3IEXA

Schistosoma purine nucleoside phosphorylase in complex with guanosine
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
284
structure length
276
Chain Sequence
b'SVTANIENVKKVAHHIQKLTSIVPEIGIICGSGLGGVKDKITIPYTKIPNFPQTSSGNLIFGTLSGRKVVVMQGRFHMYEGYSNDTVALPIRVMKLLGVKILMVSNAAGGLNRSLKLGDFVILKDHIYLPGLGLNNILVGPNQEAFGTRFPALSNAYDRDLRKLAVQVAEENGFGNLVHQGVYVMNGGPCYETPAECTMLLNMGCDVVGMSTIPEVVIARHCGIQVFAVSLVTNISVLDVESDLKPNHEEVLATGAQRAELMQSWFEKIIEKLPKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine-nucleoside phosphorylase
publication title Structural basis for selective inhibition of purine nucleoside phosphorylase from Schistosoma mansoni: kinetic and structural studies
pubmed doi rcsb
source organism Schistosoma mansoni
molecule tags Transferase
total genus 90
structure length 276
sequence length 284
chains with identical sequence B, C
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-07-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iexA00
1PR1A 1JDVA 3UAVA 4KN5A 1YR3A 2QSUA 5EUBA 4UC0A 4EB8A 5F76A 1SD2A 3GB9A 1K3FA 3MMSA 3LA8A 4GLFA 1VFNA 4DABA 2H8GA 1U1FA 3F8WA 2IQ5A 1PBNA 3NM6B 4L0MA 2B94A 3GGSA 4L5AA 1ODLA 1OUMA 1JDZA 4L5CA 1U1GA 1A9PA 1RSZA 2QTGA 4G89A 4M3NA 3QPBA 1T8RA 1TCUA 2GUWA 1B8NA 2AI3A 1Z37A 4R2WA 1YQQA 5F7OA 4LNHA 1Y1TA 1ULBA 2I4TA 3UAZA 1NW4A 4QAQA 5ETJA 1PWYE 1VHJA 4DAEA 4OJTA 3BGSA 1Z5NA 1K9SA 1RR6A 3PHCA 5F78A 2A0XA 3E0QA 4DAOA 5CXQA 4U2KA 3DPSA 4OEHA 2P4SA 4QATA 5CYFA 2OC9A 1OV6A 3FWPA 4LZWA 1ULAA 3OCCA 1N3IA 1ECPA 3KUKA 1RXCA 1JP7A 1U1CA 1ZL2A 1FXUA 1YBFA 1WTAA 3KHSA 1U1EA 1TCVA 5CCDA 4E1VA 1Z35A 4BMZA 1NC3A 1XE3A 1V3QE 4TXLA 4G41A 4PR3A 4D9HA 1Y1SA 4JP5A 4D8VA 4WKOA 4F1WA 2QTTA 1PR6A 1RCTE 4YNBA 4LKRA 3P0EA 3NBQA 3EEIA 4DA8A 1T8YA 1T8WA 2OC4A 1PK7A 3P0FA 1RXYA 3DF9A 4D98A 5B7PA 1K27A 2A0WA 5F7ZA 1PK9A 1ODIA 4RJ2A 4DANA 1PR2A 1LV8A 5K1ZA 1PF7E 1Y1QA 4OGLA 4WKNA 3NM4A 3OPVA 1YRYE 1T0UA 3KVVA 2I8AA 5B7GA 3KVRA 4JWTA 3IOMA 1V41E 2RJ3A 3OZBA 1JPVA 4MARA 1OTXA 3ODGA 4FFSA 2AC7A 1G2OA 1JYSA 1PKEA 3OF3A 1TD1A 4TTAA 4DA0A 2OXFA 4JOSA 3FB1A 3OZEA 1VHWA 1A9RA 1V45E 3PNSA 2OECA 3OOEA 5F73A 4PNPA 2AI1A 4GMHA 2ISCA 1PR0A 2AI2A 3FNQA 4TTJA 5I3CA 1M73E 5KB3A 5DK6A 1CB0A 4I2VA 4GLJA 3E9ZA 1JDSA 1PR4A 5EPUA 1Z38A 4R2XA 3FOWA 3KVYA 5C80A 4P54A 1JE1A 1RXSA 4ECEA 1LX7A 1SJ9A 4IP0A 4H1TA 4NSNA 1SQ6A 4L5YA 4QFBA 1PR5A 4G8JA 3C74A 4OY3A 2HSWA 2BSXA 2QPLA 4F2PA 5JPCA 5IU6A 3BSFA 3T94A 4TXNA 1TGYA 3DP9A 5CYGA 3E9RA 5F7XA 3LBAA 4OGKA 4TS3A 5B7QA 4QEZA 2A8YA 2PGAA 4D8XA 3OZCA 4WKBA 4BMXA 3INYA 3OZDA 1Z5OA 1Q1GA 1SD1A 1PW7A 1OU4A 5FAKA 4M1EA 1JDTA 4M7WA 1OTYA 1B8OA 4MCHA 1Z5PA 3K8OE 4TXMA 3ONVA 3KU4A 4QARA 2Q7OE 1RXUA 4K6OA 4X24A 3TL6A 3EUEA 4WKCA 1Z36A 3ENZA 1A69A 1A9SA 2HN9A 2QDKA 3UAXA 1I80A 4WKPA 3BL6A 1V2HE 2ON6A 4YO8A 3DDOA 3PHBE 4F3CA 4BN0A 4TXJA 5F77A 4YMLA 3PNPA 4GKAA 1OVGA 1V4NA 4F3KA 1JE0A 1Y6QA 3EUFA 4DA7A 3D1VA 3SCZA 3FAZA 1RT9A 1U1DA 3EMVA 5F7JA 1QE5A 1A9QA 3FUCA 5CCEA 1YQUA 4LDNA 4EARA 1V48A 3MB8A 5B7NA 4OF4A 1Z33A 3IEXA 3U40A 3UT6A 1A9TA 1ODKA 1Z39A 1VMKA 4QASA 1LVUA 4D8YA 1Z34A 3K8QA 3DJFA 2XRFA 4R31A 4TS9A 4DARA 5EFOA 4TXHA 3BJEA 3O6VA 4TYMA 4F2WA 1ODJA 2HRDA 1CG6A 1C3XA 3UAWA 4BMYA 4DA6A 5CXSA 4LNAA 1TGVA 2HWUA 1RFGE 1Y1RA 1ZOSA 4MCIA 4NY1A 4TTIA 3OOHA 3O4VA 2A0YA 1JDUA 3UAYA 4NS1A 1T8SA 4L6IA 4YJKA 3LGSA 1A9OA 5IFKA 1RYZA 1Y6RA 3NM5A 1NC1A
chains in the Genus database with same CATH superfamily
1K7FB 1S4MA 7ADHA 3JWPA 3C5HA 3OIVA 4KB5A 3KUXA 1U9IC 5BO5A 1FX0B 2H52A 3OEHA 3VOAA 3TUIC 2IYYA 2J87A 2PL9A 3U26A 4AX8A 4CKEA 5JCJD 1ODFA 4F46A 2A35A 4J1QA 5C53B 3VTKA 4PPQA 3GLUA 5EKUA 3UC9A 5U4QA 1DJMA 2HWYA 2AD1A 2UXBB 3WL3A 3EGWA 4CI0B 1OLUA 4REOA 3ZHXA 2YS7A 2Q1YA 4KQFA 4K9KA 4MPPA 5A4MS 1QHXA 1R5NA 1QHEA 3HRKA 1SUPA 2UZ1B 2IIQA 4B7AA 5AXAA 4O8CA 3FMOB 4BB9A 4EW6A 1W0JD 1YI0A 3NORA 1FX1A 3UB2A 3HADA 4AUMA 1P18A 5AKXA 5FPKA 3TAUA 5B6PA 3HBNA 3A6PC 1DBVO 4W7HA 1F38A 1Z0FA 4HNAA 4G89A 1BHSA 2ILVA 1N1EA 4IXTA 4M3NA 4N3NA 4RHFA 4PLPA 1X3SA 5YASA 2ENWA 4I9HA 1P4RA 5BXQC 2YN2A 1NURA 4JL5A 4GXTA 2VP2A 1B8NA 1E3MA 4L0QA 4F4HA 3A1CA 4YP9A 4WNAB 3A0UA 3EW7A 1NKTA 2DUNA 3KDPA 4H1VA 3WXMA 1C1HA 4X6LA 1NRXA 3KQLA 3DNPA 5DKFA 2XQIA 4XXHA 1QIFA 1GPAA 2I7XA 4Q34A 1BS1A 5KNBH 1OYYA 4B84A 1YVRA 2C20A 1LF5A 3FFTA 1QBKC 2I7CA 2IU3A 3IILA 1PDOA 1V5IA 1FDRA 3DMDA 3VYVA 3WGTA 4I1PA 4Y30A 3V7FA 3WKBA 3VO9A 4R8KA 5ECWA 5CDUA 2GNOA 2IYRA 3HH8A 3VSEA 3U60B 4U7GA 4BMCA 1FW8A 1CNMA 3U39A 3MWFA 3RJ5A 1E5LA 1HM5A 4DXAA 1QGOA 4EX7A 5IRCD 1XIVA 5ED0A 5EIBD 3IO5A 4P0PB 2I33A 2QX8A 4DEXA 3K5PA 4PC3A 1YTLA 1DC7A 1RZVA 3BRQA 1RWQA 1R88A 3AR9A 1YJCA 3G0BA 4XVRA 2WPNA 2VJDA 3FFBA 4HRYA 1V25A 2ZRKA 3FX2A 4F60A 2M6LA 2Q6OA 4OLFA 1LA2A 2G04A 4Q7KA 1VPWA 4OEHA 4OA5A 5B3LA 4KSBA 3AU8A 5JT1A 3AUTA 3OWXA 4Q01A 3CW9A 5KOJB 1X1AA 4HDNA 3EZXA 1ZUHA 4BCBA 1S01A 3ASVA 4MUEA 4YJ2A 2V7PA 2QE6A 4FBGA 3ZJUA 1DWPA 1I2ZA 1ECPA 2V4ZA 5ALYA 5HVNA 1E2MA 1P2TA 1X3LA 1Y4DE 1KFEB 2A0FA 1OD6A 1QCZA 1G59A 4RW0A 3ESBA 1R0RE 4TYPA 5FBHA 4NVRA 1NJ8A 4M9RA 1FSFA 4QPDA 4QD3A 2H2HA 3RQIA 3WK7A 5AM1A 3TFOA 1YBFA 2Z98A 4I81A 5FLEX 