3IF6C

Crystal structure of oxa-46 beta-lactamase from p. aeruginosa
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
231
Chain Sequence
VVIRSDWKKFFSDLQAEGAIVIADERQAKHTLSVFDQERAAKRYSPASTFIPHTLFALDADAVRDEFQVFRWVNRSFAGHNQDQDLRSAMRNSTVWVYELFAKDIGEDKARRYLKQIDYGNDYWIDGNLKISAHEQILFLRKLYRNQLPFKVEHQRLVKDLMITEAGRSWILRAKTGWEGRFGWWVGWIEWPTGPVFFALNIDTPNRTDDLFKREAIARAILRSIDALPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords OXA-46 oxacillinase
publication title Crystal structure of the narrow-spectrum OXA-46 class D beta-lactamase: relationship between active-site lysine carbamylation and inhibition by polycarboxylates
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
total genus 72
structure length 231
sequence length 242
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3if6C00
1FSWA 4KG6A 4OPRA 1YLWA 3HLCA 3LY3A 3OPHA 2ZM8A 4EWFA 3I7JA 4R4SA 1FQGA 1JWPA 1MWTA 5D3OA 4ZTKA 3SS5A 3ZVWA 3UPPA 3ISGA 2B5RA 2X02A 3S4XA 4UHUA 4KG2A 4PM7A 5HX9A 3UDFA 5DTKA 5HAQA 5E2FA 5EPHA 1L2SA 1FCOA 3MFDA 4RA7A 5U47A 2WKHA 2V1ZA 4KQQA 4ZJ2A 3UNWA 1XPBA 2Y2KA 5F1GA 4LV2A 4DRTA 4OOYA 1M40A 1W79A 1K57C 4WEJA 3M2KA 3W4OA 1PYYA 4S2JA 4Y0UA 4S2NC 5F1FA 1Y54A 3V50A 2EX9A 3PBQA 3Q7VA 1TDGA 4JXVA 1ZG6A 2ZM2A 1YMXA 1JVJA 5M19A 1ZG4A 3IHBA 1ES5A 1YLJA 2XEPA 4PM9A 1LI0A 3OPPA 4KZ8A 5TFQA 3ZCZA 4EBLA 3O87A 1ONGA 3CMZA 3ZFZA 1L0EA 4R23A 2PU2A 4M3KA 3W4PA 3Q7ZA 4XUXA 4DE2A 2ZQ9A 1ZKJA 1JWVA 4OQGA 1BT5A 3M6BA 4UAAA 2EXBA 5EVIA 1XXMA 2P9VB 3PAGA 4EQIA 3NY4A 4ZDXA 1H8YA 2Y4AA 1K57A 1ERMA 1QMEA 1SDNA 2EX2A 4WZ5A 4S2NA 4PM6A 5GHZA 2HDUA 3UO9A 3W4QA 2VGJA 3IWIA 1BULA 4FH2A 4R3BA 4RX2A 1NYYA 2EX8A 4QD4A 1YM1A 3SS3A 2OLVA 2WKEA 5EOOA 4LENA 2ZQDA 2WUQA 2ZQ7A 5AQAA 2Z2LB 2XGNA 3P09A 3RXWA 3BFEA 3MKFA 2WAFA 4BJPA 3C5AA 1NRFA 4GN2A 5CERA 3G4PA 2Y2QA 1XKZA 4JXWA 4E3NA 4S2KA 3IH9A 4KQRA 4R1GA 4BENA 2ZC5B 2WGWB 1IELA 2PU4A 4LCLA 4K91A 5FA7A 5HFOA 1IYSA 5FQMA 3SS4A 3LO7A 2HDQA 3ZNTA 3Q07A 4NETA 3QNBA 5A91A 4OQ0A 4WEKA 3ZNYA 3BEBA 2EFXA 3C7VA 3N8RA 1Q2PA 2WKIA 3HBRA 3GQZA 1PWGA 2GDNA 3RXXA 5KMWA 1L0FA 1KE4A 2RCXA 4KG5A 5CHUA 3VMAA 5KSCA 3UY6A 2XLNA 1KE0A 4KZ4A 1E3UD 1O7EA 1QMFA 2BG1A 3WS2A 5FQKA 4X55A 2WADA 5DF8A 4P6BA 5CHMA 3VP1A 5HARA 3VSKA 1YT4A 3VP4A 1NZOA 1Q2QA 3OZHA 3HREA 4MBFA 4BLMA 3DW0A 4QB8A 1IYPA 2ZQAA 2QPNA 3PTEA 4FCFA 