA 1HH4A 2AD1A 4AYXA 2GXUA 4L9WA 2DFTA 1KZGB 3ADBA 4AG6A 3P20A 1G16A 2GESA 1S9DA 3AF1A 4KFUA 4YC7A 1IY1A 1SXJB 1KK2A 3W8RA 4WA7A 1Q12A 2ZETA 3B1YA 4M8NE 2G6BA 1Z8FA 2J46A 1E2GA 5H1YA 1D2EA 4YY3C 1W48A 3HP1A 4JLPA 1GOTA 2XTNA 1G3UA 1PLKA 2XEXA 4IDQA 4JIMA 3T35A 4TLAA 3DL0A 2R62A 1VMAA 4JVNA 1G3QA 1OXUA 4LSGA 3ONWA 3EW9A 5IDVA 5HE9A 2PT5A 1QHHA 3SDZA 1KHTA 2WV9A 1Z6GA 3BB3A 3I1FA 1U0JA 5K8IA 4JKIA 2ZR0A 1FOEB 3ZGXA 2GEUA 3X1DA 4PAOA 3KUDA 4P3YA 4MYCA 1XXHB 2VHQA 4BUJA 2X77A 1OKKA 1SVMA 2OCYC 4UNRA 1AA9A 4MGKR 3ZH9B 2MMGA 4A1FA 1G6OA 4IW3B 1BO6A 4TYNA 3I72A 1FMJA 2C95A 1ZNXA 2ANBA 2P0EA 1NY5A 5E7MA 1U9IA 3AF4A 1KDTA 4IVQA 1OSNA 3HDTA 3LQRA 4UQOA 2E9SA 5IK2D 1NN3A 3GKUA 2YKGA 2PT7G 1KKMA 3FHOA 2J0QA 4QHTA 4BEJA 1R4AA 2QG6A 1DBSA 4JBYA 3PV0A 3B60A 4FCTA 4OQLA 1GNRA 4ON9A 2QT1A 5DI3B 1L4YA 5AR1A 4Q1DA 2HJGA 4DEYA 4AG5A 4PAQA 4MUBA 3EASA 4BZXA 4DT1B 4KSCA 4WBSA 1VG9B 1R0XA 1OE0A 2KJQA 2C2HA 5FBVB 2CHGA 4XVUA 3WRXC 1MKYA 1S1MA 1OT3A 3VNUA 4FMBB 4A2WA 5JZVA 4UKDA 1F3OA 4CVNA 2UZ3A 4XOIA 2WJHA 1IBLC 2WOJA 4PO8A 3I5XA 3V4RA 1M7GA 4X8HA 1SXJC 4H1UA 4IOJA 1G41A 3RRYA 2XNDD 5CK5A 4O3MA 2QMEA 4BRWA 5HTKA 3K0SA 1EFTA 2QSYA 2REXB 3ETLA 2A9KA 3BFKA 4PC3A 2RGNA 3KXIA 2D3WA 4ZI3A 2X2FA 1M1YE 3W5IA 1E2NA 3RS3A 4JLAA 4ZCIA 1IN4A 2YOFA 4NL4H 3FMOB 1W4CA 1YR8A 3UIEA 2GK6A 2G83A 2ZE6A 4HI0E 2L0XA 3LBIA 3NC1C 4YMUA 3I8SA 2KB0A 5AWFC 2IS6A 3GLGE 4ZI2A 3W6NA 1G7SA 1VTKA 4JL6A 1HTWA 4Q19A 4DSNA 1JR3E 1KY2A 3UK6A 2QUZA 3R20A 3BB4A 1Z08A 3KJEA 4BFUA 4BFTA 5FLXD 1GKUB 5AK0A 5A4JA 3TJZA 2DBYA 4YLGA 5L8VA 3I8XA 1TL7C 3RNLA 4DUYC 2GCNA 2WAYA 2FEMA 4YXWD 1FZQA 1HNZC 2P6UA 4IDHA 4O0MA 4XTRA 1BKDR 4PO9A 1GL6A 4IHQA 4JMPA 3RRZA 1ZM2A 4Y0AA 2NPFA 5KHOC 1TPZA 2ZS7A 4G5SA 1XWIA 2R44A 4B6EA 3AV0B 1I94C 4OK6A 4QM7A 2AN9A 4LPSA 3TKLA 4HUQB 4JKYA 1NNEA 4ZKEA 1E2FA 3OF5A 2ZYVX 2JAQA 1V43A 2P5SA 4CF7A 1CKEA 4BFYA 2O8DA 3W9YA 1YHNA 1JR3D 5EXTA 5FL7D 1QG2A 3VR2A 2ERYA 2CLDX 2OG2A 4OJKA 4M9QA 1GUAA 4EJSA 3U60B 2AR7A 4DV0C 2PZFA 3LRPA 2KBFA 1CBUA 2WTUA 2JJ2D 2O8BA 4N0DA 2VP2A 4RZXA 2PX3A 2VA8A 1KSGA 4BASA 4F4JA 4D25A 4JI8C 1EFRA 1E1QD 2WAXA 3GMTA 1KDPA 4NYMR 1G21E 3U7EB 3WHLA 4RD4A 2O8CA 4JVSB 3MD0A 1CJVC 2ZROA 5FR1A 3NWJA 4NYIR 4A6PA 1XEWX 4LV8B 3M0EA 4C0JA 4B3CA 2N1BA 2V3CC 2WJJA 4AYTA 2ZJZA 3KQNA 3QKRB 4POAA 2MMCA 3NH6A 4JI2C 1R5OA 2BJVA 5CM9C 4Q9JA 1VHLA 4Z8YA 4B3XA 1G3RA 4GOXA 2WWIA 1EG7A 3B78A 2GEDA 3A4MA 1K0RA 5TB5A 3TVDA 4DLRA 3AEZA 3NKVA 4I4LA 2QSZA 1USPA 2CVHA 3LX8A 4IOLA 1ZCAA 3QXSA 4G01B 4P4SA 4Q4JA 3TUJC 1T5LA 2XZOA 3GLFA 1G5PA 2J59A 2ZSAA 3K9NA 4AD8A 5GJCA 4JJKA 1II0A 4IVPA 4KHPC 2D7CA 5JWHA 1WMSA 1ZP6A 3GCGA 4C0LA 2ZXUA 2BM0A 1VG0B 3Q7PA 2FWRA 3OESA 1W5SA 1GILA 2P5TB 1A2KC 2PJRA 2YC2C 1KO7A 1L4UA 4PAMA 1JQLB 1E1RD 4Q9IA 5CIWA 3GP8A 1ZBDA 3I32A 1E9EA 1Z0JA 4N0EA 2O0JA 3BH7A 4M22A 1KZ7B 4B73A 3EWSA 4JLKA 2B92A 2C8VA 3TW8B 3THXA 1YQTA 2I4IA 1DELA 5SZKB 3ADCA 1QHHB 2B8WA 3S1AA 1P9WA 1YR7A 4LV6A 2PJZA 5BW8A 4PPFA 4A4DA 1RRPA 1JBKA 1Z6AA 3ASZA 4RD2A 4GT1A 5JS8A 2ODNA 2ZRFA 1Q1BA 1M74A 2NPIA 4XIGS 5AJXA 2QGNA 2V9PA 3KKMA 1MOZA 4NXNC 4C0KA 3G5UA 2GZHA 4CW7A 4Q66C 