3IEXA

Schistosoma purine nucleoside phosphorylase in complex with guanosine
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
284
structure length
276
Chain Sequence
SVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGGVKDKITIPYTKIPNFPQTSSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine-nucleoside phosphorylase
publication title Structural basis for selective inhibition of purine nucleoside phosphorylase from Schistosoma mansoni: kinetic and structural studies
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
total genus 90
structure length 276
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iexA00
5IU6A 5DK6A 4ECEA 1B8NA 1LV8A 1Z36A 4OF4A 1A9PA 1Y1SA 1Q1GA 4H1TA 1ULBA 1Z37A 2QPLA 1JYSA 4DAOA 1WTAA 1JDTA 4P54A 1V48A 4F1WA 5F7XA 3P0EA 5EUBA 2BSXA 2ON6A 3KHSA 1RSZA 1RCTE 3DF9A 3KU4A 4F3KA 1B8OA 4E1VA 3FUCA 4DAEA 4LKRA 4YNBA 1OUMA 1NC3A 3O4VA 4OY3A 5ETJA 1JDUA 1JDVA 5KB3A 4U2KA 4G8JA 1ECPA 4TTAA 4D98A 4DANA 1U1DA 3D1VA 1SD1A 4WKCA 4QARA 1JP7A 4L6IA 4MCIA 3PHBE 2GUWA 1VMKA 2A0YA 2A0XA 4YO8A 1Z35A 1A9OA 5F77A 1T8SA 1Z33A 4NY1A 4BMXA 4D8XA 1V4NA 3BGSA 2QTGA 3C74A 1JE0A 3KVRA 5JPCA 4G89A 4PR3A 4TTIA 1LX7A 4JWTA 3ONVA 1K3FA 2I8AA 4LZWA 1Y1TA 4F2PA 1ZL2A 1OTXA 3EUEA 1U1GA 4DABA 4GLJA 3OCCA 4TYMA 4LDNA 4D8VA 4G41A 1RXSA 4EB8A 4QEZA 1XE3A 1Y1QA 4WKOA 5B7PA 1YQUA 1PR2A 1Z5NA 3OF3A 4QFBA 1VHWA 4F2WA 1Z38A 2PGAA 1ODKA 5CXQA 3NM6B 4BMYA 3NBQA 3OZBA 3OZCA 1OV6A 3DP9A 3DJFA 2ISCA 1TGVA 2HN9A 3E0QA 1T8YA 1SD2A 1T8WA 3OOEA 1QE5A 1CG6A 1A9SA 1OU4A 2HWUA 4M7WA 5EPUA 3UAVA 3LGSA 4QAQA 1A69A 1OVGA 4OEHA 3KVYA 4TXNA 4BMZA 4DA7A 4OJTA 1PKEA 4NSNA 2QDKA 2HRDA 2A8YA 5EFOA 2Q7OE 1Z5PA 1ZOSA 3UAYA 3EEIA 4TXLA 2HSWA 3PNPA 1V2HE 4BN0A 3IOMA 1TCVA 4EARA 1NC1A 1U1EA 1FXUA 2P4SA 1OTYA 1G2OA 1LVUA 1YBFA 5F73A 5F7JA 4NS1A 4YJKA 1SQ6A 1K9SA 4QATA 1JDZA 2OC9A 1PR6A 3QPBA 1SJ9A 3SCZA 3ODGA 5CYFA 5CXSA 2AI3A 4L5AA 4TS9A 1JPVA 1VHJA 1RXUA 3NM4A 3P0FA 3ENZA 1PK9A 1U1FA 3KVVA 1M73E 4TXJA 5F78A 3OOHA 1V41E 2AI2A 3INYA 4PNPA 4UC0A 1ULAA 1YRYE 3LA8A 1Y1RA 4KN5A 1Y6QA 5B7NA 4GLFA 3BL6A 3OPVA 4TXMA 4L5CA 2AC7A 4L0MA 3FWPA 1Y6RA 4DA8A 2B94A 1T0UA 2OC4A 3EMVA 4LNHA 3UT6A 1RYZA 1ODJA 3KUKA 5B7QA 3DDOA 3F8WA 3UAWA 2XRFA 1PF7E 4IP0A 3UAZA 3GB9A 4D8YA 4TXHA 4MARA 4I2VA 4FFSA 4TTJA 5C80A 1V45E 2OXFA 4DA0A 1C3XA 5F76A 1CB0A 5K1ZA 1JDSA 1YR3A 4RJ2A 3NM5A 3K8OE 3O6VA 1A9RA 1TGYA 3EUFA 1NW4A 5I3CA 5CCDA 5F7OA 3PNSA 4GMHA 2AI1A 4WKPA 5IFKA 3FOWA 1I80A 1PR1A 2OECA 4YMLA 4X24A 1TD1A 1PBNA 4QASA 2I4TA 1PWYE 3TL6A 1Z39A 3K8QA 3GGSA 4OGLA 1U1CA 3MMSA 1Z34A 1PW7A 1PR4A 1RFGE 1T8RA 1N3IA 4JP5A 3U40A 5CCEA 1K27A 2H8GA 4R2XA 1RR6A 1ODLA 3DPSA 1TCUA 3FAZA 2QSUA 4GKAA 4MCHA 2IQ5A 3IEXA 1VFNA 3FNQA 4R31A 5FAKA 1PR5A 4F3CA 2RJ3A 3BJEA 3MB8A 5B7GA 4LNAA 2QTTA 4DARA 1V3QE 3LBAA 4K6OA 4JOSA 3BSFA 4DA6A 3UAXA 4L5YA 4WKNA 1A9QA 4TS3A 1RXCA 1YQQA 4M1EA 2A0WA 4D9HA 1RXYA 5F7ZA 5CYGA 1JE1A 4M3NA 1ODIA 3FB1A 1A9TA 3T94A 1PK7A 3E9RA 1PR0A 1RT9A 3E9ZA 3PHCA 4R2WA 3OZEA 3OZDA 4OGKA 4WKBA 1Z5OA
chains in the Genus database with same CATH superfamily
4N12A 3UKOA 3N8GA 3OQHA 2W6MA 3GRVA 2BFBA 3HUTA 3QQ5A 1DCKA 2C2WA 4K8RB 3VPHA 3LVBA 1QIKA 2VSOA 5KWVA 2ZUUA 2A57A 5KYXB 4BP1A 3DS8A 1RYFA 2HHHB 1R0SA 4C0WA 1Q1GA 3PX3A 2GJ8A 1MRZA 1AIPA 2FXVA 2VYVA 3KX2A 4C0QC 2RHTA 3G9ZA 3L7AA 1DC7A 3R2JA 3RC9A 1GUZA 3DG9A 1V43A 1K66A 1WUJS 5K0CA 2XSZD 3RFFA 4JT8A 4PTYA 3W1EA 2GARA 3FLAA 4TTSA 2B4TO 3G9XA 1EDEA 4Q9LA 3DB1A 3FI0A 2P4EA 4L0QA 3WLSA 2ZIGA 1Z0ZA 3HFSA 3MT8A 1WULS 3EAQA 2NU8B 1KPIA 2CJYA 3IEPA 1VLHA 3QUAA 3V4RA 4MVJG 1WCWA 3DF9A 1FDRA 1E4EA 4QT4A 3NUZA 2QSZA 1UWCA 4L4RA 2OFFA 2PUBA 1QWOA 1WHTB 3E05A 3TZEA 4LRQA 4YNBA 1RWXA 3E3OA 3F9CA 5FP0A 5K0FA 3WRYA 3MWEB 4YDSA 4MWDA 1Y7HA 1UP6A 2W7TA 4M9UA 1R3DA 2A78A 4UNPA 2ZEJA 1CHDA 2P1DA 3AUYA 3EGVA 3E22A 4Y8VA 2W2KB 1SKAA 2WUGA 5ALLA 5AVSA 1WPQA 3VBEA 3DMDA 5KIAA 2O5VA 5EPEA 2DR2A 3T5MA 1P74A 1UFKA 1VJCA 1DQYA 4D97A 4I55A 3TLYA 4FEGA 3FZQA 4WA8A 1DRJA 4NU5A 1FQJA 2VT7A 1XJQA 3K70D 1FFHA 1W0JA 4JQZA 3LKZA 2PFSA 3PDIA 5CNKA 2PGNA 5WRFA 3F5QA 3KALA 1OREA 5FUQA 5L3RA 1YI8A 2NO0A 1JPUA 1DKQA 4I1OA 4LXXA 1I24A 2HBQA 2OBBA 3F8SA 1FEZA 3DUFB 3OLYA 2QVLA 2X22A 4AWAA 4C0AC 2ILTA 2C5AA 3R23A 5LP6A 1BC5A 3TQIA 2CZCA 2B5OA 2G83A 3EQ8A 2XMZA 1XFAA 4BQNA 4M8NE 1CUJA 3BMOA 3KTFA 5K3EA 1D3AA 1DADA 4HAXA 3KS9A 3ZHQA 4MR8A 4YWHA 2FE4A 4IJKA 3X1MA 5F64A 4JK3A 1E66A 5CA1F 4L27A 4UMDA 4N9WA 4CKCB 3OZAA 5KKCA 2V6MA 4RKQA 4NY1A 1TPZA 1Z18A 2HCTA 3A1WA 2IWRA 3HXTA 1HQCA 2FN8A 2HU5A 3DEIA 4GOJA 2FEKA 2CMDA 2M6SA 4WEOA 3ZWOA 3MD0A 3NTRA 4AKEA 1RW4A 2OFWA 1DC5A 5G3YA 4AQDA 3JALB 3D8HA 1D04A 1GUBA 4DTIA 4D25A 1Z73A 2HLDD 4KFRA 2V3VA 4E09A 1YJBA 1QH8B 3IP5A 5DZSA 1I2CA 4G89A 2G9NA 1LX7A 2OCBA 1SURA 4TWJA 2I2BA 2R1TB 2ZRIA 3E9EA 1CIPA 2ATXA 3GLHE 4MUBA 1D2EA 1L7PA 2GH1A 1XMJA 3AP2A 4ZXPA 2ZAOA 5K51A 3UCFA 5C46F 4ZRNA 3T1VA 4ALIA 4QUDA 2WHPB 2Z9DA 4L4SA 1J6UA 1NVVQ 1O94A 5DM2A 3PGKA 5CT6A 1M0SA 5FADA 4MMYB 1PJLA 1G8GA 4K46A 2R4QA 3SG0A 4LRUA 3RC8A 5C52B 1D0VA 5JCOA 1J5EB 4PAWA 4DY4A 3N74A 4D4JA 