1C3BA 4R3JA 3V39A 1NYMA 2J9PA 1XP4A 4FD8A 4GZBA 5HL1A 3WS4A 1CK3A 2V2FF 4EUZA 5GLDA 2VGKA 1HTZA 1GCEA 1S6RA 3G2ZA 4E3IA 1K54A 4JKTA 3IWQA 1MWRA 5JYOA 4DKIA 1K4FA 4KZBA 3ZG0A 2Y55A 4PPRA 5DF7A 3PAEA 3VSLA 2Z2MB 2ZC7A 2Q9MA 3M2JA 2RL3A 2XH9A 2WGVA 1DJBA 5FQQA 5CRFA 5GLBA 2Q9NA 2WGIA 2WYXA 2ZJ9A 2H10A 1MWUA 3HVFA 3IWOA 3V3SA 4QU3A 3MZFA 3LCEA 4DXCA 5FAPA 1SKFA 5KSHA 2OV5A 5M1AA 1GHIA 3B3XA 4HESA 4OPZA 1FR6A 4DE0A 3G2YA 1K55C 4D2OA 2R9WA 1PWCA 1U60A 4WM9A 5FDHA 5IHVA 4ZJ1A 5A90A 1PZOA 2CC1A 4GOGA 4H8RA 4IBXA 3HLGA 1MXOA 5EECA 1ES3A 5CHJA 4WBGA 1FCNA 4N92A 3ZHHA 5A93A 1NJ4A 3VOZA 2Y2MA 3HUNA 1N9BA 1SDEA 1PI5A 1KDWA 3UPNA 3OC2A 5FAOA 3NC8A 4UA7A 4MNRA 4C75A 1LI9A 2HDSA 3P98A 4JPMA 5FATA 4U0TA 2HPBA 1GA0A 3AGDA 2ZQCA 5JYPA 4X69A 3BFDA 4IBRA 1VQQA 1YLZA 1HVBA 4P87A 3GMWA 4QY5A 3WS0A 1JWZA 2Y2NA 2Y2LA 4DE1A 1RCJA 3MKEA 2DCFA 1KE3A 3VOYA 1SCWA 5EOEA 2XD1A 1LL5A 4GDBA 3FKVA 3NBLA 4OP5A 1FOFA 1MWSA 1XA7A 3NDEA 5EE8A 3BLMA 2JBFA 4P0MA 4X68A 1ES4A 1W8YA 4B4ZA 4S2MA 3HLEA 4P85A 4QJGA 3UPOA 1EI5A 3ZVTA 1BSGA 2Y2HA 4OQHA 4R4RA 4B4XA 3IH8A 3RJUA 4WMCD 4EBNA 3EQUA 4OPYA 3UDIA 4S2OA 5CGXA 1WYCA 2OSUA 3IF6B 1KVLA 1K56D 1TDLA 1OMEA 3G30A 4MBKA 4YINA 5FI7A 4ID4A 4LCMA 3WRZA 1BLSA 1FR1A 4X6TA 4UA9A 5DF9A 5E2HA 4NK3A 4PMAA 2I72A 3WRTA 4GDNA 3CZDA 3HUMA 1E3UA 4KZ5A 4X53A 4JF6A 4BL2A 1MBLA 1LL9A 1VM1A 4OVDA 2Y2OA 3GSGA 5GLCA 3IF6C 1NY0A 3HLWA 5KZHA 3V5MA 2V20A 1IYOA 1K38A 4X56A 3O86A 1W7FA 2BLSA 4IVKA 3O88A 3PBNA 5FQJA 2XF3A 2FFYA 1CI9A 3IQAA 1BLHA 5GL9A 1ES2A 3FYZA 3UE1A 2P9VA 3CG5A 3PBOA 2C5WB 1N4OA 1YMSA 4U3TA 4Y0TA 3E2KA 4CJNA 4Q8IA 3OCNA 3IXBA 1IKGA 4KQOA 1XX2A 1K6SA 2ZC3B 3GVBA 5A92A 1LLBA 2J7VA 3WWXA 1O07A 2EFUA 5FI2A 5AQ7A 3SH8A 4ZAMA 2WZZA 3N8LA 3S1YA 5M18A 1FCMA 3A3EA 5TR7A 2XFSA 5I94A 2PBYA 4FH4A 3N4IA 4E3LA 1W8QA 3VP0A 1TVFA 3AGFA 3CJMA 1MY8A 2G2UA 1YLYA 2R9XA 2WGWA 2JC7A 2ZC4B 3BECA 3PBSA 3HUOA 4BQMA 5CEBA 2H0YA 4OKPA 4RVAA 2HP5A 5FSRA 5GHYA 1PWDA 2H0TA 4N1XA 2WZXA 2IWCA 3GV9A 1H8ZA 1M6KA 3VFFA 4DDYA 4C3QA 3OPRA 5HW3A 4K0WA 4OQIA 3MXRA 1NXYA 4KZ3A 3A3JA 3VP3A 3IF5A 4B88A 3MZEA 1ESUA 5CEDA 4EBPA 4YFMA 1G6AA 3Q7VB 4CPKA 5AQ9A 3UDXA 4JLFA 2ZD8A 4XUZA 2DRWA 4E3JA 5G18A 4QY6A 2XFTA 4S2PA 1J9MA 3OCLA 1HD8A 4KZ6A 4N9KA 1LHYA 5CXWA 5E2EA 1TEMA 4L0LA 1RP5A 3DWKA 4LV0A 5FAQA 3UN7A 5GLAA 1S0WA 2DNSA 2UWXA 4IEDA 3TSGA 