5CLLA 1VKJA 1VIAA 3PEUA 3B13B 3CPHA 4HAUA 3IEUA 3T5DA 1CTQA 4JT4A 1Q0UA 4R2HA 4U00A 4LPKA 4BEBA 2BCGY 3OEEA 2OUKA 1W7AA 4AQYC 4A8JA 1C4OA 1OKKD 2RAPA 3BORA 3CNNA 1UADA 2HDNB 1FMLA 4TWZA 2D06A 4IDOA 5FPKA 1S9HA 2IYRA 4M1TA 4NP6A 5DYIA 3VR6A 1EX7A 2IUSA 2H17A 1SVKA 2G1JA 1YZUA 4FN5A 2VSXA 2WWWA 1QHGA 3AUXA 3MG9A 1XJQA 4QKQA 4A0HA 1D9ZA 2CVFA 4D2IA 1OB2A 2OXRA 2VHUA 1W1WA 1YZNA 2ORIA 1JAIA 1NI3A 1KGDA 1YJ5A 1Z0DA 3A4LA 3EIHA 3OEHA 1YU9A 2BM1A 1NLZA 4I1OA 4CYMA 3WMEA 5DISB 5FI1B 5H70A 1RIFA 1G19A 5B2ZA 1J8MF 4LFCC 2PCJA 4DV6C 4B3BA 4LJ8A 4TYYA 1PUJA 1SULA 2ANCA 1P72A 2N42A 3AGPA 1UAAA 4E5UA 3Q7QA 2JASA 4DCVA 1W46A 1ZJ6A 2NQ2C 4QRHA 5DN6A 1OH6A 4V0NA 3B5JA 1QG4A 4DKXA 4U7DA 3PENA 1H8EA 3VMFA 2QENA 5H8WA 1G8HA 2BBTA 4RZ2A 1SQ5A 1VCOA 2ZRPA 2ZQ5A 3R7WB 2FFAA 1E2EA 1Q1QA 4DR4C 1DAMA 1QBKC 2R2AA 1A2BA 2GK7A 2WWFA 5LBIA 4CIDA 4TZ0A 3UWOA 4XD7A 1Z28A 5BN5A 2ZSDA 5JHHB 2TMKA 5KO2A 2O8EA 3AF5A 4LHXA 1Z0IA 1M8PA 4HEJA 3SJAA 3PXGA 3RC3A 4G0NA 1XPUA 1P2SA 2UXDC 4UXHA 3NC0C 3T61A 2Z43A 4PTLA 3ZZ0A 4X65C 1GRQA 5EXPA 1JR6A 1ZM3A 5AJZA 1N6RA 3UKDA 1M34E 4BECA 1TTTA 4L15A 1T4GA 1TEVA 3AP3A 1ZCBA 4HAYA 2Z4SA 1W4BA 3LDAA 4URUR 4TTRA 3TQFA 1T5IA 4TMKA 3ZJYA 2Z0MA 3Q8XB 5CK4A 4R98A 4LYAA 4B6FA 4LK2A 1MRSA 4OI0A 4RD0A 1IBMC 1ZD8A 3LV8A 4ZIRA 3ICQB 3QOFA 3FDIA 2NO0A 4MQBA 5EZ5A 4D82A 1ZC3A 2AX4A 5CITA 4URVR 4OKSA 1GZSA 1K5GA 1ZIPA 3CRRA 3IDQA 2REBA 1F48A 2ZRMA 4ESHA 1A1VA 5JCZA 2AKAB 5EP1A 4S35A 2QP4A 3VNVA 3MRSA 3EPLA 3VR1A 2ZI3A 2X2EA 4AURA 1LF0A 1EFCA 4A0FA 3U6KA 3MWLA 2QMUA 3QEOA 3AM1A 2O8BB 2G1KA 2CCJA 4X8OA 3UMFA 3CKLA 3CW2A 3K9LA 1AGRA 621PA 4B35A 3DDCA 1VG1A 4KYUA 2NG1A 3PUWA 4O2RA 1N25A 3OIUA 4Q48A 3QEJA 4OX9C 2FFBA 4RD3A 1FW6A 3EARA 3DVLA 1BH2A 1UBGA 2BMJA 3GLFE 4WXPA 3BS4A 1I2MA 1X1SA 2KBEA 4TQAA 3GFPA 1E2PA 2PN2A 2GJSA 3CH4B 1EFRD 2QRNA 1IXRC 3RC8A 2OE2A 3K9HA 1SXJA 3A4NA 4DXAA 3EG5A 3BBPA 3QKTA 2IHBA 1TMKA 1YRAA 1OXVA 1VLAA 3EZ6A 1P5ZB 4LZZA 4PO1A 3W90A 1USPB 2IHYA 5KSYA 1ESNA 2WKQA 3EAQA 1SKYE 1KI8A 2YCBA 4P4SB 4XSGA 3GLFB 3DKVA 2QI9C 4DBLC 4GPTA 1RE0A 3D8BA 1J70A 4V0OA 4GKKC 4Q01A 1OPXA 3C8UA 3U61B 1NVWQ 1IAQA 5IT9D 2CL7X 3B7GA 2RGGA 4HDCA 3KXLA 3RSOA 1G17A 3BFXA 3IBGA 3KX2A 5AJVB 4HLDA 3FKSD 3I3SR 1XXHA 3L43A 2ZRCA 2OBLA 1MV5A 2DCUA 3MFYA 4C0HA 2HCJB 2PMKA 4B3RC 1R0ZA 3CR7A 3THXB 4LJ4A 2G0NA 2G3YA 2OFXA 4M2LA 1OFIA 3BB1A 4NH0A 2OZEA 3B85A 3QBTA 4AK9A 3RWOA 2IYZA 2EFDB 1H65A 4M1MA 2BMDA 2EFCB 4LI0A 4A92A 2E1RA 4M1OA 3FMFA 3WNBA 2D62A 1OXTA 5KYKA 1M7BA 1E6CA 4OHXA 1S3SA 2W6JA 4LHZA 1HNXC 1AM4D 3JZAA 5DIFA 2IW3A 3TIFA 4Z51A 3EPKA 1XX6A 2ZS9A 5JMTA 3ADDA 2CE7A 3A37A 3AQ4A 4JI7C 1GKYA 2EFGA 2Q21A 4V0MA 2AK3A 3X2SA 2QL6A 1LFDB 1OYWA 4ABYA 3VFDA 4A8JB 4I81A 4IOKA 1ZNWA 1QVAA 2GA8A 3W3ZB 1UJ2A 1E0SA 5TXGA 4TLBA 4DLUA 4M4SA 2AXNA 4A0GA 1NJGA 2QORA 4TT3A 3DOFA 1DAGA 1WDTA 3RS5A 3V4FA 4BLOA 4YMTA 2VQSA 1E3MA 1KK1A 1RVDA 4X62C 4WXRA 5SZIA 4YDHB 1CEEA 1N6LA 2FEOA 4TLCA 4RD6A 4TLEA 4TZ6A 2ONKA 3IIKA 5FPHA 5GVRA 1NJFA 1SKQA 3RABA 3OEED 4B34A 2LCFA 3A1SA 4DV7C 1SVOA 5KDOA 4URZR 5GJBA 3EZ9A 1RW4A 1U99A 2VQEC 4PQFA 2P6RA 1CJKC 1KNXA 1OFTA 2WKRA 4RJLA 