3A37A 1FLDA 2WD7A 3BD7A 1CZRA 3ZHOA 2PUEA 3TS1A 4UAVA 3QLTA 1N0WA 4MRVA 1U3UA 3KR0A 3MT0A 5J1SB 3ETLA 2I9KA 2QG9A 4CFYA 4YECA 1G3RA 4EATA 2FLKA 1S3SA 1DBSA 3STTA 3X0DA 4R81A 5HF6A 3U1BA 3IQHX 4TT8A 3ZIUA 3SQDA 3ITNA 4HF7A 1EP3B 3GK3A 1C0KA 3N0XA 4QDOA 4C0KA 1YIAA 4C7VA 5M29A 1FP6A 2ZIAA 4B2LA 4EHDA 3Q5DA 4KR3A 4LRTB 1N5JA 2Q6IA 2MOKA 3CEJA 3I6QA 2PT7A 4S2EA 3TTUA 4YJFA 3Q8XB 4OK3A 4AS3A 1I2BA 3TF5A 3ETNA 1X7WB 1JDNA 1E2BA 3KEQA 4K03A 2PUJA 2A7XA 5HXAA 1P1JA 3Q9UA 1T3HA 4LWZA 5IS2A 2WU4A 5I7AA 4YUVA 3M81A 4M60A 2FSUA 5FR2A 4D92A 2E2WA 3C14C 1FQWA 1MV8A 1UR5A 2MINA 4G5FA 4NXNB 5KTPA 1UJCA 1N25A 3A05A 6REQA 5CB8A 7GPBA 1O03A 3TLJA 3NV7A 3JQAD 4XVUA 4E2XA 3QY0A 5A9SA 1YH3A 1JG4A 4XQ0A 1ZMRA 5EGNA 5EHQA 5ITSA 1G4HA 3QEBZ 1L8XA 5JD3A 3DEFA 1K27A 2O06A 3DT6A 1DELA 4UM8B 4KO4S 4DCSA 4KP7A 3REGA 4CCYA 4XWOA 5TX7A 1AS2A 1X0XA 3CZ9A 5ESXA 1Y3DE 2HXSA 1AXGA 1Y33E 3E84A 4RJ2A 2Q9BA 4AB1A 3UEOA 5K6AA 5J2UB 2XMRA 5L3RA 3JR7A 4V0NA 2OAP1 2Y4NA 2NSYA 4KFRA 3CBGA 1FSGA 1KJJA 2XMSA 4JZYA 4NF2A 1JAIA 1YRHA 3UTDA 3R7DA 1GTRA 3DAOA 1N3BA 1GUBA 1NTOA 3ZLBA 3UV3A 2ZAMA 4CUZA 4XUCA 2QHXA 3BRSA 3SHWA 5C9ZA 2ZTLA 4L4YA 4TSRA 3ZGYA 2YDYA 1DT3A 3HBLA 4HAVA 1NSYA 4YJ3A 5IM4A 5CB4F 2H4XA 3A6LA 4DIKA 2AOTB 2UYHA 1EXDA 1TK2A 1T9KA 3EXHA 2FF7A 4CHTA 2FWIA 4XDGA 3KKOA 5DGXA 2JASA 3BMQA 5JCXA 2XBUA 2H18A 3PGMA 3A9SA 1M0SA 3PWZA 4NULA 1PTJA 5L95A 1QFJA 1VKHA 4RXMA 4S1WA 3WBBA 4GI3A 4ZHQB 5F98A 3C6QA 3OTGA 2Y66A 4DBZA 1THZA 1Q1EA 2RARA 4W8OA 1CETA 4DA0A 1C80A 3DBVO 1SD5A 4KZKA 4PC1A 4A8TA 2ZUEA 1JSLA 5EXPA 1OFTA 2JVIA 3C3DA 2NO7A 1M2EA 3VAYA 5IT9A 3JQAB 1SVNA 1TX4B 1A9RA 2QL9A 3DE3X 5EWMB 1E1DA 1NU6A 5MFPA 2AFIA 1SVOA 4IZ6A 4CBVA 4D99A 4S1VA 3EIFA 2XT6A 1XMSA 5BPHA 2HFKA 4LPSA 3KT8A 3TM4A 2WWXA 5DEOA 4TUYA 1FQOA 1Q20A 1ISIA 1I4OA 4WLEA 5FADA 1EVEA 2IE0A 1VGRA 2JIDA 2R62A 3EODA 1ZI8A 4Z3DA 3V4SA 3MWEA 4EY5A 4ENSA 5AM4A 4CLHA 1VDMA 3LLCA 4KLRA 2IHZA 3GQBA 4NK4A 3DZHA 4C0WA 5U9CA 1S5PA 3VC3A 1DCMA 2A9OA 4XOIA 3TLXA 4COOA 4FYMA 1M73E 4DF3A 3D5TA 3L0SA 1UDWA 5DK6A 1IK6A 4R1MA 4PIMA 2MDTA 4QU5A 1INLA 2NSHA 3KXPA 4TZTA 1QVRA 3B38A 3CR8A 2XF8A 2ZPAA 4L07A 5TSDA 1IVNA 2AYZA 1KZ6A 3C85A 4ZVPA 5ALTA 3C3XA 4CQMA 4MUBA 5HKKD 4CQLA 2OKGA 4HQ0A 3CUWA 1USUA 3RODA 1QFXA 3DVRX 1KARA 3KTAB 3SE7A 2BFDB 2QE7D 1L5WA 1ZIOA 3JQGB 5K3CA 3VISA 3CZQA 4LOJA 4EHKA 4ZAFA 5DYNA 1Q21A 4N6NA 3I9KA 2E87A 4EFLA 1RQPA 3AF0A 1KBQA 4P4NA 4BO6A 1CUJA 3IPAA 3AZPA 4OKSA 1IQPA 3O93A 2BFWA 3PNOA 4ZVVA 5I4KA 4GKBA 5K8TA 1FTNA 1YV9A 1RKVA 2VUHB 1VI2A 2Z5GA 2O5EA 3PGVA 4J1SA 4JV5B 4H1TA 3MC1A 4R05A 2AGVA 2KHZA 1U99A 3Q3HA 2QBYB 3ZZ0A 1UWVA 2QMEA 1QRSA 2ZSJA 1N75A 4RC9A 1ABFA 3JVEA 2KM1A 4Q1CA 2BKXA 1XTQA 2FR8A 4OSOA 2OFPA 4CL3A 2F8SA 2K5UA 3CX8A 1SQSA 3UYKA 1RE1A 2X2FA 4ARIA 1U04A 2IEYA 2YBDA 3KKEA 4HDCA 4F4FA 3GRPA 4IGIA 2A14A 1I6LA 3E9MA 3IXQA 3QF7A 2HFJA 4M9XA 3FPHA 3LWNA 1ESMA 2J59A 1OZHA 5DBFA 1WMAA 5DGDA 4B48A 2BGRA 1DKNA 4HD8A 4UM9D 5I51A 3KSDO 5BWLA 4K6CA 3KLBA 3B1KA 3PXDA 3B3AA 1M2NA 3LBAA 3MQ2A 3GGOA 3DOEA 3AF1A 5DCYA 1V11A 2OKCA 3BSSA 3EEYA 4TT3A 3SJAA 5B7QA 2VTBA 2RGBA 4BTLA 2BDTA 2ZIZA 3WHPA 2WABA 4AM8A 4MW9A 1T36B 4FHGA 3VYRB 4D8XA 4G0VA 4MHTA 4HMOA 1B0UA 4HMPA 4ZEOA 3EXG1 4PGMA 3P5BA 4EITA 2V58A 3OZCA 3PICA 4Q6WA 3GUZA 3L8CA 1PFGA 2XMCA 3IEMA 2AXEA 2GZ2A 2VTDA 5DGHA 3G0GA 4QUJA 4GUDA 4L22A 2XRMA 3D2CA 3HCFA 5DTRA 4BLOA 5ALJA 4EEZA 4D02A 3I05A 1OFUA 3NTVA 1BKSB 4YC7A 2H1IA 2YWRA 3IMKA 3JZAA 4P86A 2VHUA 5KC9A 1QG6A 3SOZA 3IKTA 1DAHA 3MHPA 2ACWA 4LQCA 4RA6A 1ZOPA 5EP3A 3B6KA 1E92A 3FJYA 3GLIA 1BJTA 1GPWB 2X0JA 5HTKA 3W9BA 1SZCA 3CZRA 2C5HA 2RHOA 1QIHA 4GECA 1URPA 3ONVA 5F9MA 5H4GA 3LU1A 5EE5B 2EHJA 3N8NA 3ORFA 4CLEA 4GZ5A 1RXUA 1JYEA 1JT9A 5CA1A 4E13A 3H2BA 1M54A 2BFAA 1YKGA 3L7YA 1FY2A 4PYRA 4IQ0A 2DRIA 2ZGVA 4WTOA 3G7NA 3NAMA 3S55A 4D81A 16PKA 4KSYA 1NVXQ 3CLTD 5KZMB 1I4DD 2VPZA 1A9SA 2ZJ0A 4YAEA 3WQBA 4LQDA 5BQXA 5I6DA 4ZV7A 2P9EA 1G42A 2CDAA 1UP4A 3INNA 1OKKA 1CEYA 1AZTA 1R16A 3JU3A 1N33B 3CZ4A 2NUAA 3OE1A 1DIHA 1RJWA 2R8PA 3N2GA 4CMIB 1Z6TA 2BVNA 3H4VA 2YWDA 5A7GA 5J4LA 3DW1X 2JCYA 2RBEA 2HTEA 2YMLA 3PSAA 4JA2A 3WGJA 1TT5B 5CHYA 3FZNA 1XALA 3KSBC 2CBZA 1I4EB 3Q7RA 1PT7A 1LSOA 3EWIA 1GXSA 3PNPA 4HQRA 3I73A 2XXAB 1NUTA 5HQ3A 4FJ0A 1UFQA 2AF4C 3WHIA 3DVLA 2VHEA 1KDOA 4BIMA 5KPJA 1C9NA 4FVTA 4FX5A 4BLUA 2EJTA 2BEVA 2BP7A 2H4WA 3WKEA 1UXGA 2Z4RA 3RU7A 3PPVA 4DSAA 3D1VA 3JZMA 1E79A 1N0UA 1JF8A 1Q2XA 4KH1A 2X0EA 5J4VA 2QV0A 3D4OA 4FI3C 1Z0IA 4Q3NA 5A0TA 3DDUA 1A9QA 2IHNA 1OC2A 3SICE 4ZT2A 3EIQA 4E08A 2C61A 1PS9A 2Q5CA 4JY7A 1MRZA 4D9KA 4RH0A 3TR0A 3LZDA 4F06A 4XSGA 2H51A 3TG2A 4OF4A 5BQOA 3OWHA 1QDLB 2LBPA 3EZ7A 2MSCB 1IM2A 1XF1A 5JJCA 3NHAA 3OCUA 4ON9A 1D9XA 3CXUA 2D06A 1O8CA 5HOQA 1GNPA 4YLEA 5F3WB 4BB5A 4EY3A 4X00A 4ZDKA 3G2QA 4AWBA 4BMNA 2J41A 5BMVB 2JDID 1JLRA 2JFFA 3D0QA 1JGTA 1XB2A 3V1NA 4CMHA 2QQEA 3PRKE 1ZZEA 1ZXXA 4C3UA 1G8FA 2BMAA 3N87A 4DCGA 3VA7A 4FHFA 2NZUG 3E9DA 5FTKA 1XA0A 5IJAA 1HXHA 5IC5A 4R1PA 4EPTA 2H2AA 4V2IA 3EVDA 5ECYA 5JVDF 3GARA 1KMMA 4EYQA 4MK4A 2OYRA 2YUTA 5FWYB 1IXKA 1P81A 1CS0A 3WFJA 1QHHA 2BFCB 1IU9A 3CKYA 4EA6A 4BMYA 