5CTNA 2QZ6A 4HBTA 1GHPA 2C6WB 3ITBA 2IWBA 3N7WA 3UE3A 3BFCA 5EVIB 4E6WA 3FWLA 4E3OA 2HP6A 5CGSA 4Y7PA 3BYDA 1ERQA 4K0XA 2P74A 1I2SA 4JXGA 4DXBA 3ZGAB 4OLDA 4DDSA 5BOHA 1BUEA 1KVMA 1K55A 1PZPA 2ZMAA 4UA6A 1H5XA 1YLTA 4WMCA 5FQIA 1BLCA 1K56A 4KZ9A 4O7DA 1AXBA 1BLPA 5EVIC 1PIOA 1E4DA 1RGZA 3HL9A 1IEMA 3GTCA 4PM8A 1NZUA 4WZ5C 1PI4A 3UE0A 3OPLA 4DF6A 2J8YA 3BFGA 4OH0A 4E3KA 5CTMA 3EQVA 4Z9QA 3VP2A 3FKWA 4BD0A 3A3FA 3S22A 1CEFA 1I5QA 4F94A 4Y0OA 3QHYA 1L0GA 2OLUA 2IWDA 3IHAA 4HBUA 4MBHA 2E8IA 1HZOA 5EVLA 2HDRA 3DWZA 4RYEA 4LV3A 4BL3A 1DY6A 1RGYA 3BM6A 3G34A 3NI9A 1EROA 2FFFB 4JF5A 1KGFA 4JBFA 2ZQ8A 4HEFA 1CEGA 1WYBA 3G35A 4S2IA 2ZC6B 1FSYA 5EUAA 4ZJ3A 1I2WA 1G68A 3NCKA 2ZM0A 4JF4A 4OOLA 1PW1A 5AQBA 3MBZA 1KGGA 3FV7A 4WELA 3ZG5A 5HAIA 2X01A 3WS1A 3ZDJA 2EXAA 1KGEA 2XD5A 3V3RA 1XA1A 3IXHA 2XR0A 3A3IA 1PW8A 1YLPA 5EVID 3A3DA 5TGFA 4LV1A 4RX3A 3ZG9B 5L2FA 4EV4A 2Y2IA 3G32A 5F83A 3C7UA 4GKUA 2WAEA 5FASA 3NDGA 3Q81A 3GR2A 5E2GA 5GHXA 3BFFA 3MZDA 5FI6A 1XGIA 4GD6A 4DE3A 4FSFA 4IVIA 4E3MA 1K54C 1MPLA 3C4PA 3IF6A 4S2LA 1IYQA 3BLSA 4WZ4A 3PBTA 3VFHA 4BD1A 4N9LA 4OOMA 1E25A 5DTSA 3W8KA 1GA9A 5FQ9A 5CECA 1JTDA 1SHVA 3JYIA 4MLLA 4N1HA 2WK0A 4E6XA 2Y2PA 4MEZA 3FZCA 1JTGA 1ESIA 4GB7A 5F82A 3WS5A 3SOIA 4OONA 1IKIA 4U0XA 1XGJA 4OP8A 3N6IA 3MXSA 3IT9A 1ALQA 2A3UA 2X71A 1EWZA 4WYYA 4JXSA 2JCHA 4KZ7A 3HLDA 4R0QA 4XXRA 5DTTA 3SH9A 1ZC2A 2H5SA 2XQZA 2Y59A 3IXGA 1W5DA 3LY4A 3N8SA 1CI8A 4GD8A 4OPQA 3Q82A 1Z6FA 3LEZA 3NIAA 5E43A 5J8XA 3ITAA 4OLGA 2JE5A 3M6HA 3HLBA 2Y2JA 3SH7A 4GNUA 1KDSA 2Y91A 3TOIA 1L0DA 5CGWA 4A5RA 1DJCA 3TG9A 1K4EA 2XK1A 2EX6A 2ZLYA 2A49A 1MKIA 2HP9A 3E2LA 2Y2GA 3O3VA 3C4OA 3D4FA 2J9OA 3IXDA 3GRJA 2G2WA 1K25A 4PM5A 3HLFA 1YQSA 3PBRA 3Q1FA 4KZAA 4ZBEA 1DJAA 5HAPA 4C6YA 1ONHA 1WE4A 3G31A 3BRMA 1BTLA 1GHMA 1K6RA 2XDMA 3ZG7B 3QNCA 4QHCA 5DVAA 3AGEA 2QMIA 3ZG8B 3DTMA 4KENB 1BZAA
chains in the Genus database with same CATH superfamily
4KG6A 1YLWA 3LY3A 2ZM8A 3I7JA 1LL8A 4X1MA 3T50A 1JWPA 4ZTKA 2FH5A 3EWKA 3ISGA 2L0WA 3S4XA 1YSQA 2ZL1B 5E2FA 5EPHA 3MFDA 5U47A 3E0YA 4HJ4A 3NOUC 1DP8A 4DRTA 3W4OA 3M2KA 3TE8A 5F1FA 2EX9A 3PBQA 5L07A 1TDGA 4JXVA 1ZG6A 4NXEA 1V9ZA 2VLGA 4EBLA 3T1XA 2PHYA 2J3TD 3SZTA 4XUXA 4ARZB 4JGPA 2JKRM 4EXOA 1ZKJA 4UAAA 5EVIA 3BY8A 4HP9A 1SDNA 2EX2A 5GHZA 4PM6A 2VGJA 3IWIA 4R3BA 1NYYA 3K3CA 