4IEIA 4B2IA 4YXWA 1IN7A 2YWEA 4QNMA 4UJ3A 4B48A 2W0MA 4LBVA 1E0AA 1MRNA 3B8HA 3CM0A 1N34C 2BEKA 4LY6A 2GXSA 4JL5A 1OHHA 2F6RA 1U94A 4BRUA 1F5NA 2ZSBA 4EQ6A 3IBYA 5C1BA 4NCIA 2IL1A 2OFWA 2V1XA 2EFEB 2VLIA 4C7OB 1ESMA 4LF9C 3CRVA 3OEHD 2WVJA 1UKYA 3H2YA 3SFZA 3BRWD 4NDZA 3CIOA 2JLRA 5FPTA 3CLVA 4N1AA 2JIZA 2RGDA 1D5CA 2ZAOA 4AKEA 3P26A 2GCPA 3R9IA 1QHXA 2DFLA 2UKDA 4LYFA 3TQCA 3VHXA 2RGCA 2QU8A 2ASEA 2F43A 3LW7A 1C9KA 5FUXA 4LUCA 5BN3A 2F55A 1F60A 4DR7C 3EZ7A 3L0IB 2ZM5A 2GEVA 5K8UA 3CNOA 4KYIB 3B2EA 3SN6A 5EXXA 2YWFA 4X66C 1JQJC 3TSWA 2R6GA 4EDHA 2RGBA 1A82A 1HURA 1X3SA 2BJOA 1P3JA 3KKNA 2PCLA 3IKJA 3SZRA 3LUSA 2ZJOA 2WICA 4A15A 4K0KC 4QHYA 3VX4A 3GJ5A 3PFIA 2IXEA 2IYLD 3KQLA 4HAXA 3VX3A 5G41A 2OCAA 3P27A 4A9AA 4LJ9A 1KAGA 3FMPB 3B1ZA 1W4AA 3BXZA 3OAAD 4D26A 4LJ5A 3WP0A 4L8GA 3ZZTA 1NF3A 2O0KA 4D0LB 3EPHA 2WHXA 1KSFX 4OQNA 4PHTA 2HLDA 2R9VA 4XD7D 3O8RA 4TQUS 4WAUA 5FOUA 3TAUA 2ZJYA 1BS1A 3DM9B 4K81B 1J99A 2QAGB 1G5TA 3PG5A 5FFMA 1VG8A 3U7HB 1M7HA 5FOSA 3U3JA 2IS2A 4ZIRB 3WP1B 4D81A 1ZM9A 1DS6A 3AUYA 5HKKA 1U0LA 1OXSC 1XEXA 5BWMA 3PEYA 1N0UA 1S1CA 3AKYA 5JSZB 2YHSA 1DTSA 1GDDA 3L2OB 3UXMA 4FMDB 5EE3A 5FTKA 2I1QA 1CS4C 2DR3A 2ORVA 4G5GA 2ZRGA 2XR1A 3K70C 2ORWA 1N0WA 1E98A 2NO6A 3TSZA 1P9RA 1N3BA 5FBWB 3A6PC 1SXJE 4TL6A 4OQFA 1WBBA 3CRMA 4AC9A 4DHEA 1E4VA 2X19A 3NBZC 2UVQA 1V5WA 3BJIC 3L0PA 4TTQA 4PQRA 4QBIA 3HU1A 1Z5ZA 2WWXA 3CX7A 3UWKA 3SBDA 4Q5IA 1MO4A 1L2TA 1P73A 4HAZA 1T0JB 3THYB 4B2PA 1IN8A 1GL7A 4JT2A 3Q5DA 3REFA 1KK3A 1LNZA 2VBCA 3KKPA 2GNOA 1G7CA 5SZJA 1IY0A 2W6IA 1XXHE 4NMMA 3IPXA 4AKGA 4LYHA 3VR5A 2BHRA 4HDQB 2QPOA 3DEFA 2ZSEA 2JMPA 3PUXA 3CF0A 2ZU6A 2XB2A 4MKFA 3KZ1E 4PQYA 3TW4A 5HZKA 4DZZA 1SXJD 3P4XA 3CF6R 4W5HA 3U6BA 1JAHA 1CULC 1Z83A 4MRNA 1E69A 3MSXA 2C04A 2QAGC 1Q3HA 4B32A 3I73A 1HY3A 1RC8A 2W83A 1N0VC 4Q4HA 2R65A 2EFHB 1IQPA 3QF7A 3IQXA 3WNCA 3PUYA 4FINA 2D2EA 2AKYA 4V0ME 2Q0HA 1XMQC 5DNYB 4BPBA 1NMYA 2BJWA 3MJHA 2KWIA 4HLUC 1TQ6A
chains in the Genus database with same CATH superfamily
3KAJA 3WRVA 2VF4X 1C7RA 1PGQA 1HXHA 4QLAA 4XEHA 1EE1A 1UMBA 5CNIA 3WMGA 1I51A 2I3DA 3UFXB 4AJLA 2WIBA 1BSVA 4XUCA 4P3OA 1JECA 5KS2A 2FF5A 4CMCA 2X2OA 4XGKA 4DV2C 1P5HA 2O3UA 3KCQA 1PT5A 2ZJFA 4OMDA 4TTIA 3ZYCA 3C4JA 4RDIA 2Z8ZA 4LJ7A 1Y1TA 121PA 2PKXA 2YY7A 3M3PA 1Z0FA 1A5TA 3UJHA 3SBXA 1PZHA 4GSLA 4CEJA 4MLPA 4DVGA 2QMHA 3OM0A 1UC5B 3EEQA 4IX9A 4RK5A 1LK0A 5A6SA 1L4FA 1K4KA 9LDBA 3BGIA 5AK6A 4BZQA 1SZCA 3FCXA 1CFJA 1WTCA 3CF4A 3ZWYA 3F73A 3ISTA 1MO2A 1WB6A 1UBCA 2YDXA 3JQ9C 1YKSA 2VDLB 2ZG6A 2VYND 3UATA 3K30A 4XWKA 3FCCA 1X1RA 1XKTA 1B4DA 4M0EA 5BWNA 2ABWA 3ZHXA 5LMNB 1XCOA 1RJWA 2ZVQX 3R2JA 4W8OA 2QZZA 1RWBA 1FPMA 2WNSA 3VHRA 3ZJ4A 4GRAA 4CEHA 1D2HA 4J3FA 3E9RA 4DM3A 4E31A 3T34A 3EIOA 1P1RA 3OKFA 5TPWB 4D8TA 3NZEA 4JI8B 5BMVB 2A0KA 1PX2A 4I5GA 2QTLA 2NV6A 1M2KA 2B99A 2EL9A 3FRHA 3OZIA 1L3CA 4TT3D 3NHMA 5J40A 2MTBA 3GFSA 4YGYA 1LF5A 4W7SA 4CM8B 3DMHA 5ALEA 4DE5A 1VIVA 1XNJA 3G8CA 4D0SA 1YACA 3ML1A 1SUWA 1O0CA 2Y68A 1KOJA 1MP0A 4LQ4A 2JEOA 2ODWA 3QLJA 1MO3A 3RD5A 1EAYA 2DHQA 4IXMA 2ODTX 1LNSA 4UASA 4U1RA 5JECA 4I9GA 3H2SA 