3IF6C

Crystal structure of oxa-46 beta-lactamase from p. aeruginosa
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
231
Chain Sequence
b'VVIRSDWKKFFSDLQAEGAIVIADERQAKHTLSVFDQERAAKRYSPASTFIPHTLFALDADAVRDEFQVFRWVNRSFAGHNQDQDLRSAMRNSTVWVYELFAKDIGEDKARRYLKQIDYGNDYWIDGNLKISAHEQILFLRKLYRNQLPFKVEHQRLVKDLMITEAGRSWILRAKTGWEGRFGWWVGWIEWPTGPVFFALNIDTPNRTDDLFKREAIARAILRSIDALPPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXA-46 oxacillinase
molecule tags Hydrolase
source organism Pseudomonas aeruginosa
publication title Crystal structure of the narrow-spectrum OXA-46 class D beta-lactamase: relationship between active-site lysine carbamylation and inhibition by polycarboxylates
pubmed doi rcsb
total genus 72
structure length 231
sequence length 242
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3if6C00
3TG9A 4MBHA 4KZBA 3RXXA 4BL2A 3UPOA 1SKFA 2P74A 1L2SA 3CJMA 3IXHA 5CHMA 5A91A 2I72A 3CZDA 4GNUA 4R3BA 4WMCD 1XA7A 5EVLA 3OCNA 1KE3A 3IH8A 2ZQCA 4YINA 5DF8A 1VQQA 3LY4A 3GQZA 5CGWA 1YT4A 1CEGA 1MWTA 1HTZA 2EXBA 5DTSA 4MEZA 1G68A 2Y2QA 5CTNA 1TDLA 1KE0A 2P9VB 3E2LA 1J9MA 1E4DA 1K54A 3LO7A 1LHYA 4IVIA 4EV4A 4WEJA 1G6AA 3VSLA 1LI0A 1TEMA 5BOHA 3ZCZA 3RXWA 3PBSA 5FQ9A 5EE8A 4GDNA 1IYOA 3O87A 2Y91A 3A3FA 1K38A 1K25A 3SH9A 3ZNYA 5DF9A 4WEKA 3HLBA 3C4PA 5CECA 3QHYA 4GZBA 3S4XA 1WE4A 4DE1A 1ES3A 1JWZA 3UDIA 1BUEA 3BFFA 3BLSA 4S2OA 2Y59A 1FOFA 4GB7A 5GLCA 1ONHA 4KZ4A 1DY6A 5M19A 1FSYA 4X69A 1KDSA 3LY3A 4YFMA 3UE1A 3PTEA 2V2FF 1I2WA 2ZM2A 3ITBA 3Q7ZA 4BLMA 3N8SA 4MNRA 4X68A 3Q7VB 2WGWA 3BFDA 3G4PA 3A3IA 4U0TA 2BLSA 1KDWA 4L0LA 5EOEA 1MWUA 3VP4A 4DE0A 3WS1A 3FV7A 1ONGA 3PBQA 1HVBA 1SDNA 3NC8A 4OP8A 4BD1A 2DRWA 5FQKA 2RL3A 3C4OA 3UY6A 4N1XA 1ES2A 4ZAMA 1TDGA 1PZOA 2IWCA 3GR2A 1S0WA 3OZHA 4JKTA 5E2GA 3HLDA 3N6IA 4K0WA 4LV2A 4X6TA 3W8KA 4PPRA 3E2KA 4DE3A 5FA7A 1JWVA 3NIAA 3PAEA 2XFSA 1PWDA 3FKWA 2WAEA 3G35A 3MZFA 1W7FA 1KGGA 3IF6B 4BD0A 5FATA 3VP1A 2JC7A 3EQUA 1K4FA 4ZDXA 4KZ5A 5GL9A 3AGFA 3IF5A 1NZOA 4MBFA 3HLGA 2Y2OA 1KE4A 3WWXA 1K6RA 1YLTA 3AGDA 5KSCA 3IWQA 4IBXA 2H0TA 4S2PA 4R4SA 1RGYA 4R4RA 3IWOA 1Q2PA 1ZKJA 3G30A 4DRTA 3OPRA 3W4PA 2XD5A 4O7DA 3BFCA 4OPRA 3Q7VA 3V39A 2H0YA 4FH4A 4PMAA 2WKIA 2WAFA 2EFUA 4OKPA 4JXSA 2HDSA 1XA1A 5AQAA 5DTKA 1BZAA 5DTTA 4E6WA 3OCLA 1YLPA 2ZQ7A 5DVAA 5E43A 4Y0TA 1YMXA 3PBNA 4RVAA 2V1ZA 2ZC6B 4P85A 2G2UA 1YLZA 5JYOA 4FSFA 2FFFB 1ESIA 1BLSA 2OV5A 1Y54A 5HW3A 2ZD8A 3UN7A 2JCHA 1XGIA 4KZ8A 3ITAA 3GSGA 4R1GA 4X55A 3GRJA 4RYEA 1ES5A 2HDQA 5I94A 1S6RA 1K57C 1KGEA 5M1AA 4JF6A 3MFDA 3ZG5A 1TVFA 4DXCA 4IBRA 3Q81A 2J8YA 3VOYA 2Y2IA 3V3RA 5E2HA 4HEFA 5FAPA 2R9WA 5CRFA 4WZ5C 3OC2A 1PW8A 4JLFA 2FFYA 3HLWA 5A93A 3BEBA 3MXRA 3B3XA 4S2LA 2Y2JA 1K56A 4PM9A 1EI5A 3HL9A 4QJGA 2EX6A 3VSKA 1L0EA 1SCWA 3W4QA 1FR1A 3N4IA 4WZ4A 3ZHHA 3UE3A 4GKUA 5IHVA 3JYIA 4XUZA 4C6YA 5J8XA 1JWPA 1H5XA 2G2WA 1XPBA 3FKVA 4Y0UA 4OLDA 1HZOA 1BTLA 3OPHA 3PBRA 4GOGA 2OSUA 5EVIB 4K0XA 2Y2MA 5HARA 3IWIA 3P09A 5EOOA 2JBFA 1YQSA 4KG5A 2QZ6A 3C7UA 4EBLA 3SH7A 1W79A 4B88A 2UWXA 1FSWA 2PU4A 2B5RA 1RGZA 4QB8A 1IYQA 4OPQA 2WGIA 3AGEA 1JTGA 4HBUA 4Q8IA 4WYYA 2XH9A 5TGFA 4LV1A 5FASA 4PM5A 3BYDA 4ZJ3A 1YLYA 1QMEA 4DKIA 1Z6FA 3M2JA 4GDBA 1WYCA 1C3BA 1K54C 5GLAA 4EUZA 1PZPA 2XK1A 1IELA 4KENB 4KQQA 2C5WB 1VM1A 2DNSA 4MBKA 2XF3A 1DJCA 1RCJA 3G31A 1E25A 1MPLA 2C6WB 2XD1A 3PBTA 4UA9A 5CGXA 3EQVA 3SOIA 3VOZA 4UA6A 4OQ0A 1ZG6A 5AQBA 3GTCA 3N7WA 3UPNA 3M6BA 4Y0OA 5M18A 4GN2A 4KG2A 4OLGA 1YMSA 2XR0A 5F83A 3SS4A 3ISGA 1KGFA 4QU3A 2XDMA 2Y2KA 1GHPA 4KZ7A 4X56A 1MXOA 5CHJA 5D3OA 1E3UA 1FR6A 3G2ZA 3OPPA 2WK0A 4ZJ1A 1GA0A 2OLVA 4Z9QA 4LV0A 4E3MA 2PU2A 2R9XA 2HP5A 4NK3A 3MXSA 1FCNA 4OONA 5FI2A 5GLDA 1OMEA 1CK3A 3UE0A 1O07A 1IYSA 3TSGA 3ZNTA 4E3JA 2WADA 1O7EA 1NY0A 2XQZA 1M40A 4RX2A 4UHUA 4WM9A 2J7VA 1MWSA 4S2JA 1JTDA 4S2NA 2HDRA 2WKHA 1HD8A 3BFGA 1BLCA 2Y4AA 4E3NA 1YLJA 3HUOA 3S22A 1GA9A 2PBYA 3W4OA 2ZC4B 4H8RA 2HDUA 2Q9NA 4RA7A 4CPKA 4Y7PA 1FQGA 2VGJA 3C5AA 4IVKA 3UDXA 2EXAA 3HLEA 4E3KA 2WYXA 3HREA 5F82A 1KVLA 4JXVA 3M2KA 4ZBEA 1ZG4A 3Q82A 4R23A 1GHMA 4GD8A 5F1FA 3ZVWA 4JF4A 1SDEA 4FH2A 2XGNA 3HLFA 5FQQA 2J9PA 2V20A 4OOMA 4JXGA 5FDHA 1M6KA 1YM1A 4U0XA 3WS4A 3SS3A 5EECA 1XXMA 3NI9A 3HLCA 1ERMA 4FD8A 5CTMA 2GDNA 1XX2A 5CXWA 3V5MA 2Z2MB 1PWGA 3O88A 5KZHA 3WS5A 4KG6A 4S2IA 1W8YA 1H8YA 3HVFA 1H8ZA 5HL1A 4UA7A 5HAPA 4JBFA 1NYMA 3IH9A 1IEMA 2H10A 1K55A 5FI7A 3IHAA 4RX3A 1LL9A 1CEFA 1XP4A 5FAOA 4BQMA 3NDEA 4ZJ2A 2XLNA 2Y2LA 3S1YA 3LEZA 4NETA 4QY5A 3ZGAB 3DWKA 4QHCA 1AXBA 2A3UA 2WKEA 1GHIA 1I2SA 1Q2QA 3GVBA 2HP9A 4HBTA 1W8QA 4OH0A 2Y2NA 5AQ7A 5FQIA 5E2FA 2EX9A 4E3LA 1NZUA 4B4XA 1IYPA 2ZQAA 3C7VA 3BRMA 1LI9A 1NYYA 3NCKA 5HFOA 3UO9A 1QMFA 5A90A 5CEBA 1DJBA 3O3VA 5AQ9A 3UPPA 2DCFA 2XFTA 5EVIC 2WZZA 4C75A 5GHZA 4A5RA 2Y2GA 3BFEA 4OP5A 4EBPA 1ALQA 4K91A 2QPNA 1PI4A 4M3KA 2XEPA 3V50A 1E3UD 1L0DA 5EVID 4OOYA 5FSRA 4D2OA 4DE2A 3SH8A 5A92A 5EPHA 3IHBA 1BLHA 3RJUA 1EWZA 5FQMA 2JE5A 4DXBA 4KQRA 4BL3A 4UAAA 1EROA 4GD6A 2Y2HA 4E3IA 4XUXA 2X01A 2HP6A 3A3DA 5FI6A 4KZAA 3IXDA 1K57A 4B4ZA 5HAIA 5GHXA 3IF6C 1L0FA 4S2KA 5GHYA 3IXBA 3VP0A 1I5QA 1IKGA 1ES4A 2J9OA 1PWCA 4IEDA 4E3OA 3TOIA 5DF7A 4DF6A 3N8LA 3WRZA 3BECA 3SS5A 5L2FA 5HX9A 5EUAA 5FQJA 2IWBA 1PIOA 2P9VA 3ZG7B 1BLPA 1FCMA 2CC1A 3Q1FA 4LENA 4LV3A 1CI9A 4R3JA 5EVIA 2E8IA 3I7JA 3G2YA 5KMWA 4S2MA 3DTMA 4MLLA 3PBOA 1SHVA 5JYPA 4X53A 1RP5A 4ID4A 1CI8A 3UDFA 3HUMA 3VP3A 4PM7A 4C3QA 3MKFA 4KZ6A 4WELA 3IT9A 3MZEA 3IF6A 4PM6A 2ZC5B 2BG1A 3ZVTA 2RCXA 3DW0A 3N8RA 3QNBA 3FWLA 3DWZA 4LCLA 4PM8A 1PYYA 4OQGA 4BJPA 4FCFA 1K4EA 1MWRA 3HBRA 5KSHA 3LCEA 2WGWB 3WS2A 1K56D 2WUQA 3FZCA 3CMZA 4OOLA 2ZC7A 1XGJA 3M6HA 3MBZA 5F1GA 3VFHA 1BULA 1ESUA 2WZXA 1PI5A 3A3JA 5CHUA 4R0QA 3ZG9B 3D4FA 1ZC2A 1MY8A 2Y55A 5CEDA 3NBLA 1BT5A 1YLWA 4CJNA 1GCEA 3NDGA 3FYZA 4KQOA 4XXRA 2ZQ8A 4EWFA 4WBGA 1U60A 3Q07A 4OQIA 3VMAA 5GLBA 3WS0A 1ERQA 5CERA 3UNWA 2Y2PA 4ZTKA 1MKIA 2Q9MA 2QMIA 4P6BA 2Z2LB 2VGKA 5TFQA 5G18A 3ZG8B 5E2EA 3A3EA 1NXYA 2X02A 3GMWA 2ZMAA 1MBLA 4JXWA 2ZC3B 4P0MA 2HPBA 4N9LA 4WZ5A 4E6XA 5U47A 2EX2A 4BENA 4DDSA 3ZFZA 4OVDA 5FAQA 1K55C 4QY6A 2ZLYA 4P87A 3G32A 3PAGA 3MZDA 4OPZA 3ZDJA 3V3SA 1LLBA 2X71A 3GV9A 1WYBA 1PW1A 1N9BA 3G34A 4N1HA 1NJ4A 3ZG0A 3OPLA 4N9KA 1NRFA 2H5SA 5TR7A 3NY4A 4WMCA 3QNCA 2EFXA 3VFFA 5CGSA 4S2NC 3WRTA 1XKZA 4OPYA 4U3TA 4HESA 4EQIA 3IXGA 1IKIA 3BM6A 4KZ9A 4OQHA 1K6SA 3VP2A 5HAQA 2ZQ9A 3MKEA 2A49A 2IWDA 3P98A 3CG5A 2OLUA 1L0GA 4KZ3A 2ZQDA 3O86A 1JVJA 4JF5A 1DJAA 1BSGA 2ZM0A 1KVMA 4EBNA 2EX8A 4DDYA 3IQAA 3BLMA 4JPMA 4LCMA 4N92A 2WGVA 2ZM8A 1N4OA 4F94A 4QD4A 1FCOA 2ZJ9A 1LL5A 3HUNA 1W5DA
chains in the Genus database with same CATH superfamily
