3IEVA

Crystal structure of era in complex with mggnp and the 3' end of 16s rrna
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
302
structure length
302
Chain Sequence
HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of ERA in complex with the 3' end of 16S rRNA: implications for ribosome biogenesis
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Nucleotide binding protein/rna
molecule keywords GTP-binding protein era
total genus 99
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3ievA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ievA01
1WP9A 1GG2A 2Z43A 5FUYA 1OYYA 2HLDD 2W6ID 5BYJA 5ELXA 4L9WA 4GBMA 5SZIA 1FP6A 2VHJA 3AF5A 4LFBC 4MYCA 1XMIA 3RABA 4IW3B 4U5XA 4WOPA 4HEJA 2P6NA 3OE7D 4R98A 4FMCB 1XP8A 4PFSA 1ESMA 2ZAMA 1T5IA 1II9A 1TNDA 2OESA 1QVRA 1L4UA 3RVBA 2ZU6A 4L9SA 2RGAA 2XTZA 4GMDA 2IYSA 3RLFA 2JLXA 2QAJA 1N6RA 1DTSA 3BFKA 6Q21A 1UBEA 3PEVA 2DR3A 4BFZA 3WMFA 1Z06A 5EE1A 1TF7A 2HXSA 2IXFA 4PAMA 4PSKA 3TAHA 1Z2AA 2XZLA 2YHSA 4URWR 1M8PA 3U44A 2QAGC 5BN3A 3I07A 3E70C 1S3GA 1ZBDA 4PAQA 1F2TA 5B58C 2KJQA 4DVGA 4B3CA 3BWDD 4RZ2A 4C2UA 5CLQA 5A5GA 1X3SA 4P33A 2P6RA 2EYQA 4LBWA 4RVCA 4MGKR 2PH1A 4F4CA 4YXWA 4C0QC 1GSIA 2ZYWX 1OH6A 1BS1A 3CX7A 4TLEA 4B3GA 1E0AA 3OEED 4DV7C 4UNQA 2FGJA 1EGAA 4MGZR 2GJ8A 5FUWA 5FOVA 2P6UA 2XR1A 2WKPA 3CZPA 4R7ZA 1CRQA 4C0AC 2YCBA 1GP2A 3B1XA 4RD0A 1M6NA 4ON9A 3U4QB 2R2AA 3EZ9A 5HPYB 4C7OA 2ZVQX 3AF6A 3F8TA 1KMQA 4HATA 4P4SA 5KNDA 2ZSFA 5KSZA 3CLVA 2BKEA 4TYNA 4AWXA 1UJ2A 2I1QA 4OHWA 1RW4A 2ECKA 4DEXA 2VEDA 4L4UA 4PAOA 2GWHA 3LLMA 2Z83A 2EU8A 2QU8A 3SNHA 5FPKA 1DELA 2PMKA 4DR3C 3DOFA 3B1WA 4JI6C 3GLGB 3U44B 3TVTA 4OQFA 2EFEB 5KYKA 4DBLC 1W36D 1LV7A 2FN4A 1E2MA 3WBKA 3W90A 2A5JA 1E9FA 2GNOA 2PCJA 2P5SA 3DPUA 3IEVA 4EPVA 2RGBA 2FMXA 1E4VA 2B7CA 1E2EA 1YRBA 1R4AA 4QJ3A 4LJ4A 4V02A 4GNKA 2GXUA 1JJ7A 5FR1A 3EA5A 2RGXA 3KUCA 4WVFA 1YR6A 4BQSA 4JL8A 1WQ1R 1U81A 3MG9A 4OHZA 4RZUA 3NDBB 4AK9A 2SHKA 2VP6A 4E03A 1UKZA 3SHWA 1E2PA 3SQWA 4ASUD 1T0JB 4AYWA 4NHOA 1Z8FA 3WRYC 3ECCA 4PPFA 4DSNA 1PLKA 1P9NA 2VL7A 5KDOA 2NZ8A 2VH5R 3BK7A 2WZQA 4DCSA 3AH8A 3C41J 5FFMA 1EFCA 1Q20A 2QROA 4XH9B 2CE2X 3EWSA 1UF9A 3RS4A 1UKEA 2P67A 1W2HA 4NCJA 2ZYVX 3GJ7A 5FUXA 3CRW1 1KI2A 5CB6A 1A5TA 3RS0A 1NI3A 2DBYA 4M1TA 5UKDA 3WYAA 2OO7A 5FTNA 3P27A 2AX4A 5JJIA 1M1YE 3L0SA 4AURA 4B3MC 1PJRA 4Q4AA 5BN4A 4DCTA 2CDNA 3AF3A 2ATXA 3JVUA 1CR2A 3UWKA 2QBYB 1GNRA 1NVUQ 3IKJA 1S4QA 2JJ2D 2IUTA 2AK2A 1UKKA 2WM9B 5GVRA 3ZDQA 2O8EB 1J99A 2DB3A 1JOSA 2WKQA 2F1RA 4U00A 1HNXC 1BYUA 3KQHA 3K9GA 2QT0A 2GK7A 3RSLA 3X1XA 3ZIAA 2B8WA 1H8HA 3G0HA 2OZEA 1Z0AA 4JL5A 4Q47A 4UXIA 3SHFA 4QKQA 2H57A 4TZ6A 2R8RA 2GZAA 4YHHC 1FMJA 5CLLA 2NG1A 2PZEA 1P3JA 1ML8A 1KDPA 3RAPR 3TH5A 1OW3B 1MO5A 5KUTA 1VDZA 2NMVA 3VMFA 1QBKC 5K8UA 3VR2A 4X8OA 2AXNA 2HHHC 2W00A 1NN0A 3NHBA 2J0SA 3QSYA 4KHZA 5IHPA 3AVPA 1XTIA 3D31A 4HAXA 4PO8A 5DYIA 4LHVA 3A58B 4JLOA 3LY5A 4BFSA 5SZJA 4FWTA 3DM9B 4M21A 3FMFA 3AVWA 2RMKA 4QC2A 2ODWA 1VCMA 1IBRA 1NN3A 3SS8A 4I4LA 3L0IB 5E4FA 1HEIA 3DMNA 3TAUA 1F5NA 3WHLA 3A1SA 1KK2A 1KSGA 2WSSA 1GFIA 2UUBC 2RB4A 2VYFA 4HLDA 4A36A 3KXIA 3W6OA 2OE2A 3B1YA 1TL7C 1KO5A 3CNNA 4L5BA 5J4YA 4BFXA 3OESA 4LYFA 4MGIR 1G4UR 3TK1A 3KKMA 2G83A 1VG0B 4GKKC 3THOA 3ADBA 2CXCA 1SKYB 3A8TA 2HCBA 4EFNA 2WOJA 1QHXA 1FTSA 1GUAA 2IYQA 1TU4A 221PA 4ZCLA 3CF6R 2ZM5A 1UKYA 4C7OB 2OAP1 3NWJA 5GJVC 1U99A 4OI1A 1BOFA 2PLRA 1E9RA 4DDWA 2C95A 3I92A 1IJEA 1GL9B 1M74A 3NG1A 3T5DA 4LV6A 3P32A 4MDEA 1Z22A 2ZUCA 1ZJ6A 1D8TA 2ZRMA 3LV8A 5CDFE 5L3VA 3AB3A 3V9PA 4ESVA 2GBLC 1LQLA 2BHRA 3M6AA 1OE0A 1VCIA 3CZQA 1R7RA 2GF9A 4K8OA 4B73A 5JCPA 2NO6A 2ORIA 3SC3A 1FW6A 1OF1A 2KE5A 1OHHA 3QENA 1HURA 1CJVC 5C1BA 4OQXA 3TRFA 4HUQB 4BE7B 4BLSA 3B82A 4KO8A 2ZI6A 1Q1QA 1DAEA 1XDBA 2ZRLA 4LSGA 3KKNA 4I99A 1IN5A 4B6FA 2A5YB 1NVWQ 1ZNXA 3LLUA 1KGDA 3GLFE 1G8YA 4A0GA 4TMZA 2I4IA 4R2IA 3GJ3A 3W34A 2QPOA 1FPMA 3KKQA 4FIDA 5TMPA 3CRVA 4DV2C 4HLCA 1ZM9A 4J0QA 4D0GA 3FFBA 3QPUA 3IO5A 4ERNA 3KL4A 3L8YA 3QF4B 1KI3A 4EDHA 3KFVA 2GDJA 3ZQJA 2QP3A 1KOFA 5G3YA 4TQUS 1MH1A 2HT1A 2OLKA 2DFLA 2HLDA 3KB1A 1NY6A 3PUVA 3LRPA 2J3EA 5FOTA 4IVPA 3VR3A 4DZZA 8OHMA 4I81A 1ONBA 3AUXA 4G0NA 4NDZA 1Q1EA 3LX8A 4ZO4A 1YQTA 2YWGA 1L2TA 2A3RA 3N2EA 2UZIR 1Z0JA 3QBTA 4KFTA 3VR5A 2N42A 5KNCA 4V0NA 3QG5A 4A9AA 4BWYA 2ORWA 4PHTA 3I5XA 2GETA 4ILEA 5KDDA 2A78A 5FL7D 5FTKA 5DHFA 2PT7G 1TQ2A 1N0VC 3KKPA 4L16A 1S1CA 1ZINA 2CHVA 2ZU0C 4JVLA 2NO9A 2QSYA 2WIBA 3P1JA 1CF4A 3THWB 1K6MA 3THYB 4BFTA 2WJHA 4V0KA 1IN6A 5FOUA 2ONJA 1UDWA 4JIMA 4BPBA 2HYIC 1OB5A 2CMKA 1NKSA 4IFEA 1LY1A 3FHOA 4UXHA 2NIPA 2FOLA 3MJRA 1E1QA 2GCPA 3CONA 2BMJA 2UKDA 4YMWA 1Q12A 1RYHA 1D5CA 2QQEA 4UNRA 4ARZA 1ZYUA 2G1KA 3KQNA 3MWLA 4AC9A 3TSOA 1TUEA 1GKUB 4KYUA 2VP4A 1I4TD 1XD8A 5L3QA 4ARZB 2MMGA 4EUNA 721PA 4NCHA 3LVRE 3ZIAD 2IUUA 2H5EA 4D2IA 1CR0A 1RYFA 2R6CA 4X62C 1E2IA 4W7SA 3U7GA 2Q6TA 1E9BA 1E2KA 1YZKA 4Z8XA 2B21A 2WWHA 1KI7A 4GZMA 3PG5A 1RZ3A 4PPQA 4LFAC 5H8WA 3CX8A 3BFXA 5KTYA 1DPFA 2AFHE 2BV3A 1D2NA 3FTQA 1GILA 4KLNA 4HZIA 4KXFB 1J5EC 2O8EA 3CF2A 