4LZLA 5A04A 2I1VB 2IA5A 1FJXA 4WLNA 3VUEA 4TKVA 3W3AH 3ZE0B 5LN1A 3AVWA 1BE6A 3L8EA 2AK2A 3DMTA 4BNGA 2QRMA 5SV2A 1T3ZA 5K3CA 3AJRA 2P0AA 1GRVA 2BISA 4JXKA 1AQIA 5JATA 1UKAA 1V11B 4HWGA 4ZRDA 3RRMA 2FVYA 1FMTA 4X41A 1OHHD 2V6GA 1WEHA 3DT9A 2OPHA 2ZUCA 1VA4A 3G7UA 4PO3X 5L3QA 4WFQA 3ZCRA 5HSGA 1XOIA 2XJ4A 4TWBA 2O19A 4BLTA 4U2GA 4E07A 4KHPB 1WP9A 1YVEI 3F4BA 4JM1A 1B76A 2J3JA 2P7HA 1YA8A 2IXFA 4LOJA 3ZN2A 3WYEA 1FDUA 1E3WB 3UV3A 2JIZD 3GH1A 3L6BA 4D4KA 4TQ9A 3DAYA 3MT8A 1J39A 3UG6A 1Z6XA 5A4DA 4R3UC 3RR2A 1ZINA 3VKGA 3A26A 1A04A 1ORRA 2Y0PA 3ZU3A 4PW0A 5DNVA 3PHBE 4HADA 5MGBA 3SPXA 3ZGNA 4Q9AA 2PV0A 3EEFA 1I2DA 4AUKA 4E5NA 2PGAA 1G8FA 5LD2C 1GR1A 1WSBA 1YQ9A 4LXTA 3QZUA 4UXJA 1TM3E 3BEDA 3RVMA 3CH5A 4QODA 4R1OA 4A0SA 5KJ6A 1TEZA 4M8IA 1C3OA 1UDXA 2X1VA 1UBKS 1GGNA 3L7MA 4U3JB 3AEYA 3GAFA 4UU1A 4EFNA 2AZXA 2GCGA 1ZRSA 4PSCA 3G9XA 4NXNB 5BWOA 4F9GA 1JQDA 1DIHA 4GPD1 1Y4AE 3AFIA 3RTEA 5A3SA 1TF2A 4FNGA 3CUUA 4NE9A 5EIWA 5AQEA 3FKQA 2IPNA 4G5HA 1NVVQ 4TVBA 3UJ6A 4D1YA 5JR3A 2JI4A 5ALGA 5CB4B 3E9CA 4G85A 4RJIA 1DBRA 2J9XB 5H5JA 1SUDA 2AD5A 4QBGB 3MCVA 2XT9A 4B7AA 1KY3A 5BW4A 4EPYA 5DHQA 4L57A 3T7SA 3JD2A 5TGZA 4N5LA 4F4IA 1K63A 3LLUA 1H3FA 2NZXA 3QPWA 3U4MA 1KKGA 1PIWA 3GDGA 5I7VA 2J45A 1VGVA 3K05A 4KQ6A 5G40A 2VNAA 3OP4A 4Z4FA 2NZ2A 3X1YA 4ZI7F 1XHLA 1LK7A 2X4LA 4UMEA 5FI3A 5K4AA 3WJ1A 4ETIA 4MW2A 2BGGA 5A9RA 5AE3A 3K70D 3A1CA 2QQ0A 5DP1A 5DWDA 3ROQA 4LQDA 3I2JA 5K8JB 1H93A 3DKRA 1NR7A 1BDBA 2P35A 1WCV1 3K09C 3KZXA 5ECYA 3I9LA 3UMGA 4E5SA 2IHUA 4D4LA 3JAMA 1XRPA 1JOSA 2KSQA 2O4UX 4TKUA 4YO7A 2VNHA 2P5YA 4KG7A 4WS9A 4P5EA 1M6VA 3VPHA 3F74A 1X70A 1KMHA 1ENYA 2KM1A 4HS9A 1O5OA 1DJMA 5SICE 1L3BA 1RABA 3CZPA 3RUFA 3LK7A 5CBPB 4BKRA 2ZR7A 2R5NA 1MIOB 2X14A 3HEMA 4K9OA 4OK5A 3QWFA 2PLNA 4BUZA 1SUAA 1OBFO 5J2UA 3EWIA 3DZIA 1ZRNA 1ZOIA 1DG3A 3C48A 1MEEA 4DJ5X 1N9ZA 1VMIA 2VSNA 1TM4E 2FR0A 3ETOA 2I7DA 2Z5LA 1GRNA 1NN1A 3LLCA 2IV7A 2W6MA 3I0NA 4DIDA 3WYNA 2Q5HA 3NTUA 1CXZA 4GKVA 3Q98A 4LWZA 1N1GA 3LPMA 1SB8A 1VECA 1T91A 2IKQA 3LVQE 4I4TF 4YLEA 4BO0A 1UIRA 3VR5D 4IGIA 1NVXQ 1T2EA 2B5WA 3UXHA 3BIOA 1IBRA 2PL5A 3ZE8A 2BEJA 4ERNA 2GF0A 1TQDA 1CD5A 4L4ZA 4DR5C 1VKNA 3LKBA 4OK3A 2Q4RA 1EM6A 2JARA 2PXAA 4A6XA 1M6YA 5L4LA 4LCEA 3VOAA 5TJHA 3FHJA 4YONB 3TL2A 3WKAA 3UHPA 4UTPA 2AEJA 4LFAB 2I6SA 2IXAA 3CKYA 1NSFA 1PJLA 3KYCA 1L8LA 3LL7A 1KI3A 3CXRA 3GRPA 2Y1FA 2OMKA 3U7RA 2G80A 4DJEC 2P2FA 4YT2A 4PX9A 1P2TA 1GVNB 3RC1A 1CIJA 3D81A 2CHVA 1N0IA 2JIMA 3MK31 3P4YA 4MS4A 3EX7C 2PANA 3IKMB 2FPWA 3TLAA 4ARUA 3PK0A 4XA8A 4CCYB 2NAFA 3IUBA 1U3WA 4MKZA 1LUAA 3X1KA 3ZCVA 5LJLA 2WWYA 3EPRA 1WDMA 4NMWA 2PKYX 3DF7A 4AKSA 2HTFA 1RXEA 3RKSA 5JHGB 3GJQA 3G2QA 3JR7A 4HX2A 4R0VA 2EDAA 3FCUB 2HM7A 1WDKA 2Q6VA 1YE3A 1NJ1A 3BXXA 1LC0A 1CEYA 5BSTA 1VYVA 3WE7A 4EEXA 1JXMA 3G2HA 1DO0A 2VO1A 2NOAA 1FYDA 3AWIA 3IKVA 3SF8B 3MUOA 4NBSA 4HNVA 2RD2A 1A76A 3ZD7A 4DIEA 3JASA 2JI7A 4PZCA 2J3EA 1JIKA 2IQ5A 1WXXA 2BTQB 3CRQA 3N28A 4KNVA 5D6OA 3PRYA 5C1DA 3CE6A 5JS2A 4Q00A 2XUHA 1MEJA 3VGPA 1ORVA 1M3SA 3G5MA 3SQOA 4OL9A 5TT1A 3C8DA 1LSJA 1NF8A 3JWPA 3OPNA 2JAOA 1YFKA 4TYQA 4WDRA 2G17A 