3TG9A 3TJZC 3CJMA 5CHMA 3IXHA 1XA7A 1KE3A 3IH8A 2PT7A 3LY4A 4UQIM 5CGWA 1YT4A 4HP4A 2EXBA 5DTSA 2Y2QA 3LO7A 1E4DA 4EV4A 1G6AA 1LI0A 1TEMA 4CLCD 5HPIA 3ZCZA 2QKPA 4GDNA 3UE6A 2Y91A 1IOUA 1SZVA 2DMWA 1K38A 1K25A 3ZNYA 5DF9A 4UEYA 3S4XA 3MJQA 1WE4A 3MMHA 4DE1A 2PR5A 4JGRA 4YFMA 3UE1A 2V2FF 4BBVA 2HZ5A 4MNRA 4U0TA 3VP4A 4O01A 1HVBA 2DRWA 3C4OA 1ES2A 4ZAMA 3GR2A 3OZHA 4JKTA 5E2GA 4R38A 1D06A 3HLDA 4X6TA 4PPRA 3EGDC 3BQAA 4DE3A 3PAEA 3FKWA 4P6ZM 3IF6B 4X25A 2Y79A 3EQUA 2B95A 4ZDXA 4KZ5A 3AGFA 3D72A 4MBFA 2OAQ1 2Y2OA 1KE4A 3F1NB 2FH5A 3IBJA 4S2PA 1RGYA 1TF1A 4R4RA 3OPRA 2Z6CA 3W4PA 1CF0A 3V39A 3VV4A 3NHQA 3QP4A 4G3WA 2WAFA 4JXSA 1XA1A 5DTTA 4E6WA 3OCLA 2VX8A 4NEED 3PBNA 2V1ZA 4HI4A 4IUHA 1ESIA 1Y54A 3ITAA 4NXBA 3P01A 2V8CA 1S6RA 2VGLM 1TVFA 2HJEA 1OTBA 2J8YA 3VOYA 1W63M 5CRFA 3U2AA 1EW0A 4JLFA 1VEUB 3MXRA 3B3XA 2W3FA 4QJGA 3HL9A 3BJNA 1L0EA 1SCWA 3N4IA 3JYIA 4C6YA 2G2WA 3FKVA 4BBTA 4OLDA 4GOGA 5EVIB 2OSUA 2Y2MA 4KG5A 4EBLA 3RFBA 2PU4A 4QB8A 1IYQA 3AGEA 4WYYA 2Z6DA 3LUQA 4PM5A 3BYDA 4ZJ3A 3MF0A 2MJ6A 4GDBA 1X0OA 4WLAA 3GECA 4YNRA 4KQQA 2DNSA 3PBTA 3VOZA 2XD1A 3CWFA 5CGXA 4EETB 4UA6A 1ZG6A 3GTCA 3N7WA 1PFLA 4Y0OA 4IUKA 3S7NA 2XR0A 1KGFA 2Y2KA 1OTEA 3OPPA 2WK0A 2OLVA 2HP5A 3VE4A 1XJ2A 3LIBA 2ZOIA 3EWKA 1TS8A 3E0YA 3MSHA 1AWIA 4PKYA 2J7VA 4HY8A 4S2JA 4S2NA 2HDRA 4GHIB 2Y4AA 2VKSA 5DKKA 1F9IA 1YLJA 2QHKA 1GA9A 3W4OA 2ZC4B 2WKPA 3F1PB 1FQGA 3UDXA 3C5AA 3HLEA 4E3KA 1KVLA 4JXVA 4LFUA 1GHMA 3ZVWA 1NLYA 4QPRA 2V20A 4JXGA 3NI9A 4FD8A 2GDNA 1XX2A 2A24B 2L0WA 3V5MA 2XROA 3CAXA 4GW9A 4KG6A 1XJ6A 3H7WA 4WL9A 3IH9A 4Q0JA 3A0RA 5FI7A 3IHAA 3QP2A 5FAOA 3NDEA 2XLNA 2Y2LA 3C38A 4QHCA 1AXBA 3GVBA 1GHIA 1Q2QA 3T1RA 5AQ7A 4E3LA 2ZQAA 3A0VA 4HNBA 3O3VA 4LGWA 2DCFA 2GZAA 2XFTA 2WZZA 3QP5A 4K91A 2QPNA 1E3UD 1L0DA 5EVID 4D2OA 3LIEA 2HJ9C 1EROA 3UMEA 4KQDA 2HP6A 3A3DA 3FPVA 5GHXA 1L0FA 5GHYA 1ES4A 3EOIA 3N8LA 3WRZA 3MS6A 5L2FA 2O9AA 2IWBA 3ZG7B 1BLPA 2VV6A 3Q1FA 5EVIA 1HLUP 3G2YA 5KMWA 3LIDA 3MQOA 1RP5A 5L07A 4FOFA 4FUWA 3IT9A 3MZEA 5K5BA 2BG1A 4Y13A 3N8RA 1K0KA 1N9LA 1DP8A 2VGLS 4R3AA 4OQGA 1XFNA 1K4EA 1MWRA 3HBRA 4MMNA 4Y15A 3WS2A 3FZCA 4OOLA 3MBZA 5HWTA 2PAVP 3QP8A 3MXQA 3NBLA 3NDGA 2B18A 2ZQ8A 1U60A 4OQIA 5GLBA 3UNWA 2PBDP 2Z2LB 2O9CA 2VK3A 5G18A 3IBRA 1NXYA 2X02A 2ZC3B 4JGPA 2EA9A 4BENA 4MCWA 4BWIA 2M7VA 4P87A 3LIFA 4ESPA 3ZDJA 3V3SA 2M7UA 3F1NA 2H5SA 3NY4A 4I39A 3QNCA 3UB9A 4P6ZS 5CGSA 4HHDA 4EQIA 4HESA 3BY9A 4EU0A 1K6SA 2ZQ9A 2A49A 3P98A 3CG5A 1S1YA 1T1AA 1DJAA 4R6LA 1BSGA 4LCMA 5I5LA 4F94A 3IX3A 4QD4A 1FCOA 3HUNA 3F1PA 1W5DA 4I5SA 3E98A 1ZHHB 5TBMA 4BL2A 1SKFA 1L2SA 3MQQA 1LSWA 2I72A 3CZDA 2JHEA 2ZQCA 3T4LA 3MFXA 1VQQA 1N9OA 1MWTA 1HTZA 1GSVA 3QP6A 4MEZA 1G68A 1TDLA 3F1OA 3T4JA 1KE0A 3E2LA 1J9MA 1K54A 4IVIA 2QJ5A 3KSGA 4L9EA 1IYOA 3NJAA 4WEKA 3CI6A 1GSWA 2VEAA 3FG8A 3UDIA 2O0YA 2Y59A 1FOFA 3CUEA 4GB7A 4S2OA 1ONHA 5M19A 4X69A 1KDSA 2Q0OA 2ZM2A 3ITBA 3G4PA 4EEUA 3A3IA 1MWUA 1TS6A 1ONGA 4OP8A 1SDNA 3NC8A 3L9KA 5FQKA 2RL3A 4N1XA 3LGOA 1TDGA 1PZOA 3T4SA 3MQ0A 1JNUA 5MC7A 3N6IA 4PHTA 3B33A 3DTKA 3E2KA 2HV1A 1JWVA 2V0UA 1PWDA 3MZFA 1KGGA 4BD0A 5FATA 3VP1A 3LR4A 2JC7A 2VZWA 5GL9A 4JGQA 3E4OA 1NZOA 3IF5A 2WKRA 3S7QA 2VV8A 2KOIA 5L8MA 1Q2PA 1ZKJA 3G30A 4DRTA 3Q7VA 1STZA 4FH4A 1S4SA 4PMAA 1T1BA 4OKPA 1BZAA 3DTEA 1ZTUA 2ZQ7A 4Y0TA 1YKDA 1YMXA 2G2UA 3IS2B 1YLZA 2FFFB 1F2KA 2JKRM 2ZD8A 3UN7A 4KZ8A 3GSGA 4X55A 3GRJA 1KGEA 4JF6A 3MFDA 1NWZA 3ZG5A 4DXCA 3Q81A 4GS9B 3CLOA 5KIZA 2R9WA 1PW8A 2V1AA 5A93A 2Y2JA 1EI5A 4YWZA 4ETXA 4WZ4A 1V9ZA 3PHYA 5A8BA 1BTLA 5HL6A 4K0XA 5J4EA 1YQSA 2QZ6A 3C7UA 3SH7A 2UWXA 3U4LP 4K08A 2B5RA 2YKFA 1RGZA 4OPQA 2WGIA 1JTGA 3BQ8A 4LV1A 5TGFA 2JN7A 1TS0A 1C3BA 1H0MA 1J3WA 2XK1A 5AJGA 4KENB 2C5WB 1E25A 4UA9A 3EQVA 3SOIA 3UPNA 4O0PA 5F83A 3SS4A 4X56A 1H3QA 1E3UA 3E4QA 3G2ZA 1GA0A 4Z9QA 2PU2A 4OONA 1FCNA 5GLDA 4X1MA 1O07A 1IYSA 3TSGA 3ZNTA 1O7EA 1NY0A 1M40A 4UHUA 1JTDA 2WKHA 3T50A 5IT5A 3S22A 3HUOA 1MC0A 3KYQA 2PBYA 3D9YA 4HH2A 3SW1A 2VGJA 4IVKA 3DTIA 3HREA 1ZG4A 3Q82A 1LT0A 4GD8A 5F1FA 1SDEA 3NOUC 4HH3A 4HJ3A 1M6KA 4RQ9A 5CTMA 2INWA 5CXWA 1PWGA 5KZHA 4B9OA 3PXPA 2K7SA 3OLOA 2LB9A 4MDZA 1K55A 2K2NA 3DAVA 3G6OA 4AFIA 5C5KA 4FTXA 4BQMA 1DRMA 2PR6A 3LEZA 4NETA 3DWKA 2WKEA 2HP9A 2R78A 3C7VA 1P0ZA 1LI9A 1NYYA 3NCKA 3UO9A 1XFQA 5CEBA 5HPFA 4CLCA 3UPPA 2V9AA 5FSRA 5A92A 3IHBA 4X1LA 5FQMA 4UAAA 4GD6A 4KZAA 4L9FA 4B4ZA 2L4RA 4S2KA 5HDDA 1CJFA 4Z1WA 4LRXC 2J9OA 2H28A 1LL8A 1PWCA 4E3OA 2BTFP 1OTIA 1XJ4A 3O5YA 3SS5A 4B93A 2CC1A 3LICA 1CI9A 3LEQA 2E8IA 4JGOA 3DTMA 4MLLA 2A24A 4R70A 5JYPA 4E04A 3VP3A 4I3JA 4PM6A 4Y2FA 1YSPA 3ZVTA 3QNBA 4YOFA 4LCLA 1PYYA 4BJPA 3LCEA 1K56D 3M6HA 1ESUA 2WZXA 1PI5A 1LSXA 4I38A 1MY8A 4HQAA 1YLWA 1BT5A 4CJNA 2LB5A 2PHYA 3FYZA 4XXRA 3C8CA 3WS0A 1OT6A 3UB8A 4ZTKA 1MKIA 1NLZA 4P6BA 3LR0A 1NRJA 3A3EA 3GMWA 3H82B 2HPBA 4DDSA 3ZFZA 2W1TA 2O9BA 4I3AA 3EEAA 5FAQA 2NUPC 3OOVA 3PAGA 4OPZA 3GV9A 1PW1A 3OPLA 2EFXA 1T18A 5L10A 4S2NC 3WRTA 4U3TA 4EW7A 3IXGA 3KSHA 1IKIA 3MKEA 2IWDA 1L0GA 2ZQDA 3O86A 3W2ZA 4EBNA 1G5UA 3BLMA 2QWSA 1N4OA 2PD8A 1LL5A 2JKTI 4MBHA 3RXXA 2P74A 1VETB 2VA0A 4GNUA 5EVLA 4YINA 5DF8A 3GQZA 4CLCE 1LHYA 3LYXA 3TRCA 4WEJA 2GJ3A 2J80A 3RXWA 3UB7A 3O87A 2YKHA 3A3FA 1LSVA 3HLBA 5CECA 3QHYA 4GZBA 3GDIA 1ES3A 1BUEA 3BFFA 4KZ4A 1DY6A 3CHWP 3LY3A 3PTEA 3R7WB 3Q7ZA 4BLMA 5G4YA 3N8SA 4X68A 5HZHA 2BLSA 1KDWA 3IX4A 4DE0A 3WS1A 2VJWA 1ACFA 4BD1A 2PDRA 3UY6A 3KYEA 2W1RA 2J3TD 5HD3A 1VHMA 3NIAA 1T19A 2XFSA 2WAEA 3G35A 1VB6A 2O99A 1K4FA 3NOPC 1K6RA 4MN6A 2FZ0A 3AGDA 5KSCA 3IWQA 4IBXA 5IS1A 3R4KA 4R4SA 4BBUA 3IWOA 2XD5A 3BFCA 2H0YA 3EEHA 2XA7M 2EFUA 3R7WA 5AQAA 5DTKA 3KYZA 3ULFA 5DJUA 1YLPA 1OTAA 2BASA 5DVAA 3QP1A 2P7JA 5JYOA 2W1TB 4FSFA 2OV5A 1BLSA 1XGIA 4G3KA 1PRQA 4R1GA 4RYEA 1ES5A 5I94A 1K57C 3LR5A 3HJIA 4IBRA 4EESA 3V3RA 4IJGA 4HEFA 5FAPA 4WZ5C 4NXGA 3OC2A 3PYPA 2OOLA 3HLWA 4S2LA 1K56A 4PM9A 5J3WA 3VSKA 3ZQ5A 2OAP1 3B42A 3CUEC 3ZHHA 3UE3A 5J8XA 1JWPA 2GNXA 5HARA 1F5MA 3T4TA 3P09A 2J3TC 4B88A 5HSQA 4HOIA 3BWLA 1YLYA 1Z6FA 4NKPA 1K54C 1SKOB 5GLAA 2JKFA 1IELA 1VM1A 4MBKA 1DJCA 1RCJA 2ACGA 2XF3A 1MPLA 3G31A 5AQBA 4OQ0A 3M6BA 4GN2A 4OLGA 1YMSA 3ISGA 2XDMA 3T4QA 5IU1A 4ZJ1A 3SZTA 4LV0A 4E3MA 3HCYA 4GJ4A 4O8GA 4UQIS 2P04A 4GS9A 2WADA 2XQZA 4MN5A 5AVFA 4XT2B 1BLCA 4CLCB 3D3OA 3OBFA 2V1BA 4H8RA 4LPZA 4RA7A 4Y7PA 1V9YA 2EXAA 2NUTC 5DJTA 2WYXA 4ZBEA 4NXEA 2EWWA 3HLFA 5FQQA 2D01A 5EV0A 4Y3IA 3WS4A 3SS3A 2Z2MB 4S2IA 1W8YA 1H8YA 3HVFA 1H8ZA 5HL1A 2PYRA 4JBFA 1NYMA 5FEGA 2H10A 4LRZE 1VEUA 2B02A 3S1YA 4GHIA 5CX7A 1W8QA 4OH0A 2Y2NA 5FQIA 2EX9A 1NZUA 3BRMA 4WF0A 5A90A 5TJJA 2OWJA 1ODVA 2JKRI 3BW6A 5AQ9A 5EVIC 5GHZA 3BFEA 4EBPA 1ALQA 4F3LA 4CLCC 4ZRRA 4ME4A 4DE2A 1UWPX 2D02A 2UV0E 3RJUA 1EWZA 4DXBA 4BL3A 1H8MA 2X01A 5FI6A 3IXDA 3CPTB 3IF6C 5EVEA 1IKGA 2K31A 4IEDA 2EWVA 3TOIA 5DF7A 4DJ2A 4CQHA 3BECA 3VE3A 2P9VA 1PNEA 3F1OB 1FCMA 4LV3A 4R3JA 3I7JA 3T4KA 3TW8A 4S2MA 5DKLA 2ZBBA 3UB6A 3UDFA 3MKFA 4KZ6A 2ZC5B 3DW0A 4Q0IA 3FWLA 3K3DA 2PD7A 4FCFA 3BY8A 3CMZA 3VFHA 1MZUA 1BULA 3A3JA 1FILA 4R0QA 3ZG9B 1IFQA 2Y55A 5CEDA 1OJ5A 4KQOA 