3ZDYB 2JNWA 4X54A 3UC9A 1RZ3A 2F6RA 2R4UA 2PX0A 3AC0A 1RXSA 1M72A 4IF4A 2VDKB 1XE3A 1W75A 1IB6A 1UFVA 2EP5A 2QWXA 3OWOA 4GS5A 1I30A 1BKSB 2AHOA 2FVXA 1C4OA 2PG3A 2YCBA 4FGUA 2QLTA 4GOXA 4YBRA 4CN9A 3H97A 5BW5A 4IVQA 3FUVA 4K40A 3WO1A 3KR0A 5JS7A 2OQVA 2W71A 4QFBA 3KOOA 4URFA 1NG9A 3PNVA 1KYIA 3O91A 1TLTA 3QI2A 5A5FA 3DKRA 3R41A 2B35A 2EW8A 1V8PA 3SYLA 2OENG 1WXXA 3QWFA 2GAOA 1Z38A 5ERYA 1KRHA 1Y1LA 3GJ3A 1ZU5A 2DETA 2Y1WA 3HB9A 1GLGA 4YMUA 3GUVA 4KQFA 5K6TA 3G0BA 2PUHA 3AIIA 1O7JA 3UMCA 1BWSA 1FCJA 3KUXA 4FUTA 4LWPA 3KQHA 1XNHA 5AHWA 3OZCA 4OREX 1Z4NA 1GNSA 3UB3A 1CP3A 4RZ2A 3WIVA 4D9MA 2HUNA 5LP1A 2ZBFA 2EKLA 1ZK0A 3PFFA 1ZITA 2H18A 2YV3A 4TQGA 1U0LA 5HRAA 1XZ8A 1FMLA 3N6VA 1REQB 4WZAA 3LCJA 3TR5A 1B8UA 1B76A 5KKAA 2JFHA 3AHCA 1YS1X 1H0KA 4WECA 1HMYA 3M3HA 2V4ZA 5JR3A 1BHSA 1O1YA 3WC4A 3NX4A 1E3LA 4U9UA 3EEOA 2LIPA 4QGAA 2X8BA 3BZBA 1AZWA 4UQOA 2LKCA 2XCIA 1UH5A 1TJNA 3HZHA 4IRUB 2QVCA 4L74A 3QBTA 5FF9A 3RGGA 1M7HA 3EFOB 3NIBA 5HUJA 5IJ9A 2GOYA 1TC1A 4O4HA 2OHIA 4DWOA 3Q5GA 4WH0A 3HDHA 2H2DA 1YB1A 2PT6A 4MVJH 3ILVA 1R8XA 2PVSA 2QN7A 3CWZA 4HLDA 3F73A 4NCIA 2XYHA 1G21E 3MM4A 1K6XA 3MAJA 3U61B 4IL5A 1QFXA 3SNHA 1AQNA 3CIFA 5IASA 5J9FA 4BFWA 2YHUA 4OHMA 3WHLA 4HBZA 2FSPA 2L0XA 3FNHA 2BGIA 4FCVA 2O8EB 3HQ4O 1MX9A 2A9QA 3I42A 3I2YX 3P97A 4YJ3B 1OLUB 5EFOA 3KUDA 2PPLA 2JLCA 3CQ9A 4JASB 4O3FA 2KBEA 3HKEB 2HK9A 5IVIA 3JAKB 1AS0A 2RCNA 2OP1A 5JECA 4QOSA 2QD3A 3FNBA 3O1IC 5EJ2A 4N8EA 3EH1A 5H0IA 5LLSA 3V1YA 1BDHA 3R0JA 3KJFA 1GKYA 3OKAA 4OVKA 2Z5VA 1II8A 3AMVA 3U16A 5KTKA 2YR0A 4O4JF 2FE1A 1VJDA 2DSNA 5TMEA 2LCQA 4N7MA 5CVCA 2EWVA 4E1BA 2HZBA 1SQ0A 3DB2A 5LQSA 3FTCA 4KWCA 1LX6A 1JHDA 2HDOA 3UGTA 1ULUA 1TVCA 4DR6B 1R0RE 2SECE 1BSVA 1Q5PA 2XXBA 4XM0A 3CCFA 1AA9A 3WISA 3E5RA 4URZR 3HL4A 4FB5A 3ECSA 4OQMA 3FOZA 1CS4C 1VKOA 2IOFK 1YRAA 2P6NA 1IN7A 3DLCA 5EJGA 1JDZA 4EI9A 1SJ9A 3LJKA 1CRPA 3PITA 2VDWB 2BP7B 4G0VA 1LTHR 1CUIA 3KQPA 2CHUA 5CYFA 2QUIA 2YOFA 2VEDA 2VHXA 1A2QA 4OHPA 1WHSB 2J3IA 2VBIA 3BSSA 4S1PA 4TL6A 1FUYB 3BB3A 4MZDA 4OUKX 1EGVB 2HF2A 4IPTA 4A3SA 1ZEMA 2GAAA 3ICQB 1FFXA 3KVVA 3LUFA 1EFVA 4M98A 3O2NA 4GPD1 2EGGA 3W6NA 4XYLA 2R1UA 5CLLA 3RBVA 4WE3A 3FMPB 3BH0A 3DDCA 4HNUA 3VU3A 3FVTA 1GUDA 4TMYA 1TKRA 3C5HA 1DWUA 4FNMA 3AKYA 4YAIA 1DARA 3HZZA 2F1JA 4PPGA 4KITB 2OHFA 1JRLA 4A1OA 4JXJA 2W6JD 3BL6A 4BKRA 1NW3A 3LRPA 4GPBA 3DP7A 2OYSA 3AY3A 3KKPA 5L8VA 3P2IA 3X1WA 4JWKA 4BX8A 5K8JB 5IYZA 5EP1A 4DFDA 2BBTA 2VDOB 4PHFA 2BL4A 2I3ZA 3D1JA 4TV8F 4G9GA 5A5DA 4OH1A 3WA6A 5CB6A 2PS1A 1LU9A 3EWSA 3HI4A 3AF5A 3HLKA 1UPCA 3AERA 4B71A 1VL5A 1XRNA 3OCJA 4IIGA 2I7CA 3IUYA 4LG1A 3A6EA 3E9MA 2FQ1A 3JRNA 4FD3A 3GVHA 4GUDA 4MQMA 4WVLA 1AN0A 2HRQA 2KHZA 1FP1D 1QE3A 4AMBA 1HEUA 1UF9A 1Y9EA 2VSYA 2JCYA 3GA5A 3DMHA 4OA8A 5JTTA 4BGEA 2YN0A 2X9VA 4W8HA 2LW7A 1L2TA 4N18A 4Y0VA 5AH0A 5JDCC 2VQFB 3AVVA 5B7QA 1JTEA 5JADA 2XCRB 1HURA 1I3OA 3N2NA 3MMPA 1FC0A 4I3HA 2MMCA 3D1LA 2I91A 3GT0A 3PSHA 1BD4A 2NU7A 2XE4A 4WN9A 4DV3B 2NV0A 5EN4A 2XT9A 2GZ3A 3VNRA 1E9RA 1HRDA 1OJ7A 1OV4A 1WX1A 2VDUE 1SKYB 2ZUEA 4TLEA 4MX8A 1DIBA 2PQ2A 3CRVA 4FKMA 4TRJA 2C9CA 3E1KA 3IIIA 4FCWA 1KAQA 2P3QA 4L2IA 4NG5A 5HILA 1KHTA 1PN3A 1RQ2A 2B82A 1C1YA 2N75A 3B52X 1LTQA 1NBMA 4NS4A 4Q15A 4XPIA 3WDMA 3N6XA 3SYNA 1I10A 1FLVA 1DDIA 3T99A 4IDAA 3H5LA 3L7KA 1B7GO 1JEQA 2ADOA 2BTQB 2XT6A 4WOKA 5HQ3B 3UHPA 1JAXA 1X77A 3TX6A 5FBRB 3ZGYA 3U31A 4IO1A 3RAPR 4BV8A 4OK3A 2GM4A 1G0NA 1JBQA 1ECLA 5HCIA 2PNJA 4TWRA 5FULA 1J8DA 3A3PA 3TSOA 2RK6A 1DOAA 1XROA 3QU9A 1H2ZA 1RLIA 1ISFA 1GFSA 4JBLA 5TPZA 3VYSB 3FDFA 1NVMB 3KZOA 4AP9A 4LF8B 4K9KA 2VR1A 1QFZA 5T67A 2HFKA 1PJSA 3GI1A 1LH0A 3OLCX 4WLOA 4RD0A 4ZQFA 4DXAA 5IM4F 3EOZA 4E5UA 5KHLB 2VDQB 4JEUA 3HCEA 3RC7A 3ZEAA 3D81A 2R6CA 2I4RA 2W22A 1CRWG 2F3QA 1KIFA 2VAPA 4K0RA 4M2LA 4ND2A 4RE5A 2SNIE 5EJ4A 1ZN2A 1SIUA 1TF5A 3ASVA 4IM7A 1ID1A 1W0KD 3FHOA 5AKLA 3ZHYA 2ZIZA 3ZXYA 4FUQA 4DSZA 4BKPA 1R10A 3V8EA 3NP7A 1B6GA 3F9RA 1M2HA 3EODA 1EA7A 2NNWB 2OECA 1AHPA 4G0UA 1IXSB 1JG4A 3DT6A 3ZU2A 3KJXA 3LDAA 1KOGA 4IGEA 4AXBA 4DQLA 2GPNA 1VCIA 3PHHA 1QRAA 2CDAA 4ND1A 4OQEA 4TYYA 2WSSD 3ZWDA 4CL2A 1UT8A 1PR4A 3CUUA 1FP7A 3KZ1E 4RW0A 1J9EA 1I4EB 1L5RA 2MSNA 3BGDA 1FNNA 1RFGE 4LK2A 3GNSA 3U7EB 2Q62A 3HKCA 2X4IA 2C7OA 3AXSA 2BHLA 2IYEA 2IH2A 3BIXA 5AW8A 4Q0MA 5DU2A 2JLVA 5E7MA 3UN1A 2J5KA 2KLBA 4OPMA 2HJ9A 3QVWA 1QQBA 3C6BA 2WB4A 3KDSE 3NONA 1HTWA 3FRJA 1CFJA 4WSOA 4AY4A 4EUSA 5MDHA 4HEQA 2H0AA 5TQ2A 2Q28A 4RXTA 3NDIA 5ALQA 4V2UA 2AT1A 2DCMA 4Q1EA 2DKFA 3SMQA 3UV7A 3D8UA 3CB2A 3IS3A 4YXWA 3UCEA 4V0QA 3UQZA 3RUCA 4QM6A 4JODA 3TQFA 4LQLA 2REQB 3RS3A 1C3JA 1AKQA 4Y2RA 1Y5NA 4B7UA 3FZNA 1HZZC 3IVRA 1GO2A 4N0MA 2IDZA 3DVLA 4JLDA 1L5SA 5DCYA 3UGKA 4EVRA 1KFCB 3Q3JB 3EGDA 5KTSA 1QKJA 4P3PA 5DNDA 1CJBA 3JD2A 4PZDA 1XPUA 5EIBC 3T6KA 5GGYA 5ALTA 5I7OA 1KZ6A 1OX4B 4J0EA 4UEQA 3USCS 3AF2A 3TG8A 1DX6A 2FLWA 3OIDA 5B3JA 4BYMA 3E9QA 4DUPA 3IIKA 1U9ZA 3UAXA 1XZAA 3HWX1 2CFCA 3AHHA 4N49A 5AO9A 2A5FA 1B0UA 3NVAA 4CBVA 3T35A 2FSVA 3AUFA 4GAEA 5FR2A 1X7XA 1YRQA 3DOEA 4D0NA 4R9SA 3O8NA 1GZ3A 3A6GA 3SIWA 3TPZA 