4BMWA 2KDKA 3JVVA 1PFLA 4K08A 5DKLA 1CQAA 3C5AA 2V0UA 1NRFA 4GN2A 5CERA 3PXPA 4E3NA 4R1GA 4EU0A 4EUVA 3MMHA 2XRNA 5FA7A 1VHMA 4I38A 1IYSA 4NXBA 3IX4A 5TJJA 3QNBA 3T4OA 2WKIA 3LFVA 3UB6A 3GQZA 2GDNA 4ETZA 3VMAA 4KG5A 5KSCA 3H82B 1UGUA 2XLNA 4MN6A 3LIEA 1O7EA 1QMFA 3WS2A 2VGLS 2R78A 4GCZA 5DF8A 2JKGA 3VSKA 4EESA 3HREA 4MBFA 1OTBA 3DW0A 2QJ7A 4R3JA 3V39A 4KUOA 4Q0IA 5F69A 5GLDA 2HZ5A 3NJAA 3IWQA 4IHQA 5JYOA 3DAVA 3ZG0A 4PPRA 1HLUP 3PAEA 3VSLA 2HF6A 2Z2MB 2RL3A 3P7NA 1G6OA 2WYXA 2H10A 1MWUA 3IWOA 4X1LA 1TS6A 3MZFA 4DN0A 4DXCA 5KSHA 2OWJA 1GHIA 5M1AA 3B3XA 4HESA 1FR6A 4DE0A 1PWCA 3H7WB 4EQ1A 2WKRA 4ZJ1A 4GOGA 4H8RA 4IBXA 2UV0E 5G4YA 5A93A 2Y2MA 1PI5A 3OC2A 1LI9A 3OBFA 3TRCA 3AGDA 5JYPA 4X69A 3BFDA 3U4LP 1YLZA 4FOFA 2Y2LA 4EERA 2O9AA 2DCFA 1KE3A 3VOYA 1SCWA 5EOEA 3UMDA 3FKVA 2I9VA 3MQ0A 4PKYA 4X68A 3MR0A 4S2MA 3O5YA 3UPOA 3QP6A 3ZVTA 4WMCD 2OSUA 4Q0JA 3S7NA 4LCMA 3WRZA 1BLSA 3BY9A 5DF9A 2I72A 3HUMA 3EGDC 5FL3A 4JF6A 4BL2A 1MBLA 1LL9A 4OVDA 5DKKA 3HLWA 2Z6CA 5KZHA 2V20A 1K38A 3KYEA 2KX6A 5TBMA 1PRQA 5FQJA 2HJ9C 4MCWA 1CI9A 3IQAA 1BLHA 1OTAA 2P9VA 1YAXA 2QHKA 1YMSA 4U3TA 4WF0A 5G4ZA 3E2KA 4Q8IA 1IKGA 4KQOA 2EWVA 1O07A 5FI2A 3SH8A 4ZAMA 4KQDA 4R3AA 1FCMA 1F98A 3A0VA 2G7UA 2XFSA 5J7EA 3N4IA 4E3LA 3VP0A 2R9XA 2ZC4B 1YLYA 2WGWA 1S67L 3TJZC 3R7WA 2H0YA 5GHYA 4Y13A 3VFFA 2PBDP 3A0RA 3MXRA 1NXYA 4B88A 5CEDA 4YFMA 4CPKA 3IX8A 3IS2A 2V9AA 1HD8A 1TEMA 1RP5A 3DWKA 2DNSA 3TSGA 5CTNA 2QZ6A 4HBTA 1GHPA 5DFXA 3ITBA 1OT9A 1PNEA 4UEYA 3VE4A 4DXBA 1STZA 1KVMA 2ZMAA 1YLTA 4Y17A 1BLCA 1XFNA 4O7DA 3QP8A 4KZ9A 3KYZA 3DTEA 4WZ5C 3OPLA 3EEHA 3BFGA 5KIZA 4Z9QA 1DP6A 4F3LA 4F94A 2OLUA 1ODVA 3IHAA 4LV3A 4BL3A 3KYQA 5HD3A 1YKDA 4JBFA 5J4EA 3LIDA 2V1BA 1MZUA 2ZC6B 1FSYA 5EUAA 4ZJ3A 2ZM0A 3MBZA 3FV7A 3WS1A 3ZDJA 1KGEA 3DTKA 3UB7A 4I3JA 4HNBA 3MFXA 3A3DA 4HH3A 1OT6A 4LV1A 5L2FA 3T4LA 3G32A 4JGOA 4GKUA 2WAEA 3T12B 1OTIA 5FASA 5DJUA 3GR2A 3BFFA 4FSFA 1K54C 1MPLA 4WZ4A 3VFHA 1Y4OA 2D02A 4IUHA 1GA9A 5AVFA 3JYIA 4N1HA 2Y2PA 4MEZA 3FZCA 3MF0A 1IKIA 2PR5A 4KZ7A 2Y59A 4LRZE 1W5DA 3N8SA 5HPIA 1D1JA 4OLGA 2Y2JA 3SH7A 4GNUA 3TOIA 1DJCA 3TG9A 2EX6A 2VV7A 3O3VA 1IFQA 4I39A 3VOLA 2G2WA 1SKOA 3PBRA 4B93A 3QP2A 4KZAA 2J3TC 5IU1A 4C6YA 1OPXA 5DVAA 4XT2B 1FQGA 5D3OA 1MWTA 1VETB 4KG2A 5HL6A 3MJQA 4R38A 1L2SA 1FCOA 4ZJ2A 1AWIA 2Y2KA 1OJ5A 4JGRA 