4WBGA 4DN0A 3Q07A 3RH8B 5CERA 2Y2PA 1P97A 5E2EA 2ZMAA 4JXWA 4P0MA 4DJ3A 4WZ5A 4E6XA 2E8JA 1UGUA 3IS2A 3MR0A 2ZLYA 3G32A 5J7EA 3RTYA 1LLBA 2X71A 4N1HA 1N9BA 5FDSA 4L9GA 5TR7A 2PYPA 5F69A 4KUKA 1T1CA 4OPYA 5LBRA 2JKGA 3BM6A 4KZ9A 1D7EA 3VP2A 2W0NA 4KZ3A 1JVJA 4NXFA 2ZM0A 1WA9A 2L1MA 2EX8A 4DDYA 3IQAA 4JPMA 4N92A 2WGVA 2ZJ9A 3NECA 4HIAA 4KZBA 1L3LA 3UPOA 5A91A 4WMCD 4R3BA 3OCNA 2W3DA 1CEGA 5CTNA 2P9VB 2P08A 3H9WA 5DFXA 3VSLA 5BOHA 1FIKA 2JKTM 3PBSA 5EE8A 5FQ9A 3T1XA 5F6AA 5HWVA 3SH9A 3C4PA 4Y17A 2AVXA 1YAXA 1JWZA 1G6OA 3BLSA 2I9VA 5GLCA 1XJ3A 1FSYA 2G7UA 1I2WA 3T1SA 3Q7VB 2WGWA 3BFDA 1YSQA 4L0LA 5EOEA 4Y5FA 3FV7A 3S7PA 3PBQA 2WKQA 1UWNX 2IWCA 1S0WA 3IX8A 4EEPA 4K0WA 4LV2A 3W8KA 3KSIA 2HGVA 2V0WA 5FA7A 4H6JA 1W63Q 2VLGA 1S4RA 5TBMB 2XSSA 1W7FA 5EM0A 1GSXA 2XRNA 5F68A 3HLGA 1S66L 3C30A 3WWXA 1A0KA 1YLTA 3C2WA 2OWHA 2H0TA 3E4PA 4O7DA 4OPRA 2W3GA 5G4ZA 2WKIA 2HDSA 4Q0HA 5E43A 4RVAA 1OJGA 2ZC6B 4P85A 2HF6A 5FL3A 5HW3A 3L7HA 2JCHA 4HJ6A 2HDQA 4GLQA 4LLOB 5M1AA 2ZMVA 1OT9A 2Y2IA 5E2HA 1OPXA 5DFYA 1CQAA 2FFYA 3UMDA 3BEBA 2EX6A 4GCZA 1P9WA 3CITA 4LRYC 3W4QA 1FR1A 4GKUA 5IHVA 4XUZA 1H5XA 3HJKA 1XPBA 4Y0UA 5HAQA 1HZOA 3OPHA 3PBRA 3JVUA 3IWIA 5EOOA 2JBFA 4QWOA 1W79A 1FSWA 2A2LA 4HBUA 4KUOA 5F5YA 2XH9A 4Q8IA 5FASA 4BMWA 1QMEA 4DKIA 3M2JA 1WYCA 3NOTC 4EXOA 4EUZA 1PZPA 4EUVA 2ZL1B 5HDCA 2CMNA 2C6WB 5EFWA 1OTDA 5M18A 1N9NA 4KG2A 4QU3A 5CHJA 1GHPA 4KZ7A 1MXOA 4HJ4A 5D3OA 1FR6A 2R9XA 4NK3A 4M4XA 3MXSA 5FI2A 3S7OA 1OMEA 1CK3A 3UE0A 5AVEA 3NULA 2KDKA 4XT2A 4E3JA 4RX2A 4WM9A 1MWSA 5HWWA 3BFGA 1HD8A 2KX6A 4E3NA 1VETA 2HDUA 2Q9NA 4CPKA 4IHQA 4PAUA 5F82A 3M2KA 4R23A 4JF4A 4FH2A 2XGNA 2J9PA 4OOMA 5FDHA 4U0XA 1YM1A 5EECA 1XXMA 4G3VA 3LFVA 3HLCA 1ERMA 2PRFA 3O88A 1BYWA 3UB5P 3WS5A 3ZYTA 3H7WB 3V67A 4UA7A 5HAPA 4PKYG 1F98A 1IEMA 5EM1A 4EQ1A 4RX3A 1LL9A 1CEFA 1XP4A 3T12B 4ZJ2A 1Y4OA 1Y28A 2M1CA 4ETZA 3DBAA 3CPTA 4QY5A 3ZGAB 3ICYA 3JPUA 2A3UA 4HBTA 1I2SA 3T1QB 3EGXC 1G28A 5E2FA 2KLIA 4B4XA 1IYPA 5HFOA 1QMFA 1DJBA 2IA2A 1TS7A 4C75A 4WUJA 4A5RA 4EERA 1YPRA 2Y2GA 2J3WA 4OP5A 4F3LB 1PI4A 4M3KA 2XEPA 3V50A 2QJ7A 4OOYA 3LI9A 3SH8A 2W27A 1D1JA 5EPHA 3P7NA 1BLHA 4NG2A 2Y8HA 2JE5A 4KQRA 2VV7A 2Y2HA 4E3IA 4XUXA 3LIAA 1K57A 5HAIA 4ARZA 3IXBA 3VP0A 1MKMA 4DF6A 3KX0X 1SKOA 5HX9A 3B47A 5EUAA 5FQJA 1PIOA 2W3HA 4LENA 1Z09A 3LI8A 1S1ZA 4H6JB 4HP9A 4ARZB 3PBOA 1SHVA 4X53A 2V8FA 4ID4A 1CI8A 3HUMA 4C3QA 4PM7A 4WELA 3IF6A 3PR6A 3FPWA 5HDSA 1S67L 2RCXA 3JVVA 3DWZA 3VOLA 4PM8A 4MN7A 4D60A 2ZOHA 5KSHA 5HD5A 2WGWB 3T4OA 4DMZA 2WUQA 2ZC7A 1XGJA 5F1GA 3KO6A 5CHUA 2QYBA 3D4FA 1ZC2A 1GCEA 4EWFA 5FEFA 3VMAA 1ERQA 2Q9MA 2QMIA 2VGKA 5TFQA 2W3EA 3ZG8B 2GX5A 1MBLA 3KSFA 4N9LA 5U47A 3TE8A 2EX2A 4OVDA 3FC7A 1K55C 4QY6A 2ZL1A 3A0SA 3H82A 3MZDA 1WYBA 3G34A 3K2NA 3LR3A 1NJ4A 3ZG0A 1KOUA 4N9KA 3K3CA 1NRFA 4WN5A 4II7A 4WMCA 3VFFA 1P9RA 1XKZA 2XA7S 2ZMFA 4OQHA 2OLUA 1DP9A 4JF5A 1TD5A 1KVMA 1DP6A 2ZM8A 5L09A 4I3IA 1I5QA
chains in the Genus database with same CATH topology
3TG9A 4MBHA 4KZBA 3RXXA 4BL2A 3UPOA 1SKFA 2P74A 1L2SA 3CJMA 3IXHA 5CHMA 5A91A 2I72A 3CZDA 4GNUA 4R3BA 4WMCD 1XA7A 5EVLA 3OCNA 1KE3A 3IH8A 2ZQCA 4YINA 5DF8A 1VQQA 3LY4A 3GQZA 5CGWA 1YT4A 1CEGA 1MWTA 1HTZA 2EXBA 5DTSA 4MEZA 1G68A 2Y2QA 5CTNA 1TDLA 1KE0A 2P9VB 3E2LA 1J9MA 1E4DA 1K54A 3LO7A 1LHYA 4IVIA 4EV4A 4WEJA 1G6AA 3VSLA 1LI0A 1TEMA 5BOHA 3ZCZA 3RXWA 3PBSA 5FQ9A 5EE8A 4GDNA 1IYOA 3O87A 2Y91A 3A3FA 1K38A 1K25A 3SH9A 3ZNYA 5DF9A 4WEKA 3HLBA 3C4PA 5CECA 3QHYA 4GZBA 3S4XA 1WE4A 4DE1A 1ES3A 1JWZA 3UDIA 1BUEA 3BFFA 3BLSA 4S2OA 2Y59A 1FOFA 4GB7A 5GLCA 1ONHA 4KZ4A 1DY6A 5M19A 1FSYA 4X69A 1KDSA 3LY3A 4YFMA 3UE1A 3PTEA 2V2FF 1I2WA 2ZM2A 3ITBA 3Q7ZA 4BLMA 3N8SA 4MNRA 4X68A 3Q7VB 2WGWA 3BFDA 3G4PA 3A3IA 4U0TA 2BLSA 1KDWA 4L0LA 5EOEA 1MWUA 3VP4A 4DE0A 3WS1A 3FV7A 1ONGA 3PBQA 1HVBA 1SDNA 3NC8A 4OP8A 4BD1A 2DRWA 5FQKA 2RL3A 3C4OA 3UY6A 4N1XA 1ES2A 4ZAMA 1TDGA 1PZOA 2IWCA 3GR2A 1S0WA 3OZHA 4JKTA 5E2GA 3HLDA 3N6IA 4K0WA 4LV2A 4X6TA 3W8KA 4PPRA 3E2KA 4DE3A 5FA7A 1JWVA 3NIAA 3PAEA 2XFSA 1PWDA 3FKWA 2WAEA 3G35A 3MZFA 1W7FA 1KGGA 3IF6B 4BD0A 5FATA 3VP1A 2JC7A 3EQUA 1K4FA 4ZDXA 4KZ5A 5GL9A 3AGFA 3IF5A 1NZOA 4MBFA 3HLGA 2Y2OA 1KE4A 3WWXA 1K6RA 1YLTA 3AGDA 5KSCA 3IWQA 4IBXA 2H0TA 4S2PA 4R4SA 1RGYA 4R4RA 3IWOA 1Q2PA 1ZKJA 3G30A 4DRTA 3OPRA 3W4PA 2XD5A 4O7DA 3BFCA 4OPRA 3Q7VA 3V39A 2H0YA 4FH4A 4PMAA 2WKIA 2WAFA 2EFUA 4OKPA 4JXSA 2HDSA 1XA1A 5AQAA 5DTKA 1BZAA 5DTTA 4E6WA 3OCLA 1YLPA 2ZQ7A 5DVAA 5E43A 4Y0TA 1YMXA 3PBNA 4RVAA 2V1ZA 2ZC6B 4P85A 2G2UA 1YLZA 5JYOA 4FSFA 2FFFB 1ESIA 1BLSA 2OV5A 1Y54A 5HW3A 2ZD8A 3UN7A 2JCHA 1XGIA 4KZ8A 3ITAA 3GSGA 4R1GA 4X55A 3GRJA 4RYEA 1ES5A 2HDQA 5I94A 1S6RA 1K57C 1KGEA 5M1AA 4JF6A 3MFDA 3ZG5A 1TVFA 4DXCA 4IBRA 3Q81A 2J8YA 3VOYA 2Y2IA 3V3RA 5E2HA 4HEFA 5FAPA 2R9WA 5CRFA 4WZ5C 3OC2A 1PW8A 4JLFA 2FFYA 3HLWA 5A93A 3BEBA 3MXRA 3B3XA 4S2LA 2Y2JA 1K56A 4PM9A 1EI5A 3HL9A 4QJGA 2EX6A 3VSKA 1L0EA 1SCWA 3W4QA 1FR1A 3N4IA 4WZ4A 3ZHHA 3UE3A 4GKUA 5IHVA 3JYIA 4XUZA 4C6YA 5J8XA 1JWPA 1H5XA 2G2WA 1XPBA 3FKVA 4Y0UA 4OLDA 1HZOA 1BTLA 3OPHA 3PBRA 4GOGA 2OSUA 5EVIB 4K0XA 2Y2MA 5HARA 3IWIA 3P09A 5EOOA 2JBFA 1YQSA 4KG5A 2QZ6A 3C7UA 4EBLA 3SH7A 1W79A 4B88A 2UWXA 1FSWA 2PU4A 2B5RA 1RGZA 4QB8A 1IYQA 4OPQA 2WGIA 3AGEA 1JTGA 4HBUA 4Q8IA 4WYYA 2XH9A 5TGFA 4LV1A 5FASA 4PM5A 3BYDA 4ZJ3A 1YLYA 1QMEA 4DKIA 1Z6FA 3M2JA 4GDBA 1WYCA 1C3BA 1K54C 5GLAA 4EUZA 1PZPA 2XK1A 1IELA 4KENB 4KQQA 2C5WB 1VM1A 2DNSA 4MBKA 2XF3A 1DJCA 1RCJA 3G31A 1E25A 1MPLA 2C6WB 2XD1A 3PBTA 4UA9A 5CGXA 3EQVA 3SOIA 3VOZA 4UA6A 4OQ0A 1ZG6A 5AQBA 3GTCA 3N7WA 3UPNA 3M6BA 4Y0OA 5M18A 4GN2A 4KG2A 4OLGA 1YMSA 2XR0A 5F83A 3SS4A 3ISGA 1KGFA 4QU3A 2XDMA 2Y2KA 1GHPA 4KZ7A 4X56A 1MXOA 5CHJA 5D3OA 1E3UA 1FR6A 3G2ZA 3OPPA 2WK0A 4ZJ1A 1GA0A 2OLVA 4Z9QA 4LV0A 4E3MA 2PU2A 2R9XA 2HP5A 4NK3A 3MXSA 1FCNA 4OONA 5FI2A 5GLDA 1OMEA 1CK3A 3UE0A 1O07A 1IYSA 3TSGA 3ZNTA 4E3JA 2WADA 1O7EA 1NY0A 2XQZA 1M40A 4RX2A 4UHUA 4WM9A 2J7VA 1MWSA 4S2JA 1JTDA 4S2NA 2HDRA 2WKHA 1HD8A 3BFGA 1BLCA 2Y4AA 4E3NA 1YLJA 3HUOA 3S22A 1GA9A 2PBYA 3W4OA 2ZC4B 4H8RA 2HDUA 2Q9NA 4RA7A 4CPKA 4Y7PA 1FQGA 2VGJA 3C5AA 4IVKA 3UDXA 2EXAA 3HLEA 4E3KA 2WYXA 3HREA 5F82A 1KVLA 4JXVA 3M2KA 4ZBEA 1ZG4A 3Q82A 4R23A 1GHMA 4GD8A 5F1FA 3ZVWA 4JF4A 1SDEA 4FH2A 2XGNA 3HLFA 5FQQA 2J9PA 2V20A 4OOMA 4JXGA 5FDHA 1M6KA 1YM1A 4U0XA 3WS4A 3SS3A 5EECA 1XXMA 3NI9A 3HLCA 1ERMA 4FD8A 5CTMA 2GDNA 1XX2A 5CXWA 3V5MA 2Z2MB 1PWGA 3O88A 5KZHA 3WS5A 4KG6A 4S2IA 1W8YA 1H8YA 3HVFA 1H8ZA 5HL1A 4UA7A 5HAPA 4JBFA 1NYMA 3IH9A 1IEMA 2H10A 1K55A 5FI7A 3IHAA 4RX3A 1LL9A 1CEFA 1XP4A 5FAOA 4BQMA 3NDEA 4ZJ2A 2XLNA 2Y2LA 3S1YA 3LEZA 4NETA 4QY5A 3ZGAB 3DWKA 4QHCA 1AXBA 2A3UA 2WKEA 1GHIA 1I2SA 1Q2QA 3GVBA 2HP9A 4HBTA 1W8QA 4OH0A 2Y2NA 5AQ7A 5FQIA 5E2FA 2EX9A 4E3LA 1NZUA 4B4XA 1IYPA 2ZQAA 3C7VA 3BRMA 1LI9A 1NYYA 3NCKA 5HFOA 3UO9A 1QMFA 5A90A 5CEBA 1DJBA 3O3VA 5AQ9A 3UPPA 