4XVUA 4L15A 2FSHA 4Q01A 2GZDA 3CPHA 3QVUA 2KZFA 2JLRA 1IHUA 4LUCA 2JLZA 5IT5A 3VKWA 4KODA 4OHXA 1CP2A 2WSMA 3QI2A 2O0JA 4A0FA 4EQ6A 3MGCA 3IEUA 3PXGA 4JI5C 1NJFA 3LAWA 4LWZA 3AVXA 3MWJA 1EFHA 1PUIA 1SVOA 1AS2A 2DFKB 2ZETA 2YC2C 2CLCX 3L82B 5LPNA 1QHNA 4XVQA 4JLJA 3A1VA 1U9IA 5GVSA 3RS2A 5JHGB 3I4LA 1ESNA 1YU9A 5FBQB 2ZANA 3C4JA 4M53A 2J7PD 4HLQB 4TTPA 1CLUA 2GCOA 3QF4A 3KZ1E 3TQFA 1VCNA 3LO5A 2EGTA 1TTTA 4KSCA 3K70B 1I2DA 3ND8A 4HAUA 3Q7PA 1H8EA 4C0HA 1W4RA 5GJBA 2EWWA 5D3MA 2LWIA 5FOWA 4EPTA 2ATVA 4X64C 1S0UA 4NL4H 2D4HA 4Q7MB 3AVOA 2E87A 3HYTA 4MRVA 2ASBA 2EFCB 1ETUA 3W8RA 4B3RC 1XMOC 2ZIAA 1YVDA 1R10A 1Q21A 2OILA 2W0MA 2J0QA 2WSSD 4HUQA 4JI3C 2VP5A 2VQEC 5TB5A 1RC8A 1P2VA 2VSFA 3MWYW 1R2QA 2IWRA 3P4YA 1E9AA 2R6GA 3W6PA 1LF0A 2G0TA 4XD7D 2YYZA 4AYTA 2CL7X 2RCNA 3TMKA 1U94A 2EWVA 2OBMA 1NKTA 3TLXA 2IA5A 3ZZ0A 2DWQA 1KI6B 2UU9C 3CNOA 4ESHA 2W83A 1KK3A 1II8B 4CF7A 4D25A 2P2LA 3EC2A 4MUBA 1JXOA 4LYAA 4QJ5A 5EP3A 1XMSA 1RRGA 3CPEA 3I61A 1FL9A 2DWPA 1G64A 1NVXQ 3IPYA 4MKHA 4TYYA 1Z3IX 4YONB 1KKMA 4G5RA 4PANA 3SJAA 5LBIA 4TWZA 1HQYE 2F9MA 5FBVB 5IRCD 2OHFA 1G8FA 3MFYA 4LF4C 1EK0A 1SVLA 3U60B 1CULC 3T06B 3U7FB 2ZSBA 4TYQA 1CJTC 4Y0AA 3W3ZB 4RJLA 4Q1DA 1IAQA 1J90A 2C9OA 1HE1C 4KJZA 2ATWA 3BAFA 2HUPA 4S2EA 4Q9KA 3QVVA 1NMYA 2FNAA 2OCBA 4LPSA 5CIQA 4L8GA 4ZDKA 1VPLA 3FWYA 3LXXA 1HH4A 3PENA 3NBYC 5EE3A 1IY0A 1QVAA 5CK4A 3D6TB 2A5DA 3ETLA 4FCWA 2XTMA 2AR7A 3N70A 3MWKA 5TVKA 2ZYUX 2ZJBA 3T5GA 4EAQA 3TUIC 1VCOA 1KSFX 3D3QA 4TL8A 3U61B 1ZIOA 3OIWA 1P72A 4NXMC 1W0JD 3IQWA 4B48A 1G3RA 3AVUA 2KBEA 3AF4A 3RRNA 2UXCC 3ASZA 2IS6A 1W2GA 1N6OA 1KDOA 1FX0A 1HA3A 1YE8A 1DBSA 2WIAA 3EZ2A 2Q0HA 4QGAA 1ANKA 1KKLA 2F1HA 2ZUBA 3EZFA 5HZHA 1T4GA 4OI0A 1Y3AA 3VHLB 1BMFA 1MABA 3LW7A 1XEXA 3ZZUA 2Q3FA 1BMFD 2ZI5A 1XCMA 4LJ7A 4QM7A 3T1TA 4DV6C 1P61B 2I3BA 4QGFA 3VQTA 1SVMA 4MYUA 1NN1A 2QE7A 3VX4A 2ZS7A 4JVMA 1QHIA 1ZM4A 3NH6A 2ZRDA 2FV8A 1E94E 4DV3C 4RY2A 1Z07A 5CJ2A 3B78A 2IW3A 3IDQA 1OH8A 1W0JA 4JLPA 4MKGA 1NBMA 2AN9A 4JLVA 4Q1AA 4R2HA 4PO9A 2AKYA 2IYXA 1NBMD 3A36A 1CIPA 2UZ3A 1E98A 4ZPXA 4HB4A 2Q3MA 2ZE6A 1CJUC 2UUAC 4WAUA 2VRWA 1ZUHA 2ZM6C 5BYKA 3THYA 5FOSA 4RFSB 4PC2A 4Q4HA 4HYYA 4YMSA 3RRYA 4DWJA 4HZUA 1RRCA 1IY2A 2XXAA 2QENA 4LV5B 1UPTA 5LDDC 1SHZA 2PN2A 2FH5B 4Q00A 2NZJA 3MSXA 4A92A 1NLZA 2JASA 2WWYA 3SZRA 1XPOA 3VU9B 4MKFA 3HPRA 2EW1A 2QN6A 3QKRA 4FMCF 1WBBA 3CX6A 2QGNA 5AJZA 4PQRA 3W6NA 4GOXA 2VP2A 2VLIA 2QRZA 2ZR9A 3KKOA 3K70C 1AZSC 4OHVA 1ZUNB 4UNPA 4Q18A 1NLFA 5EXSA 1Z0IA 1U8AA 2KB0A 1FQKA 4Y0VA 4F91B 4HDOB 5A0FA 3O8RA 1XJQA 5F3WB 3ZVLA 2V9PA 1TADA 3K0AB 2MSCB 4JZKA 4NTZA 2IL1A 4QGHA 4OJQA 4UKDA 4LF7C 3LBHA 1W4AA 5EP2A 4LC0A 2ZJOA 3GFTA 4IJMA 3WYFA 1KO7A 3C5HA 2W2TA 4NYIR 1GRRA 2DFNA 3OF5A 2V6JA 3NH9A 3K9LA 1LF5A 4IXNA 3LDAA 4Q66C 2OCAA 3HU3A 3IHWA 4HDCA 4DLVA 1XD2B 1CJKC 2FPKA 2FZ4A 2BCJQ 4IXMA 1LB1B 4JS0A 4MH0R 3H0KA 1W36B 5B57C 4DV4C 1G5RA 3AKDA 2R6DA 1SGWA 3HU2A 3I5YA 1H65A 4B34A 1XWIA 2BC9A 3AF0A 5EXXA 3GLGA 1N6IA 3EIHA 3GD7A 4GMXA 2J7KA 4U7DA 3SN6A 3QXJA 4LI0A 3KQLA 3K53A 4LJ9A 2XSZD 3PUYA 3ZJYA 3B1ZA 2HV8A 2XZPA 2ZRCA 1OXVA 4P4SB 2F9LA 4US1R 1NSFA 4E5UA 3U3MA 2O52A 2OT3B 4HAVA 1N2FA 5DE3A 3PR1A 4NYIQ 5AUNB 4JV5C 4WXRA 4B35A 5IDVA 3MAAC 3S1AB 4E07A 1SXJE 2FSIA 2ZJZA 4YDSA 2QUZA 1S8FA 2WKRA 2FPMA 2G77B 4IDPA 5A2QD 1IN8A 1OSNA 4D4JA 4HI0E 2AK3A 1EX6A 1G9XA 1LNZA 5E7IA 1N32C 4JBWA 2PZFA 4PC7A 2ANBA 3PUXA 1IXZA 1ZVQA 2ZRFA 4A0HA 3BB4A 4Q21A 2DCUA 1UBFA 1N0WA 4HB2A 1X8KA 2NO0A 3ZD7A 5D3QA 3U6BA 4QL3A 2WWGA 2GHIA 1P2SA 4URVR 2WAXA 5AUOB 4Q9HA 1FNNA 1DAIA 3AKYA 4GDFA 1Y63A 3CRMA 1NNEA 1E1RD 2Q9CA 1J2JA 1Z6YA 2KWIA 3P26A 4NCNA 4FD2A 3GLFA 4LBYA 3GKUA 3RSOA 4LCBA 1EX7A 1E9EA 2C78A 1A7JA 1P2UA 1Q57A 3W8NA 5KSOA 1B0UA 4HB0A 2D7DA 3BFVA 3IGFA 2VHQA 5DYGA 3DL0A 1VIYA 3QNUA 4B6EA 2NOAA 5EXTA 3QUSA 3KB2A 3E1SA 4G5SA 5JZVA 4MTNA 1CR4A 1P9WA 2GZHA 3JVVA 3QIAA 4JSTA 5EUMA 3THXB 2K5UA 2NTYC 3T61A 4AKIA 2XGJA 4B75A 3M4YA 5B30A 2E7GA 4Z1MD 1OKKD 4B3DA 3K9NA 3BXZA 4C0KA 4AY2A 3Q8XB 4ZCIA 1OH5A 1NSTA 1G3UA 3B5JA 1SHKA 3ONWA 2FFQA 4LRWA 3OAAD 3A1TA 5KDLA 4B2IA 4C0LA 2JLQA 3G82C 5CYOA 3N2IA 3SYKA 1Z0KA 1NL3A 1G6OA 5DISB 1QG2A 2BBSA 2IC5A 5E7JA 2OXCA 3CWZA 3UMFA 3Q7QA 1JAHA 1OFHA 2QNRA 4U02A 5C4MA 2CHGA 3BORA 2YNMA 3AKCA 3QKTA 1HUQA 3FDIA 4BRUA 1ZIPA 1M7BA 2IYLD 4HAZA 3CNLA 5DGXA 4K46A 3BH0A 5GJWC 1QF9A 3NVAA 4FINA 2OPLA 1AA9A 3IILA 3KXLA 4D82A 4O3MA 3KTAA 2I1VB 4I1UA 2OSBA 4DJTA 1USPA 1F2UA 1ZCAA 2WMNB 4QGGA 4X8MA 5FLXD 1ZP6A 1T8TA 1E69A 4R71A 4UNSA 4D26A 4QG7A 3IIJA 1WA5A 2ZSAA 4M1KA 1LS1A 4M0LA 2WPDD 3EC1A 4OK3A 5CDFA 1N0UA 4IHQA 1XBTA 2Z4SA 4LGMA 4OL0A 4QNRA 2NO1A 3BH6A 2ZQ5A 1GWNA 3GEHA 5JBQA 3ICEA 3V4FA 5JJKA 4KSBA 4YY3C 2CL0X 3CO5A 1W36C 4Q02A 3B85A 1CS4C 1ZRHA 1XNJA 3T35A 2QSZA 3AP2A 3R9XA 4CEIA 3O8DA 2WJIA 2KSQA 1W1WA 4V0LA 3AF2A 3M0EA 4JVSB 2H7VA 4M1YA 2D3WA 2JLVA 1PLJA 4M1SA 1DAGA 4BFYA 4EPRA 1BO6A 4QRHA 2OEPA 1C1YA 1G7RA 5JSZA 1E96A 2O8DB 4BZPA 1JEDA 1GIAA 1YZLA 3GJ5A 4B74A 4DT1B 1WXQA 2IXGA 1TAGA 1HR0C 1A2KC 1XZQA 1SXJA 1A4RA 3RHFA 3VNUA 1Z6AA 1N5IA 1R5NA 