1H9AA 5CXSA 4OYLA 3GLFE 1MEOA 4TL6A 3W34A 1P39A 4EM6A 2X8BA 3UXMA 2EARA 3QBTA 3DZGA 1GJRA 1G1MA 1XZDA 1JG2A 5CJPA 4K9QA 3V4RA 2NGRA 3CLKA 3QU9A 1CK4A 1BYIA 2I2BA 4REQA 3NI2A 4P9NA 2Q4TA 1G8JA 4P4SA 4P7BA 3KPUA 3PXGA 4O3MA 1EDEA 1B0AA 4IHKA 3HFRA 1Z28A 3VAAA 2FCAA 1SU4A 1UP7A 4B6JA 4MR8A 3OE4A 4RVUA 5FUVA 4E3WA 4NFSA 4YJKA 3N07A 1BH6A 2QEQA 2D13A 5CVUA 1CRQA 1DIOB 4G1EB 3GLVA 1ZH4A 4TYQA 5E6UA 5EZ6B 1ZQ9A 3LK7A 1E7QA 5F5LA 1ZW1A 5M2QA 1P17A 2O6LA 4R1UA 2HV9A 4BO9A 4FFBA 5COAA 3MGGA 2X6QA 2Y6VA 4FYJA 3COVA 4I9NA 1HKHA 1H22A 4ZQCB 1B0PA 4LDJA 2L82A 2XTAA 2JI8A 3KSAC 1QP7A 3G8AA 4FBLA 1US8A 3AIOA 1E18A 4BAUA 2HMAA 2H2IA 4RO0A 4EB8A 1R8XA 4H7EA 2V5UA 4DLPA 1NBME 4RVOA 4BMVA 2GWHA 4BO4A 3MMSA 1BD3A 2RH8A 3ZXXA 4DC9A 1C4KA 4B7XA 4CM5A 1EVYA 1O58A 1HFJA 1JTEA 1MDFA 2CSUA 2IZ6A 3GJ8A 2KE5A 4DY4A 2G9QA 5IEBA 4A15A 3NNDA 2CT8A 1K89A 3IJRA 5D86A 5DTQA 4D4IA 2ZVJA 4DABA 1IK4A 1I5EA 1KORA 1NVEA 1R9JA 2B8EA 1COWD 2PLNA 3FCYA 3CRVA 2QRMA 3L0DA 4TLMB 3RYIA 3KQNA 1BOOA 1PBNA 4NV0A 2GKSA 2YS6A 3B52X 1M6YA 3F98A 1NUSA 2VHTA 4EO4A 2NN3C 2CXOA 3H86A 5G4KB 4WVFA 3P4UA 3THYA 1GTZA 1VCNA 2OSBA 2VHCA 1YUMA 4NP6A 4U7JA 3HKCB 3DEKA 4YROA 1IJKA 9LDBA 1AK2A 1VOTA 3IEKA 4X20A 4WGFA 3HB5X 3BWCA 3LGXA 2CJWA 4L8LA 2WFLB 4ARZA 1IY2A 1W581 4JT4A 3CZCA 4YBZA 1G8PA 4RV5A 4G0UA 2O1EA 4AULA 1T43A 4WXMA 1YZ3A 3PT5A 4YVFA 4DNQA 2HYIC 4H0FA 2E5WA 4TVSA 2FP3A 2WOOA 3DP7A 3LTNC 1ZJZA 2H63A 5AMXA 3GPIA 2WWYA 4DDMA 1QV6A 2XTMA 3AY6A 4KEAA 1M8FA 2I4TA 3LCUA 1FDTA 2J7PD 4N54A 1F2UB 1L5VA 3GGCA 4E15A 2JEYA 4QA9A 1XQVA 4QAQA 3KV3O 4PZZA 3JQBC 4R0VA 1GQSA 1GG8A 1PSWA 1NBEA 1AQUA 1DC3A 2OK8A 3PWSA 1CVIA 1N1MA 2ZRLA 5ECDA 5LA6B 2IBTA 1UBLS 3NYIA 4ED9A 1F8GA 5KJFA 1U4SA 3T35A 2OCLA 2W2MA 2Z9CA 4NYJR 4O4HF 4WLUA 3TN7A 1HFKA 1PWEA 2GYYA 3NBMA 3SJCA 2WB2A 2O54A 1NXTA 4WFIA 4F5DA 3WMFA 1BG6A 4H1WA 1LX6A 2ZBUA 1YDHA 3CLUD 4FYIA 2V8OA 5E3IA 2OD9A 4BLSA 1Z0SA 1QZXA 4RTJA 4KIGA 2GDZA 4WCFC 3DPSA 5BN4B 3RHFA 4E21A 1ESZA 1Z22A 4II3A 2EW2A 4XFKA 1UT6A 3CSUA 3AP1A 2I62A 3G2JA 3FWPA 5AK5A 3HDYA 4HQ6A 3P9CA 1MJGM 4J94A 3TGPA 3FSGA 4ALMA 4MVJD 5JXWA 5EKDA 3KT0A 2DPLA 2XSZA 4EB6A 3HB7A 3MELA 4P4TA 2I55A 4WBXC 1GAEO 4XSVA 2BUAA 3D8UA 3MJEA 5B64A 4YREA 4JYAB 1MV5A 4D3YA 1CJTC 4GL4A 2XAAA 5G3ZA 1BAPA 2WHEA 4TTRA 3F67A 2VJOA 2XITA 1T9HA 3BORA 1Y9EA 4P22A 5BSEA 4ENUA 4QOFA 4ZYUA 2YYAA 2JHPA 2GBLC 3K0KA 5I8ZA 4JYPA 3TW6A 4KI0A 1QRTA 1PT5A 5KJCA 1T29A 2C0PA 1AHIA 3QUCA 3L1VA 1CZOA 1ZJ4A 3IQGX 3D6HA 2ZWIA 3NS7A 1M1UA 4OK6A 4Q12A 3UAGA 3Q3CA 4LHSA 4EG1A 4CL8A 1FNSA 4P3NA 3CWQA 3H3JA 5LQSA 1TYBE 2ZUTA 3EFBA 4NEHB 4EF4A 3GX1A 4RY0A 3H8SA 5LMZA 2WF5A 4QXQA 1QTNA 1AKNA 4M49A 4URFA 1FDOA 4RPLA 2I2AA 1S8NA 2EKPA 3GVHA 4I9GA 1Q7BA 4O2AF 4Y9DA 4RM3A 4BCCA 4F0JA 5KNCD 1G7CA 2A67A 5BSUA 3O8QA 6LDHA 4RY9A 3QEOA 2ZBRA 2DPHA 4DV2B 4CLOA 1JTFA 5HCNA 2G67A 3GT0A 4IDEA 2JI4A 5DN6D 3K2QA 4ABTA 4D6PA 1L7MA 4ND8B 4FFDA 2AOWA 2ZJ2A 1PK7A 4Q0MA 1T25A 1AA9A 2PFKA 2YFYA 4HSGA 4S1PA 4DLSA 3A4IA 2LIVA 5JI2E 1WS6A 5FBKA 3GVXA 3ML1A 1UDBA 2EIHA 2GBCA 1W44A 3M5DA 5JAHA 3TSOA 3L8ZA 3ES9A 1SGWA 1YJAA 3MF4A 5A71A 3UXEA 4ZK2A 5CFPA 3CG0A 1T2VA 3VR5A 2NU8B 4ESHA 3HGMA 1RRGA 3MTBA 3R7BA 2VT7A 2I2CA 4HNGA 5PNTA 1C8LA 1E1QA 2VZ0A 5EA2A 3UHAA 1NI4A 4AP5A 1EUCA 3E0XA 4XD7A 1ZY2A 2P6RA 5JSHA 4EG7A 3SYLA 5EJMA 4RTOA 1UPUA 2WPDD 3U09A 4XA8A 3PQCA 2O0HA 4PQYA 2CFCA 3S27A 4K9LA 1M2OB 3J81k 2QZ9A 4I6GA 5K3OA 4C05A 1YK1A 4LRXA 2C3PA 3PEFA 2AEFA 5BPFA 3T1YB 1QKKA 1WE2A 4PYMA 3T3NA 1XCPA 1XDGA 1ZGGA 1IEWA 2GPWA 1E3QA 1GQOA 3SG0A 3ZDXB 5E95A 3AF6A 4OHBA 2EX4A 3CCFA 1G6Q1 1ZSNA 3ICEA 4AKHA 1I3NA 2J5XA 2V98A 5BXYA 2G9UA 3LPLA 2XOKD 1IATA 1XA4A 4M89A 4B2YA 2ZJBA 1Y8ZA 5GVSA 2AFHA 1E8DA 2OY0A 3EVTA 3DE2X 3DKIA 3GFPA 4Y2XA 5EEHA 3UJDA 4TWZA 1M66A 4I1UA 1U0TA 1Y3IA 1T1EA 4FT2A 4HWSA 1J56A 1N1DA 4OM8A 2VCYA 2BZ0A 1QV9A 1AG9A 3KB8A 2XMPA 3LYLA 2PYZA 2B8WA 2OWDA 6ADHA 4L7VA 3K9CA 3CX6A 2RHMA 3H0EA 3MJHA 4DCJA 3BMCA 1HNNA 1Y6GA 2C5BA 3R3SA 3RROA 1I32A 3G8CA 1LC3A 2W6IA 3PEWA 2PH5A 3HM9A 3QYFA 3DVAB 5L6LB 2ZSDA 3MTEA 4ZAXA 3O8OB 4LZLA 5G0UA 1T8TA 1Y9DA 1HQCA 1OI2A 2NSLA 2Z9BA 1PJLA 4KPUA 3OJOA 4WLNA 3JQFC 3WLOA 1M83A 4UPVA 3P2JA 1GT6A 2V54A 1Z29A 5D6OA 4ABYA 3FLBA 3GN1A 3NPMA 3QVGA 4YMHA 1N4DA 1USGA 4O8ZA 1QH1A 3BIFA 5CNKA 4RTNA 4KKXB 3K3PA 5JPIA 3TJRA 4B7UA 1W5SA 3EPHA 3T7AA 2WWIA 3BD8A 1GCGA 3M1YA 3R7AA 1CB0A 1WU7A 4HEHA 4YP0A 4EY4A 1P9WA 4RPGA 1H6AA 1CZHA 5FBVB 3IMGA 4UNIA 3Q7QA 3AJEA 3F4KA 1SAYA 1Z2EA 3HCPA 3MCTA 2ZT5A 4GDFA 4ZRNA 2EJBA 2XD9A 6YASA 4GAEA 1Z38A 3L41A 3GC6A 4YJGA 1SBHA 2I2DA 2RMKA 2C96A 2XOEA 3BWEA 1WXEA 1O5TA 4GMKA 4KRYA 4L2IA 3TPCA 4PLGA 4ZCRA 2DB3A 3TFWA 1WZIA 5BW4A 4YV7A 2ORYA 3I4LA 4D0NA 2WM9B 1AKTA 1ZPDA 1DAMA 3GXBA 1ENOA 2BCEA 1TMKA 1WTCA 2GRAA 1DU4A 2MMGA 3SM9A 3VH3A 4E1BA 4UVHA 2ENUA 4IX9A 4FB4A 2PGDA 2PR7A 3IYLW 2C8VA 4FCWA 3G1TA 1MB4A 3QPDA 1D1QA 3FW1A 3PE4A 3KZKA 4QHSA 5IM5A 4BFWA 1LRJA 1VYHA 4EEKA 1F1JA 2AXNA 3OVMA 5ALEA 4NG5A 3UANA 2UYCA 1ZP6A 3LDAA 4ZZ3A 3OBBA 4BP3A 4F6RB 4GM0A 1HORA 3Q7TA 1ZS9A 1TTHA 3DFUA 4E2ZA 2YJ3A 1HL3A 4RS3A 4ADSG 4CMEC 4G23A 1E98A 1PFYA 2XNKA 3FG9A 1DHTA 4TRMA 