2DCFA 2XFTA 5EVIC 2WZZA 4C75A 5GHZA 4A5RA 2Y2GA 3BFEA 4OP5A 4EBPA 1ALQA 4K91A 2QPNA 1PI4A 4M3KA 2XEPA 3V50A 1E3UD 1L0DA 5EVID 4OOYA 5FSRA 4D2OA 4DE2A 3SH8A 5A92A 5EPHA 3IHBA 1BLHA 3RJUA 1EWZA 5FQMA 2JE5A 4DXBA 4KQRA 4BL3A 4UAAA 1EROA 4GD6A 2Y2HA 4E3IA 4XUXA 2X01A 2HP6A 3A3DA 5FI6A 4KZAA 3IXDA 1K57A 4B4ZA 5HAIA 5GHXA 3IF6C 1L0FA 4S2KA 5GHYA 3IXBA 3VP0A 1I5QA 1IKGA 1ES4A 2J9OA 1PWCA 4IEDA 4E3OA 3TOIA 5DF7A 4DF6A 3N8LA 3WRZA 3BECA 3SS5A 5L2FA 5HX9A 5EUAA 5FQJA 2IWBA 1PIOA 2P9VA 3ZG7B 1BLPA 1FCMA 2CC1A 3Q1FA 4LENA 4LV3A 1CI9A 4R3JA 5EVIA 2E8IA 3I7JA 3G2YA 5KMWA 4S2MA 3DTMA 4MLLA 3PBOA 1SHVA 5JYPA 4X53A 1RP5A 4ID4A 1CI8A 3UDFA 3HUMA 3VP3A 4PM7A 4C3QA 3MKFA 4KZ6A 4WELA 3IT9A 3MZEA 3IF6A 4PM6A 2ZC5B 2BG1A 3ZVTA 2RCXA 3DW0A 3N8RA 3QNBA 3FWLA 3DWZA 4LCLA 4PM8A 1PYYA 4OQGA 4BJPA 4FCFA 1K4EA 1MWRA 3HBRA 5KSHA 3LCEA 2WGWB 3WS2A 1K56D 2WUQA 3FZCA 3CMZA 4OOLA 2ZC7A 1XGJA 3M6HA 3MBZA 5F1GA 3VFHA 1BULA 1ESUA 2WZXA 1PI5A 3A3JA 5CHUA 4R0QA 3ZG9B 3D4FA 1ZC2A 1MY8A 2Y55A 5CEDA 3NBLA 1BT5A 1YLWA 4CJNA 1GCEA 3NDGA 3FYZA 4KQOA 4XXRA 2ZQ8A 4EWFA 4WBGA 1U60A 3Q07A 4OQIA 3VMAA 5GLBA 3WS0A 1ERQA 5CERA 3UNWA 2Y2PA 4ZTKA 1MKIA 2Q9MA 2QMIA 4P6BA 2Z2LB 2VGKA 5TFQA 5G18A 3ZG8B 5E2EA 3A3EA 1NXYA 2X02A 3GMWA 2ZMAA 1MBLA 4JXWA 2ZC3B 4P0MA 2HPBA 4N9LA 4WZ5A 4E6XA 5U47A 2EX2A 4BENA 4DDSA 3ZFZA 4OVDA 5FAQA 1K55C 4QY6A 2ZLYA 4P87A 3G32A 3PAGA 3MZDA 4OPZA 3ZDJA 3V3SA 1LLBA 2X71A 3GV9A 1WYBA 1PW1A 1N9BA 3G34A 4N1HA 1NJ4A 3ZG0A 3OPLA 4N9KA 1NRFA 2H5SA 5TR7A 3NY4A 4WMCA 3QNCA 2EFXA 3VFFA 5CGSA 4S2NC 3WRTA 1XKZA 4OPYA 4U3TA 4HESA 4EQIA 3IXGA 1IKIA 3BM6A 4KZ9A 4OQHA 1K6SA 3VP2A 5HAQA 2ZQ9A 3MKEA 2A49A 2IWDA 3P98A 3CG5A 2OLUA 1L0GA 4KZ3A 2ZQDA 3O86A 1JVJA 4JF5A 1DJAA 1BSGA 2ZM0A 1KVMA 4EBNA 2EX8A 4DDYA 3IQAA 3BLMA 4JPMA 4LCMA 4N92A 2WGVA 2ZM8A 1N4OA 4F94A 4QD4A 1FCOA 2ZJ9A 1LL5A 3HUNA 1W5DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TG9 A;  4MBH A;  4KZB A;  3RXX A;  4BL2 A;  3UPO A;  1SKF A;  2P74 A;  1L2S A;  3CJM A;  3IXH A;  5CHM A;  5A91 A;  2I72 A;  3CZD A;  4GNU A;  4R3B A;  4WMC D;  1XA7 A;  5EVL A;  3OCN A;  1KE3 A;  3IH8 A;  2ZQC A;  4YIN A;  5DF8 A;  1VQQ A;  3LY4 A;  3GQZ A;  5CGW A;  1YT4 A;  1CEG A;  1MWT A;  1HTZ A;  2EXB A;  5DTS A;  4MEZ A;  1G68 A;  2Y2Q A;  5CTN A;  1TDL A;  1KE0 A;  2P9V B;  3E2L A;  1J9M A;  1E4D A;  1K54 A;  3LO7 A;  1LHY A;  4IVI A;  4EV4 A;  4WEJ A;  1G6A A;  3VSL A;  1LI0 A;  1TEM A;  5BOH A;  3ZCZ A;  3RXW A;  3PBS A;  5FQ9 A;  5EE8 A;  4GDN A;  1IYO A;  3O87 A;  2Y91 A;  3A3F A;  1K38 A;  1K25 A;  3SH9 A;  3ZNY A;  5DF9 A;  4WEK A;  3HLB A;  3C4P A;  5CEC A;  3QHY A;  4GZB A;  3S4X A;  1WE4 A;  4DE1 A;  1ES3 A;  1JWZ A;  3UDI A;  1BUE A;  3BFF A;  3BLS A;  4S2O A;  2Y59 A;  1FOF A;  4GB7 A;  5GLC A;  1ONH A;  4KZ4 A;  1DY6 A;  5M19 A;  1FSY A;  4X69 A;  1KDS A;  3LY3 A;  4YFM A;  3UE1 A;  3PTE A;  2V2F F;  1I2W A;  2ZM2 A;  3ITB A;  3Q7Z A;  4BLM A;  3N8S A;  4MNR A;  4X68 A;  3Q7V B;  2WGW A;  3BFD A;  3G4P A;  3A3I A;  4U0T A;  2BLS A;  1KDW A;  4L0L A;  5EOE A;  1MWU A;  3VP4 A;  4DE0 A;  3WS1 A;  3FV7 A;  1ONG A;  3PBQ A;  1HVB A;  1SDN A;  3NC8 A;  4OP8 A;  4BD1 A;  2DRW A;  5FQK A;  2RL3 A;  3C4O A;  3UY6 A;  4N1X A;  1ES2 A;  4ZAM A;  1TDG A;  1PZO A;  2IWC A;  3GR2 A;  1S0W A;  3OZH A;  4JKT A;  5E2G A;  3HLD A;  3N6I A;  4K0W A;  4LV2 A;  4X6T A;  3W8K A;  4PPR A;  3E2K A;  4DE3 A;  5FA7 A;  1JWV A;  3NIA A;  3PAE A;  2XFS A;  1PWD A;  3FKW A;  2WAE A;  3G35 A;  3MZF A;  1W7F A;  1KGG A;  3IF6 B;  4BD0 A;  5FAT A;  3VP1 A;  2JC7 A;  3EQU A;  1K4F A;  4ZDX A;  4KZ5 A;  5GL9 A;  3AGF A;  3IF5 A;  1NZO A;  4MBF A;  3HLG A;  2Y2O A;  1KE4 A;  3WWX A;  1K6R A;  1YLT A;  3AGD A;  5KSC A;  3IWQ A;  4IBX A;  2H0T A;  4S2P A;  4R4S A;  1RGY A;  4R4R A;  3IWO A;  1Q2P A;  1ZKJ A;  3G30 A;  4DRT A;  3OPR A;  3W4P A;  2XD5 A;  4O7D A;  3BFC A;  4OPR A;  3Q7V A;  3V39 A;  2H0Y A;  4FH4 A;  4PMA A;  2WKI A;  2WAF A;  2EFU A;  4OKP A;  4JXS A;  2HDS A;  1XA1 A;  5AQA A;  5DTK A;  1BZA A;  5DTT A;  4E6W A;  3OCL A;  1YLP A;  2ZQ7 A;  5DVA A;  5E43 A;  4Y0T A;  1YMX A;  3PBN A;  4RVA A;  2V1Z A;  2ZC6 B;  4P85 A;  2G2U A;  1YLZ A;  5JYO A;  4FSF A;  2FFF B;  1ESI A;  1BLS A;  2OV5 A;  1Y54 A;  5HW3 A;  2ZD8 A;  3UN7 A;  2JCH A;  1XGI A;  4KZ8 A;  3ITA A;  3GSG A;  4R1G A;  4X55 A;  3GRJ A;  4RYE A;  1ES5 A;  2HDQ A;  5I94 A;  1S6R A;  1K57 C;  1KGE A;  5M1A A;  4JF6 A;  3MFD A;  3ZG5 A;  1TVF A;  4DXC A;  4IBR A;  3Q81 A;  2J8Y A;  3VOY A;  2Y2I A;  3V3R A;  5E2H A;  4HEF A;  5FAP A;  2R9W A;  5CRF A;  4WZ5 C;  3OC2 A;  1PW8 A;  4JLF A;  2FFY A;  3HLW A;  5A93 A;  3BEB A;  3MXR A;  3B3X A;  4S2L A;  2Y2J A;  1K56 A;  4PM9 A;  1EI5 A;  3HL9 A;  4QJG A;  2EX6 A;  3VSK A;  1L0E A;  1SCW A;  3W4Q A;  1FR1 A;  3N4I A;  4WZ4 A;  3ZHH A;  3UE3 A;  4GKU A;  5IHV A;  3JYI A;  4XUZ A;  4C6Y A;  5J8X A;  1JWP A;  1H5X A;  2G2W A;  1XPB A;  3FKV A;  4Y0U A;  4OLD A;  1HZO A;  1BTL A;  3OPH A;  3PBR A;  4GOG A;  2OSU A;  5EVI B;  4K0X A;  2Y2M A;  5HAR A;  3IWI A;  3P09 A;  5EOO A;  2JBF A;  1YQS A;  4KG5 A;  2QZ6 A;  3C7U A;  4EBL A;  3SH7 A;  1W79 A;  4B88 A;  2UWX A;  1FSW A;  2PU4 A;  2B5R A;  1RGZ A;  4QB8 A;  1IYQ A;  4OPQ A;  2WGI A;  3AGE A;  1JTG A;  4HBU A;  4Q8I A;  4WYY A;  2XH9 A;  5TGF A;  4LV1 A;  5FAS A;  4PM5 A;  3BYD A;  4ZJ3 A;  1YLY A;  1QME A;  4DKI A;  1Z6F A;  3M2J A;  4GDB A;  1WYC A;  1C3B A;  1K54 C;  5GLA A;  4EUZ A;  1PZP A;  2XK1 A;  1IEL A;  4KEN B;  4KQQ A;  2C5W B;  1VM1 A;  2DNS A;  4MBK A;  2XF3 A;  1DJC A;  1RCJ A;  3G31 A;  1E25 A;  1MPL A;  2C6W B;  2XD1 A;  3PBT A;  4UA9 A;  5CGX A;  3EQV A;  3SOI A;  3VOZ A;  4UA6 A;  4OQ0 A;  1ZG6 A;  5AQB A;  3GTC A;  3N7W A;  3UPN A;  3M6B A;  4Y0O A;  5M18 A;  4GN2 A;  4KG2 A;  4OLG A;  1YMS A;  2XR0 A;  5F83 A;  3SS4 A;  3ISG A;  1KGF A;  4QU3 A;  2XDM A;  2Y2K A;  1GHP A;  4KZ7 A;  4X56 A;  1MXO A;  5CHJ A;  5D3O A;  1E3U A;  1FR6 A;  3G2Z A;  3OPP A;  2WK0 A;  4ZJ1 A;  1GA0 A;  2OLV A;  4Z9Q A;  4LV0 A;  4E3M A;  2PU2 A;  2R9X A;  2HP5 A;  4NK3 A;  3MXS A;  1FCN A;  4OON A;  5FI2 A;  5GLD A;  1OME A;  1CK3 A;  3UE0 A;  1O07 A;  1IYS A;  3TSG A;  3ZNT A;  4E3J A;  2WAD A;  1O7E A;  1NY0 A;  2XQZ A;  1M40 A;  4RX2 A;  4UHU A;  4WM9 A;  2J7V A;  1MWS A;  4S2J A;  1JTD A;  4S2N A;  2HDR A;  2WKH A;  1HD8 A;  3BFG A;  1BLC A;  2Y4A A;  4E3N A;  1YLJ A;  3HUO A;  3S22 A;  1GA9 A;  2PBY A;  3W4O A;  2ZC4 B;  4H8R A;  2HDU A;  2Q9N A;  4RA7 A;  4CPK A;  4Y7P A;  1FQG A;  2VGJ A;  3C5A A;  4IVK A;  3UDX A;  2EXA A;  3HLE A;  4E3K A;  2WYX A;  3HRE A;  5F82 A;  1KVL A;  4JXV A;  3M2K A;  4ZBE A;  1ZG4 A;  3Q82 A;  4R23 A;  1GHM A;  4GD8 A;  5F1F A;  3ZVW A;  4JF4 A;  1SDE A;  4FH2 A;  2XGN A;  3HLF A;  5FQQ A;  2J9P A;  2V20 A;  4OOM A;  4JXG