3IEVA

Crystal structure of era in complex with mggnp and the 3' end of 16s rrna
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
302
structure length
302
Chain Sequence
HMKVGYVAIVGKPNVGKSTLLNNLLGTKVSIISPKAGTTRMRVLGVKNIPNEAQIIFLDTPGIYEPKKSDVLGHSMVEIAKQSLEEADVILFMIDATEGWRPRDEEIYQNFIKPLNKPVIVVINKIDKIGPAKNVLPLIDEIHKKHPELTEIVPISALKGANLDELVKTILKYLPEGEPLFPEDMITDLPLRLLAAEIVREKAMMLTREEVPTSIAVKINEIKPGDANPNMLVIKGEIIVDRENLKPIIIGKKGQRLKEIGKRARQELELILGRPVYLELWVKVVPDWRRRPEYVRLFGYAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTP-binding protein era
publication title Structure of ERA in complex with the 3' end of 16S rRNA: implications for ribosome biogenesis
pubmed doi rcsb
source organism Aquifex aeolicus
molecule tags Nucleotide binding protein/rna
total genus 99
structure length 302
sequence length 302
ec nomenclature
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01926 MMR_HSR1 50S ribosome-binding GTPase
A PF07650 KH_2 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.300.20 Alpha Beta 2-Layer Sandwich GMP Synthetase; Chain A, domain 3 GMP Synthetase; Chain A, domain 3 3ievA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 3ievA01
4D0LB 1W7AA 1N6NA 2ZRLA 1VKJA 4UQOA 2RHMA 2J5XA 1FP6A 3TVDA 1UADA 3PJRA 1UKYA 1E69A 2DWOA 2QROA 3K70D 4I4LA 2BBSA 4RZUA 2WJYA 1ZCAA 4PSAA 1K6MA 4ESVA 1AKEA 3MD0A 1US8A 3IGFA 2F1HA 3QNUA 4JVNA 5FL7D 5JJKA 5E7JA 1EWQA 1WXQA 3OTOC 3BD9A 1AGPA 1TF5A 1FNNA 1TADA 1YZTA 1ZIPA 2FFAA 4QC2A 521PA 5KPDA 3TAHA 2GVZC 2PCJA 2P65A 4PTLA 2CK3D 4JI8C 1WRBA 2A3RA 3U7EB 1E32A 4PFSA 4XH9B 1G64A 3NEJA 4ZKEA 4TT3A 3U4QA 1XTJA 4QBIA 2WWXA 1UAAA 1MRSA 3KQUA 4DDVA 1W36B 1BMFD 2I1VB 2FX3A 1G6HA 1N34C 4BLQA 4TSFA 1KKGA 4AWXA 2ZANA 3ASZA 3NC0C 1QHSA 2YOGA 1FQJA 2OILA 4DKXA 1G3MA 3GLHE 4HZUB 5JBQA 4Y0AA 2L0XA 4KAXA 4RKEA 2JJ2D 4IXNA 2CXXA 3GLIE 2DYJA 2ZI4A 4ZCLA 4D26A 2MMGA 1MO4A 1E99A 3DM5A 4HB0A 1H8HA 3OIYA 2XTZA 2B7BA 2J7PA 2C9YA 2ZJZA 5B58C 5CDFE 4DR7C 3SQWA 3T61A 2NMVA 3C5CA 1WBDA 1HV8A 4B3GA 4Q9LA 1RRCA 3AH8A 1Z5ZA 4MGKR 5FTKA 4HUTA 2OAP1 3K70B 2UUCC 3CRVA 2ZRKA 2JIZA 5G53C 1VCMA 2QAGB 3U7GA 3J80D 1H65A 1KKLA 2GETA 4JS0A 2B8TA 1MO5A 1G16A 4LDJA 4AG5A 3EWAA 3R9WA 3OFNA 2QE7A 2YV5A 4JL8A 2JCSA 4ACAA 4AKEA 4EKDA 2DFKB 5CLLA 1ONBA 3WNDA 3FHOA 4D2IA 4PPQA 5CB8A 3LXRA 1Z6YA 1TQ6A 3N2IA 3OEED 3X2SA 4B2PA 4DIEA 4LJ9A 1K5DA 2FPKA 3LFUA 4GKKC 1GKUB 3NBYC 1S1CA 3U3JA 4LBVA 1OH6A 3WP0A 1N6KA 3AVUA 2EFEB 4CT5A 1T4GA 4TL9A 2ZRDA 3IBYA 4LYHA 4QBHA 3CRRA 5DHAA 4QGFA 2RKOA 3KFXA 3FDIA 3AP3A 2ONKA 4U7DA 4MH4A 4ARZB 1XD2A 1EESA 1UJ2A 4M53A 3DM9B 4ZKDA 4DSUA 3X1ZA 1QWIA 2V7QA 4FWIB 2XNSA 2IYSA 4EJSA 3LWNA 3P4YA 1QVRA 2WJVA 3F3YA 3EASA 1P2SA 2IS4A 1XMIA 1N6OA 1XRJA 5JFGA 5IF9A 2FSGA 5B2ZA 4Z54A 4LJ6A 2DWQA 1NVVR 3AVWA 3EZ9A 1G8GA 4A2QA 1G20E 1UEIA 1U9IA 3N2EA 1XCPA 2A5FA 2VSOA 2OAQ1 1G4UR 2PBRA 4NCHA 1IN7A 1QF9A 3WYFA 4D4MA 4IFEA 2QM8A 1VECA 3QUSA 1KAOA 2WAYA 3LVQE 1EWRA 3CZPA 3DKPA 4PPNA 2D2FA 1CEEA 4HDOB 1HNXC 2J7KA 4YMTA 3MRSA 3X1WA 2BBOA 4JLKA 1KY2A 3R20A 2QTFA 4LRWA 2R6AA 3SYLA 1DG1G 4LPSA 4CZ2A 1SVWA 2Z83A 4P4TA 2P6RA 1XEWY 2IYRA 4D6PA 4OI0A 1QHHB 2H18A 5C4GB 1CIPA 1XMJA 1D9ZA 2Z4SA 2ZI6A 4URYR 4XTCS 5FH9A 4NPHA 2W6JA 3BFVA 4ACBA 5FOVA 5BYKA 1USPA 3IQWA 1GUAA 5CJPA 4V0LA 4QNMA 2WOOA 3TW8B 2OFOA 4DC9A 1TF2A 1GG2A 4PAOA 4MDFA 3NH6A 3KXLA 3NKVA 1F5NA 3ZVLA 1TU3A 3D31A 1AQYA 4DCUA 1N5LA 1MOZA 2H17A 2XXAA 3MAAC 1ESMA 4Q1FA 3THYA 2ZRJA 3VAAA 4AQYC 2BMJA 4HAZA 3RS2A 1GL9B 3SJBA 2GK7A 2FE4A 1H8ED 2GESA 3I5YA 1VCIA 1UFQA 4PXAA 1GTVA 2WSMA 1OFTA 5E7MA 5AR1A 3NC1C 3B8HA 1FOEB 1RIFA 2DFTA 4MUBA 2ZSAA 1QG4A 1T91A 2QBYA 4C0AC 1R0ZA 2BJVA 3TW4A 4E03A 3HU3A 2ZRFA 2BVNA 3NBFA 2E87A 2GNOA 3CUEF 3AUXA 4FD2A 4IXMA 4M8NE 2V1XA 2HYDA 2J0QA 1YRBA 5IT5A 3MMPA 2NIPA 2VYFA 5HR5A 4C0JA 4LHXA 5LB4A 2F1RA 1W4RA 4WZBE 2H7VA 2P6NA 3W3AA 4F92B 4QM6A 2EYUA 3WMEA 1TPZA 3FHCB 1CU1A 1ZM9A 3B1VA 4YMUA 5JHHB 1EG7A 5J40A 4B6EA 1NIPA 4M1OA 1DO2A 1S0UA 4V03A 4PQFA 4NE2A 1U94A 2WJGA 1E3MA 1GL7A 2ZYUX 3B7GA 2V54A 3A8TA 3GJ0A 3OIWA 4RFSB 1KMQA 1GAJA 1S8FA 2ZAMA 4DXAA 2ASBA 2XNDA 3UIEA 2ZUCA 3ZYCA 4P4SA 2IA5A 4NYIQ 4O25A 1KO4A 1G41A 4DWJA 1G3IA 1I4TD 4O3MA 4JI3C 2I3BA 1ZNWA 3VQTA 2AL7A 3QKSB 3RDPA 1WP9A 2WBLC 2NO6A 4ZDWA 3T1TA 4MA4A 4QHSA 2IYYA 3U61B 1RKBA 5FUYA 3Q3JB 3LAWA 4IVRA 2ODBA 3LXXA 1Z0DA 3QKRA 1JECA 1HYQA 1T3HA 2ZJ2A 4E5UA 1NJGA 4BZPA 4QL3A 1UBGA 2VP2A 2ZRNA 3RABA 2IL1A 3ZGXA 4XD7A 4QKQA 5LB2A 1WBBA 1CR0A 3CX7A 2OHFA 2OEPA 1MO6A 4Q47A 4KHZA 3B85A 1DE0A 3RRZA 4IEEA 1JJ7A 3EA5A 4EDHA 1XNRC 2G3YA 4JI6C 1G7TA 4DB2A 2XJ4A 1NKTA 2VP0A 3TKLA 1E9AA 3Q7PA 5E4FA 3W5JA 4FMDB 2FZLA 3DO6A 5LPNA 4NHOA 4DUZC 5GADl 3ZJYA 4EFLA 3A6PC 3CKLA 2P5SA 5ANRB 1CRPA 1SVLA 2EGTA 1SQ5A 1T0JB 4D0GA 1IN8A 4M9QA 4KJZA 4OHXA 2QUZA 5DYIA 4GP7A 4Q9KA 2ZJBA 3H2YA 1KNXA 1RYFA 1SHZA 1Y3AA 3IO5A 3UMSA 4TL7A 3Q5DA 1M7BA 3VX4A 4M1WA 2E5LC 2QN6A 5FUXA 3T1OA 1CP2A 1JR3A 4S35A 2KJQA 2XZPA 5EE3A 3HYTA 5DI9A 2CXCA 3K0CA 1Y63A 3TVTA 1NF3A 1XNJA 3TE6A 5KNBA 2RGNC 3V4RA 4BZXA 1QRAA 1A82A 5BN3A 4K46A 3QKUA 3V4FA 1AS3A 4URVR 1WB9A 3B5JA 2O8FA 4DV2C 4ILEA 2QEQA 4CEIB 4B3XA 4MRRA 