5KNBD 3L8GA 2IUSA 1G0NA 4F2PA 2ZYRA 4MYTA 2OUKA 4J0IA 5JPCA 2PKCA 3FRIA 2MT9A 4LSWA 1DTEA 3VPHA 2AW3A 1JKJB 5JFGA 4X71A 5K4GA 4F04A 2QMUA 5LQAA 3ADOA 3FTCA 5F5XA 2BLNA 5K3DA 3VJKA 1NPYA 1OXUA 4JELA 4OGKA 3TPZA 4TYNA 1NW9B 4D9NA 5JBQA 3HBFA 4OGFA 1V1RB 5I45A 1P0CA 1UXOA 2YX1A 2NOAA 1ZFNA 4CT5A 1BX3A 1RAGA 4GE3A 4MW5A 4JI6B 1F48A 1VG0B 4CTNA 1NYTA 1O2DA 4ISBA 1FUYB 2YHBA 4URUR 4WDRA 5D2CA 4QTYA 1X70A 4DSOA 3AFGA 3PI6A 2RFLA 3B89A 3CKMA 3U31A 3I6YA 3NTRA 3OZDA 3I61A 3ZV3A 1Z5OA 5I4IA 5AIAA 3EEOA 3ESDA 1AX9A 4YB8A 1IN6A 1HT2E 1ZCAA 1FP1D 1E62A 2C7QA 4BRSA 4CDMA 5LU9A 4DV4B 2C4WA 3EGOA 2ODQA 4RF2A 4ITUA 3ZUPA 1LSUA 3HUDA 2C2KA 4U9IS 3HRHA 3QFHA 1O9BA 3OOSA 3UMSA 4JSYA 5MDHA 2JH3A 3YASA 4IKOA 1LPBB 3LT4A 4FC6A 4GICA 1J0BA 2BT4A 2E7ZA 2ZUCA 2AZMA 5DTMA 5B53A 5TMEA 4DLWA 2RHGB 4JIGA 4D9IA 1J8YF 1M7BA 2CK3A 3EF3A 1N2EA 2UZ3A 3A4LA 2A3NA 2OZEA 4Q21A 3RQSA 4AK9A 1ZD8A 4AMBA 3WSWA 2XE8A 4B3TB 4Z4FA 5J5VA 2EFHB 1D2EA 3V8QA 4JLJA 1S2LA 3M5WA 4R2MA 3B36A 2Y1XA 1QQ5A 2LCFA 5GONB 2PMBA 2JJMA 4C14A 2TSYB 2MHCA 3ICPA 3EIHA 1I2AA 3UJ3X 4S05A 1O0SA 2OCAA 3I8SA 3QFFA 1ACMA 2OUIA 3SR4A 1XXHE 2NO5A 5DIFA 1D1PA 3CHYA 3DEHA 4KODA 1NYRA 3HY6A 3M82A 3QHPA 1J2YA 2HIMA 1DC6A 3NOQA 1C4XA 1TUGA 3H2HA 5C3UA 4UUAA 3UG6A 3EQ7A 3ROFA 5ED4A 1D2RA 4IIEA 5HQJA 1KYZA 3IVRA 5CH3A 5A02A 4PFJA 4FHEA 3DCIA 1PZEA 5C8XA 5JCJA 5T8KA 2J07A 1MOZA 2NO1A 5AJUA 3RU2A 1F12A 2GXQA 3I6BA 1SEVA 4N7JA 3RRZA 4BL5A 1K8YB 2XECA 1C0IA 4BVBA 4BS9A 4ZZ2A 3LWZA 3TAXA 3E7FA 1TJNA 1V0JA 3T5DA 3FAZA 3I9V6 1KKLA 2H06A 4RLFA 5FB3A 3SZRA 3Q98A 2UZ0A 2KW5A 2O8FB 4IIJF 4OXNA 3EMVA 3OJCA 2ECKA 2I78A 1Q0RA 2YJ4A 4X6YA 2Z9DA 5KOJA 1DHRA 1Y8AA 3K1TA 4LGMA 3R6LA 3PHHA 4RANA 4GI2A 3PITA 3KZXA 2J09A 1JEDA 3OP4A 5LXTF 5ER9A 3KYIB 2EWWA 3SEQA 5EJ8A 1MJNA 1U11A 4LJSA 2OOKA 3B7GA 4QVIA 3UKJA 3VAZA 3GT7A 5FUBA 3C48A 5IAAA 4GD3Q 3Q15C 4N3BA 4O0MA 5EUQB 2AWNA 2Z2YA 5BN3B 4LF7B 2GPTA 1SBYA 1LVUA 2R3SA 5JW6A 1GD1O 4ROSA 4MP3A 1NW3A 2ZKIA 5K2MA 2A5DA 1L5SA 4AJEA 2R6CA 4R31A 3MTGA 1HYGA 1PQPA 4ML3A 2QZZA 3WBKA 2ZRJA 5G3YA 4Z6KA 1BO6A 1G55A 3ZU5A 2ZLBA 3DKVA 4HDRB 2C1EA 2V6IA 3MWYW 4BXOB 1W4ZA 2E1PA 1ISFA 3O6VA 3MCVA 2CFTA 5CURA 4YUWA 3GT4A 1O77A 2WD9A 3FD8A 2HKIA 4CQJA 1W5FA 4ZAVA 2PUBA 1JJIA 1HETA 2B7LA 3UOWA 2CVPA 3CMCO 3C8UA 5ESWA 3AOEA 4C6RA 5FWNA 1U5AA 3I2YX 3WYFA 2REBA 1X7WA 2WNHA 4G25A 1ZOSA 3MWKA 4NRDA 4NZ9A 3VKFA 1OH8A 4MDEA 1EESA 3F6BX 4HAXA 4P2GA 1YE5A 2E0IA 4DLVA 3WWPA 4BNTA 1MCZA 1GUYA 2ID8A 2YVAA 1MR3F 3IUEA 5E4YA 1LK5A 1RACA 5JV5A 3U13A 3B1VA 3UGQA 2Q1WA 3ROPA 1CUZA 2E4YA 4G4SP 4JQYA 4L4XA 1KETA 4DLLA 3LGSA 2V3CC 4G5QA 1UMCB 4BTEA 1NOKA 4KVAA 4BZWA 1GO2A 1NKSA 1RYZA 3AETA 1NC1A 1ADFA 1SIWA 3FR8A 1VRWA 4I0WB 1UDRA 4KN5A 1J8QA 1K6XA 3PE3A 4ZOCA 4UD6A 3WY9A 4BX9A 5JQGB 3P94A 4OB6A 5J2UA 3CF4A 3GP8A 2UZIR 1JSXA 3TIIA 3CUUA 5REQB 1T13A 1B1CA 3NWEA 3AB3A 1Z4MA 4GVPA 2YTZA 3CJQA 3K05A 5AOBA 2UUOA 3W5SA 4MHOA 1CY1A 3GIWA 3ZLTA 2VF4X 2PKQO 3OQIB 3SLKA 3TLBA 3ZR4B 4BB6A 2HHAA 3KSRA 3D43A 2Z30A 4LXXA 4D42A 3TG8A 2ZJ6A 4MPRA 5J5CA 3K7EA 1RPAA 4PGGA 1E94E 1EFAA 3Q3GE 2AOTA 3NTLA 3KZ1E 2B35A 3ZI0A 2IYEA 4ZYVA 2WJJA 4UDOA 2IH4A 1JDZA 2QT9A 5EJ2A 2C2YA 4YCAA 4BFSA 4L5CA 2M98A 4A27A 1X7GA 3B9RA 3LLMA 1A9PA 2JAHA 2X42A 4WWHA 3VZPA 3TTVA 1M5TA 2FZ5A 1EVJA 1TADA 1PQ4A 4OUDA 4ZHQA 1VJRA 2R0QC 1UJNA 1BEEA 1XDBA 3L1JA 1YRBA 4TN5A 1XP8A 1RRVA 2D0PB 2V6GA 2AI3A 3FOCA 4MINA 1NG1A 1U8AA 1Z37A 1SU7A 4G0MA 4K86A 4POAA 4R9NA 1CY7A 1T2NA 3GD5A 1Q7EA 3WFZA 3H5WA 1LC0A 1SCAA 3UOAB 1Y34E 3JQAA 1SOAA 1Z6AA 2AZDA 4GF5A 1N8TA 4LNHA 4LXUA 4NPAA 1G5PA 5EWMA 5FKJA 1D04A 2O4CA 9LDTA 4EUNA 13PKA 1T1IA 2GCOB 4EAAA 2ODEA 3AONB 3ZEIA 3RYFB 4OH7A 1JS1X 3SIPA 4EB0A 1HY3A 4JVMA 4N6OA 2H2FA 4LGYA 3WX0A 3WNCA 2NP7A 3OQJA 3KT6A 5K3BA 2D1RA 4FR0A 4RSMA 2J3DA 3Q88A 3OQMA 1LXCA 3WYBA 4WN9B 2ZRAA 3A6KA 2OZVA 3FBGA 5K8VA 4FDAA 6AT1A 1YS9A 3GDGA 1JWLA 1IY0A 1EIWA 3PHCA 4Q4HB 2B8JA 2A0XA 4PZEA 4C2UA 1USWA 2GTIA 2PTHA 4ASUD 1WQ1R 2WJHA 4KE8A 4M1QA 4GX2A 4LW8A 1V7QA 1ZSVA 1UADA 1WXHA 1E9CA 3B8EA 3FIJA 4P3KA 4UM5A 1JL3A 1DOHA 1KAGA 3L93A 5CLGA 3WADA 1KK3A 3CU5A 2FSFA 2P9BA 4GLBA 1SVIA 1IAVA 3QXJA 4W1SA 5CYFA 1H66A 4JA0A 3PC3A 1N3IA 4MYHA 4KXXA 4PPGA 4UU0A 3HL0A 4ZCPA 2WILA 1AIPA 4U1RA 1A7JA 3LQQA 4X3CA 4DLXA 5IT5A 3PC8A 1I1OA 1E4VA 2QLTA 3BH7A 4FMDB 2PRKA 2FSHA 2RC6A 1LSJA 4RPHA 4PF1A 2BFDA 1U3VA 4QQNA 4R9SA 4EG4A 3D3QA 4DV5B 2NT4A 4OO3A 1OXSC 3FYCA 4I8XA 3LQ2A 2GO1A 3RHSA 3ETHA 4BEJA 1V4VA 1VB5A 1N2OA 2C57A 4M8LA 4RPKA 3C3YA 3PYLA 3FCCA 5EY5B 3VPCA 3BSWA 3CSDA 4CN9A 3KB1A 1TVMA 5D00A 2I7VA 2VNKA 1C4WA 4IG9A 1NUUA 5DZSA 1PJAA 2QBYA 1XCBA 2QLLA 2ZQYA 2Z0MA 5AJVB 1R6DA 2XI4A 1TC2A 3C7TA 4MYDA 1CS4C 3NIGB 4UTXA 3ZCVA 1A97A 1UBTS 4URHA 2Y76A 5LM3A 1CHDA 1CR4A 1Z7YA 4HNVA 2ECQA 3U9LA 4F1WA 4IJMA 1EWQA 1DVRA 1YVEI 3DTNA 5AJZA 1C3OB 1JQAA 3FHLA 4QJ3A 4IQ8A 3C3EA 1KJNA 2QVGA 4Y2SA 1EUQA 4CKZA 4JXZA 4CGYA 1MT3A 3I9V1 3SD7A 5B3JC 1LH0A 3VO1A 1JG6A 1NF3A 2IZ5A 3QWFA 3N05A 1GQRA 2LV8A 4JJZA 3U81A 3QEAZ 3INGA 3NDJA 2CHVA 1WD7A 3G9XA 4PNHA 5IMSA 1E3EA 4BUCA 1ZI9A 3NHMA 4NZZA 1FC0A 2ZTUA 5ALHA 4JDPA 1QO7A 2FN4A 4Q4AB 4U2BA 