A;  5FDH A;  1M6K A;  1YM1 A;  4U0X A;  3WS4 A;  3SS3 A;  5EEC A;  1XXM A;  3NI9 A;  3HLC A;  1ERM A;  4FD8 A;  5CTM A;  2GDN A;  1XX2 A;  5CXW A;  3V5M A;  2Z2M B;  1PWG A;  3O88 A;  5KZH A;  3WS5 A;  4KG6 A;  4S2I A;  1W8Y A;  1H8Y A;  3HVF A;  1H8Z A;  5HL1 A;  4UA7 A;  5HAP A;  4JBF A;  1NYM A;  3IH9 A;  1IEM A;  2H10 A;  1K55 A;  5FI7 A;  3IHA A;  4RX3 A;  1LL9 A;  1CEF A;  1XP4 A;  5FAO A;  4BQM A;  3NDE A;  4ZJ2 A;  2XLN A;  2Y2L A;  3S1Y A;  3LEZ A;  4NET A;  4QY5 A;  3ZGA B;  3DWK A;  4QHC A;  1AXB A;  2A3U A;  2WKE A;  1GHI A;  1I2S A;  1Q2Q A;  3GVB A;  2HP9 A;  4HBT A;  1W8Q A;  4OH0 A;  2Y2N A;  5AQ7 A;  5FQI A;  5E2F A;  2EX9 A;  4E3L A;  1NZU A;  4B4X A;  1IYP A;  2ZQA A;  3C7V A;  3BRM A;  1LI9 A;  1NYY A;  3NCK A;  5HFO A;  3UO9 A;  1QMF A;  5A90 A;  5CEB A;  1DJB A;  3O3V A;  5AQ9 A;  3UPP A;  2DCF A;  2XFT A;  5EVI C;  2WZZ A;  4C75 A;  5GHZ A;  4A5R A;  2Y2G A;  3BFE A;  4OP5 A;  4EBP A;  1ALQ A;  4K91 A;  2QPN A;  1PI4 A;  4M3K A;  2XEP A;  3V50 A;  1E3U D;  1L0D A;  5EVI D;  4OOY A;  5FSR A;  4D2O A;  4DE2 A;  3SH8 A;  5A92 A;  5EPH A;  3IHB A;  1BLH A;  3RJU A;  1EWZ A;  5FQM A;  2JE5 A;  4DXB A;  4KQR A;  4BL3 A;  4UAA A;  1ERO A;  4GD6 A;  2Y2H A;  4E3I A;  4XUX A;  2X01 A;  2HP6 A;  3A3D A;  5FI6 A;  4KZA A;  3IXD A;  1K57 A;  4B4Z A;  5HAI A;  5GHX A;  3IF6 C;  1L0F A;  4S2K A;  5GHY A;  3IXB A;  3VP0 A;  1I5Q A;  1IKG A;  1ES4 A;  2J9O A;  1PWC A;  4IED A;  4E3O A;  3TOI A;  5DF7 A;  4DF6 A;  3N8L A;  3WRZ A;  3BEC A;  3SS5 A;  5L2F A;  5HX9 A;  5EUA A;  5FQJ A;  2IWB A;  1PIO A;  2P9V A;  3ZG7 B;  1BLP A;  1FCM A;  2CC1 A;  3Q1F A;  4LEN A;  4LV3 A;  1CI9 A;  4R3J A;  5EVI A;  2E8I A;  3I7J A;  3G2Y A;  5KMW A;  4S2M A;  3DTM A;  4MLL A;  3PBO A;  1SHV A;  5JYP A;  4X53 A;  1RP5 A;  4ID4 A;  1CI8 A;  3UDF A;  3HUM A;  3VP3 A;  4PM7 A;  4C3Q A;  3MKF A;  4KZ6 A;  4WEL A;  3IT9 A;  3MZE A;  3IF6 A;  4PM6 A;  2ZC5 B;  2BG1 A;  3ZVT A;  2RCX A;  3DW0 A;  3N8R A;  3QNB A;  3FWL A;  3DWZ A;  4LCL A;  4PM8 A;  1PYY A;  4OQG A;  4BJP A;  4FCF A;  1K4E A;  1MWR A;  3HBR A;  5KSH A;  3LCE A;  2WGW B;  3WS2 A;  1K56 D;  2WUQ A;  3FZC A;  3CMZ A;  4OOL A;  2ZC7 A;  1XGJ A;  3M6H A;  3MBZ A;  5F1G A;  3VFH A;  1BUL A;  1ESU A;  2WZX A;  1PI5 A;  3A3J A;  5CHU A;  4R0Q A;  3ZG9 B;  3D4F A;  1ZC2 A;  1MY8 A;  2Y55 A;  5CED A;  3NBL A;  1BT5 A;  1YLW A;  4CJN A;  1GCE A;  3NDG A;  3FYZ A;  4KQO A;  4XXR A;  2ZQ8 A;  4EWF A;  4WBG A;  1U60 A;  3Q07 A;  4OQI A;  3VMA A;  5GLB A;  3WS0 A;  1ERQ A;  5CER A;  3UNW A;  2Y2P A;  4ZTK A;  1MKI A;  2Q9M A;  2QMI A;  4P6B A;  2Z2L B;  2VGK A;  5TFQ A;  5G18 A;  3ZG8 B;  5E2E A;  3A3E A;  1NXY A;  2X02 A;  3GMW A;  2ZMA A;  1MBL A;  4JXW A;  2ZC3 B;  4P0M A;  2HPB A;  4N9L A;  4WZ5 A;  4E6X A;  5U47 A;  2EX2 A;  4BEN A;  4DDS A;  3ZFZ A;  4OVD A;  5FAQ A;  1K55 C;  4QY6 A;  2ZLY A;  4P87 A;  3G32 A;  3PAG A;  3MZD A;  4OPZ A;  3ZDJ A;  3V3S A;  1LLB A;  2X71 A;  3GV9 A;  1WYB A;  1PW1 A;  1N9B A;  3G34 A;  4N1H A;  1NJ4 A;  3ZG0 A;  3OPL A;  4N9K A;  1NRF A;  2H5S A;  5TR7 A;  3NY4 A;  4WMC A;  3QNC A;  2EFX A;  3VFF A;  5CGS A;  4S2N C;  3WRT A;  1XKZ A;  4OPY A;  4U3T A;  4HES A;  4EQI A;  3IXG A;  1IKI A;  3BM6 A;  4KZ9 A;  4OQH A;  1K6S A;  3VP2 A;  5HAQ A;  2ZQ9 A;  3MKE A;  2A49 A;  2IWD A;  3P98 A;  3CG5 A;  2OLU A;  1L0G A;  4KZ3 A;  2ZQD A;  3O86 A;  1JVJ A;  4JF5 A;  1DJA A;  1BSG A;  2ZM0 A;  1KVM A;  4EBN A;  2EX8 A;  4DDY A;  3IQA A;  3BLM A;  4JPM A;  4LCM A;  4N92 A;  2WGV A;  2ZM8 A;  1N4O A;  4F94 A;  4QD4 A;  1FCO A;  2ZJ9 A;  1LL5 A;  3HUN A;  1W5D A; 
#chains in the Genus database with same CATH topology
 3TG9 A;  3TJZ C;  3CJM A;  5CHM A;  3IXH A;  1XA7 A;  1KE3 A;  3IH8 A;  2PT7 A;  3LY4 A;  4UQI M;  5CGW A;  1YT4 A;  4HP4 A;  2EXB A;  5DTS A;  2Y2Q A;  3LO7 A;  1E4D A;  4EV4 A;  1G6A A;  1LI0 A;  1TEM A;  4CLC D;  5HPI A;  3ZCZ A;  2QKP A;  4GDN A;  3UE6 A;  2Y91 A;  1IOU A;  1SZV A;  2DMW A;  1K38 A;  1K25 A;  3ZNY A;  5DF9 A;  4UEY A;  3S4X A;  3MJQ A;  1WE4 A;  3MMH A;  4DE1 A;  2PR5 A;  4JGR A;  4YFM A;  3UE1 A;  2V2F F;  4BBV A;  2HZ5 A;  4MNR A;  4U0T A;  3VP4 A;  4O01 A;  1HVB A;  2DRW A;  3C4O A;  1ES2 A;  4ZAM A;  3GR2 A;  3OZH A;  4JKT A;  5E2G A;  4R38 A;  1D06 A;  3HLD A;  4X6T A;  4PPR A;  3EGD C;  3BQA A;  4DE3 A;  3PAE A;  3FKW A;  4P6Z M;  3IF6 B;  4X25 A;  2Y79 A;  3EQU A;  2B95 A;  4ZDX A;  4KZ5 A;  3AGF A;  3D72 A;  4MBF A;  2OAQ 1;  2Y2O A;  1KE4 A;  3F1N B;  2FH5 A;  3IBJ A;  4S2P A;  1RGY A;  1TF1 A;  4R4R A;  3OPR A;  2Z6C A;  3W4P A;  1CF0 A;  3V39 A;  3VV4 A;  3NHQ A;  3QP4 A;  4G3W A;  2WAF A;  4JXS A;  1XA1 A;  5DTT A;  4E6W A;  3OCL A;  2VX8 A;  4NEE D;  3PBN A;  2V1Z A;  4HI4 A;  4IUH A;  1ESI A;  1Y54 A;  3ITA A;  4NXB A;  3P01 A;  2V8C A;  1S6R A;  2VGL M;  1TVF A;  2HJE A;  1OTB A;  2J8Y A;  3VOY A;  1W63 M;  5CRF A;  3U2A A;  1EW0 A;  4JLF A;  1VEU B;  3MXR A;  3B3X A;  2W3F A;  4QJG A;  3HL9 A;  3BJN A;  1L0E A;  1SCW A;  3N4I A;  3JYI A;  4C6Y A;  2G2W A;  3FKV A;  4BBT A;  4OLD A;  4GOG A;  5EVI B;  2OSU A;  2Y2M A;  4KG5 A;  4EBL A;  3RFB A;  2PU4 A;  4QB8 A;  1IYQ A;  3AGE A;  4WYY A;  2Z6D A;  3LUQ A;  4PM5 A;  3BYD A;  4ZJ3 A;  3MF0 A;  2MJ6 A;  4GDB A;  1X0O A;  4WLA A;  3GEC A;  4YNR A;  4KQQ A;  2DNS A;  3PBT A;  3VOZ A;  2XD1 A;  3CWF A;  5CGX A;  4EET B;  4UA6 A;  1ZG6 A;  3GTC A;  3N7W A;  1PFL A;  4Y0O A;  4IUK A;  3S7N A;  2XR0 A;  1KGF A;  2Y2K A;  1OTE A;  3OPP A;  2WK0 A;  2OLV A;  2HP5 A;  3VE4 A;  1XJ2 A;  3LIB A;  2ZOI A;  3EWK A;  1TS8 A;  3E0Y A;  3MSH A;  1AWI A;  4PKY A;  2J7V A;  4HY8 A;  4S2J A;  4S2N A;  2HDR A;  4GHI B;  2Y4A A;  2VKS A;  5DKK A;  1F9I A;  1YLJ A;  2QHK A;  1GA9 A;  3W4O A;  2ZC4 B;  2WKP A;  3F1P B;  1FQG A;  3UDX A;  3C5A A;  3HLE A;  4E3K A;  1KVL A;  4JXV A;  4LFU A;  1GHM A;  3ZVW A;  1NLY A;  4QPR A;  2V20 A;  4JXG A;  3NI9 A;  4FD8 A;  2GDN A;  1XX2 A;  2A24 B;  2L0W A;  3V5M A;  2XRO A;  3CAX A;  4GW9 A;  4KG6 A;  1XJ6 A;  3H7W A;  4WL9 A;  3IH9 A;  4Q0J A;  3A0R A;  5FI7 A;  3IHA A;  3QP2 A;  5FAO A;  3NDE A;  2XLN A;  2Y2L A;  3C38 A;  4QHC A;  1AXB A;  3GVB A;  1GHI A;  1Q2Q A;  3T1R A;  5AQ7 A;  4E3L A;  2ZQA A;  3A0V A;  4HNB A;  3O3V A;  4LGW A;  2DCF A;  2GZA A;  2XFT A;  2WZZ A;  3QP5 A;  4K91 A;  2QPN A;  1E3U D;  1L0D A;  5EVI D;  4D2O A;  3LIE A;  2HJ9 C;  1ERO A;  3UME A;  4KQD A;  2HP6 A;  3A3D A;  3FPV A;  5GHX A;  1L0F A;  5GHY A;  1ES4 A;  3EOI A;  3N8L A;  3WRZ A;  3MS6 A;  5L2F A;  2O9A A;  2IWB A;  3ZG7 B;  1BLP A;  2VV6 A;  3Q1F A;  5EVI A;  1HLU P;  3G2Y A;  5KMW A;  3LID A;  3MQO A;  1RP5 A;  5L07 A;  4FOF A;  4FUW A;  3IT9 A;  3MZE A;  5K5B A;  2BG1 A;  4Y13 A;  3N8R A;  1K0K A;  1N9L A;  1DP8 A;  2VGL S;  4R3A A;  4OQG