3ZQ5A 2VV8A 4WEJA 2B95A 3JPUA 3V50A 3Q7VA 1T1CA 1JVJA 5M19A 1ZG4A 3IHBA 4HQAA 3ZCZA 1P9RA 3CMZA 2OWHA 1OJGA 2PU2A 3W4PA 4GS9B 3S7QA 4DE2A 4KUKA 2ZQ9A 1BT5A 1GSVA 5DFYA 2A24B 1H8YA 1K57A 4WZ5A 4S2NA 4RX2A 3SS3A 2MJ6A 5AQAA 2WUQA 2GNXA 3RXWA 3MKFA 1H0MA 3KX0X 1XKZA 2ZC5B 2PU4A 4LCLA 5FQMA 1LSVA 3LO7A 1Q2PA 5EM0A 4HHDA 3RXXA 5KMWA 1L0FA 2JHEA 5CHUA 4ETXA 4UQIM 3UY6A 1E3UD 3PR6A 3CWFA 2WADA 4P6BA 3TW8A 1NZOA 1Q2QA 1A0KA 4IJGA 4QB8A 4FCFA 4D60A 2J9PA 3F1OA 3WS4A 1CK3A 1GCEA 1S6RA 1K54A 4JKTA 1XJ3A 2Y55A 4BBTA 5DF7A 4CLCE 2V0WA 2WGVA 1DJBA 2K2NA 2QJ5A 3QP5A 5CRFA 2Q9NA 4QU3A 2HV1A 4EEPA 3G2YA 1U60A 4WM9A 5FDHA 5A90A 2QWSA 3HJKA 4WBGA 4HP4A 3ZHHA 3VOZA 3C8CA 4DMZA 3UPNA 5FAOA 4EETB 3QP4A 4MNRA 4GHIA 1WA9A 3P98A 2ZQCA 1VQQA 4PAUA 3GMWA 5L09A 1JWZA 2VA0A 1YPRA 3S7OA 3NHQA 5F5YA 3LR0A 2VZWA 4L9GA 4HJ3A 3D72A 4BBVA 1LL5A 1TF1A 4X25A 3NDEA 5EE8A 5FEGA 2JBFA 2W1TB 4P0MA 1W8YA 4QWOA 3H7WA 5J3WA 4I3AA 4CQHA 2O0YA 3RJUA 1DP9A 3V67A 2P04A 3EQUA 4P6ZS 5CGXA 2Z6DA 5HWVA 1FR1A 4X6TA 4PMAA 4O8GA 4GDNA 4X53A 3GSGA 3IF6C 4H6JA 1NY0A 1P9WA 2V8CA 3CUEC 1IYOA 2KOIA 3G6OA 2K7SA 2FFYA 1ES2A 3UE1A 3CG5A 2C5WB 1XFQA 1G5UA 4EW7A 3T4SA 4CJNA 2EA9A 1ACFA 4R70A 1XX2A 1LSXA 2ZC3B 5A92A 2J7VA 2EFUA 1P97A 2WZZA 3HJIA 3S1YA 3T4JA 3A3EA 2PBYA 2AVXA 3BECA 5CEBA 3LYXA 4RVAA 1PWDA 3UB5P 2WZXA 3GV9A 1H8ZA 4ESPA 4DDYA 4CLCA 1W63M 3VP3A 3MZEA 1ESUA 3UDXA 4JLFA 3KO6A 1J9MA 3BW6A 1LHYA 4CLCD 4NG2A 4L0LA 4LV0A 5FAQA 4HI4A 4IEDA 2UWXA 3MSHA 2C6WB 3UE3A 5EVIB 4E6WA 2K31A 3F1PA 4Y7PA 1ERQA 5DJTA 2P74A 5HWWA 3ZGAB 4DDSA 1BUEA 2PR6A 1PZPA 4WMCA 1LSWA 2ZMVA 1AXBA 1T1BA 1PIOA 1E4DA 1IEMA 4PM8A 3NULA 1PI4A 1KOUA 4GLQA 2O9CA 1F2KA 2LB9A 3FKWA 3A3FA 3S22A 3K2NA 4Y0OA 1DY6A 3EGXC 1KGFA 5C5KA 4I5SA 4Y15A 3RH8B 3VE3A 3OLOA 3E4QA 2P7JA 4S2IA 2V8FA 4JF4A 1PW1A 5AQBA 1GSXA 4WN5A 2EWWA 2XR0A 3FPVA 3ZG9B 2JKRI 3MZDA 3CPTA 4DE3A 4IVIA 3IF6A 3C4PA 3PBTA 5CX7A 4PHTA 2OOLA 3CUEA 1NLYA 1E25A 3RTYA 2M7UA 5FQ9A 4E6XA 3MXQA 4U0XA 2A3UA 4WYYA 2LB5A 2X71A 5DTTA 4JXSA 3HLDA 4Y0TA 4OPQA 5HW3A 3Q82A 1Z6FA 3LEZA 3NIAA 5J8XA 3M6HA 2XSSA 2Q0OA 5F6AA 4O01A 2Y91A 1L0DA 1K4EA 2ZLYA 2Y2GA 3C4OA 3LIFA 3HLFA 3Q1FA 5AVEA 3E4PA 3BRMA 1BTLA 1K6RA 3QNCA 4QHCA 3AGEA 3ZG8B 2HJEA 3IBJA 1FSWA 4OPRA 3HCYA 4EWFA 3OPHA 2PT7A 2W1RA 4YNRA 3ZVWA 3UPPA 2PDRA 2B5RA 4HJ6A 5HX9A 3UDFA 4Y3IA 2WKHA 