1G42A 4YRQA 4TV9F 5ALWA 4HQOA 3OICA 1U0EA 4QYMA 2XUPA 4YT4A 4FWIB 1T24A 2ZTUA 4WY2A 2LXNA 5EHQA 1Z74A 4YMWA 3JQDA 4LC1A 1ID1A 4PX5A 2NUPB 1AQJA 1RKXA 1QMPA 5H68A 1Z5VA 3DP9A 1DBQA 1Y7TA 4CPDA 4N3NA 5JYCA 1JWAB 4L9SA 1IIBA 5AJYA 4EB8A 1W36C 3BC1A 3P0EA 5GZ6A 5IC4A 1QPBA 2HA5A 1HQCA 4YBZA 4JUIA 4FQ8A 2Z3VA 3EVAA 4GBMA 4B17A 2ZJ8A 3KETA 4KFSA 4BXOA 3H1TA 3SHOA 1CY7A 5ETJA 1KSHA 1U3TA 1L5YA 1UFKA 2JZOA 3E8MA 3F98A 1XD8A 1FUEA 3JQ6A 3LCUA 3OX3A 4G5RA 4XSHA 4BNZA 4D7AA 5KOHA 5LQJA 2WT8A 1CB0A 1V16A 1NVFA 2B20A 5A2QA 1HYQA 3GA0A 3BTUA 1E4YA 1NW3A 2GO7A 3N7AA 1SCQA 3PWTA 5LZ5A 4EBBA 5BSEA 1MB4A 2QW1A 4L0CA 3VC7A 3BM5A 1UP4A 2DUJA 1ST2A 4INJA 1EG2A 3BCUA 3KL4A 2BPOA 2ZBQA 2V98A 3D1VA 2FZVA 4LNAA 4Q1VA 1OPRA 3TKAA 2UUBC 1MCZA 4LRSB 3RFUA 4JYBA 1ZN8A 1SPXA 3WK6A 1K2WA 2R1VA 3HFSA 3A06A 3DH0A 3PLAE 1KF0A 4R0MA 1YKFA 2X0RA 2FSIA 3K94A 4QWMA 2GBPA 4RPHA 4NZPA 3G2OA 5JSZA 2JDIA 2P6PA 3UHAA 3R8FA 4I1PA 4HOYA 1ONNA 1B6TA 4ISBA 4K86A 2BW0A 2WUEA 1UKBA 3UBTA 2CXNA 2NV2B 2Z6UA 3PVSA 2AB0A 3W6OA 2HTEA 2HFKA 4FGUA 5D3MB 4C5BA 4BX9A 5HZMA 3ZD8A 2YDYA 1HNXB 4Q34A 2QSJA 3Q41A 5JI2E 1DRJA 3DBOB 4ZVMA 3Q6MA 1UWLA 4DRXA 4KQJA 5D3KA 2XWQA 4OJTA 4TKLA 4AJEA 5CYOA 3VHQA 2HC9A 2WM3A 3TNYA 2VUSA 4F3NA 3R6WA 4FFBB 1S2MA 4EUNA 4NJEA 4BMZA 3NCHA 4JP2A 2RH4A 2V7PA 4NZ9A 3CA8A 1TRKA 5ITVA 5E0KB 3HB0A 3ONVA 1RY2A 1KOFA 1IZ0A 2YVUA 3GRKA 3QH4A 2A9OA 1QBGA 4WOPA 1C1XB 1EWVA 2GDJA 3LY5A 1HE8B 4YRLA 3LRTA 4DMCA 1W44A 2NZWA 1MO5A 4G8CA 4KN6A 1YTUA 3ZE9A 1E79A 3I6QA 4AZ3A 2GYWA 3BZBA 3TRFA 1JQKA 3S82A 2A4MA 3O1HB 4PSKA 4Q4AB 1LB1B 3LPLA 3JATA 3L8CA 4INZA 2QM7A 4WKGA 1XTSA 3DQQA 3WSVA 4TYWA 1Y3HA 3R23A 1KDRA 5DHUA 3UJ8A 3AVUA 1U2DC 4OHWA 3PFNA 3PESA 1GTL1 4KQXA 5BQFA 5I9LA 1AKRA 1BG6A 1P6QA 1H8HA 1M1NB 3TZHA 4Q3DA 2E8FA 2R6FA 2Y1EA 3VR6H 4IIJF 1XCGB 4EIWA 3UO8B 2GBLA 3RS2A 3LFTA 2HIHA 1OQAA 3T94A 2LRHA 5KWJA 4YRNA 3QFCA 4LTMA 4X3CA 4CMEA 3W5VA 2W98A 3NRBA 5I7SA 4MJXA 2BMFA 3B9QA 4K9MA 4XFDA 4DKJA 4TN1A 5CYPA 1JFTA 1D09A 3HXMA 1T9KA 4L8FA 2WYVA 2CCKA 2H4XA 1CQIB 5BP7A 1KEEA 3FHCB 3QOYA 4M9SA 1G5HA 1WPXA 3S99A 4CDGA 3JAMD 2BGUA 4YAEA 1BOOA 3QKUA 2C0PA 4G4IA 4B5LA 3OE1A 2OPBA 3TGWA 1SCKA 3ZZUA 1AQUA 3R7BA 1GSIA 1GRCA 3CLRD 3OOEA 4EZIA 4ZQIA 3DF9A 3CZQA 2RH5A 2VT7A 2EJBA 3ANNA 1E1DA 1O6GA 3GQVA 1PLLA 2NWQA 1LQ2A 3O0TA 5LXTB 1HE5A 4X66B 4QWWA 1LZKA 5CW2A 2I7VA 1K6MA 3VU9B 4Z9AA 1MT3A 3W8FA 2EKZA 4DRZA 1IOVA 2QHXA 3QJGA 1VHQA 4JYMA 2XOKA 1BXKA 2W6ZA 1NXTA 2MINA 3KTAA 2RJOA 1VCHA 3GNLA 4C4YA 2QZ9A 5LQDA 2B7CA 3TH5A 3FWKA 3SX0A 1DEKA 3SU8A 3UUFA 2YIVX 1NW5A 3OURA 5CX1A 2O8FB 5CD9A 1DV2A 2RJ3A 3JZMA 3WR5A 5CA0B 3W5JA 3KNZA 5E2IA 4JBIA 3RHSA 2QD1A 1C7EA 1P4HA 4X45A 4IEEA 1SWWA 3C8ZA 2I2XB 1GPMA 1ZONA 1GZ7A 3OA2A 4HDKB 5ER9A 3TQTA 1N32B 5DGCA 2P4QA 1R4NA 1FS4A 3LCCA 3CMMA 4I6EA 2HCTA 3QFRA 2COEA 4WJLA 3DMDA 4HZUA 5TNXA 1YUBA 2C03A 5GQSA 2GVNA 2VNSA 1JBEA 4GSKA 1REQA 4JS0A 3J81A 3OCJA 2W2OA 2BYTA 1JPVA 2XMQA 1FMCA 1XDZA 2HQBA 3LDHA 4ND7A 5EGSA 1ANKA 3C39A 5J5VA 1Y8CA 2QB5A 2V8OA 2OORC 4YRAA 1Y7HA 1NSTA 2WF8A 2DM6A 4L16A 4M1QA 3BSFA 2BKAA 4ALLA 1P0CA 1SC9A 4MCIA 4XJXA 4CG2A 5A0VA 