3RTAA 4YV1A 3DL0A 4TSKA 3UJNA 3WWEA 3ULKA 9ATCA 4IZ6A 1Z16A 2MSCB 3MMZA 1VGQA 4LJAA 2VF7A 3GGOA 1LPPA 3FYUB 3KE9A 1ADCA 1H2RS 1PFWA 2J9RA 3P2MA 5AK6A 4A2PA 1G3QA 3WL5A 4S04A 5JSZA 3OKPA 2C4UA 4GGOA 5CX1A 2REOA 1P2DA 1U9IC 2XGSA 3O4RA 4I1YA 1X7ZA 3FUTA 4ZEMA 2IL1A 1Z2NX 4QXPA 2PSEA 1C9DB 2NSHA 3QP9A 4F5EA 1W96A 3TOVA 2UZAA 2XB6A 2EGHA 3DAOA 3TX2A 3ZDXB 4F97A 3DNPA 1Y4UA 3K5IA 1QHSA 3B5IA 2BFBB 4ZT4A 1NPTO 2W8BB 4Y2UA 3N5KA 3H4TA 2FCAA 1XCLA 4EEKA 3NIGB 4ZP1A 2X0FA 3ZGLA 1IAQA 1BX0A 1T5IA 3DQPA 3QSGA 3ZKWA 1RT9A 1JHAA 3AW8A 4NIMA 6CHYA 3AH8A 3BOSA 3NHMA 3CVWA 4P7KA 1F1BA 3S27A 1MT3A 4JVMA 4ZU3A 4ZMRA 1Q7EA 1A4UA 3LK6A 3OMWA 1G6OA 3LY5A 3DWGA 4D8UA 2ZJ3A 1UJMA 3SHVA 5B2EA 3RVDA 1MEOA 3FDXA 3NHPA 2H9IA 1RWQA 3HA7A 1MJGM 3QJYA 2J8ZA 4CT0A 2VS1A 3IOBA 1OHHA 2A3RA 3HU2A 3QPCA 3QUQA 1BHO1 3TTTA 1ODCA 4MW1A 5DK6A 5ICMA 1LV8A 3SXUB 1T1RA 4HYYA 4QHSA 3STXA 1F0NA 1V0JA 4GVPA 4OP3A 5H68A 3UTCA 5A1JA 2FJUA 5INTA 1Q0HA 3AF6A 4G09A 2CB9A 1A8IA 3VDMA 2QPLA 3FNEA 4FYKA 3TIFA 3OJ0A 1ZVVA 4NNJA 2IYNA 5DNUA 3PQ7A 2QGFA 2OV4A 4DLYA 1W6UA 1AHNA 1NMXA 3UWDA 4AMZA 2J4FA 5BWMA 5ELXA 1P5ZB 3SM3A 3W5HA 3LL7A 2VNIA 3ZHOA 2XIJA 1DPGA 4B7XA 2PH7A 1ZHOA 4I55B 3W5SA 2C88A 3F98A 5E4FA 2D1QA 1N25A 1GG9A 1ZVJA 1I4WA 3OMLA 1SY7A 4QICA 3BGWA 4D26A 3UK6A 5H1YA 2VUHB 3F2VA 1YKGA 1DBWA 2CLOB 3TTYA 4F46A 3WGYA 1ANKA 3CWCA 3KTAA 1FFYA 1DWQA 4FKZA 1P1CA 1VBKA 1E2NA 5C4IA 1OUMA 1XEAA 3AUTA 5AOVA 5C37A 2XOKA 1VL8A 4MKFA 1MPTA 5SY4A 2JI4A 4N5IX 1XELA 2IUTA 4AN0A 1DG9A 3UK2A 1MG0A 2FETA 1JSLA 5A7GA 1H9BA 4W5HA 4ZVTA 1LK5A 2PMEA 3SJBA 16PKA 2N47A 4MR8B 2FW7A 3TM4A 4GSYA 4RK4A 4EJ0A 2RI1A 4R9RA 4QFDA 4JQYA 1PYDA 3HMQA 3CZPA 3QU4A 4HAVA 1CZOA 4FHCA 4PYLA 4HRAA 1X9IA 2WYVA 1T5HX 1LS6A 5J4HA 3F6RA 3O2QB 4WCVA 4B3RB 3PQDA 1EM8A 4OOEA 3DMTA 5IKXA 4I1PA 3LKDA 4FYYA 4YCCA 2JA1A 4DLAA 2PX6A 2PV0A 3M70A 2HRRA 3IQGX 4MNTA 4AS2A 1SH7A 5BQXA 3QLEA 1LRKA 3QX7A 4K6FA 1K1EA 2GD6A 2O5RA 1F06A 3LT1A 1UJ4A 1YVUA 3QUCA 4GT1A 4IJ6A 4KJXA 4EUKA 4BKOA 4HDRA 1V9CA 4FFRA 1GZSA 1L4YA 4R0MA 2Q6LA 4Q48A 5GPBA 4LF9B 1WABA 2P11A 5AQEA 3PPVA 3PGMA 2IIBA 3MCUA 4F4JA 4NARA 4LZNA 1OI3A 4G8BA 4ZCPA 1WU7A 3I5YA 3FPCA 5TEVA 4OHVA 2JI9A 3VU0A 2P8JA 1BJTA 1R66A 3C16C 3G85A 4Q3BA 1AXEA 4RTKA 2VJAA 3UHFA 4BVEA 1SXQA 2HU2A 4M1QA 2X3FA 4B7CA 1SB8A 2VSQA 5JXJA 3IPCA 4L9WA 4E4YA 821PA 1H05A 4AFNA 4EZEA 1H6CA 1M2EA 3D8SA 2VH2A 1KVUA 1Y1PA 2FWPA 2XBLA 3NJ4A 3ZGZA 4CU2A 3CH7A 1XPRA 3CX4A 3I0ZA 3KPVA 3E48A 1PZNA 1D6SA 2YZ7A 3WLPA 1JTVA 5BSGA 1UCFA 4K9PA 2WT4A 4EZBA 4DBZA 3W8NA 4BQFA 3GRYA 3MWKA 3OU7A 5FDFA 5FBHA 4D3DA 1TC2A 3UHJA 3VU9A 4FMCF 4KACA 4TYMA 4DLRA 3CRW1 3Q3CA 1PDVA 5K3BA 1CUUA 1SOUA 2C0CA 1X7YA 1TJ3A 3WLLA 3L4BA 1C5KA 1HE1C 2PH5A 2Q8PA 1I32A 1JHPA 1DI0A 3UENA 1ZCZA 2RHLA 3CRZA 1ZFNA 1KPGA 2HRBA 4TWZA 4RIGA 2G07A 4PCUA 2C00A 1AX9A 1W46A 1ZESA 2H4JA 2GYVA 4YJFA 1E79A 3BFKA 3G2HA 2V0NA 1T6ZA 4US0R 2GXSA 3RSLA 1AXRA 4EO4A 1PD0A 3BYZA 3R0XA 5JD5A 4XM1A 2VRWA 3CEPB 2V54A 3OEEA 1QYWA 1KERA 4YV0A 3WL3A 3C3PA 1D6MA 2PRYA 3GLVA 2NZXA 3U37A 2P6OA 4BMYA 4A4DA 2C7PA 1U7TA 2JJ2A 1Q11A 1PL0A 1UMBA 2R1VA 3HUEA 3KKNA 3S2ZA 4EB0A 1KA9H 3CB4A 3D6NB 4QNNA 1ZHFA 3P0IA 4KYTA 2QPOA 2C42A 2ISCA 3OX3A 3OI7A 4RX1A 1KJZA 2AYXA 1RI3A 4AO6A 3WMXA 2P2SA 3HR7A 1JT9A 3D5TA 3QU5A 4EO9A 3I9MA 3WK9A 1SWVA 2ZSJA 3ZDQA 5LWQA 1BE0A 4CT4B 2TMYA 4O02B 2A9PA 5HK9A 2VPXA 3QEAZ 2QTRA 1BIFA 3HNPA 3OOEA 4N6OA 3TMKA 3X1XA 1ZGCA 2NM0A 2OOKA 3SJAA 3WMGA 4EX6A 1LLDA 3KLNA 4D6XA 1BX1A 1CG6A 4JROA 1YL6A 3THOA 4A6EA 3LUBA 1FOEB 1Y7TA 3ONWA 3CIOA 4M7WA 2GFHA 3KQYA 3RR2A 3RUDA 3CRNA 1A72A 3I3SR 1CJVC 4N01A 2I2FA 4KXUA 4C3ZA 4MINA 2P90A 4JJ7A 4LHWA 4BTEA 2ZW9A 3SC2A 1YHZA 2XPCA 3L0CA 3IDOA 4OQYA 1R0YA 2PLAA 2R44A 3IKTA 1SG9A 1OFIA 4RYDA 1EFAA 3E7PA 3G8DA 1A9YA 1G41A 3U7QA 4CKEA 2CNWD 4MCAA 1JFTA 1BVRA 1V1MA 1H4VB 3ZJTA 1E9BA 1KJ8A 4N03A 4CZ2A 2PWAA 3ZNOA 1AS2A 2I3AA 5KSWB 1M7BA 3AONB 2BJHA 2XNSA 2UYHA 3B2EA 4NZMA 4I8DA 3HP4A 3QIAA 2GN8A 1MEEA 1ZOSA 4BVFA 3SSNA 3VH4A 4C4ZA 4ZIRB 3PNPA 1ZD2P 3JQGA 3SEFA 3VPFA 2CDBA 4CMKA 5LUAA 1G6HA 5JH7A 4I2NA 2YVKA 2IXEA 1IXRC 1KXJA 2QTVA 3Q9LA 4BFUA 4ENRA 2VSFA 5K3OA 4Y6LA 1EINA 4DRXA 1SFRA 2PR7A 3GXOA 3T7SA 5K45A 3LC1O 2BHNA 1AU9A 1U1EA 1UJBA 3QIVA 4AZ0B 4HS4A 3F47A 3IHTA 4EDFA 4N48A 3IKVA 1XU4A 2VHVA 2Z83A 2VSNA 2ZRBA 5HFNA 3GEIA 4NQZA 4W1SA 1FDOA 1EFVB 2X0DA 4WY2A 3HB5X 2CFOA 3VR4A 1BA3A 4HXEB 3B36A 2CL6X 2FKAA 4FTWA 4CIXA 3IODA 2IHJA 3JQBA 1QO0D 4AC9A 3K1TA 4O2AF 2WWYA 5LQCA 1TECE 2OHHA 4MQFA 1XZEA 4ZK6A 4ARBA 5I5GA 3JQ6A 5E7IA 1KETA 3B1KA 3SCZA 1NQVA 2EKPA 3LPAA 1XKXA 3PFGA 1HSOA 3WGTA 1ULHA 3DEJA 2F62A 3MYYA 4RKRA 3GCWA 1LI4A 5AI5A 4ZDIA 3ISVA 1L7EA 1EBFA 3CNBA 3EIQA 1ISMA 2D2XA 2PKWA 1RD4A 2CL5A 2YFYA 3L02A 4P7BA 5AM1A 3ENZA 4M8LA 2BUCA 4QBTA 3D3WA 4ER6A 1E1QA 4Z9AA 4A16A 4PLTA 3UUFA 2YDYA 2CK3A 2C5EA 5KQGA 5IYZB 1R3UA 4Y0NA 1WWKA 4BBPA 3EGIA 2FU5C 1C0LA 1P75A 3OM9A 4OJMX 4ZQHA 1ETUA 1SC9A 4OMCA 2PIAA 1MHTA 3D7RA 4P3YA 2R8EA 4B6RA 4DNQA 3KWMA 3W04A 5B58T 4ZYVA 4O2LA 1PGQA 2W70A 3FSEA 3KEQA 1BDBA 5EHXA 3K0BA 1OC4A 2C4MA 4GH5A 3TSCA 2YHSA 