1AURA 2XNSA 3DCYA 3THSA 2R6FA 2QN2A 3S1LA 3NGXA 4CFZA 4F5YA 3EF1A 2CN1A 2OV3A 3R0JA 4M8NE 1T36A 3TE6A 3ET5A 4XR4A 3GNTA 1NF8A 2WFAA 2YINC 7ABPA 2QT1A 3OZIA 5CB4B 1WB9A 5D3MA 5U1PA 1WXXA 3MWDB 1M8GA 3NWOA 1WSAA 1GU1A 1D2CA 1WDTA 5DM1A 5EMMA 1QHGA 4YLGA 5FPQA 1OF1A 2HNAA 2YCBA 3DMTA 4CV1A 1TO6A 3UMRA 2QE7A 3OETA 4DYHA 4BUZA 1D0VA 2XCOA 1PG2A 1USVA 4FBMA 4BTVA 2Q2NA 3CMMA 2FKAA 3B20A 4J16A 5KI6A 3WC4A 1LI7A 4I4NA 6NULA 1M0WA 4IQ4A 3O1JC 3QBJA 2D5BA 2FETA 3C41J 4W6QA 2ZJ8A 1MXHA 1E9RA 4GPIB 1A88A 2II6A 2CNBA 1YRYE 2PL5A 1MW9X 3OMXA 3PRHA 2W2OA 4K3VA 5DFAA 3KVRA 4FFOA 1RWBA 4CEHB 1RI5A 3Q1KA 1GNSA 2P3SA 4HQNA 3RAJA 4F72A 3UBTA 1M1YE 1NU8A 3ABRB 2Z56A 2ZDHA 4JXJA 1N0HA 1EUZA 4YACA 1T1RA 1JPVA 1MQAA 5E2AA 5AICA 1IUOA 1GEGA 2NV6A 4JITA 3NOXA 4RD4A 2JJ2D 4ZYYA 1Z7EA 5HZKA 1E1CA 4CMIA 1U28A 1VSUA 2VK8A 3FLAA 2FFBA 2J32A 2AMYA 4LECA 3LCVB 1C29B 4ERXA 3U44B 1TT5A 1H4SA 4YT5A 4RHTA 4I5IA 1CQJB 2TMYA 2WWRA 2DT8A 2A9PA 2V5VA 2CVOA 3B6MA 4AJLA 4N5DA 1DB3A 5EEGA 4Z7OB 2XXAA 1KMNA 1BHO1 4N0PA 3RFXA 2J9XB 4BGUA 4I6JA 3TK1A 2X4DA 3DEAA 4GPAA 4IXDA 2XADA 2FDXA 3DYIA 4M54A 5TRTA 5CIQA 3RAPR 3V32A 3U3RA 3RDPA 4BU1A 4DBVO 3U2QA 4YRSA 4KXLA 1Y9ZA 1LJUA 2YJ6A 3FCUB 4YRLA 4R5HA 4AROA 5H3CA 4CUJA 3W5AA 5F73A 4Z8YA 4PTZA 4Y1EA 2LCQA 1E5VA 3H2SA 1DBPA 2B7CA 2H1VA 2JAWA 4RFVA 5KX5F 4URWR 3O4JA 5F12A 2E6UX 5FLKA 4IIDA 3L77A 3DXFA 2B5VA 4XWGA 3HV0A 4RSGA 4U7FA 5K8IA 1SK8A 4IZIA 2V7TA 3GEPA 4QICA 3A2NA 4QULA 4QTZA 1XMJA 2A9JA 2AOUB 3ONNA 4ZOLF 5HRUA 4NECA 4IIXA 1IN5A 2B8NA 1VL1A 1W85B 2QX9A 4J4TA 3SYNA 3EOBI 1JXOA 3V3TA 3VU0A 4YCMA 2JG3A 1SY7A 4CLRB 1LTHR 3DYBA 2H54A 1M8JA 1DXYA 1I3KA 2WHXA 4RY8A 1OH7A 1KSJA 4H7FA 5K6AC 3F6YA 3L6RA 1CJKC 3NOVA 2O0MA 1E96A 2TMGA 3HV2A 1KY2A 2ERCA 2FWJA 2RAVA 5HDQA 1UAGA 2BF4A 3WDSA 3U7HB 1JHPA 3IT2A 4I14A 3D6AA 3I5AA 4R9RA 1YF3A 4GI7A 5AW0A 1J1ZA 2OGZA 1JFSA 5FWYA 4A92A 3LUCA 3UGTA 4ECEA 4EJ6A 3Q2KA 1UMDB 2IVFA 2RCNA 4AN0A 4MVXA 2RBGA 2X14A 3GL9A 1YZUA 5ALUA 5KTRA 2J30A 1BXKA 2J0UA 2VCEA 4ENRA 3EXHC 1IZ9A 4R16A 2QPAA 3K6SB 3ADCA 1M9NA 1AJEA 3HDTA 2I6XA 1AGPA 1BWSA 1V9LA 1TB4A 4R2HA 1ZM3A 3U62A 1PTJC 4R9VA 5LC1A 3OPNA 3TIVA 3WYNA 4CF6A 3O3OB 1BJKA 1RYBA 1N36B 1JLKA 1VJ5A 1K8QA 3TB4A 5EIEA 5CLIA 3GLTA 1CDZA 1T2EA 2GS9A 4R54A 5LP6B 2DKFA 3CCCA 1W94A 3NT5A 1AY0A 2AJLI 2HOQA 2RHBA 1DZ3A 5EHNA 2OGWA 2XB2A 2IX9A 2YFHA 2EDCA 3GRCA 2PFSA 5L4SA 4Y67A 2NU7B 2WSMA 4JI1B 2C2OA 4LBYA 5KINB 2F9MA 3DQPA 3STUA 1G8YA 1PSZA 3O9MA 4N6GA 4DWJA 1IOLA 3AO0B 4WUTA 1SCJA 2HT1A 4C89A 1U8CB 1YDEA 2O2EA 2O3TA 3QXCA 1UJ6A 5IWCA 4R1LA 1XRSB 2OMEA 4Y9UA 5SZHB 4G81A 5EZYA 2EF0A 1HE8B 1N0IA 1XCOA 2L69A 4JUAA 5KYWB 4MQ6A 2RAUA 3O8CA 3FGNA 1M1NA 4TQUS 4M9CA 1KWGA 3KXDA 1ZINA 4H7IA 2AJBA 1EJ6A 3G1WA 4M1EA 4ZO6A 4OHYA 5LQDA 2ANBA 4AZVA 5K4AA 3NB0A 3Q8KA 1M5RA 1DGQA 1ZGZA 1W4BA 1WMFA 1RS0A 3HBJA 3UK0A 5ELXA 5A1TA 1QU3A 4FSXA 3OEEA 5K05A 3CZMA 3FYHA 2A5JA 1PUXA 5G4KA 4IDBA 4ENPA 4MCHA 4Y7DA 2I54A 2EIXA 2VLIA 2C82A 3HKCA 2G28A 3JTEA 3A31A 1NP6A 4NFHA 1O94D 1Z4JA 1XNQB 4OQEA 3OX3A 1YO6A 2IHKA 3MXTA 1UWCA 2X13A 5AI8A 4A5OA 4CZ2A 4EX6A 1VHLA 4OB8A 3STYA 4HWOA 1KVUA 1W1IA 1Z36A 3IP1A 4WHMA 4G5XA 4M87A 3VKVA 3JD1A 3B3FA 3VYWA 2DQ4A 4M6WB 1YIOA 1L7OA 3L7OA 2GCIA 4RM2A 3UAXA 1A0OA 4GM4A 4LDZA 4NAUA 2I0FA 3D6MA 1TU4A 1F2UA 5A3VA 821PA 5KWSA 4QYWA 5CM2Z 1KIFA 1Q12A 3A11A 4MRNA 5I8PA 4L74A 3U49A 2E4XA 3G9TA 2OHGA 1A76A 2VJAA 4NPHA 5D7NA 4KO8A 4PICA 3W3AA 4XAQA 4DMRA 5LA6A 1SKUA 1YQEA 2OFWA 2DWOA 2C42A 3L0ZA 1U80A 1Q95A 3Q5EA 3RARA 3IVCA 4RH3A 2FR8C 1QFMA 3HVKA 1UBEA 1JSRA 3S6JA 4B1FA 2V0NA 1G66A 2IDMA 2H2DA 3SGLA 2DUUA 3NW9A 4PRKA 1YA6A 1K4YA 3TLKA 3VH2A 5EJ9A 5FX2A 4DPMA 1HK7A 1WG8A 2AV6A 3AUAA 3OH8A 3TM5A 1QORA 3CO0S 3TTYA 4CXMA 1JHUA 4PYLA 5DW0A 3RNLA 3SNHA 5BN4A 1TCAA 5JVDB 4F4CA 2D1YA 3BREA 3M6AA 1RU3A 2FP4A 4AJNA 1IY9A 4YAWA 5JAMA 1GQQA 2B8TA 2LXNA 1J97A 1VJCA 2AIRA 4G5OA 4WZAE 5EP1A 2MYUA 5FHRA 1GL6A 1Q1NA 1C7EA 3O31A 2VXBA 1A3CA 3B9PA 4N76A 2OV2A 3BXOA 3HACA 4A3SA 1V2GA 1T24A 4RDCA 2WKQA 4HPWA 3FYTA 4G9BA 1DO2A 3E9NA 2ANCA 2QRHA 3JX9A 1B8UA 3HKDB 3P7MA 4FFRA 2R1TB 5DTEA 1L5GB 3SEFA 3NG1A 2AA3A 1SHTX 2F3SA 3H11B 3ZWOA 1VTKA 2BEUA 4RBNA 2QAGA 4C7OA 4M9SA 1X2BA 2QMOA 1FXWF 2WIGA 1C9JA 3GFVA 2B92A 4FN5A 3VZBA 2SCUB 3A4YA 3U0VA 1PNQA 2FMXA 4XCQA 1JR3D 1W4CA 1ODTC 2QPOA 4UAUA 1RHRA 4LJYA 4BVAA 2G83A 2XX3A 1L3IA 1GFIA 3DZBA 4QBKA 1YB5A 2VJYA 4E5UA 2J7PA 2ORIA 3K8ZA 1L1QA 1KDVA 2XHEA 5LPNA 1GCOA 2Q62A 4IPTA 5GM1A 1KI6A 4EKGA 5C3MA 1SC3A 5HS4A 4CEJB 4DA6A 3FAKA 4Y6GB 1YDGA 4KLAA 1DIAA 4ISCA 4XUGB 5F3RA 1P5RA 1U6KA 1Y5NA 2NVBA 2I03A 2YDXA 4GOOD 4MKRA 4NOMA 1EHYA 4B6QA 3U61B 2LZ0A 2F90A 1BXGB 3TXXA 5IXSA 1VCMA 2I34A 4YMUA 4N3GA 3MJRA 4UQLA 2YXEA 4PX2A 3NHJA 3L4BA 4YT8A 4PSCA 5AM0A 4EUKA 3HC7A 1FFCA 3PK0A 2P9JA 1QRAA 5HJ2A 4YR7A 5EERA 3EB9A 2H57A 1E2UA 2VP9A 3GVCA 3IAXA 4OVKA 1X74A 3WA7A 3UWMA 2XUGA 2B36A 3GA7A 3KQTA 5IF9A 4IH4A 5KVAA 1C7FA 2GEUA 4UD2A 2WR8A 4B4OA 2IUEA 2ORWA 1UBMS 1JLLB 1KZ4A 3OD1A 3F8TA 2YASA 1J49A 3NQ41 4B43A 1GLVA 5J3JA 5ALKA 4JUCA 3EH1A 1W49A 3DBHB 5DM60 2KYRA 1YR3A 4N39A 3DZCA 5E6SB 2QZSA 5BN5B 3HKEB 1SC6A 