4YMTA 2XNDA 1E1RA 2JLYA 1AIPA 4DB2A 2QAGB 3BC1A 4Q1CA 4WXPA 4V0MA 3UIEA 3VAAA 4D80A 1LFDB 1Z28A 3BIFA 5J4VA 4KVAA 3KQUA 1YRAA 3WP1B 2F4VC 1JAIA 2CEAA 3AKEA 3R7WA 2J0UB 5KOYA 5E3HA 2J46A 1CKEA 1WDTA 4NE2A 2RGGA 3NDPA 4WW0A 2QMHA 4RKFA 2W2XA 1R0YA 1FQJA 3O8BA 3FHCB 4TYWA 2C77A 4Q48A 4RSGA 5HKKD 2J1LA 2BEJA 1RVDA 1E1QD 1E79D 2P65A 4O25A 2BWJA 2AL7A 1HV8A 1ZUIA 4MGYR 4P31A 5DLQC 4D4MA 1W7AA 1DG1G 1OIXA 2JGNA 1T3HA 4QHTA 4NCIA 3QBVA 2Q3HA 3K0FA 1DARA 4DLZA 4C0JA 2RGNA 3IIKA 1T9HA 4TT3D 3GLIA 4JLKA 4IVQA 4JMPA 1M34E 3WMGA 3AV0B 2W6JD 4M9QA 2OFXA 1M7GA 4FW9A 2V3CC 1N25A 3CB4A 5AUPB 1KTVA 1IN7A 2H1LA 5HZKA 2DY1A 4QBIA 4C0SA 2WWFA 3GJ0A 4CT4B 2CL6X 4PC6A 2DPXA 4TLCA 3NEYA 5AR1A 1QHHB 4GL2A 3E2IA 4FMBB 2J0UA 3J81k 1ZAKA 1G8GA 3EPLA 1P60A 4BASA 3PQCA 5JEDA 2FDCA 4RZ3A 4M9ZA 4D0NA 2REOA 4LX0A 4RD3A 3WNCA 3AP3A 3GEIA 1XNQC 1RPZA 4QXAA 2ZJYA 4ZKEA 4JJZA 1S1MA 3AF1A 5E95A 3ZS8A 4PR0A 3I1FA 4LV8B 3ZZTA 5DHAA 1H8ED 4Q9JA 2JLSA 3HYRA 3ZGXA 4P4TA 1GKIA 1DAHA 1U0LA 2D06A 1DAFA 4DLXA 3C16C 2IHYA 4A2QA 4LJ5A 2R6AA 1RKBA 4PHHA 1U8ZA 2EYUA 2O5VA 2VA8A 1JBKA 3GJ8A 4PO1A 2ONFA 1W44A 2JJ2A 5FR2A 4CVNA 3WYGA 5A4JA 3DO6A 4KU4A 4F93B 4IEEA 5DIFA 3CW2A 1NRJB 2GA8A 2R6FA 4DR1C 5L3SB 2YVUA 4DUGD 2O8FB 3FVQA 1YR9A 4M1WA 4HB3A 2XJ4A 2PMDA 2FA9A 3BE4A 1Z5ZA 3NBXX 5EP4A 5GJCA 5FUVA 3WBJA 5K8LA 3MRSA 3EPHA 2ZE8A 1RJ9B 1RE0A 5CJPA 4DSOA 2A30A 4PQFA 1G17A 3CPJB 3FMOB 1KMHA 1Z0DA 5LD2C 3A4LA 4TLBA 2FFHA 3IO3A 521PA 1RRFA 5KPJA 2IUSA 3VKHA 5CB8A 4PQYA 4N3NA 4V03A 4CW7A 4DC9A 4Z51A 1FMLA 3CRRA 1UEIA 3IPXA 2NO7A 3QXHA 4OJKA 2IWHA 1NVVQ 4A1FA 2OPLB 4TQAA 1SXJC 2BBWA 2J59A 4TTRA 1YKSA 4KFUA 1UAAA 4A2PA 2YC4C 3RNLA 2VSOA 2GXAA 2ODNA 4II7A 4C2TA 4DUZC 4Q7KA 2E8CA 2B8TA 2GRJA 3SBDA 2YJTD 3QXCA 2JLWA 2BBTA 4LF5C 2C5LA 3HDTA 3SI7A 1TQ4A 1XPRA 4LJ6A 3DMDA 1G20E 2ZSDA 2A5GA 5TY0A 3B13B 4ZI3A 3F3YA 4BZQA 2ZRHA 4CEHB 4DR4C 1NF3A 2GEVA 5HKKA 2JATA 2YINC 3K0CC 2RGEA 1P2TA 2YOFA 3EARA 3GJ4A 1KAGA 2ZJ5A 3L2OB 4QNMA 4W5HA 2CJWB 4DCNA 1G3MA 1JB1A 1RIFA 4KITB 4A6PA 4IEIA 2X19A 3K8YA 5TARA 3CKLA 5FPYA 4XX2A 4LHYA 1TEXA 1YR7A 1NVVR 2E8FA 4WZ6A 4GPTA 2XAUA 1GNQA 2CBZA 2PEYA 3EASA 4HLUA 4K0KC 4BEBA 3EPKA 2FPLA 5CYPA 3TJZA 1M2OB 3A4MA 4CZ2A 4F38A 2J87A 2QORA 1XJ0A 1ZC4A 3OIVA 2O8CA 2RGCA 1P62B 4EJSA 5IWAC 3QKSA 3SEAA 4PXAA 2R62A 1DEKA 2GTPA 1E0KA 3B1VA 1FJGC 2AHOA 1AGPA 1GTVA 4URYR 2JLUA 4RD2A 1PVOA 2BJWA 2QP9X 2VBCA 1JJVA 4TSFA 4OK5A 3TBKA 4YDHB 1ODFA 3PEYA 1OIWA 3SFZA 3LNCA 2GXSA 4LHZA 2ZVPX 5J5CA 4PZYA 1AZTA 3JZAA 4MH4A 4Q1EA 2DYKA 3UKDA 2CLDX 2ZRGA 1S3SA 2GJ9A 3QPWA 4GP7A 4C30A 2J9RA 1G16A 3TIFA 1XB2A 4P32A 4OI2A 4EFLA 1XJCA 1JQJC 4MRRA 4TL7A 3K0FB 1WMSA 4RD6A 5EE0A 1N36C 1Q22A 2YOHA 4YMVA 2FG5A 1HT2E 1D2EA 2XNDD 4WIAA 4CDGA 4URUR 1XCGB 1WB9A 5TV2A 2WJVA 1G8PA 4R9UC 1VECA 1P6XA 2C98A 5EZ6B 3T1VA 3H4MA 1MO6A 4TMXA 1Z2CA 3T34A 2DFTA 3AUYA 2H17A 4POAA 1K5DA 2FWRA 4X8HA 3PITA 5EZ5A 1G5TA 1VG9B 1SVSA 1ZM7A 3B7GA 4CGZA 3GQBA 4Q19A 2QM8A 4GZLA 1KNXA 3VTKA 3R20A 2ZI4A 1ZMXA 3FKSD 1KI4A 1U9IC 3Q72A 2UUCC 1D9XA 4EJSB 3KJEA 2WJGA 2REXB 4KBFA 3C14C 4Q9LA 1KHTA 3H2YA 2X8AA 2BEKA 1GOTA 3O47A 3B6EA 2MMCA 1L7VC 4AG6A 4PPGA 3X2SA 1A82A 1EESA 4AQYC 3TKLA 4BLRA 2ASEA 3PCRB 4GSYA 3K0CA 3U7EB 4TMTA 1S9HA 4JBXA 4CRWB 4B3TC 1TF5A 2JJ1A 1OJLA 4IDHA 2OXRA 3PJRA 2O8DA 2FF7A 1E2DA 3B9QA 3ZQ6A 1Q44A 3OHMA 1P73A 5BW8A 2N1BA 4DR2C 3LXRA 3HWSA 3K09C 5KU1A 4CEHA 5L3RA 1Z47A 2RHMA 2W6IA 4NONA 4CEJA 2LKDA 2MSEB 4OQLA 1AM4D 3GFPA 2FJUA 3IUYA 1T3SA 2PL3A 2GXQA 1N6KA 1OH7A 1DE0A 2E9SA 1GDDA 4DIDA 3KUDA 5L8VA 3LD9A 4P3YA 1XPUA 2QMEA 4JL6A 2GESA 4LF8C 1I2MA 1PUJA 1DADA 5DSZA 3QKRB 3UANA 5FBWB 1U0HC 3C8UA 1V5WA 4JLDA 4DLTA 1LS6A 1USPB 1CU1A 1F2UB 1XEWY 2EFHB 5AK0A 4LYJA 1YJ5A 1Q1ZA 5HE8A 1KSJA 5FPSA 1GL7A 3AVQA 2IYTA 5LMNC 2FSGA 4B3BA 3O8CA 1W5SA 4DV0C 4DUYC 4B32A 1ELOA 2YV5A 3OEEA 4M9XA 1JEEA 1TQDA 2D62A 4KLZA 4JLBA 5HTKA 4A8JA 4RFSA 3SU8A 4XD7A 4W9MC 1G8HA 4MYTA 4FMDF 2ZI9A 1JR3E 3ZD6A 2ODEA 1X8LA 2VO1A 3T1YC 3OFND 3V4RA 3SJZA 4N0DA 1XXHA 4A4DA 5BWMA 3K09A 4X65C 3NKVA 1UEJA 2IF2A 1SVIA 2GVZC 2UVQA 4QOSA 4DLYA 4FCTA 1ZC3A 3NIBA 5BQ5A 1H8HD 2F43B 1J8MF 2OLJA 3EZ6A 2A5FA 4OX9C 4DR6C 1UBGA 2PT5A 3EG5A 4KFSA 1YZGA 4RD4A 4RKEA 4A82A 4P4UA 4NH0A 4A8JB 3RYTC 3U5ZB 1LTQA 3ASYA 3GLHA 4KYIB 4S35A 3BD9A 3U2QA 5KO2A 1U98A 1KI8A 2ANCA 4YQFA 5JS7A 4FXPA 2IYUA 4QHSA 1ZD8A 2QP4A 4HAYA 5AJYA 5HCNA 2WAYA 3J80D 4Q4JA 1BH2A 4M9SA 2QMUA 1FX0B 2G88A 3NHAA 4V0ME 2JMPA 1K0RA 1I4DD 4AYXA 2GAOA 2VP9A 2CK3D 3LH5A 1FOEB 2J45A 4QJ4A 5DN6A 4JI4C 2HCJB 5EJEA 2Y8EA 2FZLA 3BBPA 4BLTA 2G6BA 3SQXA 1KIMA 3BB3A 2O8BB 2YWHA 2ZREA 5GADl 1HQCA 1E79A 2QRNA 4G5OA 1OXXK 5J4LA 3FYHA 2QTFA 5JI2E 3WP0A 1G291 4B33A 1G18A 5DI3B 3QJYA 3NTUA 2G3YA 1NJGA 2YWFA 1C4OA 4GFDA 3AP1A 3LFUA 3T15A 4MRSA 2BJOA 2D74A 1Z08A 5TXGA 4EPXA 1KAOA 5SZKB 4DEYA 3H84A 2JJ1D 1TQ6A 3REGA 1E2FA 4JSYA 4DLRA 3ADCA 4URZR 1NG1A 2E8EA 2CE7A 2GJSA 2D7CA 5JRJA 1ZNZA 4FWIB 4LHWA 4NPHA 2XEXA 3L0PA 3K0SA 1OKKA 1US8A 4G5QA 4ZV4A 5LD2B 2RHDA 1SKQA 1G7TA 2IEYA 1XZPA 3NEJA 5DH9A 3S1AA 2XZOA 1XNRC 4TL9A 3FHTA 1IM2A 