1X7XA 3VKWA 1A50B 2VDQB 1G3IA 3NM5A 2HDOA 1VJ5A 4OX9Y 3AL0C 3G2NA 2RK4A 3D5EA 1J7JA 3ETJA 4RADA 1WUHS 2EW8A 2ZATA 2J6IA 2PWAA 1GNTA 3IDAA 3LHFA 4JI1B 4A8TA 2W6CX 1QCZA 1DDOA 1IH8A 3SHFA 2G5PA 1WKVA 5CCEA 5M2QA 2OXFA 2Q0QA 4YCBA 3TW0A 2WVHA 2FZGA 4IVNA 3MERA 1GKIA 3QLEA 2MOKA 4LMBA 7MDHA 4DXDA 3K0FA 1Z2OX 2WIDA 4CFYA 3ZHVA 3GEDA 3OM9A 3F1KA 4X93A 3LXRA 3V4LA 3VTKA 4F71A 3BRSA 2NVUB 4MEAA 1QDEA 3KPWA 4N65A 2V54A 4R69A 5DEIA 2J41A 3ZKAA 3OTIA 2XCSB 1GJRA 3T3HA 3I9MA 1D2CA 2NPOA 2RKOA 2FR8C 4FR5A 3ZS8A 2ZPAA 1JA1A 2XHZA 3H9JA 3P7MA 3TN7A 2E5LB 3PFHA 5EXEA 5CXUA 4I8XA 2BFBB 4LF5C 1WB5A 4C2BA 3B36A 1YL7A 1K6XA 3GMIA 4H4EA 4X84A 5FD8A 4HVLA 2Q3FA 1PKXA 4GHWA 3J80A 1SVNA 2FX2A 1M33A 2AIRA 3I9FA 1OZ0A 4QYXA 4RJTA 2C2XA 5K0GA 1BJKA 1YB4A 4BE4A 1RLJA 5FWXA 2CJWB 4L76A 3BKWA 4NX2A 4QM6A 2V7UA 2YZ7A 1WXEA 4AG3A 5C8YB 4MB0A 1QIKA 4OFZA 1EE9A 1VLZA 1EX6A 1Z47A 2OXEA 3L7JA 3M6UA 4G25A 4US1R 2PX6A 3U39A 2X3YA 4BFLA 1R12A 1GPWB 1P77A 2RHRA 3I6IA 1F4LA 4GZ5A 1YCFA 2MYPA 1PVDA 1RHKA 3KTDA 4TX1A 2TECE 3PE6A 5A2QD 2O07A 2X58A 1T8PA 5J23A 1C1YA 2ZSUA 3OQPA 1NNUA 3K1ZA 4MV8A 1VLMA 1GFZA 2CNBA 2A9FA 2YXLA 3C3YA 1PFUA 2BFFB 4L0MA 5M04A 3BMOB 3DWFA 3IXQA 4ZDKA 2GZMA 1Y5IA 5KVVA 5EUQB 2P9GA 2PZLA 1A4UA 4CL8A 5FWYA 3D0OA 5K99A 1BS2A 2UUOA 4QGSA 4MUHA 1W6RA 1EWQA 4XFKA 2H1SA 1L6RA 1OV6A 1N7IA 1E3LA 2XNJA 3MYRA 3O4VA 4GD3Q 4LA4A 4YRGA 1BXGB 2YYSA 2HBZA 2J4DA 3LFHA 5EQFA 3AEQA 2Q07A 3NHLA 1ZUWA 5D00A 4EGQA 4DV2B 3DXFA 4YJHA 1XQVA 4HPVA 4EEZA 4JYCA 1UT5A 2Y6VA 3AVPA 1DKMA 1RQXA 1FYVA 2JDID 1IVSA 1SHLA 3H99A 3K9QO 4MI3A 3B6EA 5KAMA 3SC6A 4CDRA 5L40A 3ZCSA 3NIDB 4M8KA 2PKQO 4H59A 1QF6A 2HMTA 2IPMA 3SQWA 1BCSA 4EW6A 4OI2A 3T06B 2HMUA 3VYTB 5K3OA 4NPAA 2YJZA 4PRZA 5IRCD 2HQ1A 2VPPA 3U3OA 1I13A 2VT2A 4U2EA 4WKBA 2IV3A 1BGXT 4YH1A 1I33A 3UUGA 3X1JA 4E2XA 3SHQA 5IZCC 2H92A 3NCTA 3AY7A 3IULA 1VRWA 3WLEA 1GZDA 3IOMA 2IOFK 4KXQA 2VYFA 1TF7A 2ZB2A 3RK0A 1CP3A 1Z25A 2JFQA 5HZGA 2SNIE 3WA7A 2K7ZA 4V0QA 1XQYA 1Z4QA 4LJ6A 3ZW7A 1V7CA 3GR6A 1KWGA 3EVGA 4H7JA 2D0OB 1QP7A 2IS1A 4U6SA 1CT9A 3IAUA 1XJWA 1TUGA 2BEWA 3AZOA 3I2YX 3UZ0A 3IUMA 4IRMA 4MV5A 4DIFA 1L9KA 2JJMA 2A57A 1Z4PX 4N0QA 3SYNA 3R5FA 2Z5GA 2YOGA 2QGZA 1E79D 2XY4A 2Q4EA 4F3YA 2L69A 2OHFA 4JV5C 1UAGA 3JQRA 2P90A 1V1RA 4GOMD 1NWCA 2AWNA 4N7MA 2G9UA 4AICA 2CV2A 5EKXA 1JKXA 1UJ6A 4TL9A 1RRCA 2X1HA 1BJTA 1EP2B 2A0FA 4JWKA 3KOUA 4YMIA 3U13A 4BL5A 3F3YA 3IELA 1NRWA 5B36A 2OHIA 3DKKA 4OP3A 1XCMA 5LQRA 1SBNE 1T13A 2PEZA 4LBZA 4KEAA 1H8HD 1Y6ZA 1TJ3A 1GCGA 1YQDA 4MHSA 5FL3A 2DLNA 2AUMA 5IAKA 1Q1GA 2GM9A 4I66A 4OJYA 1RJ9A 1N5DA 2GKGA 2G72A 4IILA 4C05A 5KWSA 1JALA 1P7PA 3IVRA 1YVUA 2WU0A 4LIPD 3FSRA 3UYLA 2JA2A 4KQGA 5TLSA 3F9IA 1X2BA 2BRUA 4DB4A 5IBPA 1E9FA 3PIRA 1QKKA 4NHOA 2J0SA 2FW7A 1KARA 3NEJA 3F0TA 2JHAA 3A14A 3FPLA 3IVAA 4PC6A 3CV3A 3SKXA 3W6ZA 5LQKA 4NSNA 4WGFA 4MVJI 4HGNA 5B53A 5AFSA 1RAEA 1MABA 4DV3C 1IOWA 2FPLA 1TEHA 1OXXK 1MX1A 4KLNA 4MDEA 4S1OA 4J2TA 3TTXA 3QUCA 2YV3A 1XE3A 3QVSA 1Y1QA 1MW9X 1W0JA 2EBUA 1V1MA 2EWVA 3K1AB 2FSSA 4LN1A 1FTQA 5BSUA 4UTXA 2YFYA 1NBEA 4MW6A 3NTQA 3NHFA 2O2IA 5AHXA 4WBXC 4AX4A 