4P3YA 4OQNA 1R0WA 1YZNA 1OIVA 3CH5A 1XXHA 3CNNA 1HTWA 4P0TA 5BXQC 3DMDA 3OIUA 1GM5A 3ZVNA 5IK2A 4I1UA 1E2PA 1N0UA 3AVVA 4ZDIA 1KSFX 1ZJ6A 4HLUA 5AUPB 2VSXA 1JNYA 2ERXA 4IOMA 2C77A 5E7IA 1Q21A 5L8VA 1NKSA 3FKSD 3HU2A 2SHKA 1CJKC 3B82A 3TMKA 4FMDF 4FMBB 2IUUA 4I99A 3UG7A 4NXNC 4II7A 3ZZ0A 1PLJA 2BDTA 5FBWB 4HUQB 1BYUA 4A8JB 4D82A 2N1BA 4NDZA 1IM2A 4E22A 1SXJB 1CLUA 5IDVA 4BLSA 1B0UA 1Q20A 2PEZA 2F3RA 3U7HB 2QU8A 1CF4A 1NBMD 4C30A 2Q21A 2PZFA 1ZBDA 3THXA 1IN4A 1SZPA 3KXIA 4DCVA 4URZR 4KBFA 4ERNA 1PLKA 4EFMA 2QL8A 1I94C 2HT1A 1FMLA 1OW3B 4V02A 2YC4C 3AVXA 3UMFA 4DSOA 3SYNA 1DAGA 2E8FA 2HF9A 4M0LA 4NCNA 4KFUA 5C18A 1D2MA 2ZE6A 3ND9A 2FOLA 1WA5A 5IWAC 1GSIA 4JLVA 2IUSA 2OCYC 1AQUA 3FYHA 4M9SA 4QGHA 3WY9A 2JEOA 4OX9C 1KY3A 2P3SA 3NIBA 5TY0A 3A36A 2C96A 221PA 2BOVA 2QPAA 4WA7A 4DSTA 3PEYA 3GLGB 2BV3A 1E9BA 5HKKA 1I4LD 3QKTA 1HQCA 3PVSA 4DDUA 4AD8A 2CL0X 2EFDB 1G8HA 5FLXD 1G8YA 3QPVA 3EG5A 3IHLA 3AVTA 3ZD6A 2P2LA 1NYEA 5GJWC 4ABYA 4TTPA 1FW6A 1UEJA 4TQUS 1OV4A 4TLCA 2CY1A 2GVDC 2QSYA 1E2MA 1A2KC 1R2QA 1VPLA 2BMDA 1D2EA 5FOTA 3VR1A 5BN4A 1EK0A 4GNKA 3W5IA 5F98A 1CXZA 1GRNA 4RKFA 4QJ5A 5FL7A 2TMKA 1M8PA 3FFBA 1F2UB 3DEFA 4Z51A 1BS1A 2Q9BA 2WICA 4P31A 2IUTA 3B6EA 4TLDA 1Z2CA 1E2JA 2CE2X 1J2JA 1F2TA 4HYYA 3OE7D 4Q7JB 5KSOA 4LYJA 4B71A 3WHKA 3QEJA 2DY1A 2CK3A 2NO7A 4JIMA 4CEHA 5G40A 1LY1A 3CH4B 5EP3A 2JLSA 1TAGA 4NL4H 4W9MC 1Z63A 4DV5C 4QHTA 2BWJA 5FPTA 4Q4HA 1BMFA 3J81k 1NY5A 2O8EB 4JSYA 1M34E 5KHOC 2W2VA 3PITA 3RRNA 2O0JA 4AI6A 2BMFA 1HR0C 4RD0A 2UXDC 5HZKA 1S3GA 3GJ5A 4LF9C 4DR2C 1OXSC 1ZRHA 2FJUA 1D8TA 2JJ2A 4ARZA 4L4UA 3EZ7A 4JLPA 2QAJA 3KJIA 4G3XA 4RY2A 1G3QA 4LI0A 1P61B 1EFCA 1U99A 1XMQC 4ZIRA 4QNRA 1I2DA 5A2QD 4EJSC 4XVUA 1KMHB 2WWFA 3W6NA 2RGBA 2RH5A 2I1QA 1M7GA 1KI8A 1KI9A 3MLEA 2BBWA 2VHQA 4IOLA 4B2IA 4X64C 3X1DA 2AD5A 2GRJA 4RD4A 3I62A 2OFWA 1KNQA 1X3SA 1NN0A 1XD9A 5BR8C 1E2FA 4JZKA 4RCZA 3SJCA 1U9IC 3RSLA 2IF0A 1U0LA 1F3OA 4M9XA 2Q3HA 4Q7KA 2VH5R 3TRFA 5HZHA 1JR3E 4LC1A 1S2MA 3KKOA 1ZNYA 4Z1MD 2OPLB 1MABA 3BRWD 2GXSA 4B33A 4Q7LA 5C1BA 2VA8A 2O8CA 2IYZA 3B9QA 2GEVA 4EPWA 2I4IA 1G3UA 2RB4A 3OEEA 2ZXUA 1FPMA 4BLTA 3GLFA 2GCNA 2EFGA 1CKEA 5A4JA 1E4VA 1N32C 4DV1C 2WAXA 1GWNA 4FXPA 2VIIA 4PO1A 4AKIA 1XXHE 3BB1A 3K09A 4UNNA 3VFDA 5AJXA 1W2HA 1XCGB 1XEXB 1HA3A 1OB5A 4CT4B 5FUVA 1UBEA 2XOKD 5JECA 1SVKA 4G5RA 2CCGA 3E1SA 2YYZA 2VF8A 3L82B 4G5OA 2D2EA 2O0HA 3LLMA 2A2ZA 4DLRA 4GDFA 3PUWA 4BQSA 3GJ7A 1PUJA 4JI0C 2QA5A 4PO9A 1NJFA 1KDOA 3P26A 3EPLA 1U8YA 1RJ9A 3W8RA 2PCLA 4OYHA 4C0HA 1A1VA 1FX0B 4MYHA 4C0QC 5LD2C 1T0HB 2LKCA 2IW3A 4LF6C 1AJEA 1RE0A 5H70A 1E79D 5JWHA 2JLRA 1Q1EA 3L8YA 5EE0A 2XX3A 4FIDA 4LC0A 3O8CA 2VF7A 3QVVA 1EFRD 3KQNA 2C5LA 1NLYA 1KSHA 2RAPA 2WIAA 4C0LA 3THWB 1MH1A 5CJ2A 3TUJC 1Z6AA 4NBSA 1Q1BA 2ZI7A 1JEEA 3PG5A 2QG6A 2NO9A 4B32A 4DR6C 1ZUNB 3L0PA 2A5JA 1KI7A 2HEIA 1TQ2A 4HAWA 4WVFA 1FUKA 2ZUBA 4DEXA 2W58A 2VL7A 3K53A 5DISB 1Z47A 3SBDA 3JVUA 2F9MA 2G1KA 4ON9A 5D3QA 1JQLB 3SOPA 5EXTA 3TIFA 3FTQA 3C41J 4M1MA 4UNPA 3DPUA 5JLJA 4TLBA 1TQDA 3OEHD 4C4PA 1N25A 1YQTA 4X65C 2ZI3A 3IQXA 4LF5C 1G1MA 2PLFA 3W6OA 4DV6C 1XDBA 5AJWA 4F4IA 5KYKA 2FDCA 1OJLA 4AIIA 1G8FA 1W36D 2HLDD 3ADBA 4KXFB 2GJ8A 4Q7MB 5KNDA 2IS1A 4PC7A 3FMPB 3FOZA 3K8YA 4RD1A 2GCPA 2C9OA 3QF4B 1H8EA 1IY1A 5JSZA 2O8BB 4IVQA 1L2FA 4HB4A 2A5YB 4B48A 4JJKA 4Q1EA 4LJYA 4PHHA 4HAVA 3I07A 1SKYE 3O47A 5AJZA 2WWYA 1VCOA 4BECA 4OQMA 3C16C 2CL7X 4OK5A 4LPKA 4TMTA 4HSEA 4LF7C 1P9NA 3HDTA 3BB3A 5HE8A 4TZ0A 2PZEA 4NZYA 1E1QD 4CRWB 3KJGA 4JLNA 1HH4A 2JMPA 4B44A 2XZOA 1VDZA 1R0XA 4EFNA 2D7VA 3B9PA 3EC1A 5J4YA 2E1RA 3B2EA 3AP1A 1OXVA 4JSTA 4N3NA 4EAQA 1E2NA 1FTNA 2G88A 3JZAA 1U2RA 3T1QA 2IYUA 4AC9A 5TDHA 2KB0A 3QXCA 1QVAA 1ZD1A 2QQ0A 1Q3TA 3KJEA 2ORWA 2RCNA 2VQFC 2H57A 3VR5A 4WXPA 3TH5A 2GK6A 1IBMC 2GEUA 1XTIA 1G5PA 4EPYA 1IN5A 5D3MA 2EYQA 2QM7A 2R6GA 4V0MA 3VX3A 1YRAA 2O5VA 3U7FB 2ZJOA 5BN5A 1WH9A 2ZYTX 4D4KA 2NZ8A 3K0CC 3FWYA 3QG5A 2JASA 2YCBA 2ONJA 3S1AA 4NU0A 3SFVA 5TMPA 2QMHA 5KNCA 2IX3A 4LHYA 3GLFE 4OHZA 4CEIA 4HATA 4JV5C 2WJIA 3B1XA 2GCOB 3EIQA 3CB4A 4FW9A 1IQPA 2AR7A 2ECKA 5FFMA 3GJ4A 3WRYC 1U8ZA 5L3VA 4ZCMA 3RS7A 4B35A 1W0JD 3UXMA 1AS2A 3Q7QA 4DBLC 3AVYA 3PEUA 4LFAC 1J8YF 1Z28A 4V0KA 2G1JA 5KOYA 4HLUC 1OHHD 4BEJA 2FFHA 1KAGA 3P4XA 1LFDB 4PC1A 1HE1C 4GP6A 2J0UB 4LBYA 1W48A 2FMXA 1GFIA 2OCAA 4R2IA 1I2MA 4JJZA 1PA4A 2XJ9A 5JZVA 1A4RA 2ZUDA 4HUQA 2VHJA 4Q1BA 3I1FA 3ZVMA 1EX6A 2JLQA 4DB4A 2HDNB 2HV8A 1KK2A 3CLVA 5FTNA 1RRGA 2QTVB 2VEDA 2XSZD 3UK6A 4PR0A 2PLRA 1AZSC 3GJXC 4C0KA 3I61A 4C7OB 3TGPA 2GZHA 1XZQA 4DCNA 4JI5C 1IONA 4JLAA 1GVNB 5EXXA 421PA 2O8DA 4C0BA 2F43A 3HYRA 2A5DA 4BWYA 2ZI9A 3ZZUA 5DI3B 2Q3FA 1TF7A 2FFBA 1XJ0A 2XR1A 5EP4A 2UUBC 5EQTA 1G21E 2BHRA 4LSGA 4ESHA 4JBYA 4CYMA 2QRZA 2JJ8A 1X8KA 4IRUB 4B3CA 2G83A 2V55B 2XGJA 1ZAKA 4NYMQ 3V00A 4G5QA 2WVJA 1NIJA 4RVCA 5AJVB 1TNDA 1UKZA 3C4JA 4OHYA 3REGA 1XCMA 2HXSA 1PJRA 1Z07A 3FMOB 1W2GA 3K0FB 3VU9B 3K70C 4LJ8A 3LQRA 5JCPA 3MJRA 5CIQA 3KQKA 1T8TA 4MYTA 4IDNA 3QY0A 1VYVA 3ADCA 3FKSA 5UKDA 4EUNA 3KZ1E 2QZ4A 2IEZA 1S9DA 4Q4LA 5DSZA 1OKKD 1U81A 1VYUA 4U02A 5SZHB 3QXSA 3SC3A 1II8B 1Q22A 4FMCF 4AY2A 4EQ6B 1ESNA 