5LYJA 4GPEA 3GLGE 1I14A 5DDIP 3L7BA 3WGGA 1CF4A 2X15A 1KBOA 3DAHA 3NHBA 3NYQA 3W7AA 1UJ2A 4ZGGA 3EPKA 1REQB 5IF3A 1ISJA 4LJ9A 4AMZA 3A6FA 1N2CE 3AI7A 4H27A 4UPDA 4H7JA 1DDGA 1UFKA 4KXQA 1FMTA 3BFVA 3DTVD 3GJTA 2HB6A 4N0EA 4O2LA 5E2IA 1KXJA 1AXRA 3EGDB 1FB5A 5BUZA 1MG5A 3QKIA 4Y6LA 4JODA 1ECJA 3F8WA 1KI2A 3SX0A 1R6VA 1R0YA 1SKQA 2A0KA 2NTVA 3DM9B 4RD3A 5A4JA 4FP9A 2DUJA 3QFSA 1GPUA 1Q17A 4LYGA 3GGJA 4FINA 4LRWA 1VL0A 3U56A 4MGZR 2VJQA 5J9FA 2CXTA 2C88A 2GN2A 3LQFA 4B74A 2ATXA 2MWMA 3QE2A 5GJVC 4GP6A 4URZR 1F1BA 2OPBA 3NYRA 3O91A 3OX4A 3B12A 4O4HB 5KNCA 1T5OA 2FPSA 2VL7A 4ZTUB 2A92A 5HW0A 2PTGA 4H4EA 1P31A 1TVKB 5ALSA 3QFTA 4LZPA 4ZXFA 4DLYA 3QX3A 1D6JA 1K9VF 4IMPA 4E03A 4DA9A 3PYMA 4DWOA 3JWIA 4UMFA 2FXVA 5K51A 4AKEA 5DHFA 3VHQA 5LMUB 5DX1A 2WUEA 2WHQA 3L05A 2KB0A 5CBKA 1RWOA 1XRQA 1J2TA 1U8YA 4Z9YA 3DVAA 2EEZA 4OOFA 2ZSBA 5NULA 3WLMA 4Z8XA 1TPYA 3GRVA 1W6UA 2QA5A 3LKDA 5G0SA 1XAGA 4J0FA 4YP5A 4ZVNA 2VYVD 1Q0LA 2VN8A 4KQXA 5AVYA 1DO0A 4D3XA 1UKEA 3UCFA 4PLFA 4YCDA 1IG0A 4OBEA 1XEWX 5SV2A 2WWVD 1XR3A 2D8MA 1U0NA 4RKEA 2G8NA 4ZO4A 4NHOA 3IPRA 1E0KA 1MC8A 4FWIB 1TYDE 2WPDA 4WXHA 1GSHA 3ROEA 2AG6A 3C45A 3DTVB 5ESRA 5J4KA 4R1OA 1QHSA 3AXSA 4CTMA 1VIAA 1Z75A 4HRAA 2Y0PA 3QKSA 3RK1A 1Z4LA 1KIAA 3KUCA 3PENA 1YBMA 2GJSA 1U9CA 2ZBEA 3E48A 2CJXA 2PUVA 3AOGA 3AP3A 1ULAA 2GAIA 2HCJB 3F3KA 3G6WA 3G8YA 1E60A 3GUVA 3V42A 4OJYA 2P4HX 3IBSA 3KUKA 4TMWA 4EFNA 5LOVF 2QRJA 3OWOA 3RKUA 2JLCA 2XOKA 3Q6NA 4HKTA 4B3IA 2BF7A 4PTYA 3HXQA 5E4FA 2P2LA 2Y0DA 4LHXA 3T9FA 3DLPX 1XRLA 3N0TA 3PFCA 4BB0A 3DHYA 1ESCA 4WXPA 2F3UA 1OFUX 1ZNQO 2P65A 3RAFC 4DA4A 1BX1A 1SBTA 4KQMA 2HIGA 2QW1A 4PGFA 1P7ZA 2YY6A 2XZPA 3W8DA 1WMSA 3D4PA 3GCGA 2DR0A 4A8JB 4BMZA 4DDTA 1SUSA 4ZQBA 2X2PA 4IF4A 2OHXA 3AW9A 3LHSA 4YTEA 2WJIA 2Q7DA 5EXDA 2YWXA 1GAJA 1UFRA 5DLYA 2XZLA 1E4YA 4IDGA 3DOOA 4HNSA 2FW9A 4IY1A 4D9HA 4ZGBA 2YIJA 1YDMA 2VBGA 4NPCA 1EWRA 1VBFA 3AU9A 3GLKA 3I3OA 1Z6GA 3R5HA 3DUFB 2YYSA 5HIMA 3RUFA 5FYQA 2HHLA 2AFRA 1AM4D 2W90A 1ST3A 3ZY4A 2HLDA 4L4RA 5JYDA 4KDCA 2QR3A 2D59A 4C6TB 5JZMA 5F9FA 5FOTA 3ROGA 4CIYA 3VU9B 4D97A 5J58A 1BMFD 3ZDRA 2QF7A 4U4AA 1JKJA 3W8RA 4N3AA 5J2TF 3WL6A 5KYYA 3AR4A 3PSHA 5K3SA 1NBWB 3MTQA 3B1FA 1FFEA 5JS2A 3EEIA 2GWRA 4V24A 1PFKA 4C0BA 1YACA 3H6KA 1NUPA 1T8WA 1ZZGA 5MFZA 1ZM2A 4GYJA 5DN9A 3SIWA 1V1RA 4HB4A 1IBKB 2IRWA 4A9AA 1R0BA 3PCTA 4WD3A 1LVHA 2M6SA 3NUZA 3U4DA 2YCLA 3AIIA 5A1JA 1MO3A 3D8TA 4Z9AA 4AJHA 3KZMA 4XTRA 2B0JA 4WECA 2HWWA 5EAIA 4FCTA 3TBFA 2XT0A 2D4AA 2QGZA 1QOPB 5BW6B 1TTQB 2BKLA 2FQWA 3RVSA 2FVXA 1NQAO 2SKEA 3OT1A 4RPCA 1ZQ1A 4KYIB 5JNVA 2Y1DA 4D79A 1RAIA 1UWLA 3CRQA 1H8HD 3TE7A 1Q91A 1QF7A 2Z58A 4NEGA 1AGYA 3QFRA 5CDTA 3VFDA 4C3VA 3N39C 4EBFA 1KY5A 2ZWPA 1BGVA 2OGTA 3WNQA 2AZXA 3KEOA 4GWGA 2P68A 2G1PA 1VXRA 2PQ6A 1M6VA 3A4NA 3PXAA 4QUIA 5J4HA 3W6UA 3A4MA 1XO1A 4E5VA 2QRGA 4LEIA 3OLZA 2Q50A 3DMHA 3L0BA 2ID9A 3BX1A 4M4SA 2NV2B 2D2FA 1KSGA 1GN8A 3TZ6A 1C30B 2ACKA 2JKYA 1PG0A 4L51A 3KK0A 3LT0A 3W05A 3VR6H 4MPJA 3W3ZB 2F6RA 4GM1A 4AICA 3DVQX 4AWAA 2PE5A 2CMHA 3E5NA 1DCKA 5GONA 4EF5A 1V41E 1BX0A 2O7VA 5LMCA 5MGNA 1YVPA 1TZKA 2I6SA 2P0EA 4MARA 5FLYA 1RLJA 2BRUC 4I50F 2GJ8A 1F51E 1N5OX 4GR4A 1P8JA 2VDRB 4LRYA 4R2LA 2WWHA 5FFFA 3ZDBA 2CDCA 4PE5B 2VIIA 4FZ3A 1GA4A 4MOWA 2BZSA 4QBTA 3WLRA 4C1BA 1EM8B 4DDKA 3LF2A 1W36C 3WQQA 4K7JA 1OBHA 2PRSA 4UNQA 4RTRA 1VIDA 3QXXA 1V4BA 3TZBA 2D7DA 1PUIA 3B9QA 1GU0A 1Y5RA 3JQQA 4L02A 2F9LA 4EW2A 1JNXX 3BWYA 3WI7A 1VBMA 3F78A 1E66A 3BH6A 4EJFA 1R37A 3CLRD 4AX4A 2CL7X 1EKXA 1OWLA 3AI3A 4LI3X 3VSCA 4P7GA 3VSDA 3L0PA 1KKMA 3R44A 4AL4A 2CXQA 2GFIA 2W2VA 3MTDA 3A4TA 1QGAA 4C5AA 4MV7A 4BJ5A 1QIGA 2VXYA 3CUKA 5I9BA 1OLXA 3WS7A 4RK7A 2A30A 3R3YA 2XNDD 2CVQA 3EDRA 4Z0PA 2O8FA 4XYLA 4ETNA 1OC4A 3O74A 3QY9A 1ISSA 1MVLA 5FP0A 1NRWA 4ARVA 3N2KA 5LKRA 1K6JA 4TTJA 3RF7A 3IUQA 4CTJA 1GDDA 2XGSA 2ZI9A 4RMHA 5A4KA 2V0GA 3HJBA 5CB0A 5K0JA 1C50A 4X7MA 1IC6A 1FMFA 2X41A 1B16A 1V5GA 2JVJA 2H29A 2Q6LA 2QKYA 3HFSA 2HNBA 3OU6A 4LFBB 1XZIA 1ZITA 1P9LA 1H23A 3LUPA 3PRYA 1T35A 1F3OA 3DFZA 4NESA 2RGYA 3AUKA 3CPHA 1G5IA 4ZEXA 3A3YA 5TC4A 1KH2A 4ACAA 1STOA 3NBZC 3OM0A 5I7WA 3JVIA 4OJNA 4YBRA 5B1SA 1DEAA 3BGWA 4QOEA 3SHFA 4BNFA 3T1HB 2NVUB 1ZKMA 4H4DA 1CB7A 4OX9Y 3DEZA 3T9BA 4NC9A 3MMNA 3F90A 1SBIA 4KYVA 3RYTC 4BXOA 5FWDA 3RTCA 4GOKA 3CNEA 4O2BB 3DTTA 4EMTA 3TNYA 1NQOA 3ORRA 5G1OA 1I6WA 1JAYA 4KQKA 4H35A 4MPTA 3PNLA 5F5NA 4FKBA 5IJXA 2ROQA 3R77A 5DO9A 2JI9A 1HSZA 2B82A 2GYVA 2X8LA 3WVNA 4KSCA 5IK2A 3P2OA 3VZSA 3N8GA 4NLLA 3RK0A 2EGUA 1E1MA 1H1TA 1I13A 2GZ1A 3FPEA 3LUGA 4IO0A 3NBXX 1SQ6A 2HMSA 2ZYGA 2OA0A 4DCTA 4ZO7A 2CJFA 3A1EA 4G8JA 1U7OA 4GHWA 5AJXA 3V3KA 2ZUUA 4P2BA 2OGUA 2DWPA 2EG5A 3DO5A 4X7RA 1BFKA 3RGWS 3IPLA 3T3IA 3R8XA 1RRMA 1MEJA 5HIAA 4ENVA 3N0WA 4MUIA 4BNUA 3U7FB 3L1HA 4EP1A 1UKAA 2QVZX 1NX9A 1E2EA 2E5LB 2R8YA 2WJPA 3EBOA 5B58T 5IKMA 3MGAA 2GUGA 2ZM5A 1TGYA 1JI3A 4QYTA 2W58A 3C97A 2C4VA 3WGQA 4V1CB 1XPOA 3QFCA 1NVKA 2WDZA 3OI7A 3DC2A 4UVEA 5JQGA 3ROKA 1KS9A 5A5DA 1MQSA 4HPXB 3EPJA 3IR7A 1TM4E 1ZG3A 2AHRA 2SKCA 2F48A 2P27A 1XMXA 2WZCA 3BXFA 1I7SB 1LF0A 1SHLA 4O1IA 3DE4X 4BNMA 2XH8A 