4GQIA 5KYTA 4JQCA 4INAA 2ANCA 2CMKA 4NICA 1X14A 3KVOA 4Q19A 4JH0A 3TINA 3UWOA 2WIKA 3K9QO 3RADC 3ZS9A 3LFUA 1GZ4A 1KJNA 2OFPA 3TS1A 2LPMA 4UEWA 1G21A 2HV9A 3A32A 4TL9A 3AESB 3O93A 1UAAA 4ARVA 5JQGA 1FJGB 3N9IA 1Y6RA 3CW2A 4RZQA 4E5NA 1ADYA 3BEOA 3GZTB 4WN9B 5AW6A 2X0EA 4EY8A 5IVPA 5BMVF 2QF7A 3CR8A 2JEZA 1A4RA 3A05A 3AETA 4FZJA 1V5GA 1MQ8B 1F4PA 4RQBA 4ZAVA 4FOTA 3AB8A 4OHRA 4Y9RA 2E82A 4GI1A 1SU7A 1BZYA 3OURA 1F2UB 1HYBA 2LV8A 2WEKA 4U5XA 4XPIB 3RFTA 5E0OA 2XOXA 3LCRA 3JU3A 4J0QA 4ND3A 1JEQB 2ZRCA 5LNK6 1P4GA 2C0PA 5K03A 3AEKA 4WVFA 5CCBA 1GRQA 2YBEA 4R1SA 1Z29A 3DZ8A 2JI8A 4EW3A 2XQVA 1M3SA 2X40A 4HFJA 5AK3A 4N3AA 1L5KA 1I6WA 4HEJA 4J07A 5I6DA 3O8CA 4TUYF 1SHTX 3CE6A 3KPJA 4FR2A 2EF0A 3FYSA 3WYDA 3EVCA 5FIUA 2F64A 3PDCA 3B9RA 3O47A 3Q1LA 4EVSA 5B1HA 1MBZA 3S8YA 2CYBA 3R6GA 3CRMA 1PKXA 4NCNA 4D5EA 1U4OA 1VI6A 4Q00A 3S44A 1XBTA 4WXRA 4EPRA 2O05A 1V45E 3LWZA 1BG6A 1AE1A 1NHGA 5K0BA 5B55A 5JYCA 1BCRA 4J2TA 3RBAA 3K9FC 4XZ3A 3HA2A 4ARSA 1T1SA 1YWGO 3DFMA 1TTQB 4ENQA 4NAVA 1OWPA 4RXUA 2FMIA 3P2OA 5JNSA 3GFOA 3K0FB 4A0GA 2FWNA 1JF8A 2WU1A 3BIOA 3ETGA 2DM6A 5C8DA 1Y6ZA 3R5FA 4GKJB 3EJ6A 1BS2A 4D6PA 3LLUA 4M49A 4TMFA 4Z1MA 1XVTA 3GZ4A 4B5KA 1VIDA 3CY6A 1AH2A 2LR0A 1DV1A 2ZATA 2JIPA 4NJMB 3SJCA 2PKXA 4JLUA 3SNKA 3VM6A 2B61A 5JCPA 1E0KA 1K7FB 4JP1A 4X92A 4BCDA 3BS4A 1K98A 1VXOA 3COSA 4DV4B 1PT7A 1V8OA 1WBBA 2G1KA 4S12A 3RROA 5TQ2B 1YFZA 4YI5A 4Y2VA 5IG2A 2FFQA 2C95A 1CVLA 2YIVX 5LP6C 4F56A 1ZW6A 4KPUA 1Y4DE 2G5CA 4RUKA 1KI6A 2J3JA 4OHCA 3IT2A 2FPWA 3AVQA 2QPAA 3WIEA 2XYVA 4ZVPA 4FYHA 3N75A 3MOIA 2D1RA 3PQ3A 3ZX4A 3SPXA 3KWFA 4L57A 1N1GA 2XXAA 4X9XA 3EGDB 2F90A 3O9VA 3QA3E 3QMVA 4KP7A 4XLZA 2NLOA 3FMIA 1I7LA 4UARA 2QQGA 1G0OA 1S2MA 4F38A 4UDYX 2JIQA 5EIOA 3B6EA 2WFAA 4BNJA 1WEHA 5BOSA 3FUXA 3NYIA 1EYZA 2RIRA 1ZN7A 3F8TA 1K06A 4B74A 3B9PA 1Z8DA 5J1TB 3SLRA 3X2FA 5GOZA 4HMQA 4UOZA 1B0ZA 4OA5A 1K63A 1PR5A 3DPIA 4E5DA 2WOOA 3SIRA 5DMHA 5H81A 4GR9A 3G79A 1T2DA 4FS8A 3KYDA 3W5VA 2A5GA 4N4AA 3LVRE 2HSGA 3UIEA 1DBQA 1EJ6A 1T9ZA 1C9EA 4JIMA 2C2BA 1U28A 2O8BB 2V7GA 2RFLA 2ZYGA 1QHGA 3AEYA 2K4MA 1F0YA 2CN1A 1YE3A 3E15A 3MB8A 3NTVA 4J3JA 4Y98A 5H82A 5JSZB 4LNAA 4Q01A 4YLGA 1IHUA 1O94C 4KXMA 5CX1B 3P1JA 1P9WA 3BCSA 1WZCA 2ZUSA 2YWDA 2Y1XA 3G5LA 4PO3X 4PZLA 4QYTA 2P68A 2L82A 5BNZA 2R8ZA 3LBAA 4G36A 4QUGA 5JD4A 1DFHA 2CBZA 5CJPA 2GO7A 4I50B 4YP5A 2G9ZA 1NSTA 1SWWA 2BFCA 5BWOA 1V96A 3LS2A 4B4WA 4DWWA 1A9QA 3L06A 1AA6A 4EPYA 3HR8A 2BR5A 4GVLA 3ZKWB 4ABYA 1GFZA 4JENA 5KQPA 1HNWB 2D6FA 2H4FA 5JLAA 1EB8A 3NDBB 2G82A 2IYPA 1IBRA 4HSEA 4ENPA 3E70C 3NWPA 1YIDA 4D9HA 3BSWA 2Q4OA 4WL0A 2PAAA 3NU1A 4HATA 4NDAA 4PPNA 4QRIA 4OLFA 4EABA 1UJNA 5HZKA 1E1MA 1USGA 5KNCA 3L5OA 3HTXA 2XI4A 1ESDA 3H2YA 1G2PA 4B34A 1USIA 4B35A 2J3HA 2GN1A 5BSUA 3RO7A 1J97A 4LECA 1SHZA 1T0PA 3KZVA 2CLIB 3C1UA 3OQJA 1GD1O 2E1PA 4GW3A 3PXGA 1RVDA 3ND6A 4TMXA 2B8WA 3TFWA 1MRSA 3THXA 1K5DA 2BSAA 3G1TA 2DBRA 4JJ6A 4K6GA 4N3NA 3HWSA 4C14A 1FXSA 3PRHA 4JJ4A 2XTNA 3I58A 4R2WA 1HDRA 3M3DA 1PVVA 4XX0B 3WLFA 2R65A 4MAAA 1Z82A 3CNHA 3LQFA 5KHAA 4DKJA 1FSPA 2QM0A 4N3BA 3M81A 5L7WA 4IIJA 4OFZA 1I13A 4AKGA 3LQ2A 2IGTA 3RJ9A 1FRZA 4G37A 1IWBB 1I8TA 1I5EA 1Z5OA 3BZUA 2CDRA 2X9GA 4PG7A 3ZC3A 4LOKA 3WP1B 4FR0A 4YPVA 1DWPA 2OFXA 1LPOA 3JQ8A 5EMLA 3KTAB 3TJMA 3R75A 5I7UA 1ULBA 4O3MA 2GEBA 3QXHA 4C3UA 2A7XA 1PNRA 4B83A 5LZ2A 5CJ2A 1DJLA 3CONA 3M6UA 2F43A 2JLBA 1QONA 4NLLA 1DPFA 2R11A 2BGTA 4ZT3A 4DAOA 1YFLA 1JDTA 2J9XB 3RK4A 3ZIAD 3OEWA 1BU8A 1YS6A 3BE5A 3ORYA 4G07A 3PV0A 5LMZA 1JDJA 4OIMA 1SPBS 5J4VA 1Q3HA 5CG1A 4ZQGA 1K7YA 2Q4DA 5B3KA 3D54D 5HGXA 3UMJA 2CXNA 2AC4A 2OUIA 2QRVA 1RABA 1HSZA 1CR1A 5K0LA 1VJ1A 3UKDA 2FZCA 2BELA 3DE7X 4M86A 4O8CA 2FQXA 4TROA 2XUHA 1L8OA 4D7AA 4OLAA 1KF0A 1PBTA 2X15A 5GJBA 2IPXA 3ZYZA 3VVCA 4AM8A 1EM8B 3G9UA 1IG0A 3WNBA 4EJFA 3VKGA 4JGBA 1J2JA 5D00A 1W8DA 1QG6A 3FTNA 1SBTA 3HU5A 1XTVA 1YU9A 2OMKA 3OJEA 4YLEA 5EA2A 5ETJA 1JDUA 4ZZ3A 4M9XA 3TL3A 3GNLA 2ONJA 1C1DB 2VF2A 2Y0PA 1OR8A 3QPWA 3THSA 1X1CA 3EXFA 2R2GA 4HDRB 4KN8A 4A0SA 2QTCA 1QQTA 1ZIYA 3ANMA 1T4GA 1ND6A 1Z0DA 1KI2A 2GLTA 1D2NA 3MA0A 4HJXA 1YDFA 1SC1A 4M99A 4D8TA 4F71A 1KY4A 1QCZA 1IN5A 5JJIA 3G02A 4DN6A 1GCIA 3HB0A 5C4GB 1YR1A 4CL0A 4EHLA 3FWZA 3DNMA 3VOAA 2QIPA 2BEKA 1LI5A 1DVRA 4ID3A 1TW2A 1ZYUA 2DXIA 6GPBA 4F6CA 5DHPA 1TL7C 4FK8A 4N8SA 1N8TA 5C7OO 5JNRA 3KSRA 4TLDA 4GZ6A 4JOQA 4GNKA 4L8GA 4S3MA 4FILA 4R1TA 4UFOA 5K3AA 4AAYA 1CQJA 3KQUA 4MR7A 2GDZA 1P62B 4UASA 1ZSYA 4B5LA 1PRYA 4BPBA 1O5IA 2X5XA 5BP7A 4MJLA 3QVSA 2Z2IA 4PLPA 5BYJA 4D9JA 4EG4A 1V4NA 1COWA 4Z9XA 3HABA 4H0NA 5JO9A 5A04A 3DT9A 1GDHA 1GWNA 1KP3A 4GOLD 4I1VA 4HQKA 3MJRA 4PO9A 1EX9A 3ANNA 3SJZA 1G3UA 4N82A 4QGGA 1NRJB 4LY0A 4E08A 4QYIB 1X7YB 2R1ZA 1SUEA 4KGZA 4NJEB 1KBOA 3RVJA 4CKBA 4XD2A 3GFVA 1SHLA 4M9CA 2ZOSA 1S2DA 3I2FA 3UK1A 2V9PA 1MC4A 2A5JA 3BWXA 4Q18A 4IHJA 2H1OA 5FOTA 2HIHA 4HGOA 3WVNA 4B87A 2UDPA 2F59A 3T4EA 3U9LA 3I9NA 2QTBA 4YAFA 5DCUA 3DWIA 2WUWE 4EA6A 2PRJA 5LB4A 1SO8A 4C2UA 3WZMA 2O3RA 5ALVA 1JIJA 2D2EA 1IATA 1Y34E 3FH0A 4TZ6A 3H2SA 1GDDA 2P27A 2CLEB 2LIVA 