4OJQA 1ZM7A 3BFXA 2WWWA 4Q1DA 4IW3B 3ZH9B 5L3QB 2ZVPX 2NTYC 1NBMA 4DT1B 1E1RD 4S2EA 3RANA 3U60B 4TN1A 4Q4AA 2GJSA 5AUQA 3VR2A 1CJVC 2O8EA 2W2XA 2OCPA 4LGMA 4PSVA 4PQYA 5TV2A 4Q4JB 3U44B 4M22A 2OSBA 3VHLB 3A37A 5KUTA 2VPPA 4J0QA 3JZMA 1TUIA 4Q18A 2CHVA 4BPBA 4BFZA 3PV0A 1N5IA 4D4LA 2R6FA 3B1WA 3TQFA 5LMUC 3NXSA 1WQ1R 3AGPA 5DYGA 1M74A 5C2JB 1LV7A 2ZIAA 3FB4A 1X8LA 3A4MA 1G8PA 3TQCA 4AYWA 1G291 2XITA 6Q21A 1IXSB 2HUPA 4LBZA 3FMFA 3CW2A 1A2BA 1RYHA 1Q0UA 2R6CA 1T8UA 2WWGA 2IWRA 3M1IA 5CLQA 4GMXA 1E4YA 2OUKA 1EX7A 3X1YA 4TLEA 1KI6B 4E07A 4N0DA 3GLHB 3SHFA 1TQ4A 4KSCA 1L4YA 4M1TA 4UKDA 2R8RA 3T12A 2XEXA 2C98A 1N6IA 4G5SA 1J99A 2YJTD 3PQCA 5B30A 3GLIB 1S3SA 4B3SC 4A36A 4RFVA 4V0ME 1E94E 4EPVA 4PPGA 3SJAA 3CPHA 3VHXA 4LHZA 2HYIC 1E6CA 1YJ5A 5F3WB 2CDNA 4LYFA 2DCUA 2OPLA 5A0FA 3PXGA 3VKGA 3OE7A 2LCFA 1LTQA 3EC2A 2X77A 1JXMA 3VKWA 4BRUA 2DB3A 4TMZA 3VNVA 2CHGA 1OF1A 3LBHA 3FFAA 4IOKA 1F6BA 4D4JA 1FL9A 3UKDA 1TL7C 2BCJQ 3IKJA 4MGZR 2QTHA 4ZV4A 3K9NA 3B1YA 4POAA 3N70A 1GOTA 3KB2A 5FPKA 3RS3A 4M21A 4NXMC 1DTSA 3K09C 4DVGA 4DR3C 2B6HA 3K0AA 4DRZA 5KTYA 3KQHA 1KI1A 1P4SA 2YWEA 3OESA 1QBKC 4URXR 3D7MA 3ZQJA 2JGNA 2XB4A 1CRQA 4NP6A 2WWHA 1DOAA 2J9RA 2R9VA 4DR5C 4NTZA 1E98A 1NN1A 2K5UA 4TMKA 4CDGA 2W2TA 3W90A 2AK2A 3NDBB 3AKEA 4CEJB 4R98A 4F93B 2A9KA 2B92A 4YY3C 5FPYA 2OM2A 1II0A 3BC1A 3GQBA 1DEKA 3QF7A 4ZI3A 2ZSDA 4XIGS 5E3HA 1EGAA 3GFOA 1D2NA 4G5GA 4Z8YA 4JT4A 2UKDA 3HR8A 4U00A 5JS7A 4TTRA 2ZS7A 1S1MA 2DHRA 2BKEA 1LB1B 3L0SA 1KJYA 1A7JA 1YE8A 2IHYA 3MUFA 3V9PA 1NN5A 5CIWA 3U6BA 2RMKA 1XEWX 2H16A 4Z1MA 3L8ZA 1AM4D 4X8OA 3CONA 4B6FA 1MT0A 2BM1A 2B7CA 2F55A 2FG5A 2WMNB 3WYAA 1XF9A 3AQ4A 3NHBA 2WPDD 2OO7A 5JRZA 2IS2A 2ZE7A 3L2OB 1KOFA 5H68A 4YC7A 3AF6A 2BJOA 2IC5A 3ICQB 2NO0A 4KFTA 5KDLA 4O2RA 1KI3A 8OHMA 3ZS9A 2J3EA 2QGZA 1KK3A 3B1ZA 3RNLA 1W4BA 2ZTSA 3C8UA 5HCNA 4B3MC 4GOKA 1JAIA 3NTUA 4WIAA 2ZI5A 2OXCA 2XOKA 3EERA 2HJGA 4UJ5A 5FL3A 3R7WB 3BGWA 5L3SA 3KTAA 2CJWA 2G9NA 1SXJD 4PX9A 3MCAA 4IDPA 4YONB 1E9CA 3TSWA 2HCJB 1VIYA 2FZ4A 3PUZA 1L2TA 3SS8A 3UPUA 1XTSA 4XVQA 1Z0AA 3T5GA 3RSOA 4IFBA 2ZAOA 1OSNA 1S96A 1ZUIA 3QQ5A 4JLJA 3DVLA 1NBME 4TL8A 1C4OA 3SHWA 3QF4A 1HE8B 5FOWA 3EPKA 4OBEA 1Q3HA 2VO1A 4XOIA 1E79A 3CNOA 4TLAA 1MO3A 3I73A 1UF9A 2FEMA 1US8B 1JI0A 3VR6A 1JR6A 1P2TA 4JL5A 5KO2A 1EFRA 3TLXA 2J87A 5K8IA 2V1UA 2G77B 3U6KA 4BSZA 4B3BA 2CHQA 4URWR 3CJEA 4CW7A 2MSCB 4YXWD 3UMRA 4Q19A 4V0NA 4BLRA 4L16A 4NKRA 4GI7A 4N0EA 4PAMA 3U4QB 2NG1A 3ADDA 2N42A 1M1YE 4WW0A 1ZM2A 5HE9A 5EP2A 4A4DA 4XWAA 2V6IA 1F60A 5DLQC 1OXXK 2FEOA 2EFCB 3K1JA 3MWLA 2Q9CA 4GBMA 2WJHA 3DMNA 1ELOA 1FNMA 4HZIA 4Y0VA 3B78A 3OEHA 3RC3A 2D62A 5K8LA 2F6RA 4GZLA 3RYTC 2EW1A 4AYTA 2ZR0A 2X2EA 1D5CA 1P6XA 1DAIA 2X1VA 2ZM6C 1J8MF 4M2LA 4BLOA 1GKIA 2QP9X 4XSGA 5J4LA 1N5JA 4A2WA 2C04A 4LYAA 1BIFA 1N0WA 2EFHB 2FNAA 2HLDA 2IYVA 2IHBA 3CRMA 2H8KA 3BK7A 2KWIA 5FTJA 2OG2A 3I3SR 1T5IA 3BBPA 3FGNA 4RCYA 4HZUA 3GJ8A 4L8GA 5FPSA 4BFYA 4DR4C 1M2OB 5F9HA 1EFHA 1ZCBA 3TJZA 4MDEA 1P2VA 3AF1A 2QMEA 1XNQC 3CPJB 5JHGB 3U3OA 2W00A 1EFUA 2PX0A 1ZNXA 2DPXA 3AVPA 4KHPC 2J1LA 4PO8A 2HT6A 2WV9A 2R65A 1XTRA 4TMWA 1OIXA 3T06B 1G7CA 1E1QA 3DKVA 4MTNA 3AV0B 4L9SA 1CBUA 1FFHA 5JI2E 1DO0A 1YR9A 5JWOA 3F8TA 3QEOA 1M6NA 3LW8A 3UG6A 1S4QA 3DOFA 2FGJA 3TR5A 4FCWA 2EU8A 4EPTA 2WMOB 5FOUA 1VHLA 2PMKA 3WNCA 4W5WA 3EXAA 2QAGA 1TTTA 4JLMA 4R71A 1QHIA 1VG0B 1P2UA 1ZD9A 2OBMA 4KVGA 5BYJA 4A6XA 5EE1A 4JLDA 4UXHA 1N2CE 2CMKA 5LDDC 1E96A 2Z43A 3NVAA 5AUOB 1WMSA 3MWKA 1XD2B 2BEJA 3GCGA 3LV8A 2IBMA 3SU8A 1OFUX 2GZDA 4NMMA 4LJAA 4EJSB 1KO8A 4YDSA 2D3WA 3EARA 1VTKA 4B3FX 2PT7A 3LX5A 5FBVB 3EIHA 1P7CA 4UXJA 4A9AA 5IT9D 5IHPA 5DNYB 2CLSA 4NYMR 4WXRA 5BQ5A 1C1YA 1OB2A 4YMVA 4N1AA 5CK4A 1OFIA 1XJQA 4MUAA 2FV8A 5SZJA 2P5TB 1KSGA 2ZJYA 3LO5A 3RS5A 2NOAA 1GNRA 2YHSA 1IOZA 2IYWA 2REXB 1W0JA 2C8VA 2R44A 2QORA 3IIMA 3G82C 4AK9A 1Z29A 4HLCA 2RHDA 4B47A 4ZI2A 5JJLA 3Q72A 4G01B 1Z22A 1OHHA 1IHUA 4PHFA 4QG7A 5EP1A 1CTQA 4Q1CA 4KITB 1ANKA 3KJHA 3KUDA 1L8QA 3OZXA 1FUUA 3P1JA 1DAMA 1CR2A 3EW9A 1DARA 3SDZA 3EX7C 4JMPA 2C2HA 4BFSA 4DV3C 2HJVA 3GJ3A 4EQ6A 4IEIA 3TUIC 1W0KD 4LV6A 4JVMA 2XSZA 1W5SA 4BUJA 3QPWA 1SVOA 1G7SA 1PLLA 2YWHA 2GAAA 4TMVA 2GXUA 1USPB 3CWZA 3KFVA 2FWRA 3E2IA 3KKPA 1UM8A 1J70A 2IXEA 1R4AA 2KZFA 2VBCA 3A4LA 4P32A 1KO1A 2NPFA 2R6DA 2Y8EA 5F9FA 4DDWA 4IKEA 5EUMA 2YWFA 4DLYA 3SR0A 2XXAB 3DHWC 3SZRA 2ORIA 3KKQA 1KZGB 3EWSA 4RD2A 3THYB 1GP2A 4NCJA 4TYPA 1QHHA 3AEZA 3WRXC 2XAUA 4ZDKA 1U0HC 2PT7G 1YZGA 3LY5A 2FPLA 1XMVA 1COWD 3QXJA 4F7WA 5LD2B 3GD7A 3RC8A 5ELXA 4LJ7A 1HNWC 3EPJA 1X1SA 4B76A 2Q6TA 2RGDA 1YR8A 4A2PA 1N0VC 4JBXA 1DAFA 4X8MA 1ZM4A 1ZIOA 1TMKA 1UKVY 2ZETA 5FBRB 1GIAA 1O3YA 1VMAA 2GHIA 2QBYB 4QJ3A 2OLJA 3DL0A 1T5LA 3FHTA 2ZSBA 4C3ZA 4Q01A 1P75A 3ASYA 3HR7A 4DCTA 2PJRA 1AZTA 3CZQA 2A78A 1FQKA 1QG2A 2AXNA 4UNQA 5DE3A 1XPRA 2BC9A 4HB2A 1XTQA 3W34A 1OKKA 3VR3A 2VSFA 3W3ZB 1R10A 3IO3A 2ZPTX 1OXUA 3CR7A 2V9PA 2Z5FA 1XU4A 1TEXA 2J45A 3WHLA 1OXTA 4NYJQ 2DYKA 4AG6A 5BW8A 3JVVA 1R0YA 1M7HA 3HJNA 1E1RA 1DS6A 3LBIA 3B60A 4UNSA 1AKYA 3FKQA 3BB4A 2ZQ5A 5GVRA 5G41A 4P4SB 3PUYA 1GRQA 2QRNA 3QJYA 5DIFA 1Q1ZA 3SE0A 3ZD7A 