1NIJA 2RH5A 1E9DA 3RANA 4C0BA 5DI9A 3R8FA 1SXJD 1P5ZB 3LA6A 1OXUA 4JYBA 3GP8A 1XTRA 3LQRA 4G3XA 2ONKA 2ZE5A 4BFUA 4C4PA 3QEJA 1HTWA 2HT6A 4C9BA 2WTUA 3K9HA 4I1SA 5FPTA 3R7WB 1II8A 3EERA 3RS7A 4MA4A 1DG3A 1EXMA 1JNYA 1KI6A 2HF8A 3TSWA 4DV1C 1XX6A 2FX3A 1TX4B 5JS8A 5JFGA 5KHOC 3OTOC 2ZRPA 1N5LA 1SZPA 1XCPA 2OV2A 4PTLA 4XJXA 3ZS9A 4LYHA 5IK2D 5JWRA 3W5IA 2QPAA 5BR8C 3ZH9B 1KI9A 5FL3A 1O87A 1L8QA 1X86B 2AWOA 4Q7LA 4C3ZA 1KJWA 3UMRA 2X1VA 4G1UC 5KSYA 4LFCC 3UATA 1HNWC 4TYPA 4IDNA 1US8B 4JVNA 2RKOA 1IBLC 2ZJ2A 3I62A 5F98A 4AI6A 1WCV1 4DIEA 4DT1A 2GILA 2IYZA 1IBMC 1G7CA 1ZU5A 4CEIB 3DZ8A 1R5BA 3I8XA 3OEHD 1D6JA 4HDQB 4DR7C 1SKYE 2J41A 2RAPA 4IOLA 4Z54A 1FUKA 1QWIA 5BN5A 2IEZA 4KFRA 4IDQA 2QG6A 2BMDA 2YOGA 1W4BA 4LPKA 5JWHA 1NLYA 3MD0A 5G3ZA 2CCJA 3FKQA 3KFXA 5M04A 3TR0A 1HE8B 1DO0A 3VFDA 2ERXA 1Q0UA 1BKDR 4TMVA 1KO1A 3AQ4A 4UNNA 4B47A 3KJHA 5DNYB 5HE9A 2NPFA 2O8BA 2AD5A 3SDZA 4JKIA 4LC1A 3U3RA 2VP0A 2X77A 1AN0A 3I8SA 4DB4A 1E2JA 4KCGA 1QHGA 1KI1A 4LY6A 3VU9A 4IRUB 3SJBA 3AGPA 5CK5A 3OE7A 3Q3JB 4I1OA 3V00A 4KHPC 2CNWD 4PHFA 3X1YA 4QBGB 1NP6A 1OXSC 2QTHA 1UM8A 2JA1A 3JZMA 4B3FX 1E0SA 2F1JA 2OFWA 2ZTSA 2OBLA 2ZRJA 3QE0A 2CJWA 1U2RA 4BSZA 1E99A 1KO4A 3K0EA 1P75A 2R44A 1B23P 3A1UA 4NBSA 4BZXA 2GAAA 4JJKA 5H70A 1IXRC 2F43A 1MO3A 3GPLA 5LB4A 2ZRKA 1R0ZA 2G9NA 1G41A 1TMKA 2UXDC 2C9YA 4NZYA 2AWNA 2RGDA 1LW7A 1N5KA 1HNZC 2L0XA 2EFDB 2H16A 3HR8A 1F3OA 2XNSA 1DO2A 1G5PA 4NCKA 2V54A 1Z6TA 2GCNA 4DCVA 3EAQA 4TQ9A 2OFOA 2HF9A 4LF6C 3THXA 4NXNC 1ZD1A 1OV4A 3VR4A 4LJAA 4D6PA 4JYAC 1EFRA 1WH9A 2ZRIA 3IBGA 1EG7A 2XOKA 2QL6A 3ADDA 2FU5C 4UXJA 2HEIA 2WJJA 4TMWA 2IS2A 2ZUDA 2HXYA 1KMHB 2R9VA 3KXKA 3LW8A 4B43A 3GMTA 1HH2P 4F92B 4TLDA 2ZSEA 1RJ9A 2ZPTX 3IBYA 3GLFB 2E5LC 4OQMA 3NXSA 3HR7A 4V0OA 2ZXUA 2GVDC 4IFBA 3TW8B 1QHHA 2O8FA 4E09A 3TSZA 1CRPA 3Q5DA 1ZM3A 1JI0A 4JT2A 3UMSA 3VR6A 5L3SA 4JI7C 3X1WA 3FGNA 4N0EA 1VLAA 3VHXA 1XF9A 5IF9A 2BM0A 3EXAA 1FTNA 1G19A 4H1VA 4DLWA 4AKGA 2F6RA 1XTJA 3P20A 2GF0A 3UG7A 4DDTA 1IQPA 1W4CA 1KDTA 3MJHA 4M2LA 4B76A 5K8IA 1XEWX 1AK2A 3AEZA 3RDPA 3HJNA 1S2MA 5C2JB 4W5JA 1NBME 2ZE7A 1IY1A 4LJ8A 4LF9C 3SFVA 2B6HA 1XMVA 4XIGS 3QOFA 2P0EA 2Q9AA 3FKSA 1WRBA 3AGQA 2D2FA 3OIUA 4O2LA 4ZDJA 2PLFA 3ICQB 2BOVA 1N34C 2A2ZA 821PA 1T8UA 1O3YA 2VHCA 2VHTA 5JECA 2FEMA 1TPZA 5AWFC 1VIAA 3U3OA 3TR5A 1GAJA 1K8RA 1W48A 2ZYTX 3GLGE 4ASUA 2PBRA 5IT9D 5JMTA 3CJEA 1WE2A 1T6NA 1TU3A 2OM2A 2QAGA 1GZSA 4GT1A 2J7PA 3DOEA 4DHEA 2OUKA 1FP7A 1Q1BA 2OCYC 5JEEA 1Z0FA 1ZM2A 4MKIA 2QPTA 4JT4A 1NMXA 2IK8A 2O0HA 4IOKA 1T91A 4WZBE 3SBEA 1GITA 3ZYCA 1D2MA 1FNMA 2C04A 4OBEA 3T1OA 3W9YA 1DAMA 3SJCA 1SXJB 3A1WA 1Z6GA 4JKYA 2JIZD 1N33C 2BBOA 2D2EA 3WHKA 1KY3A 3AVTA 3J81D 1KK1A 3TUZC 1VHLA 4JI8C 4ACAA 3QQ5A 3FFAA 5JSZB 1JR3A 4FMDB 1W49A 2WICA 3C7KA 1BIFA 1MOZA 3CR7A 4ACBA 1E9CA 4HLUC 4BECA 4XWOA 1X6VA 3A4NA 2IYWA 3QPVA 1LVGA 4W5WA 4DDUA 2ERYA 3DZDA 3Q85A 5DI3A 2GCOB 4FN5A 2ODBA 2AXPA 4IVRA 3Q5EA 3GJXC 1Q3HA 1GVNB 2WWWA 1KZ7B 3EZ7A 1E3MA 2QT1A 4BLOA 3KJIA 4O2RA 1KY2A 2ZEJA 5FBLB 1R5OA 4BFVA 4ITRC 2C96A 2IT1A 3UWOA 3WNBA 1XTSA 1F6BA 1N3BA 1G3QA 1MV5A 2P3SA 3GJ6A 3T12A 1IN4A 2AFIE 2WPDA 4QFMA 3CBQA 1PA4A 1R8SA 1U8YA 1E9SA 2PT7A 3DKPA 1OB2A 3MMPA 1EWRA 2AKAB 1VYVA 4E22A 4BUJA 1VG8A 1JALA 4XOIA 2QE7D 5HCIA 2XXAB 2PX0A 3A37A 4JI2C 4HZUB 2XTNA 3GLHB 1MRNA 2ZI7A 2GEDA 3TUJC 3N5CA 4N1AA 4Q4HB 3RS3A 1Z63A 2OG2A 4F4JA 3BERA 2DHRA 1MT0A 1KO8A 3AVYA 4I1VA 4JI0C 2CXXA 4OK6A 2CK3A 3KQKA 2V1XA 4XTCS 3CRQA 5J47A 3BH7A 1XXHB 5G40A 1DS6A 4CYMA 5FH9A 1XTQA 1UDXA 3DDCA 1OLOA 4KV9A 5L3QB 1C9KA 3OAAA 2V1UA 121PA 2GJAA 3SYNA 1OPXA 2V7QD 4XWKA 4DSTA 4IKEA 5CM8B 3GEEA 1G6HA 4Q03A 5FTMA 3FOZA 1XEXB 2KBFA 4G5GA 5J40A 5C4GB 1XRJA 3AVVA 2F7SA 5JWOA 5JI3E 3NBZC 2Z0MA 2ZI3A 3KTAB 5FTJA 2GBLA 5JLJA 3U6KA 1E2GA 1Z6XA 3CH4B 2PX3A 1S9DA 3KX2A 1WF3A 3QXSA 5EUQB 4MRNA 4ZI2A 5DN6D 1ZNWA 3FMPB 3FB4A 4OKSA 3DKVA 4Q4AB 4B44A 1KDRA 2ZR0A 2FE4A 4JBYA 2XOKD 4NKRA 5ANRB 5FBRB 2EQBA 4ZDWA 4B2PA 4D0LB 4O0MA 4EKDA 1COWD 3ADKA 1NYEA 1XFAA 4DLSA 3NC1C 4NYJR 3SOPA 1EFTA 2VPPA 4AG5A 4UJ5A 1IJFA 3WXMA 2N46A 1CJMA 3R8CA 4OHYA 4MITA 2VIIA 3I73A 2F1IA 3L0OA 4IOMA 3TW4A 3BJIC 3H86A 2QY9A 2NGRA 1QHYA 2BJVA 2VTKA 4EPYA 2HYDA 2BMFA 4GP6A 2PJZA 4OYHA 4TTQA 2EVWX 4HSEA 2F3RA 1JPJA 2BIFA 4Q4LA 3ZVNA 4F4IA 2CY1A 3B2EA 2B92A 2XB4A 3VNVA 3FPAA 2V4ZA 3IIMA 4NOZA 1JXMA 2IX3A 1VHTA 1XMQC 3ZVRA 3UG6A 1JR6A 1VYUA 1M7HA 1OFIA 3FE2A 3PUWA 4LK2A 3TGPA 3BS4A 4JLNA 1N5JA 2Z5FA 5EP1A 1NIPA 2B7BA 4M8NE 2OCPA 2VSXA 2OAQ1 2JAQA 1E2NA 1U90A 1E2QA 4NYJQ 5CITA 3EWAA 1G21E 2JJ8A 3TVDA 3W5JA 1A1VA 1GM5A 1R6BX 4MYHA 1GKYA 5FI0B 4NMMA 3VX3A 5K8TA 3RC3A 3H1TA 3BB1A 4NU0A 4CIDA 2VHUA 4KVGA 4UQOA 1EWQA 4AKHA 4LZZA 5CIWA 1KNQA 3T1QA 3X1DA 4XSHA 1I94C 1YZQA 5KPDA 1AJEA 1ZU4A 2X2FA 2P5TB 2QQ0A 1L2FA 3F0TA 2LCFA 1FUUA 3SR0A 5F9HA 2V6IA 4UJ3A 2QA5A 4DCUA 3GLIB 2BDTA 1SULA 2JCSA 5EE5B 2W58A 2JEOA 2ZR7A 2IXEA 4RFVA 5J4HA 2BMEA 4XVRA 5BXQC 5JRZA 2YWEA 1XEFA 3DM5A 3EW9A 3REFA 4GOKA 2PEZA 1N6HA 621PA 4B3SC 4Q1BA 2IHBA 4BGDA 2VQSA 2DYJA 3K0AA 1TF2A 3R9WA 4F7WA 2CVFA 5FI1B 