3ZYTA 1CJFA 4KQQA 3UNWA 2E8JA 5F1GA 2L1MA 4LV2A 3LR3A 1M40A 3T1SA 1K57C 2PYPA 4Y0UA 4S2NC 4WUJA 2ZM2A 5HSQA 1VEUA 1LI0A 3OPPA 4KZ8A 3O87A 1ONGA 5A8BA 2DMWA 5TBMB 4DJ2A 1JWVA 4OQGA 2EXBA 1XXMA 2P9VB 3PAGA 4EQIA 3NY4A 3BWLA 2Y4AA 1ERMA 2HDUA 3W4QA 4RQ9A 2XROA 4FH2A 3D9YA 4R6LA 2GJ3A 1NWZA 1NLZA 2JN7A 1YM1A 2OLVA 5EOOA 4LENA 2XGNA 1TS8A 3BFEA 2M1CA 2WAFA 3G4PA 2W3EA 2Y2QA 2O99A 5LBRA 2W3DA 3CI6A 1K0KA 5K5BA 4S2KA 2INWA 4BENA 2WGWB 1IELA 3SS4A 3R7WB 1YSPA 2HDQA 2ZMFA 3ZNTA 4NETA 5A91A 1S4RA 2EFXA 1TS7A 4WL9A 1PWGA 1KE4A 4KZ4A 5AJGA 5FQKA 4X55A 3ICYA 2WKPA 1YT4A 3VP4A 3F1NA 4BLMA 2XA7S 2ZQAA 2QPNA 3IS2B 1NYMA 3R4KA 1XP4A 4FD8A 4GZBA 1V9YA 2V2FF 4EUZA 2VGKA 1HTZA 3CHWP 3G2ZA 4E3IA 4DKIA 1K4FA 4KZBA 2Q9MA 4DJ3A 4PKYG 2WGIA 3V3SA 4GW9A 1P0ZA 1F5MA 4QPRA 1SKFA 2OV5A 5MC7A 4OPZA 1K55C 2PYRA 1Y28A 4F3LB 5IHVA 1PZOA 3HLGA 1MXOA 1N9NA 1ES3A 2Y79A 5EECA 4N92A 1NJ4A 3HUNA 4HH2A 3NC8A 4C75A 4JPMA 3H9WA 2HPBA 4MN5A 1CF0A 3A0SA 1HVBA 1XJ6A 4QY5A 2Y2NA 3MKEA 3IBRA 1J3WA 3W2ZA 2A2LA 2HGVA 2XD1A 4OP5A 4L9EA 1MWSA 1XA7A 3BLMA 3PHYA 1ES4A 2YKHA 4P85A 4QJGA 2ZL1A 1FILA 3JVUA 2Y2HA 4EBNA 2VEAA 1T1AA 3UDIA 4S2OA 1WYCA 1KVLA 1K56D 1OMEA 4MBKA 2P08A 4YINA 4ID4A 3T4TA 3WRTA 5E2HA 5L8MA 4NK3A 3CZDA 1E3UA 2BASA 4KZ5A 5HD5A 2QYBA 1XJ4A 3V5MA 4X56A 2BLSA 4IVKA 3NOTC 4ARZA 3LI8A 5GL9A 3FYZA 3PBOA 2W1TA 1N4OA 3UB9A 1SKOB 4CLCC 3D3OA 3OCNA 1LLBA 3IX3A 5AQ7A 1X0OA 5HDCA 2W3GA 5TR7A 4FH4A 1TVFA 3CJMA 1MY8A 2G2UA 2J80A 3DBAA 2JC7A 3PBSA 4BQMA 4OKPA 3NECA 2HP5A 5HPFA 2H0TA 4K0WA 3FC7A 3H82A 3A3JA 3IF5A 1FIKA 1G6AA 3Q7VB 3LEQA 3EOIA 2H28A 4XUZA 3MS6A 4MN7A 2XFTA 4LGWA 5CXWA 5GLAA 1S0WA 2IWBA 2W27A 3N7WA 1EW0A 2Y8HA 3BFCA 4JGQA 4E3OA 2HP6A 5CGSA 3CLOA 3BYDA 1I2SA 4JXGA 1K55A 1H5XA 1N9LA 1DRMA 1H8MA 1RGZA 1NZUA 1MC0A 4BBUA 2J8YA 4OH0A 5CTMA 3QHYA 4YOFA 4HBUA 5EVLA 1N9OA 2HDRA 3DWZA 3BJNA 3G34A 3NI9A 2ZQ8A 4HEFA 1CEGA 5HWTA 1WYBA 1G68A 1I2WA 5HDDA 3NCKA 3OOVA 4P6ZM 3ZG5A 5HAIA 3P01A 3F1OB 2EXAA 3QP1A 2XD5A 3IXHA 5EV0A 3A3IA 2GZAA 1PW8A 5EVID 3B47A 4RX3A 5FDSA 4EV4A 2Y2IA 3NDGA 5GHXA 4E04A 4G3KA 4GJ4A 4E3MA 3B33A 1IYQA 2VK3A 3LUQA 4N9LA 4OOMA 5DTSA 3W8KA 1S4SA 3LIAA 5CECA 1JTDA 1OTDA 4Y5FA 2VGLM 4GB7A 1ESIA 3WS5A 5F82A 5FEFA 3SOIA 2FZ0A 3N6IA 3IT9A 1ALQA 5IT5A 1EWZA 4XXRA 1ZC2A 2H5SA 2XQZA 3IXGA 3LY4A 3T4QA 3LI9A 5E43A 2JE5A 3KSHA 