1KIMA 4IDQA 2DFLA 3R9IA 5JRJA 3ICEA 2QSZA 1QHXA 2Q3MA 4HB3A 2JLWA 3VKHA 5DO9A 1E2EA 2A7QA 5EZ5A 2CL6X 3ZIAD 2YINC 3BH0A 2UXCC 2ZRAA 4C0SA 2PEYA 2NZJA 4Q48A 2ZR7A 4I81A 5TARA 1W4AA 3GEHA 1KZ7B 2DFNA 4RFSA 5DN6D 4NYIR 2QT0A 3MSXA 4QXAA 3DZDA 2A5GA 3QKRB 2P67A 5EUQB 1IJEA 2ZJAA 3QOFA 5J5CA 4F91B 1T6NA 1QHYA 4DHEA 2VHTA 2XTNA 3O8BA 1YVDA 4HLDA 2QGNA 3CF0A 4OKSA 1I4DD 4B3DA 5KU1A 4MGYR 5FPHA 4X62C 5EE9A 2JDID 3QKSA 5FBLB 1KI2A 4TYNA 4HDQB 2GZAA 1NNEA 4K8OA 1R6BX 5CITA 2W0SA 4RZ2A 1DPFA 3DDCA 3SBEA 3B13B 3T34A 2JLUA 5KSYA 2JLYA 1NL3A 3WYGA 2VP9A 1L7VC 4KVAA 2UVQA 4YLGA 3MWYW 3H84A 4DLTA 1VHTA 2GILA 1IAQA 4CF7A 2ZJ5A 4A0RA 3I4LA 1E0JA 1MV5A 2AWNA 3HPRA 3UWOA 1YR6A 4MKGA 1Z08A 1LS1A 2D06A 3L43A 1MRNA 2REOA 1VG9B 1YZQA 4TQAA 1HQYE 1IBKC 2AX4A 1RC8A 4Q9JA 1G7RA 1U90A 4U5XA 2AXPA 4OI1A 3R8FA 3KQLA 4OQLA 2JA1A 2BM0A 3QI2A 2FGKA 4GRAA 2Q0HA 4OK3A 4PZZA 1NRJB 4TYYA 4GL2A 1W44A 3T15A 4JI1C 1G6OA 1J7KA 1DAKA 1Z6TA 5GJVC 2O8FB 1XP8A 4M1KA 5GJBA 3X1XA 5FOXA 5TXGA 1JALA 4LF8C 1IBRA 1LF0A 2GXQA 2GBLA 3J81D 2X19A 2XZLA 1XXHB 3L0OA 4KODA 1IXZA 3BORA 4KU4A 2NO1A 2PZGA 3PUXA 4IHQA 2F1JA 5TVKA 5JCZA 4QGAA 1R5NA 2ZVQX 1RVDA 4EPXA 4LCBA 4DLXA 4XX2A 1RFLA 1WCV1 2WHXA 4B75A 1W46A 1DADA 4WOPA 4YMSA 2NQ2C 3E70C 3AUYA 5TB5A 1N36C 5IRCD 4P33A 4LV8B 1JBKA 4DV4C 2QY9A 1E2GA 2WPDA 3NG1A 4HLQB 2IXGA 4X8LA 4YMWA 3THOA 3D3QA 1HT1E 4DLUA 2HXYA 3RLFA 1G19A 1QZXA 3THXB 1LNZA 1B23P 3GJ6A 4LHWA 2MMCA 1NG9A 4LOAA 5F2EA 3ZVRA 5M04A 1XD8A 2A30A 3AVQA 4XJXA 4O2LA 2PN2A 5K8TA 4O0MA 2G6BA 3BOSA 2ZS9A 3A4NA 2WKPA 3AKDA 3CRQA 4KCGA 5AJYA 5KSPA 4LBWA 4HAXA 4GT1A 4A8JA 4QBFA 2ZRCA 4YDHB 4BRWA 3DZ8A 3EPHA 2AD1A 1K0RA 1DELA 3Q8XB 1SXJA 3QPUA 4FN5A 1UPTA 4RD6A 1KTVA 2VQEC 1JXOA 3BAFA 3KXKA 4FMCB 1BO6A 1KJWA 4TYQA 4X66C 1W36C 1GNPA 4PC3A 5G3ZA 4A15A 4Z8XA 4M1SA 4WAUA 4BE7B 1Q57A 5H8WA 2UUAC 4HI0E 3C7KA 4PZLA 2GA8A 4I1VA 4DV7C 1HNZC 2AFIE 2YWGA 3OHMA 4DUGD 2CVFA 3WBKA 1SVSA 2HHHC 4UXIA 4OQXA 1HY3A 2MSEB 3IHWA 3ZS8A 3JAMD 4AKGA 4TWZA 5KPJA 3I8XA 3WBJA 4OI2A 5FTLA 1KDPA 1P5ZB 2ZRPA 1F2TB 1RRPA 1SGWA 3C5HA 3OAAD 3RS4A 2ZYWX 3GLGA 1HEIA 2IYLD 4YXWA 3R8CA 4L15A 4CEHB 3ND8A 3U3MA 2WJJA 121PA 3QG1A 1C9KA 3AVOA 4GZMA 4BZQA 4LWZA 1ZU5A 1KK1A 1OIWA 2E7GA 2OFXA 4Q4HB 1P60A 2F4VC 4ZO4A 1Q1QA 4OHVA 4RD3A 3Q5EA 1NVWQ 1SKYB 2QAGC 1E2DA 2PJZA 2KE5A 5H1YA 2PH1A 1WDTA 2D7CA 3LLUA 4LY6A 1F2UA 3QXHA 3RRMA 1Z0KA 2C9CA 1Z83A 2B8WA 1E2LA 1J5EC 5CM9C 2RGXA 4M9ZA 1LVGA 2W6ID 1LQLA 4TMXA 4LFCC 1IY0A 3ZQ6A 4PHTA 1V5WA 4ZPXA 3LA6A 4MRPA 1BKDR 3GEEA 3PCRB 4HEJA 1AA9A 2GKSA 3TNFA 4ZIRB 5J4HA 3GPLA 1R5OA 2GDJA 3F0TA 1OFHA 5DHFA 1T3LA 3PEWA 3CM0A 4JBWA 2R62A 1S9HA 4DUYC 1OH5A 4MITA 3LX8A 2O52A 1XMOC 2QNRA 3CBQA 3IUYA 4EPRA 3P32A 3BXZA 3CF2A 4DLWA 4KFSA 3H0KA 4M4SA 4ASUD 1E2KA 4JYAC 3T1VA 2G0TA 1P9WA 1AGRA 3A1SA 3FE2A 4WZAE 3I92A 3AF5A 5AUNB 3AF2A 1UBCA 5B64A 4TL6A 1MABB 3EA0A 3CPEA 1KMHA 1FTSA 4OK6A 4K81B 3C14C 5B57C 2O8CB 2OXRA 1EFTA 4JLOA 1V43A 1XEFA 4TYWA 1N3BA 1T3SA 1XTKA 3LD9A 4MYUA 5FR2A 5HCIA 1GNQA 5EZ6B 3VMFA 3HU1A 4A0FA 3GLFB 1OYYA 2CBZA 3A1WA 4A1FA 3Q85A 2GXAA 4NCKA 3I72A 2OESA 1TX4B 5P21A 1GILA 1W1WA 4YHHC 1UKEA 2F9LA 1WE2A 5FI1B 3Q9LA 1Z2AA 2BMEA 2WWIA 1ETUA 3HP1A 4BFWA 3LRPA 4B74A 3L0IB 1G5TA 4G0NA 1AN0A 4GOJA 3A1VA 3WNBA 4A82A 2CVHA 1X6VA 3IPYA 3K0SA 2HF8A 2J0SA 2D74A 2VP5A 2ZRHA 4YQFA 3GMTA 2CNWD 2ERYA 4PANA 2LWIA 1NMZA 4JVLA 5HTKA 3BH6A 2QMUA 3HWSA 1BOFA 3MWJA 1QDEA 4JI2C 1RPZA 2IYTA 3VTKA 3CNLA 1RJ9B 1SVIA 3FPAA 3M6AA 1UKKA 1NI3A 3PFIA 1VLAA 2JJ1D 2ZU0C 3KB1A 1XEXA 3IILA 5KSZA 1PV4A 1K8RA 3LDAA 3H4MA 3RWOA 4IDOA 1E9EA 4B3RC 1KGDA 4KSBA 5AK0A 3RAPR 1ZMXA 3LUSA 1XPOA 1JPJA 1KI4A 5SZIA 4MKHA 2KBEA 4LFBC 4UJ3A 2VRWA 5FR1A 1E9SA 3E5HA 3EIEA 3P27A 2NPIA 2ATXA 2ZEJA 1UBFA 2WSSD 2ZJ8A 3BJIC 4MYCA 1SXJE 2LKDA 2OBLA 3A1TA 1P9RA 5FTMA 2VHCA 4F4JA 2XB2A 4WZ6A 3K9HA 1NLZA 2IXFA 3O8RA 1FX0A 1R8SA 4MKIA 5KDOA 2GF9A 1NG1A 3SYKA 2WKRA 3LW7A 4R9UC 4W5JA 2ZU6A 1KO7A 4NYJR 5FI0B 2OCBA 1W0KA 2WTUA 1KDTA 4D25A 1SULA 3U5ZB 4C2UA 4TZ6A 2VHUA 2WM9B 2X2FA 1E9DA 1Q12A 3W8NA 3THWA 4NH0A 4JKYA 1Z0FA 1G5RA 2FSHA 3WMFA 2P0EA 2AWOA 3NBXX 3KDSE 1SVMA 3KL4A 3IPXA 2Z6VA 4BLPA 5JI3E 2FSIA 4DJTA 1KDRA 2RGGA 1XX6A 2GF0A 1N2FA 1A5TA 4TT3D 3RWMB 3BH7A 2Q9AA 2OV2A 3ADKA 3GLGE 3T1HC 2J46A 4PHGA 1ZP6A 4I1SA 1U0JA 4JLBA 2VP6A 2ODWA 2P6UA 4TSFD 3SN6A 4KLNA 4DLVA 1NMYA 3I8SA 3CWQA 4LHVA 2GJ9A 3AF0A 4LJ5A 4E09A 4Q9IA 1JEDA 4B34A 1COWA 1ODFA 2DWPA 5JSZB 1LW7A 3SEAA 1FP7A 3I32A 1VCNA 1CJTC 4DIDA 3BWDD 2IT1A 4P4UA 1J90A 3BS4A 3NHAA 4Q00A 3D6TB 4FINA 2IS6A 3TAUA 2E8CA 1H8HD 1Z06A 2ZYVX 4BFVA 2J7PD 1G4AE 1NVUQ 2D7DA 2QENA 1FMJA 4JYCA 4QJ4A 2GEDA 2W83A 3HPQA 2CCKA 4US2R 4QBGB 1LS6A 3IIJA 4KYIB 4RJLA 2IK8A 2ZROA 1CJMA 2ANCA 2IF2A 2IYXA 2ZSEA 4QRHA 2O8BA 621PA 1BH2A 3LH5A 3A1UA 1DVRA 4GPTA 1E9FA 1R8QA 2OE2A 4IVPA 4MH0R 1TU4A 4OI4A 3W9YA 2JIZD 4F4CA 2CLDX 4JI7C 3QIAA 2ZSFA 3SQXA 2ANBA 2R2AA 2AHOA 4KYUA 4IJMA 4CIDA 2ASEA 1IN6A 3UANA 5DH9A 1IXRC 1KSJA 4B73A 2JATA 2FPMA 2V3CC 3OFND 5CM8B 2QE7D 5CK5A 1CR1A 2GWHA 2BCGY 1R7RA 4FCVA 5D3MB 4GOXA 2WZQA 3LQQA 1VYTA 1TEVA 4H1UA 4MRVA 2ZRBA 1W5TA 3T5DA 4XTRA 3ZIAA 4DDTA 1OLOA 3CR8A 4NONA 