1CBUA 3HP1A 1IOZA 1GL6A 4AIIA 1I4LD 4HUTA 4PC3A 4A2WA 2X2EA 4X66C 4B71A 4EFMA 1UFQA 1F60A 2C2HA 4JLMA 4WZAE 3R9IA 2HDNB 5E7MA 4YMUA 2ZJ8A 2XX3A 3ND9A 2VF7A 3Q9LA 1J8YF 3KDSE 4Q4JB 1RFLA 1T5LA 1Z29A 5G53C 3CIOA 2FFBA 3QG1A 3QKUA 4NP6A 1P9RA 2O0KA 4Q1FA 4PZZA 2WVJA 1XU4A 1V43A 4URXR 3KJGA 4M22A 5KSPA 2RGNC 3VKGA 1DAKA 4IOJA 1P4SA 3P4XA 3LBNA 2F55A 5F9FA 1GNPA 4LJYA 2C03A 4FCVA 1NG9A 1R0WA 1F48A 1NN5A 1ZB9A 2CHQA 2IYYA 3GFOA 4PSVA 4H9GA 4OQNA 2WWXA 2H18A 2WV9A 1QDEA 2QI9C 5IK2A 3A6PC 2Z6VA 3OIYA 2ORVA 1E32A 2KI5A 2GKSA 4TLAA 5EE9A 1KKGA 1II0A 3L43A 4QM6A 3I32A 5J4KA 2Q9BA 1OFUX 4BFWA 3JAMD 1E4YA 3GCGA 4D81A 4YC7A 2PJRA 1MABB 1CEEA 1G3IA 2WWIA 3DHWC 2CCGA 1R0XA 2H8KA 3PV0A 3BRWD 4Q9IA 5FTLA 4NYMR 4HAWA 1UADA 1W0KD 3TE6A 2ZRNA 4DLUA 2XJ9A 4LDJA 5TDHA 3THWA 1DOAA 3EA0A 3WMEA 1YZNA 4ZCMA 2IS1A 2BM1A 3I3SR 3U7HB 2TMKA 2QBYA 2JDID 5B2ZA 5AJWA 3OEHA 2LKCA 2CNWA 1S96A 2XSZA 2FSFA 3B8HA 3RRMA 3PVSA 4AKEA 3WNDA 1AS0A 4XWAA 4M1MA 4GKJC 2CVHA 4Z8YA 3GLIE 5FL7A 2IYRA 1SVKA 4B2LA 1KZGB 1NMZA 1OFTA 1E2LA 3RWMB 4EJSC 2QMOA 5FPHA 3UK6A 3UXMA 2OBNA 4CEJB 1G1MA 3CR8A 2C99A 4Z1MA 3QEOA 2CCKA 1ZW6A 5JCZA 4PPNA 3B9PA 2FGKA 2ZS8A 5FOXA 1XTKA 1Q3TA 1N2CE 1OHHD 1QZXA 1PLLA 3TQCA 1BYIA 4JI1C 4MUAA 3RC8A 3K70D 1N6LA 1QHSA 4NYMQ 1L4YA 5F2EA 421PA 3OZXA 1U0JA 1W47A 2NQ2C 4XTRA 4D4LA 4P0TA 1AGRA 5AJXA 2WBLC 3EIQA 2FEOA 4KI0A 4H1UA 1AKYA 2G0NA 3L8ZA 1EFRD 1IONA 1SQ5A 4PX9A 4PSAA 1J7KA 4G01B 4QHYA 5P21A 3U3KA 5CM9C 1MR3F 2HJVA 3B60A 4RZXA 2AD1A 2GJKA 3SYLA 4AD8A 1W46A 3WY9A 1OYWA 1VTKA 3ZLJA 1YHNA 3LVQE 3HPQA 2ZRAA 3VR1A 1COWA 3NBFA 3PUZA 2WHXA 2XB2A 4B3XA 2IYVA 4KAXA 3SE0A 1T3LA 1NY5A 1X1SA 4GOJA 4GRAA 4US0R 4A8JC 1KJYA 3RRZA 4CT5A 1VKJA 1AQYA 2FFAA 3I72A 2V8OA 2C8VA 2GEUA 1R8QA 4OI4A 5LB2A 5C46F 3EX7C 2J0VA 1VMAA 2V55B 4TZ0A 1MKYA 4LOAA 5LMUC 3MUFA 3OFNA 5KNBA 4DSUA 2R65A 3CM0A 4DR5C 2QEQA 1CXZA 1JR3D 2REBA 4Q7JB 1UBCA 4ZKDA 4MDFA 1OXTA 4Q5IA 4EIWA 1IXSB 1FFHA 4YLGA 3K1JA 2ZITA 5AJVB 2IBMA 2DWOA 1MRSA 3EPJA 3U4QA 1XMJA 3LBIA 5DO9A 1YR8A 3T1HC 3G5UA 4K81B 3X1ZA 4DKXA 4A15A 1KJZA 3M1IA 1ZD9A 3E5HA 4XSGA 2F3TA 1JQLB 2V7QA 3NC0C 1X8JA 1JPNA 4RCYA 2VQFC 3ZVMA 2GK6A 2QGZA 4DRZA 1P7CA 2QTVB 5HR5A 4MQBA 1E6CA 4DV5C 3C15C 5AUQA 1F2TB 3QKSB 2HJGA 1HY3A 2ZS9A 3MCAA 3QY0A 1HYQA 2QZ4A 3D8BA 2O8CB 1KYIA 4LHXA 4PZLA 4WBSA 2NPIA 1DVRA 1ZNYA 4TN1A 1W0KA 4M4SA 4TL6A 4ZDIA 1ZCBA 1VYTA 1TEVA 3IQXA 2CLSA 1GRNA 1KK0A 1PZNA 2UXBC 4QBFA 1Z83A 3LUSA 1XD2A 5H68A 4LBVA 1CTQA 2BVNA 1T0HB 2YZ2A 3WRXC 2D7VA 1G7SA 2WJYA 4TMKA 2ZJAA 5D3MB 3AM1A 2IF0A 5JJLA 1YZUA 3LWNA 1G4AE 3PFIA 2Z4RA 3PIRA 4LBZA 4GI7A 4X8LA 3GLHE 1E2HA 2PZGA 4RCZA 1AKEA 1K5GA 2BCGY 4EPWA 1N6PA 2W0SA 2W6JA 3CWQA 1E0JA 1IBKC 1QG4A 4WA7A 2ZAOA 1ZB8A 2MSDB 4TT3A 1QRAA 1TUIA 3DVLA 2VF8A 4A6XA 3CUEF 1X1RA 2PCLA 2QM7A 4FI3C 3W3AA 3MLEA 4D4KA 4YXWD 2W2VA 2ZRBA 4PHGA 1A2BA 4QBHA 4JYCA 2A7QA 3TNFA 1PV4A 2IS4A 3PEWA 3D7MA 1RRPA 4PC1A 1SVWA 4EQ6B 5G41A 1EFUA 2Q21A 3HU1A 4JLAA 4DDVA 3RWOA 4MRPA 1WBDA 2QL8A 4KBGA 3CF0A 4BLQA 4DUGA 1OIVA 2WMOB 2JIZA 4A0RA 3C5CA 1AS3A 4RD1A 3QXXA 4ZIRB 5JHHB 1W5TA 4BLPA 3F5FA 5C18A 2A9KA 3PEUA 5H1YA 3DEFA 3EIEA 2EFGA 5SZHB 5EQTA 4M1OA 4BRWA 5B64A 4ZIRA 1KSHA 1N6NA 1VG1A 3BOSA 1XD9A 3BGWA 3U3JA 1HT1E 1UKVY 3IHLA 4IDOA 1AQUA 1OT3A 1J70A 2XITA 1D9ZA 2H92A 4ABYA 1CR1A 3FMIA 4BEJA 5EXPA 2J5XA 2JDIA 3UPUA 1XXHE 2ZROA 2G1JA 3LX5A 1GRQA 4TSFD 1MO4A 4US2R 3LQQA 2C9CA 4DXAA 3CH5A 3RS5A 2YKGA 1YZTA 2BKUA 1FZQA 2E1RA 1JECA 3QF7A 2WOOA
chains in the Genus database with same CATH superfamily
5IDWA 1QCZA 2Z43A 2HLDD 2IDJA 5BYJA 1HQKA 2XMCA 4DNFA 5SZIA 3SS7X 1ZEJA 4XYMA 2C5EA 2Y66A 1NNUA 3V8MA 4KQ2A 4L3VA 3CB2A 3VJLA 2JIMA 4EAAA 2P6NA 2JBAA 4R98A 4ZTZB 1TLLA 4DE5A 4PFSA 1XZLA 5K3CA 2XTJA 3QVOA 3CLSC 2ZAMA 2OO4A 2UZ0A 3L18A 1ZG3A 1II9A 1TNDA 4XIFA 2IBTA 1T36B 3OU7A 1VL5A 3AKZA 4LQCA 4J1TA 2I3AA 4L9SA 1V16B 2RGAA 2P68A 1RAFA 1U2PA 2XTZA 2RH4A 4UMFA 2CLHB 1NFQA 4URVR 3EEBA 3LP5A 1N6RA 1OJ7A 2BR5A 5AOAA 5J2TF 4B3HA 6Q21A 3ZDCA 1CUBA 4RV9A 3NIGB 1OC2A 3EC7A 1UBEA 4BL5A 3PEVA 3CLSD 4MCAA 4ZT4A 4BFZA 5C3MA 5EE1A 2QVZX 2HXSA 2IXFA 4JLWA 4MSUA 4ZI5A 1Z2AA 3QQPA 4NK5A 3HGTA 4CLEA 2QAGC 5BN3A 4DV0B 2YVLA 4WFJA 1QM5A 1F2TA 5B58C 5KS2A 1H05A 4DVGA 1QTQA 1U2GA 5JNUA 3ES9A 5A62A 5TEVA 5K45A 5CLQA 5A5GA 1X3SA 2M9MA 3HMKA 3GFRA 4J16C 1MJNA 4P33A 3R0QA 2OB1A 4PFKA 4RVGA 4TTTS 4URFA 3B48A 2BTOA 1IATA 4W99A 4WY5A 5HIJA 1GSIA 5BNWA 4CF7A 4F4CA 3CX7A 4TLEA 3DONA 1OH6A 1XDZA 4DV7C 3RROA 1E6UA 2J5RA 3HY6A 3CEPB 3C1AA 5AI9A 1NF2A 3ER9A 3C6MA 3VC1A 1SUDA 3DE3X 1Z12A 4FEGA 3PC3A 4V1CB 1NXPA 2ZVQX 4NEGA 4P4SA 4RY9A 4GQBA 3TMAA 1LDMA 4H3VA 5BPFA 5ALQA 5KSZA 1M34B 2FPGA 2PIAA 4DJ5X 2BKEA 4UBMA 4AWXA 1VEHA 1RW4A 4BVHA 2FDXA 1G2IA 3BZBA 3M5DA 2GWHA 1X7DA 5KBYA 3W2EA 3F71A 2BGLA 4XI9A 2OORA 2OMKA 2XMDA 3BVPA 4PWYA 3GRUA 4W1QA 2MCQA 4JI6C 4L9AA 3GLGB 1F8YA 3SHOA 4ML3A 3SJUA 1YFLA 4JFRA 2F64A 5KI6A 3BSYA 4AJNA 2I9PA 4MR9A 1NYQA 3TRDA 5HJ7A 1ECLA 5A02A 5A4IS 1E2MA 3IDFA 4V3BA 4YQZA 3FYUA 4YAWA 1ES9A 2GNOA 3KXDA 4ZODA 2P5SA 2DQZA 3WBKA 3IEVA 1EHYA 4E31A 1B73A 