1ONSA 2VXOA 3A6DA 3D2AA 3E9DA 4J29A 4PX5A 2JK1A 1B3RA 1MJ5A 4EL5A 2XNKA 4DLLA 1ZRNA 4K8OA 3TAHA 4CLOA 3BE4A 1I9CA 2Y4OA 3EFBA 4UAJA 4UUPA 5BQOA 3ZXUB 3UPUA 1YUNA 3FCCA 2G5PA 1QG0A 5FBLB 1YR8A 4UTXA 5EJ7A 1ND5A 4QPPA 3IGFA 4BGUA 2HW8A 2M2IA 2XUJA 1Z2OX 1RDFA 4MI6A 5CD9A 2MSEB 4EFDA 4IICA 1BE8A 1U4NA 2A2ZA 3WGJA 1ZMXA 3QW2A 1UWLA 2VYNA 4HD8A 4Q4HA 3H6HA 4DLBA 4DE5A 1OD6A 2XKKA 1U90A 1PTKA 4DCTA 2NYAA 2JLRA 2W0MA 4JSYA 4NZ9A 1Q0PA 1DBSA 3N07A 3FZGA 4X65B 4KFTA 1ZK3A 3Q9SA 4LHYA 1H6DA 1YL5A 3Q8XB 3SC2B 4QOHA 2IGBA 3H2HA 1GQFA 2WINI 4XLTA 3VVLA 3ZY2A 1EFKA 4EEZA 2QUAA 5IK2A 3GUUA 3BHNA 1HQDA 3B1JA 3WMFA 9ABPA 5J3JA 3U6BA 1T8YA 3B1YA 4JKOA 1YJ8A 3U7QB 3FKSA 4CKEB 1I4LD 2XOEA 3RT1A 3PPYA 3SDBA 4YEDA 1UP7A 5BWLA 1U0HC 1MGPA 5FQNA 1LF5A 3EQZA 5G1OA 4J3FA 2F1RA 3RVSA 4AJKA 3ZDAA 1Z06A 4G0YA 2BE9A 2VK8A 5DHRA 3RU3A 3JQGB 1VRVA 2HIAA 1VKJA 2ATIA 3GYBA 2AMYA 2OV6A 5JH7B 2B34A 2WHQA 5DGIA 2QTVB 4G0MA 4G4GA 4KRGA 4X84A 4B8YA 2XA1A 1UIRA 1TKBA 5CTJA 4DB4A 1T9BA 3K96A 1Q1BA 3OZTA 3NQ41 5CLGA 3ZV6A 5SYMA 1IZ9A 1K0UA 3CUSA 3ZY3A 2PTGA 3LUJA 2P5TB 3U26A 1KK2A 1PR3A 2VNAA 1M0TA 3H2KA 4CR6A 2G7ZA 1PGNA 3TLAA 4FNAA 1DUVG 1C8KA 1BMFA 1C30A 1CUVA 1GPMA 1R5JA 2CHQA 2GZAA 4PHCA 4U0KA 1KC1A 1RMQA 3NO4A 1OA0A 4OFWA 3FPGA 3WB1A 3BIJA 1FFBA 4OBEA 3LBFA 3U2QA 4ZJUA 5I7VA 5DBFA 4PLWA 4MK4A 4B6SA 1T2CA 5M04A 2GKGA 3UMFA 1USWA 5B37A 4GP9A 3RSCA 1FXUA 4UHBA 1Q7GA 1RI2A 4ZQIA 1KOLA 3R9XA 1RPJA 5DWVA 4HUQA 3D3WB 4TMTA 2VLBA 3WX0A 4DPLA 4C0KA 1KDVA 5U1PA 1GZDA 1V3UA 3H11A 3KKEA 1XCPA 4PANA 4RVHA 5C5EA 3Q2IA 1SB9A 1XEFA 1JN0A 5ALGA 1SQ6A 4UXHA 4CLHA 2DY0A 4JBGA 3DONA 1WV1A 1KK3A 1TZKA 3BKXA 4HDNA 5AVXA 4HZGA 1AUQA 1GZUA 4Q3AA 3IE1A 4BJ3A 3LE8A 4DLNA 3FPFA 5J4LA 1LBEA 1AT1A 4KUEA 5JXWA 5THXA 1EESA 1ITZA 1IY8A 1VZ3A 4TZKA 2XJ4A 3UG7A 1D2MA 2VXYA 4BU1A 2VZ9A 3OJCA 4C4OA 1Z13A 2NZYA 4HGZA 3LBNA 1IBLB 2AWNA 4Z0PA 3LX5A 2GYUA 5G41A 4NWIA 5A3JA 4H18A 4JXZA 4NONA 3OX1A 4IGKA 2W6ZA 4HQFA 5JQGB 2EYQA 2YICA 3QITA 4C6RA 4AS3A 1N0UA 1A1VA 2YNMD 4EHHA 3FYHA 3KEOA 2P5YA 3OPQA 1C0PA 3PXEA 4GOKA 1N6IA 2QAGA 2Y9PB 4PNPA 3AETB 3EXEB 4TVKA 3N8IA 3A9RA 2YXEA 4R0NA 5DTIA 4D9NA 3CF2A 2QZZA 1U2TA 3PRKE 5CUQA 1QE0A 2WIAA 3IBCA 3DDSA 4A2CA 3R9IA 2EARA 1QHYA 3PIRA 3TL2A 4LTMA 4G6ZA 3OPVA 3CS3A 4Q4DA 1J06A 4BS9A 4KTVE 1FNBA 3N2KB 5G0TA 5ALRA 1XGKA 1RBYA 1YKSA 2O2XA 4UBMA 3GP3A 1H69A 1ONNA 3IP6A 3CLTC 3F4LA 4BIMA 1KSFX 1QF7A 4IVRA 3R7DA 1ENZA 1GG8A 1IB0A 1CQZA 1AKMA 3UT6A 2FMXA 3BA6A 2OB2A 3F7TA 5EL0A 3P9SA 5BN5A 1A98A 5AJVB 3KSBC 1E63A 2PNFA 5FFFA 4PINA 3STTA 4BFVA 3QOFA 1WY5A 2H1FA 1HQYE 4FQ8A 4G1FA 1RC0A 3VR5D 3N3AC 3HH8A 3FRIA 4TKVA 3DDUA 1LPSA 3AWIA 1U0OC 4K28A 4YQYA 5IKOA 5BQFA 3Q8KA 2HCFA 1HDXA 4A8JA 2E55A 1BCRB 4Q9HA 3RB8A 3H05A 3EZ7A 3R7FA 2VP6A 3F74A 3G8YA 2R79A 4D9KA 4F6LA 1OZAA 1QO9A 5BV8A 5CITA 4IJQA 3AQIA 4CMEC 2A9RA 1XTSA 3IJPA 8ATCA 3RD5A 4R9VA 5B1YA 4EQ6A 5CB8A 1JFRA 3PE4A 4JX9A 4KUGA 4XR9A 4MV4A 1ID8A 3DE4X 2P2YA 2NZUG 5KQMA 1E7MA 4EA9A 1LSUA 2ZULA 3LBIA 1F5NA 1NQWA 3L8GA 1DQRA 2E9SA 2WU8A 2XGOA 3BL8A 4TT3A 1JQJC 5KQLA 1Y7IA 2SKEA 4V24A 2J0QA 2XADA 4I9GA 4DJTA 4BKQA 1JYEA 3HJNA 4G0WA 3B8EA 3N3BC 5ALFA 3F6EX 1AGYA 2AFRA 2BKXA 2CHFA 4A6XA 4XVUA 2F8SA 4YR7A 4BLVA 2BAGA 4X8LA 1EFRD 1W2GA 1GNPA 4DR3B 2GPWA 2FXIA 1YOBA 2VHZA 1JDSA 3KYJB 3FTDA 2OY0A 3IJRA 1B1AA 1FUEA 4Y2PA 5BSTA 3QUTA 4RJ2A 3UANA 2C61A 4Z4EA 3GROA 2EKDA 1XQWA 3L8MA 1VI5A 3NBXX 5F4ZA 2GPSA 3LX8A 1KI6B 4P53A 2VP0A 3K8OE 3RVRA 3QWBA 1NP7A 1GQYA 2WNIA 3F6BX 3RJZA 4CW7A 4J1TC 2VHQA 3ZYCA 4AKIA 4KIJA 3OX4A 2XXAB 1XWIA 3ZEIA 1QZTA 4QBKA 5G4KA 4M0LA 2EIXA 1YZKA 1ZVKA 3OQVA 4KE6A 2JIZA 5LXTB 2CC2A 4DBVO 2AI1A 3IQZA 1X80A 1DUIA 2HO4A 2O0JA 5BOSB 1LNSA 2BV3A 3V6MA 1UKEA 5BN3A 4QASA 3TKYA 2B83A 1W1WA 4M89A 3HCFA 4BE4A 3B1WA 2B8NA 4AX8A 2VPZA 1XWFA 3NFRA 3C6YA 2VUTA 4DIDA 3IAS6 4URUR 1XCBA 1Q83A 1YAHA 5LOVB 2WWGA 2VEOA 1G5TA 1C29B 1SVKA 3KYDB 3QXCA 2ZS7A 2NU9A 3LUDA 3V8QA 5LQDA 3FPSA 3D8TA 1QVVA 4HC4A 4XDZA 3RU7A 3OE4A 3MGKA 2ZU0C 1VECA 2YMQA 3O8DA 3U3OA 1TU3A 4EPXA 1K27A 2H8GA 2EJBA 4N5LA 2IQIA 2PZFA 5TF0A 1KWGA 1GR0A 2WD9A 2HREA 4CFYA 2H51A 1NW7A 3DPSA 1DIOB 2WP8J 1O57A 3DEAA 3LOUA 2A1TR 4B33A 4DNOA 2QSUA 5JTUA 1LPMA 1RADA 2PGLA 5EIBD 2G4VA 4CF5A 1BGVA 3DOFA 3IEXA 1B43A 1CV2A 1M34A 2EFJA 2YDXA 3ACCA 5EC8A 4AZTA 2BGWA 5TIIA 1HPLA 4OP2A 1UBLS 4GPAA 4LJ6A 4Y9DA 2XW6A 4ALKA 2WTMA 1E3WA 2QRJA 4R8LA 2VPQA 3MRSA 3AY0A 4U0JA 3W0LB 4F11A 4LYGA 3QXSA 2H63A 3SXJA 2RJ3A 3INTA 4A73A 2YASA 5H9WA 1PNTA 3S40A 3QVLA 2EFEB 1NZDA 2AW3A 1J20A 5REQA 3D3JA 3S2SA 1TE2A 2O19A 3ETDA 2ODPA 1Z6AA 3AIMA 2AR9A 1GFIA 2GRJA 2LD4A 3C1AA 1HKHA 2PS3A 221PA 2D4AA 3NLLA 4J7UA 3JASB 2XVXA 2ZREA 4NZPA 2FR0A 1G8JA 1V5WA 4NECA 4WV3A 2Q5EA 3ONFA 1QDLB 1BFDA 1DRVA 1PJCA 4PYIA 1R4AA 2WTAA 3AQ4A 3ASUA 5SZIA 1HE4A 4QQ8A 3MYRA 3VZSA 4OQ4A 1V9SA 3CURA 2BI8A 3B1VA 3H7AA 3QFFA 4QUAA 3ZDBA 3T34A 1E0DA 1PLLA 1SA0A 2W2OA 5JZ9A 2P75A 4D0RA 3THXB 5BN4B 4EP1A 3NTUA 1G17A 2H1RA 5HE8A 2B21A 2NIPA 2VSXA 2Z09A 4W8GA 1BEUB 1EWKA 4YAWA 4D0LB 4ZCIA 2B3DA 2P3LA 1SG6A 1D2GA 1LDMA 1RXYA 2HEGA 4BFLA 3HADA 