A;  1XFN A;  1K4E A;  1MWR A;  3HBR A;  4MMN A;  4Y15 A;  3WS2 A;  3FZC A;  4OOL A;  3MBZ A;  5HWT A;  2PAV P;  3QP8 A;  3MXQ A;  3NBL A;  3NDG A;  2B18 A;  2ZQ8 A;  1U60 A;  4OQI A;  5GLB A;  3UNW A;  2PBD P;  2Z2L B;  2O9C A;  2VK3 A;  5G18 A;  3IBR A;  1NXY A;  2X02 A;  2ZC3 B;  4JGP A;  2EA9 A;  4BEN A;  4MCW A;  4BWI A;  2M7V A;  4P87 A;  3LIF A;  4ESP A;  3ZDJ A;  3V3S A;  2M7U A;  3F1N A;  2H5S A;  3NY4 A;  4I39 A;  3QNC A;  3UB9 A;  4P6Z S;  5CGS A;  4HHD A;  4EQI A;  4HES A;  3BY9 A;  4EU0 A;  1K6S A;  2ZQ9 A;  2A49 A;  3P98 A;  3CG5 A;  1S1Y A;  1T1A A;  1DJA A;  4R6L A;  1BSG A;  4LCM A;  5I5L A;  4F94 A;  3IX3 A;  4QD4 A;  1FCO A;  3HUN A;  3F1P A;  1W5D A;  4I5S A;  3E98 A;  1ZHH B;  5TBM A;  4BL2 A;  1SKF A;  1L2S A;  3MQQ A;  1LSW A;  2I72 A;  3CZD A;  2JHE A;  2ZQC A;  3T4L A;  3MFX A;  1VQQ A;  1N9O A;  1MWT A;  1HTZ A;  1GSV A;  3QP6 A;  4MEZ A;  1G68 A;  1TDL A;  3F1O A;  3T4J A;  1KE0 A;  3E2L A;  1J9M A;  1K54 A;  4IVI A;  2QJ5 A;  3KSG A;  4L9E A;  1IYO A;  3NJA A;  4WEK A;  3CI6 A;  1GSW A;  2VEA A;  3FG8 A;  3UDI A;  2O0Y A;  2Y59 A;  1FOF A;  3CUE A;  4GB7 A;  4S2O A;  1ONH A;  5M19 A;  4X69 A;  1KDS A;  2Q0O A;  2ZM2 A;  3ITB A;  3G4P A;  4EEU A;  3A3I A;  1MWU A;  1TS6 A;  1ONG A;  4OP8 A;  1SDN A;  3NC8 A;  3L9K A;  5FQK A;  2RL3 A;  4N1X A;  3LGO A;  1TDG A;  1PZO A;  3T4S A;  3MQ0 A;  1JNU A;  5MC7 A;  3N6I A;  4PHT A;  3B33 A;  3DTK A;  3E2K A;  2HV1 A;  1JWV A;  2V0U A;  1PWD A;  3MZF A;  1KGG A;  4BD0 A;  5FAT A;  3VP1 A;  3LR4 A;  2JC7 A;  2VZW A;  5GL9 A;  4JGQ A;  3E4O A;  1NZO A;  3IF5 A;  2WKR A;  3S7Q A;  2VV8 A;  2KOI A;  5L8M A;  1Q2P A;  1ZKJ A;  3G30 A;  4DRT A;  3Q7V A;  1STZ A;  4FH4 A;  1S4S A;  4PMA A;  1T1B A;  4OKP A;  1BZA A;  3DTE A;  1ZTU A;  2ZQ7 A;  4Y0T A;  1YKD A;  1YMX A;  2G2U A;  3IS2 B;  1YLZ A;  2FFF B;  1F2K A;  2JKR M;  2ZD8 A;  3UN7 A;  4KZ8 A;  3GSG A;  4X55 A;  3GRJ A;  1KGE A;  4JF6 A;  3MFD A;  1NWZ A;  3ZG5 A;  4DXC A;  3Q81 A;  4GS9 B;  3CLO A;  5KIZ A;  2R9W A;  1PW8 A;  2V1A A;  5A93 A;  2Y2J A;  1EI5 A;  4YWZ A;  4ETX A;  4WZ4 A;  1V9Z A;  3PHY A;  5A8B A;  1BTL A;  5HL6 A;  4K0X A;  5J4E A;  1YQS A;  2QZ6 A;  3C7U A;  3SH7 A;  2UWX A;  3U4L P;  4K08 A;  2B5R A;  2YKF A;  1RGZ A;  4OPQ A;  2WGI A;  1JTG A;  3BQ8 A;  4LV1 A;  5TGF A;  2JN7 A;  1TS0 A;  1C3B A;  1H0M A;  1J3W A;  2XK1 A;  5AJG A;  4KEN B;  2C5W B;  1E25 A;  4UA9 A;  3EQV A;  3SOI A;  3UPN A;  4O0P A;  5F83 A;  3SS4 A;  4X56 A;  1H3Q A;  1E3U A;  3E4Q A;  3G2Z A;  1GA0 A;  4Z9Q A;  2PU2 A;  4OON A;  1FCN A;  5GLD A;  4X1M A;  1O07 A;  1IYS A;  3TSG A;  3ZNT A;  1O7E A;  1NY0 A;  1M40 A;  4UHU A;  1JTD A;  2WKH A;  3T50 A;  5IT5 A;  3S22 A;  3HUO A;  1MC0 A;  3KYQ A;  2PBY A;  3D9Y A;  4HH2 A;  3SW1 A;  2VGJ A;  4IVK A;  3DTI A;  3HRE A;  1ZG4 A;  3Q82 A;  1LT0 A;  4GD8 A;  5F1F A;  1SDE A;  3NOU C;  4HH3 A;  4HJ3 A;  1M6K A;  4RQ9 A;  5CTM A;  2INW A;  5CXW A;  1PWG A;  5KZH A;  4B9O A;  3PXP A;  2K7S A;  3OLO A;  2LB9 A;  4MDZ A;  1K55 A;  2K2N A;  3DAV A;  3G6O A;  4AFI A;  5C5K A;  4FTX A;  4BQM A;  1DRM A;  2PR6 A;  3LEZ A;  4NET A;  3DWK A;  2WKE A;  2HP9 A;  2R78 A;  3C7V A;  1P0Z A;  1LI9 A;  1NYY A;  3NCK A;  3UO9 A;  1XFQ A;  5CEB A;  5HPF A;  4CLC A;  3UPP A;  2V9A A;  5FSR A;  5A92 A;  3IHB A;  4X1L A;  5FQM A;  4UAA A;  4GD6 A;  4KZA A;  4L9F A;  4B4Z A;  2L4R A;  4S2K A;  5HDD A;  1CJF A;  4Z1W A;  4LRX C;  2J9O A;  2H28 A;  1LL8 A;  1PWC A;  4E3O A;  2BTF P;  1OTI A;  1XJ4 A;  3O5Y A;  3SS5 A;  4B93 A;  2CC1 A;  3LIC A;  1CI9 A;  3LEQ A;  2E8I A;  4JGO A;  3DTM A;  4MLL A;  2A24 A;  4R70 A;  5JYP A;  4E04 A;  3VP3 A;  4I3J A;  4PM6 A;  4Y2F A;  1YSP A;  3ZVT A;  3QNB A;  4YOF A;  4LCL A;  1PYY A;  4BJP A;  3LCE A;  1K56 D;  3M6H A;  1ESU A;  2WZX A;  1PI5 A;  1LSX A;  4I38 A;  1MY8 A;  4HQA A;  1YLW A;  1BT5 A;  4CJN A;  2LB5 A;  2PHY A;  3FYZ A;  4XXR A;  3C8C A;  3WS0 A;  1OT6 A;  3UB8 A;  4ZTK A;  1MKI A;  1NLZ A;  4P6B A;  3LR0 A;  1NRJ A;  3A3E A;  3GMW A;  3H82 B;  2HPB A;  4DDS A;  3ZFZ A;  2W1T A;  2O9B A;  4I3A A;  3EEA A;  5FAQ A;  2NUP C;  3OOV A;  3PAG A;  4OPZ A;  3GV9 A;  1PW1 A;  3OPL A;  2EFX A;  1T18 A;  5L10 A;  4S2N C;  3WRT A;  4U3T A;  4EW7 A;  3IXG A;  3KSH A;  1IKI A;  3MKE A;  2IWD A;  1L0G A;  2ZQD A;  3O86 A;  3W2Z A;  4EBN A;  1G5U A;  3BLM A;  2QWS A;  1N4O A;  2PD8 A;  1LL5 A;  2JKT I;  4MBH A;  3RXX A;  2P74 A;  1VET B;  2VA0 A;  4GNU A;  5EVL A;  4YIN A;  5DF8 A;  3GQZ A;  4CLC E;  1LHY A;  3LYX A;  3TRC A;  4WEJ A;  2GJ3 A;  2J80 A;  3RXW A;  3UB7 A;  3O87 A;  2YKH A;  3A3F A;  1LSV A;  3HLB A;  5CEC A;  3QHY A;  4GZB A;  3GDI A;  1ES3 A;  1BUE A;  3BFF A;  4KZ4 A;  1DY6 A;  3CHW P;  3LY3 A;  3PTE A;  3R7W B;  3Q7Z A;  4BLM A;  5G4Y A;  3N8S A;  4X68 A;  5HZH A;  2BLS A;  1KDW A;  3IX4 A;  4DE0 A;  3WS1 A;  2VJW A;  1ACF A;  4BD1 A;  2PDR A;  3UY6 A;  3KYE A;  2W1R A;  2J3T D;  5HD3 A;  1VHM A;  3NIA A;  1T19 A;  2XFS A;  2WAE A;  3G35 A;  1VB6 A;  2O99 A;  1K4F A;  3NOP C;  1K6R A;  4MN6 A;  2FZ0 A;  3AGD A;  5KSC A;  3IWQ A;  4IBX A;  5IS1 A;  3R4K A;  4R4S A;  4BBU A;  3IWO A;  2XD5 A;  3BFC A;  2H0Y A;  3EEH A;  2XA7 M;  2EFU A;  3R7W A;  5AQA A;  5DTK A;  3KYZ A;  3ULF A;  5DJU A;  1YLP A;  1OTA A;  2BAS A;  5DVA A;  3QP1 A;  2P7J A;  5JYO A;  2W1T B;  4FSF A;  2OV5 A;  1BLS A;  1XGI A;  4G3K A;  1PRQ A;  4R1G A;  4RYE A;  1ES5 A;  5I94 A;  1K57 C;  3LR5 A;  3HJI A;  4IBR A;  4EES A;  3V3R A;  4IJG A;  4HEF A;  5FAP A;  4WZ5 C;  4NXG A;  3OC2 A;  3PYP A;  2OOL A;  3HLW A;  4S2L A;  1K56 A;  4PM9 A;  5J3W A;  3VSK A;  3ZQ5 A;  2OAP 1;  3B42 A;  3CUE C;  3ZHH A;  3UE3 A;  5J8X A;  1JWP A;  2GNX A;  5HAR A;  1F5M A;  3T4T A;  3P09 A;  2J3T C;  4B88 A;  5HSQ A;  4HOI A;  3BWL A;  1YLY A;  1Z6F A;  4NKP A;  1K54 C;  1SKO B;  5GLA A;  2JKF A;  1IEL A;  1VM1 A;  4MBK A;  1DJC A;  1RCJ A;  2ACG A;  2XF3 A;  1MPL A;  3G31 A;  5AQB A;  4OQ0 A;  3M6B A;  4GN2 A;  4OLG A;  1YMS A;  3ISG A;  2XDM A;  3T4Q A;  5IU1 A;  4ZJ1 A;  3SZT A;  4LV0 A;  4E3M A;  3HCY A;  4GJ4 A;  4O8G A;  4UQI S;  2P04 A;  4GS9 A;  2WAD A;  2XQZ A;  4MN5 A;  5AVF A;  4XT2 B;  1BLC A;  4CLC B;  3D3O A;  3OBF A;  2V1B A;  4H8R A;  4LPZ A;  4RA7 A;  4Y7P A;  1V9Y A;  2EXA A;  2NUT C;  5DJT A;  2WYX A;  4ZBE A;  4NXE A;  2EWW A;  3HLF A;  5FQQ A;  2D01 A;  5EV0 A;  4Y3I A;  3WS4 A;  3SS3 A;  2Z2M B;  4S2I A;  1W8Y A;  1H8Y A;  3HVF A;  1H8Z A;  5HL1 A;  2PYR A;  4JBF A;  1NYM A;  5FEG A;  2H10 A;  4LRZ E;  1VEU A;  2B02 A;  3S1Y A;  4GHI A;  5CX7 A;  1W8Q A;  4OH0 A;  2Y2N A;  5FQI A;  2EX9 A;  1NZU A;  3BRM A;  4WF0 A;  5A90 A;  5TJJ A;  2OWJ A;  1ODV A;  2JKR I;  3BW6 A;  5AQ9 A;  5EVI C;  5GHZ A;  3BFE A;  4EBP A;  1ALQ A;  4F3L A;  4CLC C;  4ZRR A;  