2O2IA 1QTRA 4H2DA 2FG6C 4U5XA 1VI6A 1F4VA 2FUG6 2E49A 3QITA 2JFVA 3MRXA 4NZPA 4PO3X 3W9YA 4EGQA 3V1YA 1ZN7A 1L4NA 4OHVA 4Z7JA 3OQIA 4B7CA 2ONZA 5A5FA 2FZLA 1GZ7A 2W9XA 1J8MF 1QHNA 2WIFA 4G2TA 3DOUA 4Q3KA 1GT91 2GPSA 3MAJA 5HS6A 2JFOA 1IN7A 2NZJA 1S9DA 3B3QA 4H59A 5KQPA 1H85A 2AN5A 2R86A 3AFNA 3G23A 5BQPA 3ASZA 5B2ZA 1T34A 1W34A 1BNCA 1JVBA 1PNVA 3TL2A 5B1EA 3BJIC 1MPXA 3IQWA 4BX8A 2FA9A 3SAJA 4KGZA 1ORVA 3PCXA 4Q9LA 3P8ZA 3IC5A 2NO4A 2W0SA 1E4OA 1AHPA 1A27A 5HOEA 2IS6A 1W2GA 2R7AA 3E03A 2WKSA 1L4LA 3RO7A 3FWHA 3ZYZA 1CRPA 3U6BA 1ANKA 3FVRA 3KQPA 2RGNA 2P8JA 5ICEA 3KHKA 3ZTYA 1JR4A 3ESQA 3UJ7A 2QN6A 1T0IA 3EFOB 1Z9BA 3ETGA 4UHJA 4RQUA 5C8DA 1ZXBA 5GM2A 2OYSA 4Y0AA 5DPMA 1S0UA 3PJFA 4LXGA 1JNYA 3JD4A 4PAMA 2GCOA 5FPSA 1CR0A 1JZQA 4MUGA 3TD9A 3RS4A 1N2SA 4BQEA 1FFHA 2OTCA 2PRJA 4Q1VA 3LHFA 4DKXA 1E9AA 1UIMA 3THXB 4LG1A 2E4ZA 1ONSA 2R8RA 3AEQA 5DJ5A 3D8RA 1JQ3A 3FYDA 3LE8A 4PSAA 4WN9A 1VFPA 2NYRA 1C7QA 3IE2A 5CRIA 4F3KA 1YQTA 1FDSA 4MKFA 3KOMA 4W9NA 2WW8A 3GJ6A 2DQSA 3RFTA 2PZGA 4FWBA 3AB7A 2PX3A 5DHQA 4DA7A 3TPFA 3RUPA 5C1IA 4ARSA 5IHXA 3K6JA 3SLRA 3M6IA 1T9BA 1C8BA 2CEKA 3SK0A 1N2HA 4U63A 1WY5A 2ZJFA 4HXEB 5AKKA 3I01A 4CLXA 3AUJB 1A8IA 2EZ8A 4DADA 1JIKA 1FNCA 3EWSA 4J0EA 1YQUA 1L4FA 4BX3A 1V96A 3D0KA 3OE7D 4X64B 1GZDA 1CIVA 2C83A 4LSZA 4Q7QA 3FXAA 5JH7A 1TM1E 4QFDA 3NDPA 3PHJA 1G0OA 3HNPA 3OF2A 3CB2A 4XRGA 2JAUA 2Y9MB 4POOA 2ICAA 1P45A 1EFRA 3EQ6A 4F5WA 1MW8X 2E4UA 1E58A 3K8QA 1RAHA 3H84A 3DJFA 4P92A 4B5KA 1XZAA 3DL4A 3PDCA 4CMBA 3GCXA 2ATVA 2P69A 3QM1A 1NBAA 3CW2A 3BICA 5HBRA 2O8EA 1D0SA 5IAJA 3UQYS 3BJEA 2G72A 1YB6A 1CR6A 1QIKA 4LCBA 1H2ZA 2WP0A 1QH8A 2BHNA 3P0IA 4ZYWA 3M33A 1P91A 4GMXA 1H2HA 3D7LA 3PNVA 3JQ9A 2XODA 3KJQA 4BFUA 1IXRC 1C3OA 1GTG1 1R00A 1X1DA 2NO0A 1I5RA 4PFQA 4B4UA 1U8EA 4FFWA 3VR1A 3GU3A 3VI3B 1ML3A 3HJHA 5EJ5A 4EL5A 1L2TA 1JX6A 2WLSA 4UFNA 3KJEA 4TLEA 3CPJB 4XIFA 5K2OA 1DKUA 1YB4A 3M4ZA 4ASUA 2YV3A 2PEZA 3F6EX 4M98A 3QRWA 2RHLA 3T41A 2WTNA 4ER0A 4HB2A 2OFXA 2JIZD 5J59A 4Q4AA 4BE4A 2K7ZA 2OCPA 2PX5A 4L6IA 4WY2A 1ZW6A 1HO3A 3K9NA 3R5KA 5T4FA 3L6DA 1YT5A 1FYFA 1RLTA 2O4UX 4ZZ0A 3ZXYA 4MWOA 3T5GA 3ZXSA 2Q9AA 1WMDA 1HYQA 3H1GA 2JGRA 1XZ8A 2QR2A 2YJ5A 2BISA 3DT9A 3FLMA 4PXYA 3MWDA 3TSAA 1DLIA 1SU8A 1RW4A 3P27A 1G9SA 5CX4A 1IUNA 4HHEA 3LUJA 4ODIA 4RK1A 3T1OA 3THWA 1NXPA 5LKAA 1FMCA 4Z86A 2R66A 2EKQA 4IIJB 4J0HA 2ZATA 3EA5A 4Q9NA 2PX8A 2VQ3A 4KMRA 121PA 3B51X 5E6RB 3TNFA 3SSAA 4B4VA 3AYXB 3W8FA 4DSUA 5CVVA 2C7RA 3NP7A 1VLLA 2PZJA 3JWGA 1W19A 4M0CA 4V2UA 3TVDA 3DR3A 3IEUA 5AP9A 3H0CA 1U02A 4PZCA 1CULC 4C30A 1CUEA 1MVNA 3PBKA 4W63A 1DX4A 3H2ZA 4Z49A 4YS6A 2YN0A 3VH1A 3DLIA 3WRVA 2OQ2A 1NOJA 4UDNA 3O5AA 5CM9C 1PE0A 4OCZA 3BQ9A 5DTJA 3T34A 5EMNA 1QP8A 3H5AA 5IJ9B 1R10A 1Q92A 1VFNA 2H8GA 3BPSA 4ND5A 2B1IA 2C92A 2HLPA 1W4LA 4Q3LA 4XIJA 5E2BA 1VBKA 1UBRS 1WL8A 4P5EA 4BNGA 1QX4A 3ZTTA 4K28A 4D74A 5JTTA 4MYSA 2G5PA 4FXOA 2P78A 1H4VB 1I6MA 5EN4A 5FO1A 1Y6FA 1CVLA 1A8PA 4AMGA 1TEHA 2XQFA 4L0CA 1YVUA 1WXQA 4DM3A 1EPUA 3H65A 3NTOA 2BD0A 2XF2A 3QPBA 1J70A 5GZ3A 3DXYA 1XUOA 3BE4A 1VECA 4FXPA 1VYUA 1CQJA 2JCBA 4R2WA 3ZC3A 4Z53A 1I1QB 2Q21A 3ZWWA 1V47A 3Q4GA 4BO0A 5T64A 1Q3TA 3I1FA 2NQTA 2DBYA 1H0KA 2WV7A 2F8TA 1VLJA 2D62A 3BD6A 2BMVA 4HN2A 4U39A 3JW8A 3GNSA 1RPTA 1GNVA 3TZKA 3I12A 3T7RA 4AURA 4M7PA 5EIBC 3UAZA 2JANA 4KIUA 1EVIA 4XWKA 1OSNA 2VQSA 4B2IA 3GF4A 3NHPA 5INTA 1OFGA 3L6UA 2FUG1 2BFBB 3UK2A 5K8JB 1FTGA 5KOYA 4PPYA 5KQMA 1Z25A 2RCYA 3I2IA 2Z2KA 2R87A 3QUQA 5G40A 4D96A 3AR8A 2HTFA 4RX1A 5EXXA 1VDZA 4NFYA 5EPEA 5C7LO 1LLCA 2ZSUA 4FIZA 5SY4A 1GYRA 1V6SA 2GLTA 1XLTA 3AVTA 1XZMA 3O26A 1X7ZB 3LF1A 2WG2A 3ZHRA 3BL5A 2AOUA 4H0CA 4EOGA 1XZCA 2ACEA 2FXIA 3KJZA 4XSHA 5TMPA 1CKEA 2BKVA 1OW3B 1W85A 1WMBA 2X1LA 4QATA 3W5JA 3WL5A 2B4YA 5I9NA 1ISPA 3AEKB 5D8DA 4DQLA 3U4QA 4LF5B 4KN9S 4LZWA 4UEKA 1BQ3A 4M1KA 4CLRA 4QFMA 5TS2A 2EOAA 3FY4A 3TB6A 2AF3C 5C81A 2ZUDA 4J1TA 2R1VB 2AYYA 2EEPA 4G4GA 3ORHA 1AXEA 2CVHA 5DNDA 1H0SA 1EWKA 4R6WA 4S0XA 4E30A 1UOPA 5LBUA 1DEOA 1ZGAA 1ONPA 2AUMA 4UTRA 1PD0A 5AKLA 5AKYA 4DPKA 4XB6B 5IANA 5FR1A 3B5JA 4JSTA 4L9RA 4BNWA 5A3JA 3UATA 1YGYA 4PRLA 5AK4A 1UMDA 3ADKA 2K2WA 1A8UA 1WRBA 3LX5A 5L40A 1SHKA 1FPMA 1DARA 3RVNA 3TSYA 2WIKA 3KZNA 3KJNA 2Y05A 4PYOA 3R2JA 5D1HA 2WYOA 4LBWA 2YMPA 1V16A 1XYGA 3SYKA 3D8NA 4D3FA 3K6SA 1S2OA 1PT9A 1XAJA 5DE3A 1IULA 2L42A 1L4GA 3P4YA 2HPAA 3CISA 4GU5A 4LRQA 3DD1A 5B58C 4D9FA 5BSWA 1M2VA 2PUWA 1VKNA 1YA8A 1I4WA 1ZJYA 2YW2A 3D7MA 2OHVA 9ATCA 3STXA 4Y1RA 1H4QA 4B3CA 4DLUA 4RLHA 5AVOA 3CNOA 4HB3A 1ICEA 2RGAA 4YRGA 5LP6A 3TDNA 4H6PA 1PX2A 1W35A 2J3QA 1OI7A 3E8SA 4HXFB 4K0RA 4RF4A 1JECA 1JI0A 3QIAA 4QUHA 5JRJA 4J7CA 2PRIA 4HCJA 2NU7A 1H0RA 2PZAA 3GZ4A 1NLMA 4R98A 1BVRA 2GI4A 2F4NA 1O95A 1GWNA 3KQQA 3M5PA 2IV7A 3K15A 3ZZMA 3L4KA 3BFXA 4LHWA 4U00A 1OREA 4A6DA 5B7PA 4MQBA 5EC8A 5AM2A 1C9MA 2PNFA 2R1ZA 3G49A 3LNCA 4TKMA 4EELA 4J0KA 2PT9A 3GEEA 1T9AA 2PMKA 2WAXA 2F3PA 1PK9A 5TF4A 2R8XA 3AMVA 3FYUA 5KYWA 2ATIA 3UY4A 1K6EA 1AO0A 2WYVA 2G4CA 5IVHA 5FNVA 2VH1A 4BVJA 3L02A 2WJ3A 2FR1A 2WMNB 3JV7A 1JDJA 5FOQA 3ZD6A 4EPYA 4BNNA 1FS4A 1VPDA 4AY6A 2Y4OA 