4PSKA 1XMSA 3S1AB 3W6PA 3EZ2A 3QENA 3QSYA 4LJ4A 3QVUA 2YNMA 3P20A 3CIOA 3CX6A 5DN6A 3ZZTA 1E2HA 2FA9A 1ZU4A 1YR7A 2GBLC 1OPXA 2C03A 1CS4C 1XJCA 2CLCX 1SKQA 3IIKA 3RVBA 2V7QD 3LNCA 1X8JA 5CYOA 1NLFA 2V6JA 3TSOA 1P72A 2GJKA 5HPYB 1N33C 5JEEA 2JDIA 4HAYA 3N5CA 2IYQA 5AWFC 1ZB9A 1JJVA 3CF6R 1UDXA 3QBTA 1ZYUA 1E2IA 5CB6A 3PIRA 1CJUC 3K0EA 3H86A 4A0GA 2REBA 1JAHA 4DSNA 3ZLJA 4DLSA 2YOHA 3UWKA 2GCOA 4Q03A 2JLXA 4AKHA 3T1YC 2KI5A 1E0SA 3T35A 4Q9HA 3ECCA 2VLIA 2OLKA 1ZB8A 3PEVA 1P62B 1BYIA 2QQEA 1Z8FA 1G9XA 4LV5B 3BERA 2N46A 1DG3A 3AKCA 5SZKB 2UZIR 3G0HA 4Q02A 3LVRE 1L4UA 4Q5IA 3RS0A 2FF7A 5DGXA 4JYBA 1Z6GA 1PUIA 2IEYA 4A92A 2ZRIA 2PL3A 3AGQA 2W0MA 2O8DB 2F43B 2J0UA 1NN3A 5L3RA 1NSTA 4Q66C 4H9GA 1LF5A 5JWRA 4DV0C 2ATWA 1ZM3A 3AF3A 2CCJA 3D8BA 1N6PA 3OIVA 2EWVA 4A8JC 2F1IA 4H1VA 5EXSA 2ATVA 1Z0IA 3SJZA 3AP2A 1SXJC 5JS8A 4TTQA 1AS0A 1MR3F 3WP1B 3NWJA 3BIFA 1HURA 4I1OA 4C7OA 4MRSA 1Q44A 2W6JD 4G1UC 4PPFA 1GDDA 1TUEA 5FOSA 3KX2A 4D80A 4HAUA 1K5GA 2FN4A 4RSGA 4GFDA 1QHNA 2O0KA 1OYWA 1E9RA 3U2QA 2GAOA 1DBSA 2FSFA 5DI3A 3IBGA 3AF4A 3ETLA 1DAEA 1ZW6A 2VP4A 2QPTA 4DZZA 4US0R 1KKMA 2PMDA 1P3JA 3K9LA 2F7SA 3CRW1 5KDDA 4KV9A 3BFKA 4LZZA 2BJWA 4ZDJA 4PQRA 2ODNA 3SFZA 1N6RA 4A6PA 1JB1A 1IBLC 4XSHA 1NVVQ 3FVQA 4US1R 3AM1A 1D9XA 4IDHA 4GSYA 3GP8A 1ZINA 4ITRC 1ZC3A 3RHFA 2ONFA 2FFQA 3K0FA 3VU9A 1ZC4A 4Q4AB 3UATA 1OH7A 2ZRMA 2AK3A 2XTMA 5JJIA 2ZRGA 4QM7A 3PR1A 1FZQA 1Z0JA 2WKQA 2CEAA 4DEYA 1X86B 3IDQA 3QBVA 2JLVA 2J59A 1II8A 1GZSA 2YZ2A 1W4CA 2KSQA 4MGIR 5J4VA 1FJGC 1JOSA 3A58B 1O87A 4KFRA 1KK0A 5K8UA 2BEKA 2YKGA 1OH8A 1XWIA 2G0NA 4KI0A 1NY6A 2YVUA 2J0VA 2RGEA 3O8DA 5L3QA 2C95A 1DAHA 3EAQA 3GFPA 4DT1A 1E0KA 2QMOA 4Q1AA 3GEIA 2ZM5A 2ZE5A 4XWOA 2XNDD 1IJFA 3PUVA 3ZDQA 2YC2C 1W49A 1XZPA 2VTKA 3NEYA 3OF5A 2H1LA 2MSDB 4MKFA 4Q4JA 3U44A 5FBQB 1JPNA 1KO5A 2WIBA 4DUGA 1UDWA 3KKMA 2KBFA 2H5EA 2QT1A 4IOJA 4BFUA 4B2LA 4L9WA 1ZVQA 2ODEA 3LBNA 5A5GA 4KBGA 4W5HA 2X8AA 4K0KC 1OE0A 2V4ZA 4LUCA 1E0AA 2PX3A 4KLZA 1IY2A 2AFHE 2BBTA 4XWKA 1WF3A 4JVSB 3SNHA 3OAAA 1N6LA 2EVWX 4BASA 4FI3C 1CR4A 1YZUA 1ZD8A 1HT2E 1YKSA 2CE7A 2ZR9A 3QXXA 4PC2A 2AN9A 4UNRA 4XD7D 4OHWA 4R7ZA 1AK2A 3TR0A 1YZKA 1E2QA 2ZREA 4LX0A 1KI6A 4MRNA 4D81A 4F38A 2RGCA 3GLHA 3MGCA 1PZNA 2ZITA 1G17A 1JQJC 2C99A 2F3TA 4HDCA 3VR4A 4EIWA 1U98A 1YHNA 3CO5A 3GLIA 4D0NA 2E9SA 4GMDA 3G5UA 3TK1A 5EXPA 4OL0A 4M1YA 4QOSA 2ORVA 3K0AB 1MKYA 5GJCA 4L5BA 1D6JA 1F48A 3M0EA 5J47A 2OT3B 5CDFA 3WMGA 1HH2P 2YOFA 2W6IA 4OJKA 4PAQA 1NMXA 5JEDA 3KUCA 1KYIA 3MFYA 3NBZC 2Z0MA 1KHTA 4LK2A 1NSFA 4RZXA 3TUZC 4B3TC 2EWWA 4JL6A 3EZ6A 1GITA 1GKYA 3TBKA 1YU9A 2B21A 3DOEA 4DR1C 3IEVA 2DR3A 2UZ3A 3WXMA 4BGDA 4JKIA 1X1RA 4NCIA 5G3YA 4JT2A 2QP4A 1CULC 1RW4A 1JR3D 1NP6A 1XBTA 4GKJC 3FMIA 2BKUA 5C4MA 2QPOA 2DBYA 4URUR 4BEBA 1N5KA 1R5BA 1ZUHA 4ASUA 4DLZA 2EQBA 4JI4C 4AYXA 3CX8A 2PT5A 721PA 4LF4C 4C2TA 1KJZA 4CEJA 4QHYA 4CGZA 1Z3IX 4RZ3A 2Z4RA 3F5FA 4A0HA 1GRRA 1II9A 2ZS8A 5EJEA 3GFTA 5C46F 1EXMA 1SHKA 1Z6XA 2AKYA 4W7SA 3GKUA 5LMNC 1YZLA 2UU9C 2RGAA 5LBIA 2H92A 2J41A 3TSZA 3U3RA 5CYPA 2VQSA 5E95A 4PC6A 3MG9A 2QI9C 3REFA 4AURA 5IK2D 1N6HA 4MQBA 4B43A 5J4KA 4DCSA 1P73A 5EE5B 2FU5C 3NDPA 4OQFA 1GL6A 3U3KA 3AKYA 3AB3A 4R2HA 3NH9A 4ZCIA 1U8AA 4V0OA 1RZ3A 3BE4A 1RRFA 4QFMA 1G3RA 1W47A 3PENA 2IWHA 1AIPA 5L3SB 2E8EA 3KTAB 2CJWB 4X8HA 4C9BA 3K9GA 4Q21A 3QE0A 2FH5B 3H1TA 1ML8A 2QP3A 2CNWA 2D4HA 3EZFA 2GJAA 3ONWA 5FUWA 4XVRA 2NGRA 3RRYA 1VIAA 5BWMA 1XPUA 4NOZA 2OBNA 4WBSA 2WOJA 1VG1A 3VNUA 2HCBA 2GTPA 1ZNZA 5GVSA 2JJ1A 3MJHA 1HUQA 3R9XA 2V8OA 2QL6A 4TQ9A 1NVXQ 2RGNA 4KO8A 1PVOA 5JMTA 3KKNA 3R7WA 1QHGA 2OZEA 4QGGA 4BFTA 4FWTA 2AKAB 2JAQA 3IEUA 1XB2A 1T9HA 2BIFA 1XFAA 4BFXA 2UXBC 1VG8A 1OT3A 2JLZA 3C15C 3SI7A 2ZE8A 3I5XA 821PA 2WSSA 4CVNA 5HKKD 3M4YA 2C78A 4PZYA 1G18A 4FCTA
chains in the Genus database with same CATH superfamily
1KF0A 4RDCA 5LDHA 3TXYA 1XGKA 2ACKA 2B8EA 4JBHA 2RHMA 1WO8A 5CB0A 2I9KA 1QE3A 3GWZA 3UHJA 4B7CA 1JHQA 4OV6B 2A14A 5CFQA 3K70D 4NJMB 4RZUA 2ZVJA 5AKYA 1ZCAA 2N75A 1AKEA 3MD0A 1MZPA 2IBSA 3IGFA 1DOHA 3QNUA 3FNHA 3EWNA 2A67A 5LM3A 3GF4A 1FFXB 1EWQA 2CHFA 1HL7A 3MNFA 4WGFA 2VJNA 1WSAA 4H60A 5ALGA 1GO2A 3ZHCA 5LDGA 1YZTA 521PA 3AR6A 3MHPA 1JAZA 5JW6A 5KPDA 4G65A 5TIIA 3TAHA 4C1BA 3NJ8A 3SZGA 3EZNA 2BGTA 1H0KA 2PCJA 3KK0A 5EHNA 3O9ZA 2BFEB 4IH4A 1MEJA 3I08A 3JQFA 3HXKA 4ZV7A 2A3RA 2QTCA 4XM2A 4PFSA 3LZDA 1KP2A 4P3KA 1G64A 4XH9B 3NEJA 4ZKEA 2LPMA 4A73A 1I32A 4Q4DA 3U5TA 1KVSA 2I33A 1MRSA 1W36B 5AIAA 4WA8A 1BMFD 2PS3A 2DE0X 2FX3A 1N34C 2CT8A 1BHO1 4BLQA 1YNOA 5LKAA 1Q0TA 3LLSA 4AWXA 3NC0C 3NLLA 1TI7A 4GOLD 2YOGA 1NVFA 1RLOA 1D7AA 4ZTZB 4UD6A 2DX7A 1HGXA 1Z33A 3ANMA 4KAXA 4Y0AA 6REQA 4ZJZA 2JJ2D 4MRMB 5IMSA 1HYEA 4QUAA 3JQ8B 2PD6A 2DYJA 2ZI4A 3PRYA 4ZCLA 4PG8A 4JJ4A 4OXNA 5A9RA 5CA0F 4D02A 1E99A 2H4HA 3KZXA 3JVDA 9GPBA 1AO3A 2J7PA 2VT2A 3QLEA 4FD3A 3E84A 4FS8A 2Y99A 2C9YA 2ZJZA 2W6CX 5ALVA 3HFGA 3IRUA 1ADGA 1YBMA 2BF7A 4G84A 4V2UA 5B3LA 2NMVA 1SUDA 3VZSA 1JEQA 4D0SA 1WBDA 5DWDA 3S82A 1FBTA 2Q99A 1HV8A 4KUEA 3ZWQA 3BMOB 4AF8A 4NNJA 1U28C 5EIAA 3DT6A 3AH8A 1JE0A 1HOXA 1QHFA 1Z5ZA 4RMGA 1J09A 4OHUA 1XVVA 3CRVA 4G5FA 2XDWA 1GSOA 