4ME4 A;  4DE2 A;  1UWP X;  2D02 A;  2UV0 E;  3RJU A;  1EWZ A;  4DXB A;  4BL3 A;  1H8M A;  2X01 A;  5FI6 A;  3IXD A;  3CPT B;  3IF6 C;  5EVE A;  1IKG A;  2K31 A;  4IED A;  2EWV A;  3TOI A;  5DF7 A;  4DJ2 A;  4CQH A;  3BEC A;  3VE3 A;  2P9V A;  1PNE A;  3F1O B;  1FCM A;  4LV3 A;  4R3J A;  3I7J A;  3T4K A;  3TW8 A;  4S2M A;  5DKL A;  2ZBB A;  3UB6 A;  3UDF A;  3MKF A;  4KZ6 A;  2ZC5 B;  3DW0 A;  4Q0I A;  3FWL A;  3K3D A;  2PD7 A;  4FCF A;  3BY8 A;  3CMZ A;  3VFH A;  1MZU A;  1BUL A;  3A3J A;  1FIL A;  4R0Q A;  3ZG9 B;  1IFQ A;  2Y55 A;  5CED A;  1OJ5 A;  4KQO A;  4WBG A;  4DN0 A;  3Q07 A;  3RH8 B;  5CER A;  2Y2P A;  1P97 A;  5E2E A;  2ZMA A;  4JXW A;  4P0M A;  4DJ3 A;  4WZ5 A;  4E6X A;  2E8J A;  1UGU A;  3IS2 A;  3MR0 A;  2ZLY A;  3G32 A;  5J7E A;  3RTY A;  1LLB A;  2X71 A;  4N1H A;  1N9B A;  5FDS A;  4L9G A;  5TR7 A;  2PYP A;  5F69 A;  4KUK A;  1T1C A;  4OPY A;  5LBR A;  2JKG A;  3BM6 A;  4KZ9 A;  1D7E A;  3VP2 A;  2W0N A;  4KZ3 A;  1JVJ A;  4NXF A;  2ZM0 A;  1WA9 A;  2L1M A;  2EX8 A;  4DDY A;  3IQA A;  4JPM A;  4N92 A;  2WGV A;  2ZJ9 A;  3NEC A;  4HIA A;  4KZB A;  1L3L A;  3UPO A;  5A91 A;  4WMC D;  4R3B A;  3OCN A;  2W3D A;  1CEG A;  5CTN A;  2P9V B;  2P08 A;  3H9W A;  5DFX A;  3VSL A;  5BOH A;  1FIK A;  2JKT M;  3PBS A;  5EE8 A;  5FQ9 A;  3T1X A;  5F6A A;  5HWV A;  3SH9 A;  3C4P A;  4Y17 A;  2AVX A;  1YAX A;  1JWZ A;  1G6O A;  3BLS A;  2I9V A;  5GLC A;  1XJ3 A;  1FSY A;  2G7U A;  1I2W A;  3T1S A;  3Q7V B;  2WGW A;  3BFD A;  1YSQ A;  4L0L A;  5EOE A;  4Y5F A;  3FV7 A;  3S7P A;  3PBQ A;  2WKQ A;  1UWN X;  2IWC A;  1S0W A;  3IX8 A;  4EEP A;  4K0W A;  4LV2 A;  3W8K A;  3KSI A;  2HGV A;  2V0W A;  5FA7 A;  4H6J A;  1W63 Q;  2VLG A;  1S4R A;  5TBM B;  2XSS A;  1W7F A;  5EM0 A;  1GSX A;  2XRN A;  5F68 A;  3HLG A;  1S66 L;  3C30 A;  3WWX A;  1A0K A;  1YLT A;  3C2W A;  2OWH A;  2H0T A;  3E4P A;  4O7D A;  4OPR A;  2W3G A;  5G4Z A;  2WKI A;  2HDS A;  4Q0H A;  5E43 A;  4RVA A;  1OJG A;  2ZC6 B;  4P85 A;  2HF6 A;  5FL3 A;  5HW3 A;  3L7H A;  2JCH A;  4HJ6 A;  2HDQ A;  4GLQ A;  4LLO B;  5M1A A;  2ZMV A;  1OT9 A;  2Y2I A;  5E2H A;  1OPX A;  5DFY A;  1CQA A;  2FFY A;  3UMD A;  3BEB A;  2EX6 A;  4GCZ A;  1P9W A;  3CIT A;  4LRY C;  3W4Q A;  1FR1 A;  4GKU A;  5IHV A;  4XUZ A;  1H5X A;  3HJK A;  1XPB A;  4Y0U A;  5HAQ A;  1HZO A;  3OPH A;  3PBR A;  3JVU A;  3IWI A;  5EOO A;  2JBF A;  4QWO A;  1W79 A;  1FSW A;  2A2L A;  4HBU A;  4KUO A;  5F5Y A;  2XH9 A;  4Q8I A;  5FAS A;  4BMW A;  1QME A;  4DKI A;  3M2J A;  1WYC A;  3NOT C;  4EXO A;  4EUZ A;  1PZP A;  4EUV A;  2ZL1 B;  5HDC A;  2CMN A;  2C6W B;  5EFW A;  1OTD A;  5M18 A;  1N9N A;  4KG2 A;  4QU3 A;  5CHJ A;  1GHP A;  4KZ7 A;  1MXO A;  4HJ4 A;  5D3O A;  1FR6 A;  2R9X A;  4NK3 A;  4M4X A;  3MXS A;  5FI2 A;  3S7O A;  1OME A;  1CK3 A;  3UE0 A;  5AVE A;  3NUL A;  2KDK A;  4XT2 A;  4E3J A;  4RX2 A;  4WM9 A;  1MWS A;  5HWW A;  3BFG A;  1HD8 A;  2KX6 A;  4E3N A;  1VET A;  2HDU A;  2Q9N A;  4CPK A;  4IHQ A;  4PAU A;  5F82 A;  3M2K A;  4R23 A;  4JF4 A;  4FH2 A;  2XGN A;  2J9P A;  4OOM A;  5FDH A;  4U0X A;  1YM1 A;  5EEC A;  1XXM A;  4G3V A;  3LFV A;  3HLC A;  1ERM A;  2PRF A;  3O88 A;  1BYW A;  3UB5 P;  3WS5 A;  3ZYT A;  3H7W B;  3V67 A;  4UA7 A;  5HAP A;  4PKY G;  1F98 A;  1IEM A;  5EM1 A;  4EQ1 A;  4RX3 A;  1LL9 A;  1CEF A;  1XP4 A;  3T12 B;  4ZJ2 A;  1Y4O A;  1Y28 A;  2M1C A;  4ETZ A;  3DBA A;  3CPT A;  4QY5 A;  3ZGA B;  3ICY A;  3JPU A;  2A3U A;  4HBT A;  1I2S A;  3T1Q B;  3EGX C;  1G28 A;  5E2F A;  2KLI A;  4B4X A;  1IYP A;  5HFO A;  1QMF A;  1DJB A;  2IA2 A;  1TS7 A;  4C75 A;  4WUJ A;  4A5R A;  4EER A;  1YPR A;  2Y2G A;  2J3W A;  4OP5 A;  4F3L B;  1PI4 A;  4M3K A;  2XEP A;  3V50 A;  2QJ7 A;  4OOY A;  3LI9 A;  3SH8 A;  2W27 A;  1D1J A;  5EPH A;  3P7N A;  1BLH A;  4NG2 A;  2Y8H A;  2JE5 A;  4KQR A;  2VV7 A;  2Y2H A;  4E3I A;  4XUX A;  3LIA A;  1K57 A;  5HAI A;  4ARZ A;  3IXB A;  3VP0 A;  1MKM A;  4DF6 A;  3KX0 X;  1SKO A;  5HX9 A;  3B47 A;  5EUA A;  5FQJ A;  1PIO A;  2W3H A;  4LEN A;  1Z09 A;  3LI8 A;  1S1Z A;  4H6J B;  4HP9 A;  4ARZ B;  3PBO A;  1SHV A;  4X53 A;  2V8F A;  4ID4 A;  1CI8 A;  3HUM A;  4C3Q A;  4PM7 A;  4WEL A;  3IF6 A;  3PR6 A;  3FPW A;  5HDS A;  1S67 L;  2RCX A;  3JVV A;  3DWZ A;  3VOL A;  4PM8 A;  4MN7 A;  4D60 A;  2ZOH A;  5KSH A;  5HD5 A;  2WGW B;  3T4O A;  4DMZ A;  2WUQ A;  2ZC7 A;  1XGJ A;  5F1G A;  3KO6 A;  5CHU A;  2QYB A;  3D4F A;  1ZC2 A;  1GCE A;  4EWF A;  5FEF A;  3VMA A;  1ERQ A;  2Q9M A;  2QMI A;  2VGK A;  5TFQ A;  2W3E A;  3ZG8 B;  2GX5 A;  1MBL A;  3KSF A;  4N9L A;  5U47 A;  3TE8 A;  2EX2 A;  4OVD A;  3FC7 A;  1K55 C;  4QY6 A;  2ZL1 A;  3A0S A;  3H82 A;  3MZD A;  1WYB A;  3G34 A;  3K2N A;  3LR3 A;  1NJ4 A;  3ZG0 A;  1KOU A;  4N9K A;  3K3C A;  1NRF A;  4WN5 A;  4II7 A;  4WMC A;  3VFF A;  1P9R A;  1XKZ A;  2XA7 S;  2ZMF A;  4OQH A;  2OLU A;  1DP9 A;  4JF5 A;  1TD5 A;  1KVM A;  1DP6 A;  2ZM8 A;  5L09 A;  4I3I A;  1I5Q A; 
#chains in the Genus database with same CATH homology
 3TG9 A;  4MBH A;  4KZB A;  3RXX A;  4BL2 A;  3UPO A;  1SKF A;  2P74 A;  1L2S A;  3CJM A;  3IXH A;  5CHM A;  5A91 A;  2I72 A;  3CZD A;  4GNU A;  4R3B A;  4WMC D;  1XA7 A;  5EVL A;  3OCN A;  1KE3 A;  3IH8 A;  2ZQC A;  4YIN A;  5DF8 A;  1VQQ A;  3LY4 A;  3GQZ A;  5CGW A;  1YT4 A;  1CEG A;  1MWT A;  1HTZ A;  2EXB A;  5DTS A;  4MEZ A;  1G68 A;  2Y2Q A;  5CTN A;  1TDL A;  1KE0 A;  2P9V B;  3E2L A;  1J9M A;  1E4D A;  1K54 A;  3LO7 A;  1LHY A;  4IVI A;  4EV4 A;  4WEJ A;  1G6A A;  3VSL A;  1LI0 A;  1TEM A;  5BOH A;  3ZCZ A;  3RXW A;  3PBS A;  5FQ9 A;  5EE8 A;  4GDN A;  1IYO A;  3O87 A;  2Y91 A;  3A3F A;  1K38 A;  1K25 A;  3SH9 A;  3ZNY A;  5DF9 A;  4WEK A;  3HLB A;  3C4P A;  5CEC A;  3QHY A;  4GZB A;  3S4X A;  1WE4 A;  4DE1 A;  1ES3 A;  1JWZ A;  3UDI A;  1BUE A;  3BFF A;  3BLS A;  4S2O A;  2Y59 A;  1FOF A;  4GB7 A;  5GLC A;  1ONH A;  4KZ4 A;  1DY6 A;  5M19 A;  1FSY A;  4X69 A;  1KDS A;  3LY3 A;  4YFM A;  3UE1 A;  3PTE A;  2V2F F;  1I2W A;  2ZM2 A;  3ITB A;  3Q7Z A;  4BLM A;  3N8S A;  4MNR A;  4X68 A;  3Q7V B;  2WGW A;  3BFD A;  3G4P A;  3A3I A;  4U0T A;  2BLS A;  1KDW A;  4L0L A;  5EOE A;  1MWU A;  3VP4 A;  4DE0 A;  3WS1 A;  3FV7 A;  1ONG A;  3PBQ A;  1HVB A;  1SDN A;  3NC8 A;  4OP8 A;  4BD1 A;  2DRW A;  5FQK A;  2RL3 A;  3C4O A;  3UY6 A;  4N1X A;  1ES2 A;  4ZAM A;  1TDG A;  1PZO A;  2IWC A;  3GR2 A;  1S0W A;  3OZH A;  4JKT A;  5E2G A;  3HLD A;  3N6I A;  4K0W A;  4LV2 A;  4X6T A;  3W8K A;  4PPR A;  3E2K A;  4DE3 A;  5FA7 A;  1JWV A;  3NIA A;  3PAE A;  2XFS A;  1PWD A;  3FKW A;  2WAE A;  3G35 A;  3MZF A;  1W7F A;  1KGG A;  3IF6 B;  4BD0 A;  5FAT A;  3VP1 A;  2JC7 A;  3EQU A;  1K4F A;  4ZDX A;  4KZ5 A;  5GL9 A;  3AGF A;  3IF5 A;  1NZO A;  4MBF A;  3HLG A;  2Y2O A;  1KE4 A;  3WWX A;  1K6R A;  