5ALOA 2F59A 1Z5VA 4W4TA 2AX4A 2GRJA 3GP3A 1Q74A 3HP1A 3LSTA 4X7PA 3LUFA 4NQRA 1UKBA 2DZDA 1DKMA 4RKWA 4YCBA 5DU2A 5FOUA 5FYDA 1P7VA 3BJZA 3EVNA 3BN3A 1WETA 3IEVA 2G1KA 3EAQA 3JQPA 2GN6A 2VK4A 2QIPA 4GXNA 3A7EA 4TMXA 2V9CA 2O19A 3PUJA 3FHCB 3PC8C 1C7ZA 5FOVA 4ETWA 2PO7A 5B7GA 1AQLA 3W5HA 5HJ7A 2YXBA 3A6HA 1V5FA 1BIFA 3NV9A 1XF9A 2VSFA 3ETDA 3GELA 4ZMBA 3PC2A 1QAOA 1ZK1A 1ZUIA 3BB3A 2ID7A 3ZUGA 2XRZA 4DSNA 1F6BA 3GDWA 2BC9A 4O1MA 2HA4A 3EEQA 4I46A 4HYYA 3TIGA 2IK8A 5KX5B 4PW0A 4G67A 5GGYA 2XUIA 3N59A 4ALLA 3U7IA 3I5YA 4D26A 4B3HA 1LI5A 4RJTA 3II6X 4ZPJA 5DYTA 3R7LA 2C5LA 4HS4A 3TD2A 4ZOLB 1BH2A 1ZKDA 1AUXA 3QV2A 4Z99A 1KMIY 2NO6A 3OFJA 4EA9A 4WDQA 2HDNB 3GLHE 1JIQA 1J90A 3HJUA 4A73A 2FUKA 2L19A 4LNUB 4A10A 4G1UC 5IBQA 2W37A 4BQFA 1WEKA 4YRCA 1XRNA 2OECA 2ADOA 2BTQB 3IIKA 5T6MA 4DG8A 3C3MA 4Y18A 2VNJA 3HA5A 3ZKWB 4IHJF 2YFKA 4MKGA 1SOWA 4NCHA 4IIVA 3TQTA 1SHJA 1VJDA 3UN1A 2VF8A 4GZ6A 1R66A 2C8JA 3TGWA 3F7OA 5C46F 1SCQA 1PS0A 4CETA 3G59A 4B47A 2P9ZA 1LK7A 3T9AA 2W2KB 4BP8A 4TKZA 4XPIA 3GJ5A 4ALKA 4CHGA 2HK8A 1I5OA 4TV8A 1G5QA 4RTPA 5FFNA 1X15A 5ALNA 1HTBA 2ZRHA 5DB4A 4CF7A 2Y8EA 4MUNA 1XHLA 1SMKA 2PM8A 4F8EA 2FTKE 1RYMA 1KAQA 1OLSB 4UVIA 3UHJA 4E4RA 3K70D 1W5BA 3EA4A 4UBIA 2C9BA 1YZHA 2N0SA 3HKDA 1FP2A 1GU7A 3DMPA 4F91B 2NTJA 1PIWA 3DMTC 3H11A 5HMLA 4NU6A 1FVOA 3W2EA 1JT2A 1LTQA 4CI9A 1SU6A 3OC6A 3UMYA 1PNTA 2FJUA 1U3DA 2H0AA 4O5AA 4UW9A 5B6IA 1DQZA 1UPTA 5JWRA 5J40A 3NIFB 4F1KA 1GTL1 1CR1A 2UYGA 2P9YA 4PCAA 5K8CA 2JLWA 2O14A 3J81A 4A4DA 3G85A 4HYTA 5D01A 3OBIA 1XPRA 1FFGA 4GT1A 1M2JA 2W2TA 2OV6A 3IGFA 1T6YA 1J9GA 1WO8A 3I2JA 4BNZA 4ZVLA 3WYAA 4XM0A 4F4IA 3IT0A 4ZO9A 4DUGD 4F86A 2DU8A 1XP5A 5JC1A 5FJIA 5ILQA 4ZWNA 2J48A 4MQ4A 1PWHA 3MGCA 1ZA1A 4IP0A 3KAPA 4Z2AA 1QP0A 1BXGA 1FEZA 1RHUA 3RVQA 1GKKA 3WOVA 421PA 2ODPA 3EZ9A 1ETHA 3EBPA 2OXEA 3H2YA 4FX2A 5TPZD 5MHTA 2FEKA 4PNEA 5ISMA 2IPLA 4NHEA 3ZV7A 3IP7A 3RFVA 2WTAA 3RREA 1U28C 4F96A 4FQ8A 4MUAA 1CQZA 2NTNA 4R3UC 5JO0A 4L76A 4BNDB 3DYVA 2QN8A 1Z83A 1SQ0A 1U2SA 5ALLA 3GT3A 1EFPB 4CMGA 1AUQA 4FOLA 2BLLA 5F64A 1SO8A 4Q00A 1JLLA 4D5GA 2A4MA 5DM0A 3VNAA 2XB6A 5BWOA 2IBSA 3QUAA 3GG9A 3DBHA 4HH1A 2Q3HA 1Z0DA 3LC2O 5BN5A 4OJKA 3ITKA 3HKEA 3TLCA 1L8LA 3K70B 1H2FA 4E2FA 3DAYA 1ZNZA 4IBOA 3LNTA 5EIXA 1GPLA 1EK5A 2B6HA 1XRPA 2NW6A 2QENA 2RONA 3D6JA 3PGLA 1REQA 2VUUA 4UATA 2PGAA 5F2EA 5BUCA 1QGDA 2FG5A 2FZ4A 4S12A 2DUWA 3O94A 1T5IA 4ITVA 5KSOA 2VJKA 1E2KA 2NUPB 1JR3A 2Y1EA 4WLVA 1SD1A 4PCVA 3EGDA 3GJXC 5AJYA 1ENZA 1PW7A 2R6R1 2VYND 2I4IA 2CBXA 2FW1A 4HQLA 4IX1A 4K26A 4YRZA 3G7SA 1G21E 3U4MA 2J31A 4IDAA 3OECA 4PY2A 2R00A 3GDFA 4HUTA 1LJLA 1UK7A 4BEWA 3DV2A 1SKBA 3B1XA 1FFWA 1M6WA 1UPFA 4ND3A 2I3ZA 3MUFA 4QELA 1FRNA 2YRFA 4P84A 4C0AC 2VJMB 3PX3A 4R2JA 1DADA 3VX3A 5GINE 4YFVA 4AI6A 2VA8A 1GYPA 1E69A 2WY2D 3ICOA 4H60A 1Z5PA 3OIGA 1VZ3A 3SXPA 1AD2A 3D5QA 4ZKDA 2X40A 3CLTC 2HRBA 2IPAB 2PZEA 3QVKA 4QARA 4E2WA 2EQ5A 4GIBA 3K9BA 1WWKA 1YMVA 4QYXA 5BSHA 4FTWA 3OJEA 1EP9A 2R7NA 3K71B 4PO9A 4FHDA 3LIIA 4DR6B 4NBVA 1FJHA 2HK6A 1R0SA 2BYTA 1K2VN 2B4AA 3VVBA 1MGPA 2Q8QA 4Z51A 3ADDA 2XGOA 4MMXB 1TKCA 3FKSD 4MUFA 4TWRA 4XW2A 1XZLA 3ZY2A 3G79A 1GFSA 3A1TA 1T1JA 3AJDA 5IVDA 5K3FB 1WKVA 1Y81A 2QMQA 2OB1A 2Z04A 4HZGA 4P1ZA 3RTBA 1VRVA 3D8SA 3PTZA 2KWIA 3IBGA 4IVNA 3VVMA 2GNAA 2BFMA 1CT9A 1K88A 2PZBA 3GOHA 4PZLA 1ID8A 2QM8A 5B4TA 3V7YA 2V1XA 4GKAA 4RTQA 3GFTA 2X9LA 1G9TA 3F6PA 3IDQA 3TIXB 3KZVA 5I8WA 3IB3A 2P11A 4QGSA 1H94A 2VQFB 1TCCA 1JJBA 3EZ6A 3MT9A 3PLRA 3LBIA 1CERA 3DTVA 1NVAA 3A26A 4NICA 1KQNA 3SCZA 1ISMA 1NBOA 3KBBA 3NWPA 4MI1A 2BHSA 4PX9A 5DM4A 2R85A 4LKOA 2ZRBA 1JXAA 4TVOA 3CNQS 2FRXA 4QRDA 4KN8A 1JFFB 1NXOA 2CYCA 4GOLD 1ELOA 3K9HA 3DDCA 3VTZA 4E5DA 4GE0A 3ZW8A 3ZWMA 4O4JB 4KMOA 4C5BA 4J6EA 4NBKA 3VKWA 5L3SB 2FEMA 2NXEA 2R97A 4JBLA 5SYMA 1E99A 1R12A 1RM3A 1NHWA 2G80A 3ILHA 2X3YA 4QPZA 4OJQA 4JI2B 4JWKA 2B34A 3DBIA 2BMDA 2NZ2A 3OKFA 3NBUA 4EW3A 1DKQA 4RHCA 3U3OA 3UQZA 3RYCA 1UDAA 4QXRA 5FPHA 1VMKA 1XD2B 2JKVA 4XJSA 3G9UA 4BDTA 3IRVA 4EMBA 3E2PA 4FNGA 4RZUA 3TW4A 4HV4A 4CNBA 2IOFA 4GI5A 5JISA 4ZQIA 1Y5MA 4NBSA 4OIMA 1I1HA 3HNOA 4DG9A 3OFND 2GZAA 2GM4A 3LUAA 4KQHA 2A5YB 1XMIA 4PWYA 1RIIA 2PVPA 1UC8A 3IDSA 4KOAA 2C03A 4A8JA 1I2MA 1MQ8B 1ZNXA 1RYNA 2CBGA 3DHNA 2Q4DA 3VR6D 4DVJA 1EINA 2OGSA 3JD2A 4JK3A 2GD2A 4KXYA 1EBFA 5LP1A 3AILA 4TLLB 2EYQA 2GYUA 3F71A 4GLOA 4UNSA 1GA6A 4HWPA 1MN6A 4NENA 5DSTA 2ZSFA 3N76A 1CP2A 5G1PA 4B3JA 4I7EA 3MWGA 4C6TA 1TGVA 3I0NA 2QUBA 2IP4A 1R6AA 5IKPA 3VU9A 1D1TA 1B93A 3T7DA 5FUQA 3HM2A 2WYIA 3E5RA 1WVIA 3DMFA 3PFBA 4FOSA 2AFVA 1B6TA 3F5MA 3C8HA 3FUXA 2ZRNA 1UZAA 3BDIA 3HU3A 4D4GA 3STHA 3R40A 2ZANA 2O59A 1IPFA 3HCNA 4TZKA 3T38A 1LZKA 1TFRA 2NUTB 4TKVA 2WF9A 1J0EA 4K3UA 4NDZA 4YMSA 1A82A 3QZUA 4WPGA 4FR5A 3C3WA 2FJ0A 2ZIEA 1BA3A 5IFKA 4I5FA 4XDYA 3LHKA 4D2IA 2QX7A 3KPYA 3FNGA 4BKOA 1JH9A 1BU5A 1K7XB 2VDLB 4U2FA 4XLLA 3W0LB 4O4LF 1LWNA 2CE7A 2ZJZA 3OURA 2FZVA 3DEIA 1M6HA 3G2PA 4MUMA 1FYEA 5JNUA 5FPYA 1SK9A 2D1TA 2DCUA 5L7YA 2QK4A 4WUVA 1DJNA 1T3LA 3W7BA 1PL7A 4C0LA 1II0A 3WWDA 4WBNF 1KMHA 3DW3X 2FSGA 3LP8A 4RTMA 4ZD6A 1P0MA 3OM1A 3BRWD 1N8KA