2RGBA 2FMXA 3SIPA 3VYTB 1E2EA 1Z82A 2YJZA 2VUHB 3QEBZ 4BJ3A 1VQ1A 2X0JA 4DMGA 1M8JA 4IDCA 4LJ4A 2G9VA 4V02A 4QJ3A 3EG9B 4P6VF 1EGHA 4BQSA 4WVFA 1YR6A 3OZBA 1KQ3A 2C5SA 1U81A 5J9FA 1RQGA 1P4AA 3DFUA 4NR0A 4AK9A 1UDRA 2V6FA 1UKZA 1E2PA 4HNGA 4RHYA 2F3UA 1T0JB 5DBFA 1E3LA 5ULLA 1PEYA 2X1HA 4ASUD 1QX3A 1RXVA 4NHOA 1Z8FA 1D8AA 4PPFA 1RADA 4TLLB 1M2KA 1P9NA 1DWQA 2NZ8A 4EO4A 1C8VB 3QWFA 3BK7A 3R5KA 2I6TA 4AXXA 1EK5A 3AH8A 2ZBFA 3NORA 4UCFA 4H7IA 5FFMA 4XH9B 1ZVKA 4WZZA 3KPYA 4H3KB 3CFYA 4BVBA 2OB2A 3GMIA 5AVJA 5JSYA 1R9JA 5BOSA 3C1TA 4HC4A 4RZIA 5CNIA 2BH2A 2CUZA 3V7YA 1N78A 4TKMA 5I7OA 4GYKA 3L0CA 1MLDA 3QZUA 3QKWA 3ZY5A 5CB6A 2VQEB 2IYFA 5AVXA 5CHYA 1A4UA 4GF5A 1LH0A 2BF4A 5DHSA 2CC2A 1UXKA 2OO7A 3LDUA 4REQA 3P27A 3VI3B 5BV1A 4MAFA 5EERA 5JJIA 2OZLA 4IAOA 3L0SA 2V03A 4AURA 1MC8A 2JGKA 2BFBA 4WFQA 1YQEA 3RT7A 4KG7A 1WX1A 2ATXA 2XKAA 3TINA 1UL1X 1P33A 3IKJA 1U3GA 1VFPA 2GZ3A 4KE9A 2M32A 2WM9B 1TM2A 2P7HA 2R7KA 5EJ8A 4WKPA 3AR4A 1NONA 3PC8A 4CM4B 4C2AA 4PNEA 3HXQA 4U00A 1HNXC 1Z8DA 5C81A 4M36A 4ODIA 3CCCA 2QT0A 2PUAA 1KFJB 3X1XA 3DCJA 3ZIAA 2B8WA 4I8XA 3T1HB 1H8HA 2WT8A 1RG9A 2NX2A 4G1CA 3ANLA 3EDQA 4EJ2A 1Z0AA 2WNIA 1DXHA 3O1JC 2P2ZA 3LCUA 4QKQA 2H57A 3OO1A 5LLTA 4UCQA 1FMJA 3FOWA 4FR5A 2NG1A 4AVYA 4Z9YA 1SCJA 1ML8A 3HJGA 1IBKB 3H5AA 4O4HA 3RAPR 3JX9A 3TH5A 1IMJA 1MO5A 1NU8A 3AIMA 4F86A 5KUTA 2VQDA 5AJHA 3RFTA 4Q1VA 3AHFA 3TTWA 5K8UA 2NMVA 3F7TA 5IJWA 2FLVA 4NOMA 2O7RA 3MJTA 4LE2A 1IB6A 2VRBA 1G66A 1ZIDA 2AJBA 3NHBA 3QOYA 4JN6B 4L57A 1D7OA 4E5VA 4LTDA 3EQ7A 3QSYA 2XGSA 5IHPA 3HKBB 3I2GA 3JQ7B 3GBSA 3OG9A 4CLOA 2CB9A 3U31A 5ICSA 1E63A 4D6XA 1SWVA 3WJAA 5A06A 5ADWA 4HAXA 1BNCA 2FF5A 3A0UA 1C30A 1GUYA 4W8OA 3NCHA 4I4CA 4RM3A 1ST3A 2HA6A 3LT2A 1WCIB 3HFSA 4QC2A 4BVFA 2GCIA 3B1KA 1SA0B 2H0AA 3NUGA 1VCMA 3O8NA 3P9IA 4PLPA 4RGBA 1G1AA 1NN3A 2HDOA 4I4LA 4D44A 1X1TA 1KE2A 2K7ZA 2NYVA 2I76A 1HEIA 1QCDA 4BV3A 3PGKA 1F5NA 3TAUA 3DDZX 5JDIC 1KSGA 4C89A 1GFIA 1A69A 1JV2B 3EH2A 3TJMA 2F00A 4QOIA 2WUDA 4EB6A 1TL7C 1Y8ZA 1WKBA 1TC1A 4YRBA 5MHTA 5CVVA 2DKFA 3TK1A 1QGYA 2HRDA 3SICE 4MW1A 4PYQA 1X7HA 1IQUA 3DHYA 5GOZA 3AQIA 3C7AA 3VYWA 2CXCA 5E9AA 4BLVA 3ADBA 2CSXA 1C2YA 1U8FO 2HCBA 3WSWA 3QELB 4J03A 3I6ZA 3VI4B 4BP9A 4FKZA 3DVAB 3TZBA 4B0OA 221PA 2P5YA 3RSZA 1U2QA 4FDUA 4GWLA 2COKA 2PGLA 1U99A 4DCJA 1BOFA 1QTNA 1V96A 2C7VA 2JH9A 1ZJ4A 2Y2VA 3AFMA 5ADZA 4NS4A 4TTJA 3I92A 4G6ZA 4H1WA 1XCLA 4BNDA 3FBGA 4LV6A 1ADFA 1KL7A 1ABFA 2PVPA 4U7HA 3ZV5A 1V2GA 5CFQA 4CKEA 3T4EA 3ZPXA 1PS9A 4QOEA 1Z35A 2ZRMA 3C5EA 1PZMA 4EW2A 5CDFE 1J25A 1AKQA 4ESVA 1LQLA 3W2GA 1J9ZA 1E5VA 3M6AA 1OE0A 2B1RA 3U26A 3LVBA 1K1EA 1VCIA 4OB7A 2G4VA 4B73A 2FI1A 4X7RA 1U6KA 2NO6A 2R00C 3H2SA 5LDHA 1FW6A 1RWNA 2X7HA 4XWWA 2JG3A 4NNOA 1DDGA 2VJMB 2KE5A 1CPYA 1OHHA 3QENA 1CJVC 3KOOA 1ZGAA 3O8QA 4BE7B 1U2DC 4CJXA 2FWNA 2NTNA 5F9MA 5LOVA 4LSGA 2PQMA 1PL6A 2V65A 4GGPA 1Z36A 4I99A 4G4IA 4N7JA 1NVWQ 4ND6A 1XSEA 3LLUA 4XGRA 2ZCUA 4B6FA 5LN1A 1P7PA 1KWKA 4A0GA 4FUQA 3H05A 1W35A 2HHCA 3GJ3A 3W34A 1QP8A 5FQOA 3IQIX 4HPWA 2DMRA 2G1UA 2W2KA 3KKQA 4FIDA 4P7BA 4YCAA 1IUPA 4DV2C 1K2VN 1ZM9A 2BFWA 2IYOA 4J0QA 4YJKA 3V4PB 4MXDA 4D0GA 4LZOA 2IIBA 4MPRA 4ERNA 1B42A 4UM9D 2SBTA 4X54A 1KI3A 4BVLA 4M7OA 4B3MB 4AQDA 2I2BA 1GU7A 3PJGA 5J2UA 3H18A 1D6MA 1P1KA 4Q3BA 1IZ9A 1MH1A 5BSHA 3HDQA 1XRPA 2JFZA 1NMEA 1G8JA 2I66A 3JQGB 3KB1A 3J7TA 3PE6A 4QPPA 5KVVA 2J3EA 3RYIB 2UVPA 4XASA 2YXBA 1Y1RA 5FNZA 2W90A 4QREA 5HFAA 3COJA 3NDJA 1HYGA 1I7DA 2G36A 3K72B 3LNTA 2YNMD 1YQTA 4OOEA 4Y1RB 1P1RA 4G67A 2M6SA 2QJWA 4DQUA 5JNLA 4CFZA 1JH8A 2X40A 4MIEA 3QG5A 1Y3DE 2CHEA 4BWYA 2BDUA 4I6GA 4PTYA 2G63A 5KDDA 3OJEA 4RQBA 2CWWA 3P71T 2HU2A 2JD2A 4L16A 1S1CA 4U7WA 2C4TA 2CHVA 3DOIA 4F84A 4LF9B 3HBAA 1IHPA 1AKRA 1T2NA 2WINI 1I0LA 3GUCA 1FSFA 1DG9A 3BMCA 3JATA 3P1JA 3R3HA 4B84A 2R8ZA 5KQSA 1Z33A 2IOFA 1IN6A 3AONB 2ONJA 3P2OA 2H4ZA 3NW9A 1OA0A 3O8LA 3UFXB 4MP8A 1IG3A 1MB4A 5CGZA 3DV9A 2NIPA 2FOLA 1CQJB 4NMHA 5CX1B 4DXDA 5IAAA 1IXYA 3O8OB 4PFJA 2XE6A 1U1EA 3P0HA 4KO2S 4Y9TA 2QHXA 1LCIA 4LGYA 3TCKA 3PXUA 5EKTA 1V26A 3BMOB 3TSOA 4C5BA 3I9V1 3NEPX 4ZOLB 1PW7A 4FKMA 3E9QA 3GR0A 1XD8A 4N49A 3FA2A 3DBRB 3KOWA 5L3QA 2I8CA 4PSDA 4NCHA 1I2BA 3RVRA 1LLCA 3OPXA 2IUUA 1XELA 4KBYA 4D2IA 2HNBA 2R6CA 3WDSA 4DYDA 4Z8XA 4A23A 3GAAA 1Q0QA 3UFXA 2IRWA 2MINA 6YASA 4GZMA 3QMPA 4Y9UA 1XZJA 1GGFA 3R3XA 4LFAC 4I3HA 4D8WA 3CX8A 4UTZA 4UU0A 3S70A 3SE7A 4D56A 1O89A 2NU7B 2V6MA 5A9TA 3MPOA 3WMWA 2O8EA 1WXXA 4KXFB 4E2FA 1EE2A 1GA4A 2JVJA 3AB8A 1JYSA 5D00A 1NFFA 3RSQA 4K6GA 1BOOA 1CUYA 4HRVA 2GZDA 5D5HA 1ZEMA 1T29A 2KZFA 4D4GA 2V96A 1S8OA 1I51A 2JLRA 2BY4A 3JR3A 3WIVA 2ZYDA 3BSSA 4QEDA 3GRRA 4RKQA 4GRDA 3IAHA 3VKWA 4G9EA 4OHXA 1CP2A 2WSMA 3E9NA 3I1IA 4IWXA 3RJ9A 3PXGA 3IEUA 4A0FA 5HKBA 4JI5C 1DXYA 1NJFA 4LWZA 1O0CA 3AVXA 3X0DA 4H3HB 5HF5A 1IUNA 2OZPA 2JB9A 3NHFA 4HWSA 2ZETA 3EQ2A 2CLCX 3AM3A 3GGDA 4N7BA 5IVIA 3OFSA 5LPNA 4PYRA 2Q4TA 1PR6A 1RRMA 3A1VA 2B1GA 5FBZA 5JHGB 2VK4A 1QH1A 3I4LA 2W98A 2FZWA 1ESNA 4P5EA 4YQEA 2ZANA 1DKRA 4KMRA 4BKQA 4EA8A 4FGJA 4M53A 4N0MA 2J7PD 2GB4A 