4KGXA 5DTMA 1UR5A 3L1UA 1VCMA 2QAGB 5D1HA 3ORRA 5ALMA 3SR3A 2VDWB 3H8SA 3HB1A 4UE6A 1ZUWA 4LDJA 2CNNA 1K9VF 3P9SA 4AG5A 3OFNA 1RWKA 5ALUA 5G0UA 3NI2A 1ZICA 5CM2Z 4L5JA 3M81A 3FHOA 5F1PA 4M46A 4LFCB 3WNDA 5CB8A 2Y1LA 5K0LA 4LOHA 3MGKA 2I3GA 1TQ6A 3N2IA 5G0VA 4ZVRA 3URMA 4B2PA 4LJ9A 1CDZA 2X40A 4MXDA 1GKUB 2XE4A 4V3CA 4KTVA 4I6GA 1TVKB 3SX4A 3TLZA 5B7GA 1JWAB 5CB4F 3QTTA 4MVYA 1OH6A 2WE7A 2M1ZA 4O6VA 2CLMB 2Y0CA 4NZ9A 4PYMA 4ZOLA 4Q0MA 3Q41A 4BE4A 1LPOA 4UW9A 4BQPA 5KOHA 5CTJA 4HF7A 3A2KA 2JD2A 5DHAA 3IR6A 6NULA 4PWZA 3FDIA 1PF7E 4OMUA 4TUYA 1A9TA 4YCAA 4ARZB 3KEQA 9LDBA 4EY7A 1UIMA 1EESA 3IKVA 5AKLA 1Q84A 1BNCA 1O92A 1BCSA 2OV8A 1QWIA 2V7QA 1XHEA 1QE0A 3C48A 4G5XA 4FWIB 5KQSA 2XNSA 3PLAE 5I7AA 2GASA 3DXFA 4DNFA 3P4YA 6YASA 2ZP1A 5F5LA 5AW0A 1X9IA 2OAGA 1N6OA 3UUFA 5JFGA 1DRUA 5IF9A 1VLHA 3EQ7A 5B2ZA 1CDDA 4D8UA 2VSYA 3G85A 3LWDA 1G8GA 1TJ5A 4A2QA 3TQIA 5M3BA 4O4JF 2XCUA 3N2EA 5DCUA 2OAQ1 4RS4A 4TKUB 2QW0X 4YHHB 3ABSB 2RJOA 4NCHA 4UMFA 1IN7A 1Z2DA 2F00A 1QF9A 5AKKA 4D4MA 4AMGA 1V35A 3TE7A 3Q1LA 1MZVA 3QUSA 3HKEB 4X20A 4L0MA 3FJ1A 1X7YB 3FZNA 5TQ2B 5H83A 4NG4A 3VNSA 1CZNA 1CEEA 1OU0A 3HY6A 3OE4A 3M5PA 3WHPA 3COPA 4DPKA 1WD7A 2GPWA 2UZ1B 3TD6A 1ONSA 3WHIA 3WRWA 3ZBTA 4F8EA 2Q27A 1KY2A 2X8WA 3P0FA 2JA2A 4HQLA 1DG1G 3ZX4A 2WQ6A 3GDFA 4LTDA 4D6PA 3H2KA 5C4GB 4Z2AA 1PSDA 4HYTA 1XMJA 2C9ZA 1D9ZA 2VDKB 1B8OA 2ZI6A 1J25A 3IT3A 4G4IA 4YV2A 1M2JA 3U16A 3DLBA 2R00C 1XRQA 3ABOB 3BK2A 1ZSVA 1A9ZA 2R1TB 1RXVA 4CM6A 4BJ1A 3B38A 4NS4A 5A2GA 3IXLA 1OR8A 3FROA 2WOOA 1YBFA 4QNMA 3TTTA 2H2GA 4DC9A 1GG2A 3WO0A 4PAOA 3GXOA 3U31A 3NH6A 1ZN8A 4BTEA 2IPMA 2Q3DA 3O4HA 2F90A 4LFBB 3DVAA 2F48A 3I04M 3M70A 5K03A 4PBSA 2I4TA 1JHDA 2JVKA 5DMHA 1MOZA 1F8FA 2H17A 3Q8MA 2GHTA 2L19A 1ZH6A 2XWJI 5H4GA 1NYRA 4GEGA 3THYA 2ZRJA 2WHEA 5BSEA 3C6QA 4OHRA 4HAZA 2V7TA 5GM2A 2Y9PB 4MV5A 1H8ED 3RFCA 4BV8A 1VCIA 1YRQA 2OL4A 4PXAA 3PD1A 1SIUA 1RLMA 2YV3A 3GA5A 2GSWA 2FX5A 3UMVA 4XRRA 3S7ZA 4BMCA 3LL7A 3NC1C 3B8HA 4CHGA 3BZBA 3AFOA 2C2KA 5BQ3A 2OZLA 3DTVB 4KGZA 2ZSAA 1VJ0A 1K8XB 2A88A 3WB0A 2E55A 4C0AC 4E03A 1W59A 4NEGA 4GZ5A 2OKGA 4GVXA 4RPJA 1D1PA 5CT6A 2HYDA 3KPVA 1TT7A 1YRBA 2FVXA 4KLAA 5IUKC 5IT5A 2GX6A 4GWLA 4IS2A 3T95A 5HR5A 4CG1A 2H5IA 1O5OA 5LB4A 1EVLA 4E94A 2G72A 3U81A 4RTQA 2EX4A 2H7VA 4M49A 4Z4IA 4BNYA 4NFLA 5DYNA 3WLEA 3ZWVA 3B1VA 4Q6BA 1W5FA 4EM6A 3IV7A 4CLHA 4G5YA 1Q50A 1DO2A 4M1OA 1D03A 1H1LA 1U94A 2R8ZA 1GL7A 1U1DA 2ZWIA 4OM8A 4YCBA 3A8TA 2YRFA 3GJ0A 7GPBA 3A1FA 5JNWA 4B3MB 5BW6B 2ZDHA 2GVNA 5ED0A 3UIEA 2ZUCA 4UUMA 3GZNA 2X7JA 1GPWB 4IIVA 1TAHA 1W87A 4HBZA 4XLTA 5CDYA 1G41A 4BAGA 4D9CA 1JU3A 2D1FA 4FQ8A 1TO1E 3NPDA 3CVVA 3FPLA 5KOJA 5B3JC 2PQ0A 3V1LA 3ZNQA 4K05A 1ILWA 5IJXA 4Z3OA 3RDPA 1WP9A 1ZCZA 2PDAA 2YUTA 3CUUA 3N75A 3P9PA 2WBLC 3IPLA 3IKLA 5DOVA 5A9SB 3DDHA 1XLTA 5D86A 4QHSA 3UC9A 3I9LA 2BEVB 5IH3A 2ZWPA 5FUYA 3A11A 1I5RA 3Q3JB 4IVRA 2ODBA 3G9TA 3LXXA 5TRTA 1JECA 3H17A 2ZTUA 2ZJ2A 3I28A 4LRUA 2XHZA 5IP5A 1DKRA 4BZPA 1GZ4A 1ZOLA 2VP2A 3WS7A 3MJTA 1ARZA 3VPGA 4JWTA 1JG4A 1R27A 4QKQA 1ZJZA 5LB2A 5FI5A 3STTA 3TBHA 2W2MA 3P0EA 4B3IA 1IQRA 2E21A 2FUG6 3RVRA 1Q17A 2GS9A 3ZDCA 1DAPA 3RD5A 4ARCA 4IEEA 1JJ7A 3EA5A 3WYDA 3Q3CA 1KZYC 3L7IA 3WK9A 2YZNA 4L7VA 3VOAA 3H1EA 1U0GA 3AJRA 2XJ4A 2PUFA 2VP0A 3UJ9A 1AXEA 5IKMA 1RZVA 3MJDA 2FZLA 1GKLA 4DUZC 1WZEA 2B1IA 2AJCA 1VSTA 2F4NA 5ANRB 3OO1A 1NQ5A 3CHYA 2EGTA 1T0JB 3IBFA 5IVKA 1NXWA 1DJOA 4M9QA 2RK3A 5EVJA 4OHXA 1KR2A 1TT5B 4D79A 3K16A 4QIHA 2R8EA 2ZJBA 3IVRA 1MGOA 5A3VA 4C29A 1UZUA 4YJFA 1WHTB 3VSEA 1O93A 4HOYA 2E5FA 1M7BA 5IYZF 4TV9A 1NRWA 2PQ6A 2QJWA 2E5LC 4WX2B 3D0RA 1KMMA 3V8NA 2BKLA 3LX6A 4JR1A 4S04A 3VM6A 3DL7A 4QU5A 4EW1A 1CP2A 1JR3A 4MOWA 3T5TA 3HBNA 4QSMA 1NQXA 5DI9A 3PQDA 4G24A 3K0CA 5T8KC 1Y63A 1DSSG 1NF3A 3TE6A 1RP1A 5KNBA 2RGNC 1W88A 5IC6A 3EGEA 4J0DA 2Y0EA 3WFJA 3ZCRA 1QRAA 5B1YA 3QKUA 4MWSA 4XYBA 1VIDA 4BVGA 5EMHA 4DV2C 3UJ3X 2DERA 4LJSA 4F1WA 4OYLA 3TECE 1RBYA 3LCMA 3I6YA 4MRRA 5C8ZA 2J5BA 3ACBA 4YAUA 4XDYA 3GRKA 1MORA 2PRIA 1OIVA 4E32A 1XXHA 4DQLA 5DNAA 4LY9A 3LCUA 1RJGA 3IA2A 3PI6A 4YN3A 1Z7BA 1Q0HA 4ZVQA 5U1PA 4I1UA 1E2PA 1N0UA 3IV9A 1NMSA 1KSFX 1WVIA 2H0QA 1JG7A 3VO9A 1A95A 3L4BC 3JSXA 1RRMA 2H29A 2EW8A 2XDQA 5L8VA 3H8JA 1OJ7A 1BX3A 2D0OB 3EDOA 4MUJA 1XDGA 4BVFA 1NVBA 3JWHA 3GAFA 5J1SB 3IRVA 3ELYA 2VUTA 3ZZ0A 1BU5A 4B4UA 4HUQB 4KPUB 3SHVA 3NHRA 4EMTA 3AESA 5C5CA 5TGDA 2PT6A 3AG6A 4E22A 2RGRA 1YS1X 4BMVA 1B0UA 2PA3A 3FLMA 3O03A 1XWFA 2PZFA 1ZBDA 4H4DA 1XQWA 4DCVA 1IIRA 1C1DA 2H48A 3FR8A 3S2GA 4EFMA 4BFLA 1P7WA 2HT1A 1FMLA 3VR2D 2XRFA 1N2XA 2QN7A 3EZXA 3IEPA 1YS6A 4E0BA 3IUQA 3SYNA 3UUGA 3ZX5A 5I48A 4NCNA 4KFUA 5EXDA 3PRJA 1TYDE 3EH1A 3KUXA 5LXTF 2H1WA 1FPQA 2R5WA 3ANTA 1F4VA 2ZE6A 4F9GA 2FWAA 2ZJ1A 3JYQA 1Y1RA 2VXYA 4GGOA 4XIIA 2CLFB 1P7VA 2IUSA 3FYHA 4X91A 3V4OA 3JYHA 4A8TA 1NU6A 2VNIA 1KY3A 2P5YA 3HVKA 3NIBA 3EXEB 4WOJA 2V5AA 2OVFA 3K9WA 5CVJA 5TY0A 3V8QA 3VNAA 3X0DA 1ECJA 1DC4A 1YHZA 2QPAA 2RDMA 3GLGB 2FPPB 4AD8A 3BGOS 4C05A 2P9FA 3QPVA 3IHLA 3AVTA 4ED9A 1QP4A 3ZD6A 2P2LA 1NYEA 2ZYGA 3KSBC 3EJ6A 2Z5LA 5EJAA 1V4NA 1DI0A 3RGGA 3WLSA 4QO7A 4TWBA 5I7OA 4TQUS 1SBYA 5G2OA 1FW6A 