3NOPC 3MQQA 3E98A 5EFWA 4LPZA 1KDSA 3KSIA 4IUKA 5CGWA 2A49A 1L3LA 1Z09A 4GHIB 3D4FA 2J9OA 3IXDA 2KLIA 1K25A 4HIAA 2NUPC 4ZBEA 5HAPA 1WE4A 1TD5A 1GHMA 5L10A 2QMIA 3DTMA 2PD7A 4KENB 3HLCA 2BTFP 3ULFA 4R4SA 3SS5A 2B18A 2X02A 3LICA 4UHUA 4PM7A 5DTKA 5HAQA 3SW1A 4RA7A 4BWIA 2V1ZA 1XPBA 3C38A 1ZHHB 4OOYA 1W79A 4I3IA 1PYYA 4S2JA 2CMNA 4FTXA 3K3DA 1Y54A 1GSWA 1YMXA 2OAQ1 1ES5A 3L7HA 4H6JB 1YLJA 2XEPA 4PM9A 5TFQA 1ZTUA 4MMNA 4LRXC 3ZFZA 1L0EA 3LGOA 4R23A 3DTIA 4M3KA 1TS0A 3Q7ZA 3C30A 3M6BA 4ZDXA 1QMEA 3UO9A 1BULA 3T1QB 2EX8A 2PAVP 4QD4A 4ZRRA 2WKEA 3EEAA 2ZQDA 2ZQ7A 4HOIA 1T18A 2Z2LB 3P09A 3FG8A 4BJPA 1S66L 2W3HA 2GX5A 4JXWA 3IH9A 4KQRA 5HFOA 4K91A 2VJWA 3Q07A 1D7EA 4OQ0A 4WEKA 1XJ2A 3BEBA 3ZNYA 3C7VA 3N8RA 3HBRA 4CLCB 3T4KA 2RCXA 4NKPA 1G28A 1VB6A 2ZBBA 1KE0A 2BG1A 2OAP1 2JKFA 5CHMA 3VP1A 5HARA 3OZHA 3LIBA 1IYPA 3PTEA 4LRYC 1C3BA 5HL1A 2VKSA 5IS1A 1H3QA 1MWRA 3F1PB 2ZC7A 3M2JA 2XH9A 2V1AA 5FQQA 5GLBA 1MKMA 2ZJ9A 3HVFA 4MDZA 2PRFA 3LCEA 5FAPA 2R9WA 1S1YA 2CC1A 4WLAA 5CHJA 1FCNA 1W63Q 2ACGA 1N9BA 1SDEA 1KDWA 1F9IA 4UA7A 2HDSA 2L4RA 2QKPA 4U0TA 5FATA 5EVEA 1GA0A 3CAXA 4IBRA 5F68A 2WKQA 4P87A 3WS0A 4DE1A 2ZOIA 1RCJA 3UE6A 5HDSA 4XT2A 4GDBA 3NBLA 1FOFA 3U2AA 1VETA 4B4ZA 3HLEA 1EI5A 1BSGA 4OQHA 4R4RA 4B4XA 3IH8A 3CPTB 4NEED 2JKTM 4OPYA 3IF6B 4M4XA 1TDLA 4NXFA 3G30A 5FI7A 2PD8A 3BQAA 4UA9A 4NXGA 3LR5A 3KSGA 1VM1A 2Y2OA 1T19A 3O86A 1W7FA 4GS9A 3O88A 3PBNA 2NUTC 2XF3A 3UMEA 2A24A 1UWPX 1UWNX 2D01A 3IXBA 1K6SA 3GVBA 4Q0HA 3WWXA 3N8LA 3E4OA 2M7VA 1IOUA 5M18A 5I94A 1W8QA 3AGFA 3HUOA 2XA7M 4LLOB 3BQ8A 5FSRA 4N1XA 1OTEA 2IWCA 1M6KA 4C3QA 3OPRA 4OQIA 4FUWA 1BYWA 4KZ3A 3L9KA 4EBPA 5AQ9A 2ZD8A 2DRWA 1VEUB 4E3JA 5G18A 4QY6A 5EM1A 4S2PA 3OCLA 4KZ6A 4N9KA 4EEUA 5E2EA 3UN7A 4G3WA 3FPWA 3FWLA 4K0XA 4OLDA 5BOHA 4UA6A 5HZHA 1LT0A 2B02A 4L9FA 5FQIA 1K56A 1BLPA 5EVIC 3HL9A 3GTCA 3UE0A 4DF6A 2O9BA 4HY8A 1NRJA 4E3KA 4Y2FA 3EQVA 3VP2A 4BD0A 1CEFA 1I5QA 3LR4A 3GECA 1L0GA 2IWDA 4MBHA 2E8IA 3VV4A 1HZOA 4RYEA 4B9OA 2VV6A 1RGYA 3BM6A 1EROA 2FFFB 4JF5A 3T1RA 3RFBA 3G35A 4Z1WA 4OOLA 1SZVA 3F1NB 1KGGA 1D06A 4WELA 2X01A 3C2WA 2YKFA 3V3RA 1XA1A 4AFIA 1YLPA 3S7PA 4UQIS 5TGFA 2J3WA 2VX8A 4O0PA 5F83A 3C7UA 3Q81A 5E2GA 5FI6A 3CITA 1XGIA 3PYPA 4GD6A 4S2LA 3BLSA 2IA2A 3GDIA 4BD1A 3B42A 2JKTI 1SHVA 4MLLA 2WK0A 4YWZA 1JTGA 4LFUA 4ME4A 4OONA 1XGJA 4OP8A 3MXSA 4D2OA 2W3FA 2JCHA 3KSFA 4R0QA 2ZOHA 3SH9A 5GLCA 1CI8A 4GD8A 3ITAA 3MQOA 3HLBA 5I5LA 4G3VA 4A5RA 2XK1A 1MKIA 2HP9A 3E2LA 4II7A 3GRJA 4PM5A 1YQSA 3UB8A 1DJAA 1ONHA 3G31A 1S1ZA 2XDMA 2W0NA 3ZG7B 1JNUA 1BZAA