4RJTA 2ZTUA 1CLUA 1NVKA 1PEDA 3RW9A 4P7GA 3EXEB 4AY5A 1ZJYA 5BNTA 4FE3A 5H80A 1PDVA 1W581 1CRLA 5E2AA 5JQWA 1I2DA 1ICIA 4YCMA 4XR9A 1ACLA 3I9MA 2EWWA 3H2BA 5J59A 4E6EA 2C4NA 1RXUA 1W29A 1E6EA 1S0UA 1TM7E 2AF3C 4NL4H 2D4HA 2VPYA 1N2IA 1R4NA 1DLIA 1EVIA 2DBVO 4MLDA 5A2QA 5MDHA 2HSDA 1MXHA 5G2OA 4B3RC 3IKLA 2ZIAA 1YVDA 4X97A 1Q21A 2OILA 3R6LA 4ES6A 4AUEA 1VKZA 4JI3C 4RZHA 1TZ2A 2W5UA 4H59A 1XK7A 4KDRA 2VSFA 2AOVA 2IWRA 1G5QA 1BJRE 4KTVA 2O2XA 3DGFC 4GLOA 1NXOA 2XW6A 4TT8A 4BO8A 1NWCA 1JVNA 4PQGA 4XD7D 3L95X 1ZOLA 3KAPA 1I4EB 2RCNA 2OKGA 3N6VA 4AYTA 3F5QA 1NKTA 1OWNA 2B4YA 4KLRA 3E6AA 3TLXA 2A4KA 2PL5A 3NRBA 5M2QA 1QRUA 4HDKB 4YAIA 2FAXA 2DJIA 2P2LA 4WXMA 5EI5A 4PS1A 2I87A 3FTDA 5JO0A 3E1GA 2ETVA 2JD0A 1RPNA 3VO9A 4YIKA 3HNPA 2ZB7A 4S24A 1RRGA 4CKEB 1L7NA 5H3HA 4ZCPA 3CPEA 4CIVA 1IQ0A 2A94A 4R1PA 1RD4A 1FL9A 4W4TA 3I61A 1G64A 1NVXQ 1QIDA 4B1FA 1AH2A 3IPYA 3N2GB 3GUHA 4OJYA 4YONB 1EUCB 1KKMA 4TYYA 4G5RA 5LBIA 1RIIA 3G85A 1G8FA 1MX9A 1EP9A 1SVLA 4KQWA 1CULC 3R5SA 4LZLA 2J3MA 2LW7A 4ZZ0A 2YWCA 1G6Q1 4HGQA 4LECA 1YDFA 3LY8A 3AWIA 1KIFA 3U7FB 1EB8A 1K86A 1TC2A 2Q3BA 3W3ZB 4Q1DA 4J0JA 2NO5A 4K6MA 3WGVA 2XWQA 3EGDA 1GUZA 3SKXA 1HE1C 1DBPA 1HDIA 5CEFA 3EQZA 3M4JA 2QF7A 1TK3A 2HUPA 2ZGVA 4Q3CA 2GLTA 2KPOA 4MQ4A 1JMYA 4ZDKA 2NZUG 2G40A 3FWYA 3R0IA 2NU8B 5HOQA 5ILOA 4CV2A 1PK9A 1NVDA 2OY0A 4HO1X 4EVRA 5AW7A 4IWNA 2K2QB 4Z4EA 1MEJA 1V25A 3NBYC 5AI0A 1IY0A 4J16A 5CK4A 4QG3A 1EA5A 4MROA 1J1IA 3G2LA 2AR7A 4ROSA 3SIWA 4A8PA 2D1TA 2AFVA 1KAMA 3MWKA 2FSSA 2Q3LA 3DFZA 4IIXA 4QD3A 1VCOA 2P4SA 1TZKA 5A9SA 1P72A 2XKBA 4O02B 1BGXT 4BY9E 3AVUA 2KBEA 3RTCA 3WG9A 3COPA 3UGTA 3Q7TA 2IS6A 1N6OA 3F3MA 4JJ4A 1HDYA 2HWYA 5B36A 3K15A 1BA2A 3EZ2A 5KOIA 1UDAA 1ANKA 1GSHA 1ZN7A 2F1HA 2ZUBA 3MELA 3O31A 5AQ1A 1XLTA 4A6EA 3LW7A 5B7GA 3C6QA 3A9WA 1BCSB 1EE9A 1EA7A 2AE2A 1XCMA 3UPDA 5TJHA 3T1TA 3AUJB 2ADFA 3FIUA 4COKA 3PXBA 2X9VA 4CF6A 3S7ZA 5CVUA 1AY0A 4C4TA 2VK2A 4JVMA 3L1HA 5HZMA 3VO8A 3BFJA 3PDJA 4XCXA 5EWMB 4BNNA 4DV3C 4D8VA 4R31A 2IW3A 3SEZA 3D4LA 4MS1B 1NBMA 1HM5A 5JMPA 2PRIA 1B8NA 3LWBA 4OIFA 5T57A 2FMKA 4RL4A 2UZ3A 3C6YA 5E1BA 2YQ5A 4EI9A 2JIOA 1J07A 5H59A 5H82A 5CXQA 2CMDA 2WF5A 3GL9A 4M46A 3ANSA 3D3KA 1VGRA 2MYTA 4WAUA 2VRWA 1GQYA 3RLIA 4CM8B 2QJOA 4IS3A 4QU9A 3W6ZA 1VP9A 4IIGA 3VR6D 2NVWA 4RFSB 4F72A 1VI2A 3DOHA 4IX9A 1GVHA 2G5TA 3KTFA 1D7AA 1Q7BA 4PTZA 2AZTA 1PD1A 4HZUA 3DBVO 1RRCA 4ZCSA 4ZZ1A 5A4KA 2QENA 2WIFA 2R8XA 5J43A 5DASA 5F51A 3GT3A 1JEYB 1LZLA 1XA4A 4WKGA 1OI3A 4CR6A 5ALKA 3QTTA 1U3UA 4TS3A 1OAKA 1USIA 3C6BA 2WTEA 4MKFA 2F3PA 4CQLA 2FZKA 2EW1A 3G1TA 4BZZA 4DTIA 4B7CA 1UWCA 3IAFA 2FJ0A 5K05A 2VP2A 5FWAA 1EIZA 5FLYA 3SM9A 1B2LA 2B5VA 4EX6A 4OHBA 3L4BA 3IP8A 4Q18A 5EXSA 3PVZA 4Y0VA 3ZW8A 5JAZA 4AIRA 3SVLA 3O8RA 2XA9A 1Z4LA 3E7FA 3LBYA 1MX3A 1JQKA 3I64A 2IL1A 3RV3A 2ZIFA 5IVDA 2YUIA 2XNJA 5DM2A 1W4AA 1QH8A 4LC0A 5K3FB 3FSRA 4S04A 1PQWA 3JSAA 3VC7A 5GWXA 4J4BA 3GAMA 5I9TA 3BWXA 4B6QA 4M49A 1TEZA 2Q50A 3QLTA 4TV8A 2IH4A 4MMYB 2X0KA 3EB9A 3P0IA 2Q49A 2AB0A 1LF5A 3B3FA 3LDAA 4IXNA 4MR8B 4Q6WA 2OCAA 3IHWA 1VJ0A 2TSYB 3NAMA 5D6OA 2UYHA 1NPDA 2P2BA 2FPKA 2P41A 1T9GR 2QZ9A 3ROFA 1GXSB 4NCAA 5HTOA 2FZ4A 2VCHA 2BCJQ 2EJCA 2GZRA 2A9FA 2IELA 2ZZNA 1RQNA 2ALJA 3VGPA 4JYAB 3ABIA 1W36B 1SO8A 4RORA 4DV4C 1R16A 2D2VA 3KQYA 3AKDA 2R6DA 1NC1A 4PRZA 2RC5A 4B34A 2BC9A 3VSCA 4OBXA 2W6PA 4AZ0A 1PZHA 1EXWA 5BURA 1Q74A 2ECFA 3IH5A 1SBTA 3GLGA 1J5PA 1XYYA 1WDMA 5J2TA 1N6IA 2QR5A 1NOJA 1P5FA 3PSHA 1EINA 4OYYA 4YX9A 5CDFA 4D9IA 3LE8A 3P9ZA 4LI0A 1KHHA 1YBHA 3A1EA 5C1PA 1HO3A 1RLMA 1TW3A 2XZPA 2EFYA 1QVZA 2I6XA 2LR0A 4P4SB 1MNAA 4JQCA 1NSFA 2P62A 3DT8A 2ZQYA 3OMWA 5I47A 2OT3B 3CLUD 4R9RA 2FN3A 2ZVJA 1N2FA 5DE3A 4DAOA 3KOYA 2A8YA 2XDQB 3PR1A 2PX6A 2HA2A 5I7HA 4B35A 3G7NA 4GLFA 2PXCA 2ZJZA 2QUZA 4IDPA 1O9HA 2G77B 4D4JA 2AUNA 1Y6FA 1CQIB 2HK8A 3ZYZA 1XHJA 2QL7A 4ZVRA 2PFKA 1LNZA 2XY4A 4GYJA 3JQQA 1CY8A 5BVGA 1P8JA 3PUXA 1EFPB 4E08A 1GQFA 1ADGA 4AJ2A 3OSZA 1RQPA 4OQDA 3BB4A 4BNTA 2HIGA 4F4HA 4RTOA 2I4MA 1RLIA 1CFJA 4UHJA 1UBFA 5BO5A 8MHTA 3ZY6A 1A1SA 5JSKA 1K9VF 5CT9A 4DILA 3UMYA 3ZD7A 3HO6A 4OUKX 3PC2A 4I9NA 1CHDA 1OYOA 1P2SA 1NDQA 3NKLA 1R8JA 3VR4D 4ER7A 1DAIA 4KLCA 3ROXA 1KQOA 4MP3A 1A3CA 2A1TS 4UUAA 4ZVSA 4DIBA 4OFXA 1R9NA 2FOIA 1PJZA 1P91A 1AHHA 4WEOA 1J2JA 3PWSA 4HH4A 3KE8A 1Z6YA 4FFSA 3LYAA 4NCNA 3MCVA 3F97A 1EJBA 3OCCA 3GLFA 1YRQA 3GKUA 1NXVA 1X92A 1Z7GA 1QIFA 4PLVA 5WRFA 5K6AC 4B3TB 5BSUA 1RWVA 2C78A 1A7JA 1C14A 3N6XA 4L5CA 1L8XA 5C4IA 5KSOA 1GTRA 2D7DA 1Y3IA 2W8ZA 4X6YA 4EI2A 4KPEC 2AMFA 5IH7A 3BIWA 3FNFA 4IQ0A 5K8CA 3GCDA 4P1ZA 4JWKA 4IR7A 1E60A 3DUWA 4JU9A 1VIYA 4P93A 4YLYA 3E3LA 1GJRA 4MGEA 5EXTA 1JB9A 4CKYA 5I9IA 3DD1A 3E1SA 2G06A 1G9TA 3D8NA 1CR4A 5JZVA 4AKIA 4BBAA 1RWQA 2K5UA 3T61A 4CHGA 3JVEA 5KNDD 4QTZA 3UJNA 2XH8A 4AJLA 1FUYB 5BRNA 2LIVA 4ALLA 1P7YA 4ZHQB 5C52B 4UM7A 5A7GA 3R6DA 4RELA 4Z4QA 2Z1NA 4AY2A 4MPDA 1RJEA 4RANA 1G5IA 3NDRA 1E3IA 3DTVD 1MW9X 5KDLA 4C0LA 1BN7A 2JLQA 1F8UA 1JQDA 3OLQA 1W8IA 1UDBA 1AX9A 1QYRA 3WIUA 5TQJA 5IAEA 1VOTA 2SKCA 3E4CA 3UMFA 1NAHA 5BXYA 1BQ4A 