2CY1A 1PQWA 2GVDC 2QSYA 1JVNA 4GBJA 1R2QA 4MVWA 4ACBA 1UC8A 2H3HA 4M87A 2KPOA 3W5IA 1X7DA 3I5MA 3A6LA 4QJ5A 3VSCA 3A2MA 4LXHA 5HK9A 2VRCA 3GAAA 1GNTA 1ISPA 3DEFA 3IAHA 4GX5A 3V1UA 2WICA 3GCDA 4P31A 4N0QA 4Z51A 1ZVVA 3I1YA 3CR3C 2JLBA 1J2JA 4ARZA 2YW2A 3OE7D 4C08A 3D0KA 3TKYA 4OFXA 5J2TA 5C53B 2IV7A 4D92A 2ZJ7A 4KMSA 1HE2A 3T3GA 4OSEA 3HH8A 4JIMA 3O2NA 4NBLA 3UAOA 5JAOA 1C9DB 4CMAA 5DNDA 2GPTA 5ARCA 3WA7A 2JLSA 3TI7A 2W37A 3SNKA 4EVSA 3EEOA 5JS6A 2IZ5A 5DEOA 1NY5A 1ODIA 4WCFA 4JSYA 1DDGA 1QYWA 5EJ5A 3DNMA 3P9IA 3RRNA 4DJEC 2O0JA 3VC7A 2EKLA 3FUCA 1S02A 3MQFA 1WMDA 1P1RA 1PR2A 3GJ5A 1JG1A 4CTNA 5KJFA 1CG6A 2Z57A 1D8TA 1N2BA 1VM6A 2HREA 3ROEA 1GSHA 3KJIA 1EK1A 2NN3C 1UPCA 1J06A 2VYVA 3QUQA 4LI0A 4B6QA 5DGHA 4FYXA 3DE4X 4HZGA 4QNRA 2YY7A 3DYIA 5A2QD 5H59A 3OMLA 2JI9A 1CHNA 2QRUA 4PXYA 4BVBA 4XVUA 3TRJA 1Z39A 1UK8A 1M1YB 4GPBA 5CT4A 3A10A 1R9GA 4WD3A 1EUYA 2BPOA 4KAFA 4LTMA 5ITWA 4TPKA 1U0FA 1VP3A 2COKA 1QGAA 4DC0A 4ZK2A 1KI8A 1KI9A 3C8HA 3P7MA 2BBWA 2O05A 2VHQA 3VC3A 5DW0A 2EJUA 3L6OO 1EHIA 3SYRA 1RSZA 4RD4A 2HEGA 4I9FA 3U2QA 2RBKA 1UKAA 1E2FA 3SJCA 2Q5HA 3L5KA 5CH8A 5TNXA 1U0LA 1F3OA 1XA0A 4R7GA 4XQ0A 4ID3A 4DSAA 4REOA 4I1PA 4CGYA 4Q7KA 4TUYF 2VH5R 1MMFB 2JGFA 1DUVG 4Y6SA 3KKOA 4O4LB 1QAQA 2YXBA 1MABA 4K6MA 4M89A 2GXSA 4TWJA 3WYBA 1TGYA 4PZEA 1R0SA 2PR2A 3CKKA 3C3KA 2XCQA 3O21A 5C1BA 4JB3A 2IYZA 1QX4A 4LE2A 3UAWA 3V80A 4P3XA 3DJYA 2I4IA 3A32A 3QLUC 4N5DA 1OLSA 4FR2A 4R2JA 3DL4A 1VQ1A 5IBCA 5CVUA 4BNKA 1MLDA 4W5OA 4EUEA 4YRZA 3G5TA 1V16A 4JGGA 1MAAA 2R7AA 4G0XA 3G7NA 3LK6A 3PDIB 2VIIA 4FEGA 4PO1A 2FX2A 3RJZA 3PFHA 3BB1A 4UNNA 4E21A 2XHEA 3W4IA 5KB3A 3HBLA 1C1XA 5AJXA 2VN8A 3I2KA 4OYYA 2P3LA 2IDJA 1XCGB 2PNFA 4QOJA 3RF6A 3DR3A 3TTXA 4BMSA 4CT4B 1GZ3A 5JBIA 1N5DA 2HHCA 2XOKD 2ZSUA 3DEHA 5JECA 3IODA 4G5RA 3R09A 3O8OB 3K0KA 1YZFA 4EGCB 2VF8A 3RYFB 2D2EA 2O0HA 3CQ9A 3AINA 1KVUA 3KWMA 5LMZA 2PD4A 3V4LA 4P2GA 3GJ7A 3ZKWB 1B0PA 1O94A 4PO9A 1RJWA 2UU9B 3FCOA 1E0DA 2OWEA 2P75A 2ZLBA 4MQLA 4R6WA 1RXEA 2VHWA 4EWLA 2FN7A 4KOEC 1WZNA 1GUDA 5FKJA 2PSFA 5I9SA 2LKCA 3T3EA 2GCEA 2V7XA 5K3BA 4BB5A 5HRCA 4BXOA 1JT2A 2ZBRA 2O2JA 3G8YA 5JWHA 1Q1EA 5EE0A 3UENA 5GIOE 2X8LA 5IKEA 4LC0A 3ZY4A 4EW3A 3O8CA 1C0PA 3FVVA 3C3DA 3VU3A 1GTG1 1N0IA 2RC6A 3NJRA 1EFRD 5G4LA 4HG2A 4WKCA 2RAPA 4A5OA 1O95D 3THWB 1C7FA 4N76A 1P4EA 3D4LA 1SK9A 3AB7A 3TUJC 4NZZA 4L76A 3O75A 1G8KA 4CHTA 3VO1A 2QG6A 1G21A 1S7GA 1ITZA 1H2ZA 2NO9A 1GKKA 4U8HA 3W8FA 1ZUNB 2ZR8A 3JWJA 1YIAA 3L0PA 4IUBS 4IGEA 1F0KA 1TQ2A 4ND8A 2NNWB 4FFBA 4KUHA 4LRYA 4WVFA 2W11A 3IULA 7AT1A 5K3OA 4DEXA 1EMDA 2FZEA 2DKOA 3BSFA 1BDIA 2Q41A 2J6HA 1Z47A 3KQTA 3D3WB 3JVUA 4CLRA 3H2HA 4EY4A 5DKFA 3CZRA 4A23A 2WNIA 2EG5A 3KQYA 1XVTA 3KZCA 4Q34A 3L3BA 2Y1FA 3VKUA 3C41J 2O2GA 3OZAA 4YA6A 4TLBA 3OEHD 3RYHB 1U8TA 3KQQA 4TXNA 4C4PA 4DIKA 1CQIB 2JCGA 1ZRNA 4F6CA 5DGTA 1OZFA 1IAVA 3BRCA 2D5LA 3QOWA 2IEGA 4RYDA 2X22A 2HV9A 4G41A 4DV6C 1KXZA 5AJWA 2FDCA 4FZ5A 4YCLA 1W36D 2PUVA 2XB8A 3ADBA 4KXFB 1GTMA 5EMLA 1TUBB 4PYKA 4RC9A 4EGSA 3LECA 4UAUA 2IS1A 4HH1A 4K9MA 3FMPB 3S6JA 5AVXA 4YRRA 1G8MA 4IVQA 1L5HB 2PX8A 1W35A 1AV6A 4U6QA 4LJYA 4PHHA 3I07A 2UVPA 2H2FA 3QUTA 3PHHA 3DO5A 1Y9EA 4EZEA 4LSZA 1I3OA 1B2RA 2CWDA 3OTOB 3SZLA 3QGMA 3ZDZB 4A16A 5CFMA 4TGLA 1CIVA 4HSEA 3OEYA 4OQEA 4HWPA 3SHQA 1E1QD 3N0RA 5AJTA 2DU8A 4PFJA 3TPCA 1JHZA 1HH4A 4OHMA 4JI8B 4Z4EA 5MFZA 5JRHA 1GADO 2W8BA 2D7VA 2I4LA 1FU7A 3B9PA 2AFHB 4FOLA 4PAGA 2E1RA 4N5LA 1VA4A 1QV6A 1OXVA 3M2TA 4X1OA 5KX5F 5KYGA 4U2FA 1NZJA 3LQYA 3N2KB 3P71T 4X41A 3EZLA 3W2GA 3JASA 4R8VA 1U2RA 3G02A 5JDIC 5ECGC 4UREA 1KS9A 5T7BA 3O8LA 1JQKA 1P7ZA 1QVAA 2PKYX 1OZGA 2GO1A 1Q3TA 2RBEA 2ORWA 2REQA 1NBEA 3QUBA 3VRHA 4DHWA 3I2HA 4ES6A 1T2NA 1M1ZA 3O4RA 5AOBA 4FKZA 2Z30A 4FDMA 2FP3A 1XTIA 4OY3A 2V6MA 1UPFA 2PFKA 3WLMA 3ZGZA 1X14A 3BDIA 4W1SA 1XCJA 3DW3X 5D3MA 1Y48E 1YRAA 3D7RA 5HIJA 1XTBA 5C1DA 2P2BA 1J49A 2XPCA 1URPA 4BCCA 2ZJOA 4ALMA 1EBFA 4BX0A 4D4KA 3OFKA 5BNTA 4L8YA 3ZHYA 2QR3A 1ZPDA 3DDZX 4O2AB 4Q3CA 1ORHA 4WWHA 3NM5A 3LGAA 3G1WA 1Q15A 1U7ZA 1R9JA 2C57A 4BCDA 5K8CA 2UUAB 1NI5A 2IEBA 3DD5A 3VR5D 5BOSB 5KNCA 3WGJA 2XTAA 5I9BA 4OHZA 5HNKA 1PBNA 1UJ4A 1KAEA 2G9UA 3DQPA 2WJIA 3B1XA 3EIQA 4HATA 4HXFB 2UUCB 2YIDA 4HQFA 2HU5A 1T29A 3OT1B 1K8YB 1BJRE 2ZTMA 3A26A 3IJ5A 2J9XB 4HGZA 1BA3A 1W0JD 5AJUA 2FG7C 2WRZA 3TPFA 2R8OA 4CMJA 1QOPB 2VC2B 3JQ7B 4CKXA 5ALNA 4NDNA 1DWQA 3Q7QA 3CZ5A 3PEUA 4TV9F 3FBWA 2G1JA 3ILXA 3G1TA 4HLUC 1OHHD 4BBYA 2NU9A 4DJJA 1JVSA 4YYEA 5KZMB 3P4XA 3H1PA 1JMKC 1V41E 1NMQA 3RG8A 3IAFA 4Q82A 4C21A 5EKXA 4FR5A 5IDXA 2J0UB 2OKCA 3M9LA 2FMXA 3H5IA 2OCAA 5U9CA 3E53A 3JALB 4R2IA 1IEXA 1AXGA 1J42A 3P2EA 4M0MA 5I5GA 2XJ9A 2YWXA 3EGIA 5MGBA 1KC1A 4Q9NA 3I1FA 3ZGOA 1SCNE 3ED5A 3N2GB 4K1LA 1LI5A 3CLVA 4RV4A 3SLGA 1Z4MA 5FTNA 1QNFA 4TRJA 5H82A 1HNZB 3MB8A 3AR5A 3FVRA 4FDTA 4O4JB 2XSZD 4EITA 3UK6A 2EJTA 2PLRA 1AZSC 4C0KA 2AOTB 2G80A 1P4JA 2Q1WA 4XW2A 2J9FB 4IILA 2QTNA 3UV3A 2GZHA 4DCJA 3QWIA 5I7UA 2L18A 4DPLA 3EVGA 4RANA 3G3EA 4CMEC 3TQTA 4RK4A 5KVSA 4ZO7A 3I2GA 4C0BA 1SJ9A 2A5DA 1DKQA 2HIMA 2ZI9A 2ZJFA 3WIOA 4U8GA 1QYDA 4OUDA 2HM7A 4KPYA 1TF7A 3PUHA 2XV1A 2JIPA 2FFBA 