3GQBA 3OZRA 4C1NA 3CR8A 3MELA 2JZNA 4YREA 3K0KA 3QW2A 4MP6A 2D7DA 1ISJA 1II8B 3VGJA 3R6GA 3NDJA 2GVDC 4DLKA 2GD0A 2ZWMA 4MV6A 3A6JA 2BM9A 3D7MA 1AT1A 5TF0A 1E99A 3KO8A 4DZTA 5LD2B 1U63A 3UUEA 1X80B 3V1YA 5CDTA 1GPDG 2XOKD 3CX8A 3JD4A 4QPJC 1ZITA 4DLAA 4EPTA 3T1TA 2C7RA 1UM9B 3ABOB 4TTPA 2ZUBA 3L7IA 2Z9CA 3KXPA 5LYJB 3ACDA 2PUEA 1P2DA 1VKZA 4FPXA 4YRSA 3K0EA 5C9ZA 2JL1A 3I9V6 3VQTA 3SIPA 3U44A 2XXAB 2HR1A 4NJOA 2QA5A 4UU8A 7REQA 4QPCA 3QENA 3AY0A 1B8PA 3EYWA 4MV1A 1FNSA 1NT2A 3T4EA 3PS9A 5A4IS 5KNBD 2I2AA 3ICVA 1OI2A 4HN2A 2R1TA 2FRDA 2ZI6A 2PG3A 4QOFA 5JLJA 3QTTA 3UYKA 3M6VA 3T8YA 3EQ6A 3PITA 2WK1A 3CEHA 4ED9A 4TWJA 2JIBA 5TV2A 3GLHA 1QV9A 5HJ7A 4C30A 3TQHA 4RWZA 2DLDA 4ECEA 1HEIA 1XNRC 2HV9A 3J81D 2EGTA 5H9UA 3R7NA 3RASA 1JLRA 3C15C 2O8NA 2AA3A 3OC0A 2GN1A 1IPHA 2M5OA 4BS9A 3CSUA 3OFJA 4UFPA 4Z4CA 3EB9A 4RTNA 1ZOLA 1L7AA 1N6OA 4F5WA 1GG5A 3N2IA 3UT6A 1KO4A 1PCXA 2O54A 4HH3C 1EX9A 4A03A 5LBUA 2IVFA 3BEOA 4Q39A 2OCIA 4Q03A 3TEFA 5L7WA 2RBKA 3FVQA 1WWKA 3DFKA 3L49A 5DH9A 3EA0A 1CR1A 2GOYA 1YOVB 4XX0B 3RJMA 3W5HA 1L4GA 2C9ZA 5E2AA 2QT0A 2SKCA 1U3VA 2K6GA 4Z9YA 1SK9A 4NOMA 4QXAA 2P2DA 1FW8A 1H2ZA 3OX1A 1Z6ZA 4W9MC 2B94A 1NVBA 2HO5A 3H1GA 2G9VA 4P31A 4YRMA 2ZE8A 2OYRA 3FI9A 5CHYA 3HABA 3DR3A 1RPNA 5ESRA 1ZM7A 3AR6A 4OAOA 2WT4A 3KJFA 3EIEA 3EFOA 4I1RA 4TXHA 3DTVB 3LYLA 4CKZA 3H5AA 2VRWA 4ZU3A 1IYZA 3QWHA 2RGXA 4IJUA 4X64C 2EKQA 2CWDA 3AF0A 3CUVA 1X8XA 2J0VA 4NOZA 2GSWA 2QE7A 1U0GA 3P2KA 4H1VA 5BWBA 3GCXA 3J80D 4LF8C 1X8LA 4EKDA 3UMCA 2VDKB 1R4ZA 4DY6A 4EH1A 3R7AA 4DR5B 5EYPB 4R05A 2WM2A 3BERA 4V0RA 4PXSA 1ZOOA 1QH0A 3TOSA 1NBIA 4C9BA 1PZEA 1PFYA 1T9AA 4DUPA 4U02A 2HUPA 3JARA 2PX8A 1S96A 3LX5A 4IQ0A 2KLBA 1NMQA 1Z75A 1WOMA 2ZAGA 4MQMA 4WZBA 4Q02A 2CLIB 3HU2A 3QVXA 4B74A 4YMLA 3QSYA 4G0UA 1FS6A 3EGVA 3ET4A 2VCYA 2WG0A 3A6DA 2IU4A 3AESB 2UUAC 3DJFA 3M1AA 1F8XA 1TIPA 3V48A 2Q46A 3ANTA 5I7FA 3NR2A 1Z2AA 2QTVB 2X7JA 3MAGA 2G0TA 1HDGO 1TUIA 3EZFA 3V2HA 5JD4A 2V7XA 5CFQA 1MB2A 4MTNA 1Z9BA 2ZI9A 3FGNA 2X8WA 4Q7LA 1FNBA 5EFOA 2P1DA 4GP7A 1ESCA 1S3FA 4MDYA 4A2CA 1Z0SA 4L27A 2ZRAA 3UANA 2Q4DA 4HLQB 4GVLA 4PPNA 4AY3A 3L7NA 1O95C 1A9YA 2KMLA 1DRVA 1IXKA 4GYKA 1I9CA 3E5MA 4MUKA 1BHJA 5CVUA 4UZEA 4MXDA 4R5HA 1O87A 3HXTA 2OM6A 2XVMA 2KE5A 1KXZA 1VFNA 3W3AD 3WDMA 3PPXA 4N3GA 1F4VA 1YZHA 3EF0A 2WT9A 1ZLYA 1XTRA 2VK8A 1JI0A 2X0KA 2F90A 4GMGA 4X44A 1U8FO 3MMPA 4BVEA 3TF5A 2H7VA 1JEAA 2XB4A 1C2TA 3AHJA 4JNCA 2HHHC 1RXWA 3J7AC 2VR1A 1OGIA 3R9XB 2ZJ7A 3M5WA 3LL4A 1EWYA 2XA2A 3NG1A 3TZEA 5ALVA 3H1BA 4BO4A 4F4HA 1T8RA 4J07A 4RF5A 3UB2A 5K05A 3BWVA 4KQEA 4RENA 1NY6A 4GU5A 4GPZA 5KWIA 4BX8A 1WHSB 3DO6A 3WB2A 5KU1A 4DDHA 1JDJA 2BR3A 2TMGA 3OQOA 5AVTA 4ARCA 1JEJA 1X42A 3TLGB 4NCHA 2YWCA 3H84A 2FWIA 2H1WA 4NZYA 1W36B 3S5UA 2Y4NA 4RQAA 4ZQFA 3GLQA 4DJJA 2A5GA 2BEUA 4DJAA 4CEIB 3FFXA 3OEYA 3PT5A 4BV9A 3CPSA 4EY6A 5J4YA 4B4OA 3RG8A 2Q2OA 3P9QA 4L4UA 1B3BA 1US8A 1JHZA 2NT3A 5LP6A 1W2GA 2XXJA 2MR5A 1CNMA 2ALJA 3OIVA 2YFKA 5CFPA 5F3DA 1W2HA 3NC4A 4BDSA 1R0CA 3KKQA 4EPXA 4JUAA 2HWYA 5M34A 5M5BA 2GAOA 3COSA 3HZRA 4FDMA 1BWPA 1TU3A 3OCYA 4WH0A 4DDTA 4XXHA 1OB5A 2ILTA 