4YRDA 2WHRA 4JX9A 5IT0A 5BT9A 2CHGA 4G09A 3KUUA 3NAGA 2YNMA 2VEOA 3KYDB 5CVEA 5DX1A 1XCJA 2MU1A 2FCRA 3EXHC 2HAEA 2I99A 5DGXA 2GBPA 3CLTD 3W0LB 3C5WP 4FD3A 1N2HA 4B31A 4XEHA 2ACEA 2ZDGA 3PC6A 3A4IA 2PNFA 3VOTA 5C32A 4O3MA 1WD5A 3JAMA 1YVPA 4DJTA 1X7GA 1F2UA 3HWWA 3IMGA 3KOMA 4AJOA 4ZN6A 1YBVA 3G2JA 3WIOA 2C07A 3OQMA 2ZDQA 2PKQP 5FLXD 5KYWA 2C2OA 1T8TA 1E69A 4UNSA 1V9CA 4CLDA 3SX4A 2WPDD 4J2HA 4PZPA 3I83A 1XZBA 5IUNC 1Y98A 1XBTA 5FD8A 2AYYA 3ORFA 1UZAA 2NO1A 4J7AA 1GWNA 4GOOD 4KIGA 4MOWA 1Z0ZA 3OLYA 4KSBA 2CL0X 2II6A 3SC2B 1GAQA 1BDHA 4OM7A 1W36C 3L79A 4Q02A 3B85A 3N3BC 2X4LA 2WD7A 1KVRA 1RI4A 1U80A 1W6UA 4M0DA 3RYCA 3LHDA 4NEHB 4RSHA 1PE0A 2WJIA 2KSQA 1C4KA 3FRHA 1C81A 3GK3A 2PGDA 2VPTA 1ZXLA 4KQGA 4JC5A 4I4TA 4Q9NA 3GRZA 2H7VA 1JDSA 1PLJA 1CYEA 4OSEA 4RK7A 1NDUA 2X8JB 3GUVA 3JW8A 1PEAA 4YXFA 4WXYB 2FWJA 1VLJA 1W5FA 5LA6A 5JRDS 2B4TO 4K9DA 3A0RB 4P92A 2XCRB 1JEDA 3OO0A 1GIAA 1YZLA 3GJ5A 2MM9A 4LE5A 1V1RB 4XM2A 5DYNA 1U8UA 1VJ5A 2IXGA 3BGIA 4UASA 3RIEA 4DT1B 2EP5A 1TAGA 1ODJA 4D02A 4NDAA 2RK4A 3OJXA 4J3NA 1Z6AA 3FPKA 1KRWA 3IP7A 1NOIA 2V7EA 4UNIA 1RU3A 1X7ZB 2W6OA 1E1RA 3HU5A 4I9UA 4ND4A 5EGSA 3UQZA 3I01A 3IS3A 2QJFA 2ON6A 4B5KA 3HQ4O 5JDIA 3WIBA 3BC1A 3UIEA 2WQ6A 3D6MA 3AJEA 1WMEA 3AERB 4KVAA 2ZBUA 3KQUA 1MIOA 3ZCUA 3DE2X 4GPEA 2CEAA 1DFHA 3R7WA 4AM8A 2O1WA 1UBJS 4IG4A 2J0UB 4UE2A 3WKEA 3A6DA 1CKEA 3H2HA 5CLIA 3RVMA 4EDFA 3KHTA 2RGGA 3NDPA 4LAFA 2QMHA 4O2BF 1C9EA 3KR1A 4FS8A 1RJWA 1DOZA 1JQ3A 1KF0A 1RNLA 1X77A 3LUHA 2PG3A 2J1LA 2BEJA 5A71A 4X9XA 4O25A 5TEWA 3IEMA 2XT0A 3WOHA 2AL7A 2DR2A 4BO1A 3ZWOA 5DTIA 5IKXA 1DG1G 4GWGA 1W52X 3TUFA 2UUAB 1ND6A 5IN5A 3FNIA 4NCIA 2H1SA 3WLEA 1DARA 2J9XB 4NULA 3W04A 3PXXA 4IDFA 1AKTA 3OQPA 4YALA 5CG2A 2GQ0A 2VDKB 4JMPA 1M34E 3QU2A 3M6MD 1U7WA 2W6JD 2Y1CA 3IJPA 4FW9A 1Z17A 3MMSA 4CR8A 1TJNA 4C3VA 3K4PA 5BSMA 2PXHA 4B3IA 1K8XB 2H6EA 5JD3A 5E4TA 4NESA 5TGTA 1OWLA 4AMBA 1SQGA 2DPXA 3WV5A 4TLCA 3NEYA 3VTZA 5DTQA 5KOHB 3D3NA 2ZWAA 4KX3A 4X1IA 4FMBB 1ORVA 1XQ9A 3J81k 1ZAKA 1G8GA 1D6NA 2PYIA 1P60A 4G0ZA 8GPBA 1KEWA 3PQCA 2FQQA 1Z5OA 5MFZA 2FDCA 3HEAA 3ZGVA 3PDUA 4LX0A 4V39A 5D5PA 2WTBA 4D0NA 4GD3Q 4MW6A 4BKPA 4EKGA 3UEOA 1RPZA 4QXAA 2R66A 1B2RA 3WHPA 4U2GA 2JHFA 5AO9A 1CZLA 5H7XA 3WTCA 3ZS8A 2P9JA 2WJAA 1XYVA 4ZK2A 5HW0A 2AOXA 4I66A 3UK7A 4GBJA 4UU1A 1H8ED 2H4XA 2J6BA 1NBIA 2H3HA 3HXTA 4X60A 2PWAA 2GSDA 5BUZA 2X2OA 4I4NA 1R0KA 4EHDA 3L4SO 2VQFB 2QU7A 4WKCA 3GRYA 4Q4DA 1ADYA 4PHHA 2JGJA 2G6TA 2GTIA 4IHKA 1DC4A 2VA8A 1Z74A 3C1UA 3GJ8A 1SK9A 3DXZA 2OWDA 1K98A 1A4IA 2JJ2A 3AUSA 1LTHR 2XMBA 3DNPA 3I58A 3WYGA 3CCBA 2L18A 4JLSA 4WA8A 3GRVA 5CXUA 3K05A 1FVHA 1TFRA 1UBLS 3BDIA 1P44A 2G5PA 1H0KA 5T4EA 1C7ZA 2JFGA 2YYSA 2YVUA 4FFRA 3T0IA 2O8FB 2PD6A 1YR9A 1HG1A 4KXXA 1ADCA 4NFYA 4H1TA 1I3OA 1FTYA 4RDHA 5ALZA 5EP4A 4EG6A 3PHJA 1VRWA 5FUVA 3GNTA 1QPBA 3D1VA 1MB9A 1XHEA 4DSOA 2OD7A 1BU5A 4DYVA 2A30A 3JYHA 3O1IC 2JI8A 2PH5A 4PQFA 2H3EA 3OU6A 4D9JA 1KMHA 1AGYA 1JRLA 1JSRA 1LDBA 1Z0DA 2R6JA 4PCUA 3KVYA 3PEFA 1QK4A 3IO3A 1A9QA 4F04A 2FW8A 1Z38A 2ZJ6A 3BMQB 2UYCA 3G0OA 4N3NA 5JFTA 3ZCPA 3INRA 1XKLA 4CW7A 4C20A 1Q11A 3H2IA 1U1DA 2NO7A 2EP8A 3FTEA 3H7AA 2Q2WA 4A1FA 1CUHA 2OC4A 5IXYA 1JWLA 4EA7A 4X20B 3D4IA 3C85A 3PQFA 1VL1A 4MUKA 3EGEA 4RKRA 1KQNA 1UAAA 1JZQA 1BFDA 2MYUA 4DHWA 3MTQA 1U2TA 4TKVB 1HLDA 5K09A 3HZZA 2GXAA 4TXMA 2R85A 1DFIA 3I9JA 4RTSA 2B8TA 2IH2A 3SBDA 3HCCA 5ER6A 4NI5A 3LL4A 4R8MA 2D0IA 4YCCA 3YASA 4XARA 1TQ4A 1Y9AA 4MI3A 4LJ6A 1UZUA 2JFWA 4ZI7B 4LYGA 3GT0A 4DGSA 3DMDA 4JELA 1QLHA 2A5GA 1E92A 2XADA 2XCSB 2Q0QA 3B13B 3D0OA 1JF8A 4MKZA 4AN4A 1WW8A 1CT9A 4BP8A 2NUAA 3GDGA 3NOQA 1ESCA 4CEHB 1P81A 3CVJA 1R74A 3ZV7A 3CSDA 1UJ4A 3DFKA 13PKA 5TRTA 3TLGA 5HKKA 4ABTA 2RGEA 4N65A 4CEIA 2IKQA 2VJBA 3PB3A 4DCNA 3U19A 3LUAA 1NQTA 3WDMA 1REQB 3MOIA 5AXDA 1ISIA 2V8BA 1RMQA 5TARA 1RXWA 3IP6A 1D2GA 4XX2A 4F9GA 4P4NA 4UEOA 2B82A 4DQVA 3NVKI 3H1BA 3VOBA 5A0VA 2HWUA 3ER6A 1ULSA 4K0KC 2GNAA 1MVLA 4JBHA 4NDNA 3T4PA 2FPLA 5K0GA 4TVOA 1B8PA 4CZ2A 3VNRA 4K6CA 3A11A 4TX1A 4F38A 4JASB 5TLSA 3I12A 3MT9A 3G17A 1XJ0A 4IIDA 3IA2A 1V5EA 1XDUA 4PRLA 3DE4X 3U56A 5IWAC 3S4YA 4K0KB 3COZA 4K03A 2Z56A 4L85A 2WE8A 1I5RA 2GTPA 1KEZA 3JWGA 4ENPA 1F0KA 2BHTA 1ZH8A 4GEKA 1APBA 1C4WA 1TLFA 4WNIA 2GM9A 3FCAA 1M83A 1NVFA 2XIQA 4C04A 3SF0A 3MAJA 3NR2A 2DHQA 1UBUS 3TBKA 2CZGA 5GIPE 3DWEX 1VMDA 2GXSA 2YMMA 3CRZA 1KFBB 5DBGA 2RHTA 5C8YA 2QKYA 2IHVA 1USKA 3BIJA 3E5MA 4PZYA 3ZZMA 4BQRA 4DA9A 4EUHA 3HP7A 2CF5A 3JZAA 2QS9A 4RQUA 4RDXA 2CGEA 3OA2A 5EZYF 2C3OA 4J0EA 4E2XA 2DYKA 2HLPA 4OP1A 1S3SA 4B4DA 1KRHA 2C3UA 2J9RA 2GK4A 4C30A 4AP9A 4ATNA 2DWUA 4GAEA 4OBBA 1JQJC 2H0QA 1SHJA 4TL7A 4YR9A 5JYEA 1G98A 5AVTA 1I24A 3ZWQA 4KYTA 3QPCA 4MV4A 5L45A 2XNDD 3AMVA 4CDGA 3DV0B 3UXYA 7REQA 1I2ZA 4DFDA 3UJCA 2VZ0A 3PDIA 5FWYA 2XUGA 3RGWS 2JHGA 2CDAA 5K6RA 2QVLA 3JWHA 3H4MA 1MO6A 2EXXA 4TMXA 3K73O 4TROA 3JVIA 2EFJA 5ITVA 2FPPA 1P74A 2APJA 1G63A 3ICVA 3OZFA 4X95A 8AT1A 2H07A 1UH5A 4Q19A 4Y3UA 4RK1A 4HRAA 3Q11A 4LZNA 2QM8A 1KNXA 3K31A 3R20A 4M1EA 1JG3A 1VE1A 1M3SA 1ZMXA 3ZHRA 4K6FA