3H5VA 3SF8A 1OBFO 1U6KA 1YFLA 3OPQA 5L53A 3GR0A 4HVAA 5IJAA 3B1FA 5TF0A 1WMEA 2RJNA 4QGSA 4LSGA 2NLOA 3C3CA 4IDBA 1O58A 1HWYA 4FGLA 1KY5A 4JBYA 1X8KA 2G83A 2AFVA 2JVJA 2IYAA 1AKVA 1QSGA 4A7PA 5LQNA 3UT5A 1GQYA 3FOFC 2GKOA 2WVJA 1B0AA 2WF6A 5F64A 2M6LA 4JYAB 1DKNA 1MXFA 4LXUA 4B7ZA 4PFQA 3UZUA 4OHYA 3R0IA 1Y6ZA 5BWLA 1R74A 1PJRA 1EVIA 1Z07A 4GEKA 1DJNA 4GXTA 1A9QA 3K70C 4LJ8A 3V32A 3GUUA 3BKXA 5AFSA 4FYWA 4IDNA 4BTLA 5CD1A 3FKSA 3ZNPA 3ADCA 2HSDA 3KZ1E 3WK5A 2QZ4A 3I5UA 1AK9A 1H3FA 1HNXB 1VBNA 1H5UA 2DC1A 1JHOA 2IEZA 3WLQA 1OLUA 5H9WA 5SZHB 2JGJA 4U02A 1NRIA 3L95X 3QXSA 3MCVA 4L57A 3WL8A 4AMZA 1G98A 5JD3A 3BFXA 4WH0A 1B1AA 2V9ZA 3K15A 3ER9A 2CWWA 2P1ZA 2WMYA 4JITA 1YAHA 1Z4PX 4IIJA 4NWIA 1CB0A 3DTVD 1QH0A 3PS9A 2PSDA 1E7WA 4D9EA 3PE3A 4S2EA 1P7LA 1TEHA 3U60B 1H23A 4TN1A 5AUQA 2GJSA 2GNPA 2A84A 2HSWA 2O8EA 3I04A 1EDDA 4LGMA 1I7QB 2OO4A 3DFMA 3ZV7A 4X71A 4MZDA 1M1UA 4R5HA 4MQ6A 3DDWA 4Q4JB 3R77A 4EDFA 3U44B 4PCLA 4RAOA 2IE8A 4J0QA 2CVZA 5G02A 5IDQA 4BFZA 2EP7A 2EBHX 3GIDA 3LO8A 1N5IA 1ZWLA 2JC3A 4S1WA 4D4LA 2CW5A 5LMUC 2V4UA 5C2JB 1LV7A 3FB4A 1CUGA 1X8LA 4CKWB 3A4MA 5K0SA 4GOMD 3ZTYA 4AYWA 2VAPA 1VGVA 4I7EA 5AE2A 4B3RB 1LBHA 2Z51A 2DQYA 2FXIA 1M73E 3LT0A 1EJ6A 2JFXA 3NRCA 4GMXA 4AQ7A 2ZZKA 3ENVA 1EX7A 2FPXA 2DHCA 1YGYA 1IATA 1Q1AA 1YS9A 3K1TA 1WCIB 3I4CA 1L4YA 2YZKA 1NVKA 4M1TA 3KM0A 3KVYA 1YL6A 1C80A 2C98A 4B87A 1HSOA 2GLTA 3PF9A 4L73A 1O96A 3GLIB 1Z17A 5B30A 3RVPA 3H19A 1RS0A 3HKBA 3CPHA 3VHXA 4LHZA 1YJ5A 2UUOA 1N3LA 2GA9A 4I8IA 3PXGA 3BSYA 1BDHA 4CLEA 4GH5A 3OKCA 1J00A 2RGWA 1C7RA 4D8XA 4KI7A 2ECOA 2LCFA 1CK4A 1GGFA 2YZGA 3EC2A 5IDYA 3DVSX 4IOKA 1UMCA 4U3JB 4UZFA 4YJKA 4EI8A 1TL7C 2BCJQ 3IKJA 3K32A 4EGAA 3LDUA 4E30A 4IF4A 2X14A 2H2IA 2QTHA 4TWRA 1U1FA 4ZV4A 3B1YA 1RMYA 4J9UE 5AHOA 4JB8A 5JAQA 2OCKA 3T5AA 1T1IA 3E35A 1Y81A 4ARIA 5KYXB 1DTSA 2H4YA 4K9OA 3IEXA 2B6HA 5HM8A 3WB9A 5KTYA 3ZHBA 2FFRA 1AGYA 2CLKB 3D7MA 3HKCB 4BZZA 1P0QA 4NP6A 5IC5A 4Q3DA 1G2QA 1DOAA 2O3SA 4AJLA 5HIAA 1E98A 4TMKA 2HB6A 1J0BA 3UOGA 2D27A 4G36A 2AK2A 4OIFA 1JFRA 4CEJB 5DTJA 4YV1A 2A9KA 2B92A 2HADA 2OCGA 2POCA 3M3HA 3OOWA 3IAM1 5D3MB 5FPYA 3F6CA 1DEKA 2GDZA 2PAFA 2R25B 3T7RA 2P6OA 2C07A 1JHVA 1FU8A 2FW8A 3L07A 3GVIA 3LCRA 5EJ2A 8AT1A 1AUVA 4XIJA 1ZRSA 1Z88A 2H5LA 3ZCSA 2IV3A 4KH1A 4C1NA 2TRSB 4J16A 4G5GA 3K4PA 3VKFA 2HTFA 1PX0A 5IYZB 4ZEOA 1SXGA 3F6EX 4QXOA 5D01A 5IBRA 3HR8A 3HSKA 3X1MA 4WJLA 4U2BA 3ZGNA 3LKBA 2ZS7A 4XVHA 2KLHA 2BKEA 2PYDA 1MC8A 3DFIA 1KJYA 3L0SA 2JI4A 1ID1A 4O5OA 2IHYA 5MDHA 2G4CA 1OUMA 5DASA 3U6BA 1XNRB 1HEUA 5FBZA 2H9AA 4LJKA 4JI6B 4YS6A 4Z1MA 4G1VA 4B6FA 1R6XA 1XKTA 2F55A 2YWRA 3EIUA 5FTWA 3PPYA 1L7QA 1Y80A 3NO4A 2WA2A 2HHHB 1XF9A 3GG9A 5AVTA 3H6KA 2AOUA 4FFPA 3R8XA 4C89A 1DXYA 2DSTA 2VJMA 3E3AA 2O1EA 3L8EA 4TV8A 1QF7A 4EF6A 1JDVA 3L2OB 3HUDA 4XCQA 2IS2A 1KOFA 5H68A 1UAGA 3TOCA 1G20B 2BJOA 2IC5A 2E1PA 1BQ3A 4DQKA 4EG6A 1PZGA 3K9QO 1NI4A 4EYEA 3WJ1A 1BXZA 4O2RA 3TJMA 2A1TR 1TYBE 2J3EA 2PSSA 1OX4A 5GIPE 4WNYA 1W4BA 4TWIA 2NTVA 3FHLA 3G89A 4YMIA 3KT3A 2PNJA 3ZQKA 4BN5A 4ZGBA 2OXCA 3R9XB 2HJGA 1SUFA 2OECA 4FSHA 4ZC1A 2H4XA 2NZWA 1AA6A 4QELA 3R7WB 2XYHA 1KMCA 1EEXB 2G9NA 2E6KA 2I6FA 3IIEA 3TSWA 3I01M 4OLBA 1VIYA 2FZ4A 2J9GA 3PUZA 3EBLA 2DH6A 4RNDB 5HIKA 3R6TA 2JHGA 1XTSA 2P2ZA 4LTNA 3O3CA 4P98A 4RORA 3RSOA 4R69A 5FDFA 3QVJA 1UKBA 5ICEA 3EYAA 1MQ9A 4EB6B 1JTFA 1S2IA 4NEQA 4JWKA 1OSNA 3HZOA 4YO8A 3T7CA 3DDOA 3VOBA 4KIFA 1NBME 4I08A 2RHBA 1JV2B 1Z5UA 3HFJA 4R9NA 5CLFA 5FOWA 3E9QA 3SYMA 2R3SA 2WJ6A 2NM0A 1Q3HA 1I5OA 1XRRA 2VO1A 3GARA 4FZVA 4I2NA 4OBEA 4QOEA 4TLAA 5IN4A 3BXXA 1O90A 3I73A 3D2CA 1JKMA 3F2IA 5BOVA 2DBZA 3CLKA 2ZUFA 2AOXA 4JJEA 1ST3A 3I6QA 3JPWA 3TLXA 5K8IA 3ZHVA 4ZT4A 4U7GA 5B7QA 1QMGA 4L5IA 4B3BA 1TGVA 4MV9A 3NNNA 4RDIA 4CW7A 1PJLA 1P33A 1J8QA 4PZDA 1YRHA 4KQGA 4BJHB 4YXWD 2H4WA 1H85A 4MEBA 4HH3C 5FF9A 5BV7A 3MAJA 4GDMA 1VSBA 3UMRA 2EGHA 2XZTA 5KVAA 5GP1A 2NG1A 4E33A 2N42A 2BONA 4RTOA 1M1YE 4TRRA 3Q9NA 2OK8A 1IXKA 3RJTA 2CNBA 2F67A 2ISCA 4KWHA 4FE4A 3I34X 4A4DA 1F0YA 2QBYB 4XWAA 2V6IA 3EGCA 1EXVA 3OZEA 1OXXK 4GBMA 3K1JA 3MWLA 4XLLA 1MB0A 2WJHA 3DMNA 1FNMA 3KYJB 2GYWA 3G23A 2O50A 1CUHA 3NANA 4HZIA 3NDJA 3ENQA 3ZDFA 4BUCA 4CQMA 4OVKA 3RC3A 6REQB 2O6LA 4E08A 3RYTC 1NBIA 4AYTA 2ZR0A 2X2EA 1WU7A 4X7PA 1THTA 1KYQA 1DAIA 2X1VA 4RQAA 2DEUA 4OX9B 5K4GA 2CNOA 2DG2A 2FYTA 5CXXA 3W5UA 4BLOA 2G8LA 1DBQA 2Q6IA 1L1RA 2QP9X 3DV2A 2PA0A 3G8AA 3QIVA 1W5EA 4LYAA 1N0WA 2EFHB 2WM8A 4NX2A 3G9XA 2IHBA 5KNLA 3F71A 2OBXA 2VYND 2LCQA 1H2FA 2ES4A 4LYYA 4J3NA 4YRSA 3MIIA 4MUKA 2OB1A 2OG2A 4ZCQA 3RRXA 2A0YA 4GI1A 2P2JA 1FLDA 1V3QE 4HZUA 1TCUA 2XRZA 5F9HA 4DR4C 4XM0A 3MTAA 1H2EA 1KH1A 3OM0A 1EFHA 1ZCBA 1C3OB 3TJZA 3LDFA 4MDEA 3K2QA 4RLFA 2Q7XA 2ZUSA 4J7AA 1NR5A 3P9CA 4LOJA 2XA2A 1XNQC 3CPJB 3P9NA 5JHGB 2W93A 3EVEA 1EFUA 4E31A 1E5VA 3D1LA 1OIXA 3F1KA 1T8PA 4ZREA 4EG3A 4BDSA 5F7OA 3LVBA 3AV0B 1LKZA 1I2AA 3OU6A 3HY4A 1FFHA 3LLCA 5JI2E 4L6CA 4ZFNA 2OD9A 3R7DA 4OHFA 5TR9A 4UEWA 1WAMA 3LW8A 1I0ZA 1T4CA 5IXSA 1UXGA 2FPWA 3RH0A 1UXHA 3DOHA 3I42A 1CYDA 2AFRA 4CF3A 4AX4A 3Q6MA 5EIHA 3I64A 2WMOB 1Y6GA 2H1VA 3LUPA 1VHLA 4ZOLB 3WNCA 1UMBA 3WGUA 4ZHSA