4EFLA 1KK0A 2O3JA 2PMCA 4ZDJA 1XD2A 5KC8A 3G79A 4K6HA 4Y6RA 3MB8A 3RS9A 4Y0VA 4MO9A 4JBNA 1D1SA 3SF0A 2K2QB 3HCDA 1ECFA 4KN5A 3ELBA 4M6WA 2CV1A 3A4IA 5KQGA 1QOPB 1T3HA 1FP2A 1PFVA 1HFWA 2QD5A 1QH1B 5F1OA 1ZG3A 2ZJBA 3E5HA 3E84A 4N8EA 4YX9A 3D54D 2JK1A 3Q3EA 3HGTA 5EP3A 4HDMB 5LDGA 3TSCA 3H4TA 3DO5A 1DRKA 4N01A 3G89A 5CJPA 3PT9A 3U2QA 4B8YA 4UHHA 1NG9A 1VI6A 3IALA 2GPTA 2QVGA 1I6WA 1U90A 1R6TA 2A33A 2DKFA 3EVDA 3TTYA 5JNWA 1HA3A 2DUWA 3I2IA 3NBYC 2O2HA 2A5LA 1FTSA 4BNDB 1W0JD 1XC7A 3LIPA 1G7TA 4KQCA 4CMIA 1XHFA 3EA5A 2XGOA 1ZAYA 3GLHE 3KC2A 3NORA 3LWNA 4KJZA 3S0JA 1LXCA 3H86A 1B43A 4GL4A 2VTVA 4YRDA 2EFYA 1N8NA 1AKTA 3IHKA 4RHEA 4DAEA 4R7GA 1DKRA 1JLLB 3EISA 5A03A 2IYNA 3P0RA 1V25A 3LQ1A 4M49A 4OM8A 3VDNB 4UM9B 1DOZA 2AI2A 1WQ1R 2VJOA 3DDOA 1ZOPA 3AR5A 1HTBA 4ZJUA 3I9V1 3NAGA 1H22A 2C59A 3DMPA 3LYUA 4RVUA 4YQEA 2CXUA 3C3JA 1IM5A 4MR9A 3UK2A 4H7FA 1IFXA 1SG0A 3IGFA 3N0RA 1E1YA 1SVSA 3DBRA 3GRFA 3PGKA 1PJ2A 4Y9RA 3VI3B 4E09A 1PLJA 4K8RB 5HPYB 4LF6C 4RFVA 4ADSG 2DPXA 3MXTA 1JQ3A 3O83A 3VU0A 4P32A 1L7DA 4IIUA 4JLWA 4MWDA 3VBCA 3EGDB 1U5BB 1VZ2A 4P83A 2UVPB 3N2ZB 2TMYA 2OUIA 4OXXA 2QUAA 3VKHA 1OD6A 3ZHTA 2XE4A 2YOHA 4W6ZA 4ZP1A 3DEYX 4FT4A 3D3WB 2H1RA 5FNVF 1ZI6A 1SVLA 2ZREA 1R5JA 1YI8A 3FPCA 4M8SA 3V2IA 2O7NA 4FFOA 5IAEA 3K0AA 3UPTA 2QIPA 4MI1A 3IJ5A 2BMVA 1W1IA 2FP3A 3PIDA 2I2CA 3LLVA 4ALIA 4AKIA 2QQEA 1Z68A 3N2KB 4ZRMA 4O2LA 3FR7A 1R8QA 2P2MA 4Q93A 2PA3A 3QX8A 5CDFE 1E7QA 1U0HC 1X1CA 2AMYA 4RNCA 4QU0A 1IJBA 4L5YA 1VIYA 3WBBA 5ES4B 4PSUA 4RPJA 1E60A 1ABEA 3OLXA 2EC5A 1UZNA 2GK4A 4QTTB 2YHBA 4MYTA 1FJ2A 3OWOA 4WZBE 3HJTA 1ZCFA 3RV4A 4ZCMA 3ZDDA 4UATA 4K1LA 3OQHA 3OHPA 2JKYA 2NYUA 4RSGA 1OIWA 3BH6A 3H17A 1JWBB 4G86A 1W4RA 2H18A 2AN3A 4UOQA 2IEIA 4HH1A 1JR4A 4ZV9A 3GJ6A 5EMMA 1ACLA 1M34B 4V03A 5DK4A 3I34X 1OJ7A 1RJFA 2QD2A 5I47A 2V55B 3N86A 2VZ0A 2QJFA 1QHNA 3L6CA 2BGMA 3BXHA 3O31A 3P9KA 4PUIA 4MGIR 4CXMA 1R0BA 2VP4A 4Q9NA 3L4BA 2F48A 2QE7D 1WZEA 2X4IA 4ZC8A 3ENQA 2NZUG 2QX8A 3ZI0A 3ZR4B 1ODIA 4IDDA 4C03A 1YS6A 4YR7A 5I8WA 1RYDA 3CH6A 4L02A 2BKXA 2BBOA 3DONA 4JUCA 2QP3A 4F04A 1I14A 3IILA 2RK6A 5JWOA 4NOKA 1HG1A 3F6BX 3LHIA 5EJFA 3KKKA 1KFCB 1TIBA 1GPUA 1TH5A 2RGAA 5BPHA 5D01A 1WMFA 4LJKA 1GL9B 1M2JA 4UNQA 5FORA 1UWDA 2ZTSA 4TV8B 2FQ1A 1NUPA 5JDCC 1J7KA 3M89A 3UT5A 3LNTA 4G0MA 1FX0B 1SHKA 2QV0A 2W71A 3WL3A 4OREX 3TO5A 2WFAA 4CMHA 2FN8A 5GONB 5AICA 2HAEA 3OF3A 1N36C 1FQOA 2L82A 3T6KA 1T6XA 4FFWA 1P1IA 1GDHA 2YY5A 5EINA 3C3PA 3K6SA 1O57A 4YJ3F 4I5IA 2YUIA 2IZZA 4Z2AA 1Y42X 1NVGA 1DWQA 1VDZA 2WSIA 1U1IA 2W6QA 1U28C 2JNVA 3HCNA 4K88A 5CGZA 4BY9E 3H2BA 4B3HA 2NUTA 4WUTA 3R3WA 2FEKA 2X9NA 1FFSA 1MTOA 2R97A 3DZGA 3RBZA 3W9SA 1I5OA 1PO7A 1QZ3A 1ZESA 2CYAA 1Y8RA 4HDAA 4RJJA 4DDWA 1LY1A 2Q7XA 4OUKX 3Q15C 3QPVA 1MR3F 4LSMA 3DC2A 3PGXA 3RSZA 1Y1PA 3AVQA 5EKUA 3L7DA 2FPGA 2XDQA 2YV5A 4G67A 3V3TA 4MS1B 1UJ4A 2C94A 1L5NA 4AO6A 3IUPA 5KUTA 3A6ZA 4FX2A 1F2TA 2IE8A 3T9FA 3ZZ1A 3DXZA 2HF9A 3QX3A 1FDOA 1XZBA 4OLJA 4WBNB 4G9GA 1YDFA 2G77B 2I3BA 4ZO4A 3S1AB 1BDMA 2C42A 1IAVA 2OGUA 4LF5B 1LEHA 2IS4A 1N5KA 2Q5FA 4BFSA 1Y4ZA 4UM8B 2HOQA 1VYTA 3T99A 2XODA