4INZA 4IIJB 4HXYA 5J40A 4M3NA 4E32A 2WVGA 1AD2A 1ODIA 2GZHA 4UZEA 1B4DA 1IHPA 4KWHA 4RCZA 3A3OA 1W30A 3K9NA 4CL3A 1EK2A 3TBHA 2CBXA 1A7KA 3A7DA 1QAQA 4RMHA 1OBHA 3BD8A 4M1KA 1G4HA 2A1TS 3PDHA 3T5DA 4GQAA 1VJRA 4Q7LA 4D57A 5JARA 4P1ZA 3DE1X 1GU7A 2QVZX 3KEMA 2FZVA 3FYDA 2OAP1 5BUZA 4P22A 5F2NA 5AJWA 4XPZA 2QQ5A 1TQ4A 1OAOA 4NYIR 1ESNA 1L1EA 2CUTA 3I8OA 2ZAMA 4OGKA 5M29A 1S2LA 2JPDA 3G0CA 1JSRA 1XTJA 2Q0XA 3R6LA 3ACBA 4C2TA 2E2WA 4X20A 4INOA 2I76A 3HV0A 2ZYRA 1PS8A 3W6PA 1MORA 3X1ZA 2ZWIA 1EGMB 4ECEA 3PXAA 1LW6E 1A7UA 3LF1A 1J25A 3F4BA 1NX6A 2BDUA 2P65A 1QMGA 3QELB 4C0LA 1OOEA 1FVFA 1N0IA 1XTBA 2LWIA 4QJBA 4S2EA 2O0KA 5KYVA 4ETNA 2Q9AA 1N77A 2QS9A 2ZJ7A 4DG9A 3K9GA 2G25A 1L8AA 4JJZA 4H60A 1EJ2A 1RJFA 4YRBA 2DC1A 1E18A 3QKTA 1HYQA 3HGMA 4RSMA 1CUAA 3L18A 4O4JA 2ON6A 1VPEA 2DPLA 3K0HA 4O33A 3QBDA 1AGNA 1AMOA 1NVBA 1RCTE 4DLXA 4TQUS 3TH5A 3A6ZA 4M7OA 2KBFA 1E5XA 1HLPA 4DCMA 3FTFA 2F2TA 1A2OA 1IWOA 1RAEA 2C5SA 4U7JA 1CY8A 3SYMA 2V9CA 3HN6A 2GQ0A 5BPFA 3F3MA 3U49A 2BMAA 1DBIA 1XDWA 3LL4A 3O26A 1R6XA 2OT3B 2F4NA 3IDQA 4HG2A 4PHTA 2J0SA 1XA3A 1TQDA 1A8HA 4FHDA 3GLFB 3ETNA 1JDVA 4I1RA 2OD9A 3FPEA 3QX3A 2XVYA 1VRCA 3GPCA 3SR3A 3C3DA 2A9OA 1BE6A 5JPIA 4G8JA 4I7EA 2GN9A 2PLNA 3E27A 3ZJ5A 4EI7A 1Z0FA 4RVFA 1XC7A 5DN9A 1S6YA 3VAZA 3U3KA 1PV1A 2ZANA 1YRBA 3OZFA 2GBLA 4F1JA 4HHEA 1JHRA 3U19A 3H0EA 5AM5A 3SK0A 1XZPA 2WPNA 4IGFA 4NZOA 4DF3A 1HDGO 1SGWA 1XZFA 2ZSHA 3E5HA 2FEWB 3A4IA 1JKJA 1I3LA 4FIZA 3FNIA 4YJHA 1EMDA 4M1TA 4L02A 1XP8A 5JAOA 3DKKA 5TPWA 4WLEA 4LJ8A 1NN1A 4MCIA 1X1EA 3KJZA 3AL0C 5CNJA 4E22A 4CKBB 1GA1A 3I6QA 5K3FA 4NBLA 1VMKA 4ZYUA 3X1JA 4RADA 2O2IA 4LXIA 1R5BA 4XIFA 5J2TB 2JBWA 1K6MA 4BFZA 4Q7MB 3ZLTA 1A9OA 4IHJB 4BLSA 1EBUA 3WWYA 5G4LA 1OFVA 2WWVD 4E2FA 4QYSA 2GO1A 4ER5A 2WIFA 2CEKA 2P5SA 2XYRA 2KM1A 2HRCA 2PUWA 4TV8A 3KOZA 1G98A 4L08A 2HK7A 1QFSA 3L92A 4XFKA 2PFGA 4QIHA 3SHTA 1ZOPA 1T3HA 1EVKA 3EDMA 4CLOB 2ZGVA 1DCMA 4OKSA 3DOUA 4EBBA 2D2FA 2YHAA 3WBFA 4QM7A 4AJNA 1SUIA 2J09A 4P4GA 3G6KA 2EFGA 3SC4A 1CJTC 1N7GA 2X9QA 3FR8A 3UJ8A 3WI7A 3PWTA 4DYVA 4QOIA 5D85A 2O52A 1AJEA 5ALIA 5HIAA 2CDCA 1O97C 2QW0X 1O58A 4Q4HB 1L8LA 5LUBA 1ISJA 5TSDA 3CZ5A 3T52A 4DABA 1LA2A 5L51A 1S8AA 2VPWA 5EE3A 4JJFA 3SZ3A 4Q24A 3UJBA 3NHUA 1PJ2A 4MEAA 3LCVB 1VSBA 4R71A 3Q11A 3RNLA 2H2GA 4R8KA 5KDOA 3PNQA 4XIGS 1M2VA 3MJVA 4O2BF 5AJUA 5HDQA 3U44B 3IEKA 1OGJA 3W5UA 3L1KA 5IVDA 1V4VA 1SKBA 1PR2A 1Z5VA 4HB2A 1ESEA 1QAOA 1J8VA 3JRXA 3FFTA 1P18A 5IHXA 3P9KA 3PQ6A 4K05A 1VHWA 5EWLA 2O4UX 3B48A 4MJ7A 3KQLA 2PZAA 3C3WA 2UZ3A 3U9TA 1IY2A 3NXKA 4WXEA 5C8YB 3GVPA 2OGSA 2ONZA 3BB4A 3ZLBA 5GIPE 3GP8A 2BI7A 3NBQA 4D92A 4DMUB 1GHTA 5DISB 4EENA 4JC0A 4HJRA 6ADHA 1YQWA 4US2R 1QF6A 2CJPA 1QCYA 3FWYA 4WOPA 3M6LA 1NXOA 3KV3O 1R9GA 2WKSA 3SHOA 4RHCA 1P44A 3EVNA 3JX9A 2R8XA 4GXQA 5IM4A 3H5WA 2B2CA 2QLJA 3MJSA 4IOMA 4W5NA 5TDHA 1S3GA 4DOMA 2D06A 2XQFA 2XZDA 4RULA 2ZXFA 1SZJG 4KQMA 3IEIA 3RJMA 4BAUA 2PR2A 2DWUA 3IXMA 4JUCA 3AHIA 3I4CA 3EBLA 1O9BA 1C30B 1WD7A 4R54A 1D5WA 2Q6VA 2ZR8A 2HXSA 5FNZA 3R76A 1YNSA 1F4VA 3DV9A 3PNMA 4R2MA 4WERA 1WCXA 2O4CA 1MXFA 1SCNE 3BM5A 4Q3LA 3O90A 3QY9A 2PYIA 3FCEA 4CMIA 1DEAA 2P2LA 3Q3GE 1TJYA 1I1OA 4HWGA 1RBQA 2ORYA 1N9ZA 2Q6OA 2WRZA 2FEOA 4ALNA 2QZ9A 1VBFA 4EY3A 1U7WA 3NEPX 4YMHA 3KVYA 3I45A 2V3CC 1IJKA 1SUCA 2UZ1A 4IXMA 5K7SA 5ED4A 3R9XB 3HEAA 1FS6A 4Z86A 4OD0A 3TSZA 4QHTA 1BXKA 1NY6A 4B40A 4BNTA 2BMDA 2ZSUA 4RNCA 2BRUA 4P92A 4DNPA 1YHYA 3AIKA 2GNPA 4E14A 1AUOA 2B30A 1LWOA 3ETEA 2ZT5A 4LOIA 2WJ6A 3LD9A 1ONOA 4G0QA 4UD6A 1RP7A 3CEHA 3I2JA 3EPKA 1R4NB 4NNOA 1U11A 1MXHA 3UUGA 4D99A 2UKDA 4FX5A 4KSBA 2QW1A 4BQSA 4RTJA 4RGYA 3TXYA 2B4QA 1QK3A 1WUTA 5BQ5A 3R7NA 3E5NA 4HNSA 4RTQA 5JPDA 2LCIA 1DWOA 5DN6A 1YB2A 3ER6A 1CR2A 1GYPA 1LBQA 3W2EA 4XLLA 4IDCA 4NMMA 1DAIA 4AP6A 3KQQA 4DV5B 1UAYA 5F5XA 1Z75A 3AU8A 1YBFA 2J7KA 3LZDA 2WR8A 5D3QA 2IZ6A 5HMMA 2BFNA 2GSDA 4IMIB 4D96A 4FYMA 4BQQA 4YJKA 5KSZA 2XAAA 3HY4A 3RYCA 1JLRA 5B57C 2F1IA 1G64A 4YI3A 2E5WA 1BWRA 1HEIA 4G4SP 4TLMB 5CP8A 1L5GB 3KJNA 3VUFA 3WRXC 2QAGB 1BS9A 4ZOLF 3BXEA 1SBYA 4LSZA 2VTBA 3AB3A 1P1JA 5FOVA 5A4FS 2GZRA 4IEEA 2OCKA 3ZDEA 1GL7A 2ZQZA 4E13A 1LVGA 3L8ZA 5BT8A 5TC4A 4UPDA 2VKQA 3VBCA 2YWHA 1USUA 2IJGX 3R1IA 1ZNXA 3NDRA 4GMDA 4KC0A 3VJKA 4DTCA 3R4CA 4JYZA 1UJ2A 2BIFA 1F4LA 3BTVA 3D0RA 2BLNA 2QYOA 4QZVA 1Z7BA 2XUIA 2J5XA 4W5WA 3W5BA 1EUDA 3EK2A 3HDVA 2WFLA 4M54A 2B36A 4NAUA 2J9ZB 3ADPA 4BATA 4TXJA 1D6JA 4QJ3A 1J0EA 3U4IA 1BXGB 1OH5A 2ATEA 2PGIA 1EZ4A 4EZIA 1U3CA 3C87A 3L6BA 4ISBA 4WI1A 3T41A 2C83A 5KU1A 3BMQA 1ULAA 3G3EA 4PVDA 1D09A 1H1LA 1M6VB 1YVRA 1P2SA 3A9TA 3IQDB 4HTAA 5IJWA 4MWSA 2P0EA 3A06A 3NI2A 3ONDA 1W36C 3ZV7A 1G8SA 1NUUA 2PM8A 5T4HA 5KC8A 4HZUA 5DIZA 2P0AA 4W1PA 1RXIA 3HL0A 4PCAA 4A8JB 1KTIA 4IJMA 3KB1A 3HDGA 3I9JA 2LCFA 2ERCA 3WYNA 1TOAA 2C7GA 4UEKA 4DB2A 4S1OA 2ID7A 3BMXA 4R7TA 2W43A 3ADCA 4M53A 4XGKA 2X1HA 4EQ6B 4CKZA 4ZCRA 4PQGA 2VYCA 4E94A 4C5AA 4ENVA 1FTYA 5HHTA 2IH5A 2OC4A 2VYVD 2WDPA 5H9VA 2B1QA 3PB3A 3D8BA 5DKFA 4MYUA 5TF4A 1L1QA 4FHGA 1DBRA 1PP4A 3L05A 1MVLA 3WB2A 3P4UA 3PIDA 3TW8A 