1YLT A;  3AGD A;  5KSC A;  3IWQ A;  4IBX A;  2H0T A;  4S2P A;  4R4S A;  1RGY A;  4R4R A;  3IWO A;  1Q2P A;  1ZKJ A;  3G30 A;  4DRT A;  3OPR A;  3W4P A;  2XD5 A;  4O7D A;  3BFC A;  4OPR A;  3Q7V A;  3V39 A;  2H0Y A;  4FH4 A;  4PMA A;  2WKI A;  2WAF A;  2EFU A;  4OKP A;  4JXS A;  2HDS A;  1XA1 A;  5AQA A;  5DTK A;  1BZA A;  5DTT A;  4E6W A;  3OCL A;  1YLP A;  2ZQ7 A;  5DVA A;  5E43 A;  4Y0T A;  1YMX A;  3PBN A;  4RVA A;  2V1Z A;  2ZC6 B;  4P85 A;  2G2U A;  1YLZ A;  5JYO A;  4FSF A;  2FFF B;  1ESI A;  1BLS A;  2OV5 A;  1Y54 A;  5HW3 A;  2ZD8 A;  3UN7 A;  2JCH A;  1XGI A;  4KZ8 A;  3ITA A;  3GSG A;  4R1G A;  4X55 A;  3GRJ A;  4RYE A;  1ES5 A;  2HDQ A;  5I94 A;  1S6R A;  1K57 C;  1KGE A;  5M1A A;  4JF6 A;  3MFD A;  3ZG5 A;  1TVF A;  4DXC A;  4IBR A;  3Q81 A;  2J8Y A;  3VOY A;  2Y2I A;  3V3R A;  5E2H A;  4HEF A;  5FAP A;  2R9W A;  5CRF A;  4WZ5 C;  3OC2 A;  1PW8 A;  4JLF A;  2FFY A;  3HLW A;  5A93 A;  3BEB A;  3MXR A;  3B3X A;  4S2L A;  2Y2J A;  1K56 A;  4PM9 A;  1EI5 A;  3HL9 A;  4QJG A;  2EX6 A;  3VSK A;  1L0E A;  1SCW A;  3W4Q A;  1FR1 A;  3N4I A;  4WZ4 A;  3ZHH A;  3UE3 A;  4GKU A;  5IHV A;  3JYI A;  4XUZ A;  4C6Y A;  5J8X A;  1JWP A;  1H5X A;  2G2W A;  1XPB A;  3FKV A;  4Y0U A;  4OLD A;  1HZO A;  1BTL A;  3OPH A;  3PBR A;  4GOG A;  2OSU A;  5EVI B;  4K0X A;  2Y2M A;  5HAR A;  3IWI A;  3P09 A;  5EOO A;  2JBF A;  1YQS A;  4KG5 A;  2QZ6 A;  3C7U A;  4EBL A;  3SH7 A;  1W79 A;  4B88 A;  2UWX A;  1FSW A;  2PU4 A;  2B5R A;  1RGZ A;  4QB8 A;  1IYQ A;  4OPQ A;  2WGI A;  3AGE A;  1JTG A;  4HBU A;  4Q8I A;  4WYY A;  2XH9 A;  5TGF A;  4LV1 A;  5FAS A;  4PM5 A;  3BYD A;  4ZJ3 A;  1YLY A;  1QME A;  4DKI A;  1Z6F A;  3M2J A;  4GDB A;  1WYC A;  1C3B A;  1K54 C;  5GLA A;  4EUZ A;  1PZP A;  2XK1 A;  1IEL A;  4KEN B;  4KQQ A;  2C5W B;  1VM1 A;  2DNS A;  4MBK A;  2XF3 A;  1DJC A;  1RCJ A;  3G31 A;  1E25 A;  1MPL A;  2C6W B;  2XD1 A;  3PBT A;  4UA9 A;  5CGX A;  3EQV A;  3SOI A;  3VOZ A;  4UA6 A;  4OQ0 A;  1ZG6 A;  5AQB A;  3GTC A;  3N7W A;  3UPN A;  3M6B A;  4Y0O A;  5M18 A;  4GN2 A;  4KG2 A;  4OLG A;  1YMS A;  2XR0 A;  5F83 A;  3SS4 A;  3ISG A;  1KGF A;  4QU3 A;  2XDM A;  2Y2K A;  1GHP A;  4KZ7 A;  4X56 A;  1MXO A;  5CHJ A;  5D3O A;  1E3U A;  1FR6 A;  3G2Z A;  3OPP A;  2WK0 A;  4ZJ1 A;  1GA0 A;  2OLV A;  4Z9Q A;  4LV0 A;  4E3M A;  2PU2 A;  2R9X A;  2HP5 A;  4NK3 A;  3MXS A;  1FCN A;  4OON A;  5FI2 A;  5GLD A;  1OME A;  1CK3 A;  3UE0 A;  1O07 A;  1IYS A;  3TSG A;  3ZNT A;  4E3J A;  2WAD A;  1O7E A;  1NY0 A;  2XQZ A;  1M40 A;  4RX2 A;  4UHU A;  4WM9 A;  2J7V A;  1MWS A;  4S2J A;  1JTD A;  4S2N A;  2HDR A;  2WKH A;  1HD8 A;  3BFG A;  1BLC A;  2Y4A A;  4E3N A;  1YLJ A;  3HUO A;  3S22 A;  1GA9 A;  2PBY A;  3W4O A;  2ZC4 B;  4H8R A;  2HDU A;  2Q9N A;  4RA7 A;  4CPK A;  4Y7P A;  1FQG A;  2VGJ A;  3C5A A;  4IVK A;  3UDX A;  2EXA A;  3HLE A;  4E3K A;  2WYX A;  3HRE A;  5F82 A;  1KVL A;  4JXV A;  3M2K A;  4ZBE A;  1ZG4 A;  3Q82 A;  4R23 A;  1GHM A;  4GD8 A;  5F1F A;  3ZVW A;  4JF4 A;  1SDE A;  4FH2 A;  2XGN A;  3HLF A;  5FQQ A;  2J9P A;  2V20 A;  4OOM A;  4JXG A;  5FDH A;  1M6K A;  1YM1 A;  4U0X A;  3WS4 A;  3SS3 A;  5EEC A;  1XXM A;  3NI9 A;  3HLC A;  1ERM A;  4FD8 A;  5CTM A;  2GDN A;  1XX2 A;  5CXW A;  3V5M A;  2Z2M B;  1PWG A;  3O88 A;  5KZH A;  3WS5 A;  4KG6 A;  4S2I A;  1W8Y A;  1H8Y A;  3HVF A;  1H8Z A;  5HL1 A;  4UA7 A;  5HAP A;  4JBF A;  1NYM A;  3IH9 A;  1IEM A;  2H10 A;  1K55 A;  5FI7 A;  3IHA A;  4RX3 A;  1LL9 A;  1CEF A;  1XP4 A;  5FAO A;  4BQM A;  3NDE A;  4ZJ2 A;  2XLN A;  2Y2L A;  3S1Y A;  3LEZ A;  4NET A;  4QY5 A;  3ZGA B;  3DWK A;  4QHC A;  1AXB A;  2A3U A;  2WKE A;  1GHI A;  1I2S A;  1Q2Q A;  3GVB A;  2HP9 A;  4HBT A;  1W8Q A;  4OH0 A;  2Y2N A;  5AQ7 A;  5FQI A;  5E2F A;  2EX9 A;  4E3L A;  1NZU A;  4B4X A;  1IYP A;  2ZQA A;  3C7V A;  3BRM A;  1LI9 A;  1NYY A;  3NCK A;  5HFO A;  3UO9 A;  1QMF A;  5A90 A;  5CEB A;  1DJB A;  3O3V A;  5AQ9 A;  3UPP A;  2DCF A;  2XFT A;  5EVI C;  2WZZ A;  4C75 A;  5GHZ A;  4A5R A;  2Y2G A;  3BFE A;  4OP5 A;  4EBP A;  1ALQ A;  4K91 A;  2QPN A;  1PI4 A;  4M3K A;  2XEP A;  3V50 A;  1E3U D;  1L0D A;  5EVI D;  4OOY A;  5FSR A;  4D2O A;  4DE2 A;  3SH8 A;  5A92 A;  5EPH A;  3IHB A;  1BLH A;  3RJU A;  1EWZ A;  5FQM A;  2JE5 A;  4DXB A;  4KQR A;  4BL3 A;  4UAA A;  1ERO A;  4GD6 A;  2Y2H A;  4E3I A;  4XUX A;  2X01 A;  2HP6 A;  3A3D A;  5FI6 A;  4KZA A;  3IXD A;  1K57 A;  4B4Z A;  5HAI A;  5GHX A;  3IF6 C;  1L0F A;  4S2K A;  5GHY A;  3IXB A;  3VP0 A;  1I5Q A;  1IKG A;  1ES4 A;  2J9O A;  1PWC A;  4IED A;  4E3O A;  3TOI A;  5DF7 A;  4DF6 A;  3N8L A;  3WRZ A;  3BEC A;  3SS5 A;  5L2F A;  5HX9 A;  5EUA A;  5FQJ A;  2IWB A;  1PIO A;  2P9V A;  3ZG7 B;  1BLP A;  1FCM A;  2CC1 A;  3Q1F A;  4LEN A;  4LV3 A;  1CI9 A;  4R3J A;  5EVI A;  2E8I A;  3I7J A;  3G2Y A;  5KMW A;  4S2M A;  3DTM A;  4MLL A;  3PBO A;  1SHV A;  5JYP A;  4X53 A;  1RP5 A;  4ID4 A;  1CI8 A;  3UDF A;  3HUM A;  3VP3 A;  4PM7 A;  4C3Q A;  3MKF A;  4KZ6 A;  4WEL A;  3IT9 A;  3MZE A;  3IF6 A;  4PM6 A;  2ZC5 B;  2BG1 A;  3ZVT A;  2RCX A;  3DW0 A;  3N8R A;  3QNB A;  3FWL A;  3DWZ A;  4LCL A;  4PM8 A;  1PYY A;  4OQG A;  4BJP A;  4FCF A;  1K4E A;  1MWR A;  3HBR A;  5KSH A;  3LCE A;  2WGW B;  3WS2 A;  1K56 D;  2WUQ A;  3FZC A;  3CMZ A;  4OOL A;  2ZC7 A;  1XGJ A;  3M6H A;  3MBZ A;  5F1G A;  3VFH A;  1BUL A;  1ESU A;  2WZX A;  1PI5 A;  3A3J A;  5CHU A;  4R0Q A;  3ZG9 B;  3D4F A;  1ZC2 A;  1MY8 A;  2Y55 A;  5CED A;  3NBL A;  1BT5 A;  1YLW A;  4CJN A;  1GCE A;  3NDG A;  3FYZ A;  4KQO A;  4XXR A;  2ZQ8 A;  4EWF A;  4WBG A;  1U60 A;  3Q07 A;  4OQI A;  3VMA A;  5GLB A;  3WS0 A;  1ERQ A;  5CER A;  3UNW A;  2Y2P A;  4ZTK A;  1MKI A;  2Q9M A;  2QMI A;  4P6B A;  2Z2L B;  2VGK A;  5TFQ A;  5G18 A;  3ZG8 B;  5E2E A;  3A3E A;  1NXY A;  2X02 A;  3GMW A;  2ZMA A;  1MBL A;  4JXW A;  2ZC3 B;  4P0M A;  2HPB A;  4N9L A;  4WZ5 A;  4E6X A;  5U47 A;  2EX2 A;  4BEN A;  4DDS A;  3ZFZ A;  4OVD A;  5FAQ A;  1K55 C;  4QY6 A;  2ZLY A;  4P87 A;  3G32 A;  3PAG A;  3MZD A;  4OPZ A;  3ZDJ A;  3V3S A;  1LLB A;  2X71 A;  3GV9 A;  1WYB A;  1PW1 A;  1N9B A;  3G34 A;  4N1H A;  1NJ4 A;  3ZG0 A;  3OPL A;  4N9K A;  1NRF A;  2H5S A;  5TR7 A;  3NY4 A;  4WMC A;  3QNC A;  2EFX A;  3VFF A;  5CGS A;  4S2N C;  3WRT A;  1XKZ A;  4OPY A;  4U3T A;  4HES A;  4EQI A;  3IXG A;  1IKI A;  3BM6 A;  4KZ9 A;  4OQH A;  1K6S A;  3VP2 A;  5HAQ A;  2ZQ9 A;  3MKE A;  2A49 A;  2IWD A;  3P98 A;  3CG5 A;  2OLU A;  1L0G A;  4KZ3 A;  2ZQD A;  3O86 A;  1JVJ A;  4JF5 A;  1DJA A;  1BSG A;  2ZM0 A;  1KVM A;  4EBN A;  2EX8 A;  4DDY A;  3IQA A;  3BLM A;  4JPM A;  4LCM A;  4N92 A;  2WGV A;  2ZM8 A;  1N4O A;  4F94 A;  4QD4 A;  1FCO A;  2ZJ9 A;  1LL5 A;  3HUN A;  1W5D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...