1X7WB 4QDZA 3W7VA 1HTBA 1ZVMA 1YGPA 3G17A 2WB2A 4DR4B 4I4CA 4JL5A 1L5LA 5DEIA 3RS2A 5C1OA 1Y6FA 4IUBS 5BWNA 3ZVLA 3WK5A 3RBXA 4KO1S 5GV8A 1XD9A 1P1FA 1U94A 5KI6A 1E7SA 2FPMA 1MFPA 1M2KA 1QH1A 1T1JA 5LXTA 4JLKA 3DM9B 5JC1A 1E2GA 3B7PA 4BUJA 4IV5A 3T5CA 3NATA 3TJRA 4EJSA 3EHDA 5EUCA 3IULA 4AUMA 4DILA 1ZNYA 4IP0A 4XUDA 2Z57A 3X1DA 4F9GA 3DBRB 1FMJA 1PT6A 4Q1DA 3RSZA 4EWLA 3TVDA 4F5WA 1N2EA 1MAUA 1QTNA 4LRTB 4PWYA 5JE8A 5DLEA 1SUBA 3D4NA 1Z26A 3OLWA 1Y37A 3OCZA 3K2BA 4I2VA 3VJMA 2HBZA 3P4YA 3H0KA 4R41A 5IAKA 3WR5A 3ZHUA 2IOHA 5KNBA 4B3TB 1GZ7A 2PCLA 2QRNA 1BKYA 4Q47A 3NTXA 3P4XA 1ZEJA 1NVAA 2AUNA 2ZBQA 3PF8A 3GLUA 3H84A 4KQ2A 2C4WA 2A94A 2ATVA 4FQ5A 5G4KB 5BSMA 4MYDA 4AF8A 4D43A 5CA1B 2QN1A 3NPMA 3F49S 1CDOA 2QMQA 4MW9A 3M5PA 1CETA 1W0JD 1AGPA 1X80B 2BY4A 1F20A 1LVHA 3ELDA 4YPOA 5LU8A 1E3MA 3A3NA 1KBQA 1S5PA 1DJNA 3EZNA 1SIBE 3OX2A 4UE6A 5BN3B 3PHGA 3B5JA 4RKWA 1SMKA 4NE9A 5AVOA 3VAAA 5LBTA 1NVGA 5CDUA 1I7SB 4Y6GB 1BHQ1 3RRNA 4TYNA 2A9VA 3C7AA 4F3RA 2NU9B 1WUYA 2EU8A 2X14A 2O5CA 4F85A 1G9TA 4MJ3A 2FH5B 1BRTA 3L8EA 5IARA 1CS0A 5DNCA 1D7AA 3A37A 1CULC 3IX7A 3DSRA 4GYYA 4YIKA 2X58A 4WHMA 4DLKA 3LUGA 3FSRA 1U3UA 3OICA 1RYBA 2KB0A 5AUPB 3GT7A 3HXQA 5JJBA 1XALA 3H4IA 4HTFA 3JVUA 2P7IA 5FD8A 3SS7X 5JAUA 3D6MA 4FCCA 2W5UA 5CG2A 1ZLXA 2XR1A 3T7EA 3N2EA 3DZDA 3V33A 5AUOB 1XLVA 2K7FA 4Z4HA 1C9MA 2C1XA 5L6LB 5I4CA 4LZPA 1M34B 1R6BX 4Z0HO 3SS9X 3VC1A 4O0LA 3HRHA 2IHNA 2IYAA 2PHZA 2AJDA 3K8ZA 3M34A 4GIBA 3RSQA 5KQRA 4M9ZA 1E3WB 1QBKC 5ER6A 4O63O 4L22A 2YBDA 5LQUA 1G9XA 4NX2A 4QGFA 1E9SA 4OI1A 2WE8A 3ZDZB 3CLSD 2ZR7A 2HTFA 5LQKA 3G13A 4TVOA 3I4LA 4HK4A 3D6VA 1AZSC 4HWTA 4JJIA 1F8YA 3SYRA 4AZ3A 3URKA 2C7VA 1U0JA 2EYUA 1K2VN 4PRZA 1O94D 2P3SA 5JD6A 2R8RA 4ZICA 5GJWC 1TT5A 4HDCA 1L5NA 4GPIB 4N9QA 3ROTA 4URXR 5EWMB 1W5EA 3PHJA 2FAXA 2Q99A 2B5WA 521PA 1L4KA 1U8FO 2D4HA 1J0DA 4ML3A 4Z51A 4OX9Y 2BEWA 3OG9A 4CM8B 5EKUA 1Y81A 3LGAA 1JHVA 2P9BA 2JRCA 1LNQA 1UZAA 4X3CA 5KYUB 3A6HA 1Q1NA 1Q3TA 2IBMA 3H7IA 4XDGA 5L7TA 4CDMA 2IU3A 3ZGOA 1HO3A 1EVIA 1CC1S 3EDRA 4U02A 1UBUS 3RIMA 2ZITA 2RG1A 1T2EA 2E5FA 3RTBA 5CJJA 4WOCA 1W88B 4L5YA 3HYCA 1TVEA 4DCSA 3KXIA 5KREA 1XCJA 4WZZA 3ENKA 3RSSA 2Y67A 1OXMA 1S1MA 4TS1A 1GNTA 3WHPA 1ZUIA 2Q5HA 3DFKA 1O95A 1RYDA 4WOBA 5J2UA 3VDQA 1WCIA 3EQ6A 2Z8YA 3H9CA 4TMWA 2DWQA 4EVQA 4BO1A 3AI1A 3QPAA 1UPTA 3VDNB 5CYGA 2BOVA 1IXYA 1PT5A 1ZVQA 1H85A 1ZIOA 2H17A 4YRJA 1IIBA 1P9NA 1M6NA 1VHDA 2DOKA 3MAGA 5HBRA 4IR7A 1TFRA 4CN8A 1FMFA 2WF7A 3GF4A 3N70A 4M88A 5ITZA 3ZJVA 2IUYA 1U8AA 3USZA 1T6NA 4NL4H 4LZOA 4N5MA 5D1HA 1CQIA 1E1KA 3DVAA 3E6AA 1P3JA 2FMKA 4R1MA 1GCAA 3VMMA 4JI1B 2BISA 2D54A 3C8HA 1F5SA 1L7MA 4JLNA 4JUAA 2ARKA 3PHCA 2F55A 2R85A 2WJIA 4KPFC 4RKFA 2WV7A 3GLIE 1C4WA 5EY5B 5LDDC 5EJIA 2RC6A 3NPAA 2EX4A 4MGIR 2YXBA 3VVBA 5HKAA 3FVWA 2JS7A 3QE4A 4O4JB 2WTBA 3ILXA 4UJ3A 1L0BA 3OO0A 4NU6A 4DCUA 5DW0A 1NNLA 2X19A 3I04A 2FOLA 2VLIA 1B8NA 4LTDA 4HNVA 2C4VA 3CKYA 4IHQA 2YC4C 1U3FA 1Y1SA 4Q93A 1NATA 2Z9BA 2O07A 3OWHA 1M2WA 5JCXA 3FCUB 4NQRA 1GTZA 4DREA 4F3YA 3O92A 1T5LA 2I1WA 3K0KA 2FG7C 4YVFA 1LJUA 2DUMA 5E2AA 4YRAA 1RQLA 3VNVA 4GX2A 1DHRA 2PXXA 2J48A 4KWEA 4A5OA 5IAJA 2N9UA 1XU7A 1ODSA 1QOZA 1VSTA 1R16A 2IXBA 2EZ4A 4W5QA 3ZLUA 2O2GA 3NJ8A 1NU8A 4IGIA 4QJIA 3ORFA 4XSGA 3ZY6A 5LVAA 1QB8A 1A9XB 1JJVA 2XCLA 4DLUA 4R3NA 3R7SA 3ONNA 4O1MA 1L4LA 2PBZA 3CT6A 4L95C 3X1YA 2JLXA 1F7VA 1ZOOA 1DC4A 4G5OA 2PUJA 1GUAA 4PGHA 2AX3A 3ZW7A 4OQLA 1JKJB 1EWQA 2WDZA 1UODA 2ZBPA 4O2AA 3V4OA 1LQUA 3HU1A 2Q3DA 2V7PA 4HYQA 4WCFA 4KHZA 3OD1A 1W47A 4X63A 5FBZA 2WAOA 5TPWB 3WLOA 3K1ZA 3ZCPA 2PPVA 4DV7B 1FSFA 4HDQB 1PJAA 2JI7A 1A82A 5K3FB 4PWZA 5L9AA 5JD3A 1JW9B 1O6CA 10MHA 3H83A 2WICA 2JFPA 3ZQJA 4QRHA 1G8KA 1OYYA 4PGMA 4RABA 1WY7A 2C9BA 3ICPA 5HKLA 5A3QA 4RSHA 3M3PA 3USES 1UK6A 1VG8A 3IC5A 3GEHA 1XJCA 3H9BA 3GFPA 2G77B 1A97A 1RAIA 3L4EA 4H59A 5BO5A 4BNGA 1OX5A 4TV8B 3KXDA 1XN4A 4FQ7A 4LXGA 4XYBA 4AO8A 1PR9A 2I0FA 4QNRA 1WS6A 3WYEA 1TIKA 1YTLA 2XCQA 2O2HA 4BMCA 2OBFA 2Q6TA 1I33A 1B16A 1RLOA 1YJCA 1F2TB 2B4AA 2QVYX 3QRWA 4HN4B 3K70B 4RE6A 2YWBA 3EZ6A 4RPGA 4GDMA 3VKWA 2BF7A 3AY6A 4E31A 4DWVA 3LQQA 5DSZA 1JBKA 2ZYAA 4P7JA 3FLMA 2J4CA 3KOWA 5F77A 5HJ7A 2PE5A 4GKBA 4D41A 2V6JA 2E4YA 4RY9A 3B6ZA 4BMXA 4WK4B 2HY7A 4BWGA 4WD3A 1SVUA 4WZBE 3SF0A 1XD2A 3R24A 3BD9A 4NCKA 3OEYA 1NUQA 1LC3A 1KJYA 3BBLA 2SCUA 3ORQA 5TJ9A 3ED5A 2BFMA 4C21A 4NOKA 2HYIC 2V7EA 2Y2UA 3KVRA 3TTWA 3GPIA 1TTTA 2FWJA 4CF3A 2ZYTX 1ZGGA 1M2VB 1VJGA 3T0FA 3PRYA 4CKWA 5AVQA 3H75A 2JFVA 1H2AS 1K0FA 1VOTA 3F5MA 2JBAA 2QI9C 2YTZA 4PRYA 4R9NA 1DJMA 4RHFA 4X00A 3G5AA 2UXBB 1OI4A 1P4AA 3H1PA 3MINA 4LZWA 2WW8A 3NORA 4EG0A 4WY8A 3TO5A 5LP6F 4DADA 2F3TA 2JJ8A 1JIKA 2SKDA 3FBGA 5K2MA 5KO2A 3UJDA 3D7LA 4ABTA 4GUAA 9MHTA 3VR2D 2JFXA 2VHEA 5FUVA 4JVNA 3KKMA 1W581 1E1CA 1LLFA 4FGZA 4PIPA 1AV6A 1FTNA 4UUOA 2XITA 4LDNA 4DLZA 4W5RA 2JJQA 2GD1O 2VQ3A 5DH9A 3FW1A 4ZI2A 1E1NA 1H94A 1M2JA 3TFQA 2BH9A 2IY9A 5ENVA 1RU3A 1L4MA 1GYRA 1NBMD 5BYAA 4KR6A 4IDDA 2XZOA 4OB8A 3PVSA 1R00A 5D5PA 3KSAC 1GGHA 1Y4ZA 4U2BA 3C0KA 3KBOA 3JATA 4QECA 4MDYA 5FUMA 2H08A 3HEMA 2NTNA 2YUIA 2ZE5A 2IXDA 3E53A 3KT8A 4D3SA 1M1YA 1N2IA 2G5GX 1KEEB 2IEAA 4PN7A 4ZRDA 4P5DA 1XZIA 5JLJA 5TQJA 4TOIA 3ADBA 3LOPA 3DV0A 2ZZMA 2WU0A 2ACEA 3L49A 5TPZD 4BTVA 2C2GA 5A5EA 1HEYA 3FNFA 1JR3E 3K3PA 4D9EA 4E15A 3REFA 3PCTA 5EZQA 1T4BA 4DMLA 1D2CA 3I9OA 3OQ6A 1AVTA 4CMIB 1NIPA 1Q0LA 3K73O 4J9VA 1KPHA 2CF5A 1RWBA 4IDPA 3DAHA 3ESXA 4FJ0A 1TZMA 5DOZA 4BEJA 5GINE 4RTNA 2YWGA 1XA0A 4OHXA 4CLRA 4AKHA 3WNQA 4G4SO 2UZ1B 2QTHA 2FGJA 3QNMA 3CEAA 4IX1A 3CLRD 3IIMA 5EI5A 4IGAA 3GCGA 1VLZA 4BLTA 3GRRA 4Y1EA 3R6WA 2WWTA 2PUFA 2MT9A 3F46A 2H0RA 1KZ9A 1L4NA 3H2GA 1A9SA 4HDOB 1O6ZA 1Y4SA 4C76A 1P29A 1ZD9A 1U1IA 1ZONA 2P9HA 3C14C 3IV9A 1J39A 2D1SA 1JDPA 3ZK7A 5CLJA 3HSSA 1IAVA 2I1VB 1XNGA 4JKYA 1A88A 2LDXA 2CCGA 2RK3A 3GFGA 3C4QA 1ZM7A 3I92A 4KVGA 1HETA 3U3RA 1GUFA 4BFCA 1QYDA 1JEYB 2VDMB 3HBFA 3B9BA 1W6RA 1A69A 2RONA 3OD5A 3QXGA 3VXKA 3QFCA 2RAPA 2JK0A 3JQ9C 3MAAC 1SXIA 1Z74A 3IUJA 3AFMA 4ITVA 2CKDA 4LJYA 4ZTBA 4DL9A 2IHUA 4WFJA 1OE0A 3RQIA 4Y2GA 5LJLA 5SICE 4YV7A 3QHPA 2A8YA 2CMHA 3UT5B 3BMNB 3QKRA 2F9MA 2Y68A 3LYHA 5A05A 5I4KA 5JSQA 3RYCB 4YXWD 3T1HB 5DHAA 3PR2B 4Q3CA 5F9MA 5B58C 2GA8A 1MO2A 2VHCA 2P78A 4HLUA 3DYIA 4OXKA 4RIIA 4A10A 4CEHB 3TQTA 2I6GA 2JCXA 3VC3A 4DCVA 2VTBB 3PCRB 3ICWA 4A82A 4MKZA 1U80A 5DX8A 5E4JA 4EARA 3NGLA 2IYFA 4X8MA 1U3TA 4R1NA 4OJQA 3RUFA 3I23A 4X6LA 5KCMA 1NV8A 2QU7A 5EVCA 3UA4A 4KLZA 4NR0A 2WU4A 3EG9A 3VOTA 4CDGA 1EUDB 4N5HX 4PG5A 3EWIA 2WFLB 2IE8A 1J0AA 2RKBA 2YINC 1J9GA 4LMRA 1X1DA 4RDHA 3G5MA 1IXKA 2AA3A 4JEMA 3CR3C 4JAVC 1UDCA 1WO8A 2ZRQA 2FR8A 1DKUA 4KIFA 1DS6A 1SUFA 3R6DA 4LRXA 4DIMA 2EWWA 2DFKB 3WIUA 4F92B 3UFXA 2FPRA 2H31A 2ZUBA 3QLJA 5I5EA 2ZJ6A 3QOYA 2G6BA 2QE6A 4HZUB 1NFQA 4R8VA 3KAKA 1VIVA 1ZC3A 3FTQA 7REQA 3QFRA 3CUTA 2HPZA 1WMFA 3LP5A 3BA1A 4I3GA 4GBED 1Z28A 1E3DA 1JPNA 5B30A 5LZ4A 2HHJA 1P9RA 5K8UA 1L7XA 2IUFA 1RAGA 4L50A 3J80A 3FKQA 1T0BA 2RCYA 3D9QX 4LJLA 3DHYA 2XLBA 3CLTD 1V8BA 1DQZA 1QM5A 1QDEA 5FUWA 3DAFA 5EP2A 1R0LA 4L5JA 4XYEA 4P86A 3RG8A 3WK8A 2RARA 5AHOA 1Z0UA 3TW8B 3KETA 1CJMA 2EATA 5IUJC 1DJPA 2MIIA 5IBCA 5IDXA 1F2DA 4GLFA 3EGOA 5D3MB 3U4HA 1LLUA 3FCXA 3UJPA 3DZGA 2YWFA 4OTZA 1K7XB 1GGNA 1HH4A 1ZHHA 4RZHA 1N9KA 2O0LA 1OHHD 1GKLA 5EJMA 5JSHA 3QX8A 3VQTA 4EJSB 1GTG1 1UMDA 4G1UC 4XOIA 3I34X 4YQFA 5HYVA 2D5AA 3WGUA 1B3BA 1DLJA 5LDHA 3V3TA 3WLRA 2JFFA 1N0VC 2ZJBA 4LW8A 3WOHA 1Z6ZA 3EZLA 4QEKA 3ZD8A 5C9ZA 3Q9UA 2OCXA 2B8TA 2J6CA 3A9WA 1XFDA 3U3JA 5BUSA 1SOWA 2WJZB 3GU3A 2VL7A 4MUAA 1ZISA 4FYIA 2AUMA 1R9MA 1ZA1A 1KQOA 1DEHA 5EIAA 4DCPA 3GV0A 1BN6A 4NYJR 4EKGA 2C9ZA 1J09A 2AG6A 3W7BA 1KI7A 2LKDA 1ODJA 4JX8A 1KEKA 1Y5MA 4KQJA 5EJ8A 2P77A 3V42A 2W6IA 3F8WA 3MT7A 4FYVA 4WQMA 3ZHTA 3NBUA 4L73A 3RSHA 5FOXA 2L17A 1FP4A 4C7MA 2WVHA 2XUOA 4P82A 3EMDA 1EWYA 1PZEA 1O87A 2P5UA 3T3MB 3S2UA 3ZWNA 1C3VA 1DKPA 2Q2OA 4OP1A 3UW1A 3ZY5A 2WP0A 2XOKD 3OQNA 4E5KA 1A2BA 1JT2A 4N0QA 1T35A 3QMMA 3U48A 3UZUA 2HI0A 4J0JA 2XMSA 5C2JB 2P8SA 1V8FA 2XF2A 1CS0B 2OV1A 4EHJA 3ZXSA 4X1KA 4V03A 4PSAA 4NBSA 4HTFB 2NYUA 2YJ3A 3LCCA 5K1ZA 2Z98A 1ECBA 1CNFA 3HEBA 5I9TA 5T41A 4MGYR 1M8PA 1U7OA 4G9BA 1NPDA 5LD2B 5EIXA 1RBMA 3QTTA 3WXBA 2X0JA 1F0KA 3CV3A 1ZXXA 4MTCA 1P7WA 1NLZA 3JVIA 2TMDA 3DFZA 1C1XA 2QNBA 3I28A 2FPOA 2OO7A 3TTXA 3DXXA 1JS1X 4GL2A 5BV0A 4NBNA 2QNIA 5AXAA 4L16A 4BFXA 4AJJA 3RT9A 5T3YA 2EXXA 3PC6A 4M7PA 5CA0F 1FLAA 3LYAA 5YASA 4YRQA 4U6NA 3ZK8A 2WA1A 3OP1A 3C85A 1JLLA 1I6KA 1C8BA 4JJAA 4NV3A 4XAQA 4XQCA 4AZ3B 3SVTA 4DR7B 2QD2A 1X42A 3SD7A 1ZUNA 3GRFA 2FPIB 4KZKA 3G82C 5FCDA 2PVPA 1TT5B 1PBNA 3P5SA 2I4TA 4MEBA 4Y2JA 1VPTA 4NMLA 4XX1A 5HBGA 3UXYA 1WUHS 1Z39A 1Z22A 3PFBA 4EO7A 2D0DA 2Q41A 3LAWA 5CR9A 4CM7A 1R2QA 1YBHA 2BEWB 4FMCB 5IZCA 3O8LA 4E2XA 2JAQA 5G40A 3E9NA 1R12A 2QZ4A 3MMXA 3T1NA 2DHDA 1N6HA 5CCEA 2WD8A 5IANA 3I6YA 1WPXA 2P6MA 2A35A 1W5SA 2ISQA 1B93A 1T24A 4Q4AB 5DASA 3ZVKA 1G291 2J9YB 3V2UA 2D3TA 4FYJA 1YI1A 1RQGA 5ALEA 5KPDA 3AI7A 1SKQA 2HB6A 1NW8A 4I4NA 5H80A 1E2DA 4PCVA 1HC7A 1W4LA 2X0KA 4KNWA 4Z3OA 3CLUD 1Q12A 2ZJYA 3JWIA 4R7GA 1K92A 3V2GA 2RGCA 4W1RA 1WZNA 1QGAA 2PQ0A 3T9BA 5H5JA 1QC5A 1XK6A 4PZ9A 1UZLA 2FPLA 1E79D 1EIWA 4LJ7A 1NL3A 3BSFA 2A1IA 3TOZA 1NN0A 5ITZB 1EA5A 1LEHA 5KNDA 3ABZA 1Q6YA 3W6ZA 3OEED 2Z6AA 1ZA2A 1VCOA 2QQEA 3DVAB 4G5HA 1IHYA 4CEIB 2FP3A 3D4PA 4TS3A 2JJ2D 1YS7A 1VLQA 5LU9A 4G85A 4UBLA 1E2FA 4YV2A 3UH1A 2XWBF 2B37A 3EIHA 3BXZA 3T7KA 4Z1OA 1OFHA 4FD2A 2W42A 3CISA 1ZINA 1EFPA 4PE5B 3NH6A 5HS6A 2HDWA 4K9OA 3BXHA 3M6VA 4IUYA 4QPCA 3VRHA 2JLWA 2VTEA 3H9EO 2H57A 3VMFA 3OOYA 4B3MB 3O2JA 2JGAA 1T2NA 4RD2A 3C3KA 3ETJA 3PQ5A 4PYNA 4Q1FA 1DRWA 1CUBA 1DT3A 3MTIA 2JGFA 3TMYA 2HGZA 3OSUA 1NI3A 3STHA 2P6PA 2VTVA 3SQNA 1PK7A 4MHOA 1XZBA 3I9V6 5E6UA 2LUOA 4AVYA 3S6JA 4ZI7F 1DZ3A 2ICAA 2RMKA 3OZDA 1O6BA 4MV1A 1JFSA 2P2GA 4BZXA 4B2PA 4ZARA 1E2JA 2AOVA 1Y8QA 2HK8A 2QQFA 2A67A 3IP9A 4JC5A 5AHKA 2HQBA 5H83A 4A6DA 2EBWA 2E4AA 4HOYA 4B2LA 1CDZA 1ABEA 4IMPA 2WKPA 5HMLA 2ACWA 3JTMA 5LC1A 3W9SA 2GPYA 5HNKA 2Y77A 2Q49A 2ID8A 1QYCA 2XT0A 1ZKDA 3EF1A 3Q72A 3E61A 2C82A 5BRJA 5C35A 4TTRA 3NHYA 1A9PA 5ALYA 3W9UA 1HGXA