chains in the Genus database with same CATH topology
1FSWA 4KG6A 4OPRA 1YLWA 3HLCA 3LY3A 3OPHA 2ZM8A 4EWFA 3I7JA 4R4SA 1FQGA 1JWPA 1MWTA 5D3OA 4ZTKA 3SS5A 3ZVWA 3UPPA 3ISGA 2B5RA 2X02A 3S4XA 4UHUA 4KG2A 4PM7A 5HX9A 3UDFA 5DTKA 5HAQA 5E2FA 5EPHA 1L2SA 1FCOA 3MFDA 4RA7A 5U47A 2WKHA 2V1ZA 4KQQA 4ZJ2A 3UNWA 1XPBA 2Y2KA 5F1GA 4LV2A 4DRTA 4OOYA 1M40A 1W79A 1K57C 4WEJA 3M2KA 3W4OA 1PYYA 4S2JA 4Y0UA 4S2NC 5F1FA 1Y54A 3V50A 2EX9A 3PBQA 3Q7VA 1TDGA 4JXVA 1ZG6A 2ZM2A 1YMXA 1JVJA 5M19A 1ZG4A 3IHBA 1ES5A 1YLJA 2XEPA 4PM9A 1LI0A 3OPPA 4KZ8A 5TFQA 3ZCZA 4EBLA 3O87A 1ONGA 3CMZA 3ZFZA 1L0EA 4R23A 2PU2A 4M3KA 3W4PA 3Q7ZA 4XUXA 4DE2A 2ZQ9A 1ZKJA 1JWVA 4OQGA 1BT5A 3M6BA 4UAAA 2EXBA 5EVIA 1XXMA 2P9VB 3PAGA 4EQIA 3NY4A 4ZDXA 1H8YA 2Y4AA 1K57A 1ERMA 1QMEA 1SDNA 2EX2A 4WZ5A 4S2NA 4PM6A 5GHZA 2HDUA 3UO9A 3W4QA 2VGJA 3IWIA 1BULA 4FH2A 4R3BA 4RX2A 1NYYA 2EX8A 4QD4A 1YM1A 3SS3A 2OLVA 2WKEA 5EOOA 4LENA 2ZQDA 2WUQA 2ZQ7A 5AQAA 2Z2LB 2XGNA 3P09A 3RXWA 3BFEA 3MKFA 2WAFA 4BJPA 3C5AA 1NRFA 4GN2A 5CERA 3G4PA 2Y2QA 1XKZA 4JXWA 4E3NA 4S2KA 3IH9A 4KQRA 4R1GA 4BENA 2ZC5B 2WGWB 1IELA 2PU4A 4LCLA 4K91A 5FA7A 5HFOA 1IYSA 5FQMA 3SS4A 3LO7A 2HDQA 3ZNTA 3Q07A 4NETA 3QNBA 5A91A 4OQ0A 4WEKA 3ZNYA 3BEBA 2EFXA 3C7VA 3N8RA 1Q2PA 2WKIA 3HBRA 3GQZA 1PWGA 2GDNA 3RXXA 5KMWA 1L0FA 1KE4A 2RCXA 4KG5A 5CHUA 3VMAA 5KSCA 3UY6A 2XLNA 1KE0A 4KZ4A 1E3UD 1O7EA 1QMFA 2BG1A 3WS2A 5FQKA 4X55A 2WADA 5DF8A 4P6BA 5CHMA 3VP1A 5HARA 3VSKA 1YT4A 3VP4A 1NZOA 1Q2QA 3OZHA 3HREA 4MBFA 4BLMA 3DW0A 4QB8A 1IYPA 2ZQAA 2QPNA 3PTEA 4FCFA 1C3BA 4R3JA 3V39A 1NYMA 2J9PA 1XP4A 4FD8A 4GZBA 5HL1A 3WS4A 1CK3A 2V2FF 4EUZA 5GLDA 2VGKA 1HTZA 1GCEA 1S6RA 3G2ZA 4E3IA 1K54A 4JKTA 3IWQA 1MWRA 5JYOA 4DKIA 1K4FA 4KZBA 3ZG0A 2Y55A 4PPRA 5DF7A 3PAEA 3VSLA 2Z2MB 2ZC7A 2Q9MA 3M2JA 2RL3A 2XH9A 2WGVA 1DJBA 5FQQA 5CRFA 5GLBA 2Q9NA 2WGIA 2WYXA 2ZJ9A 2H10A 1MWUA 3HVFA 3IWOA 3V3SA 4QU3A 3MZFA 3LCEA 4DXCA 5FAPA 1SKFA 5KSHA 2OV5A 5M1AA 1GHIA 3B3XA 4HESA 4OPZA 1FR6A 4DE0A 3G2YA 1K55C 4D2OA 2R9WA 1PWCA 1U60A 4WM9A 5FDHA 5IHVA 4ZJ1A 5A90A 1PZOA 2CC1A 4GOGA 4H8RA 4IBXA 3HLGA 1MXOA 5EECA 1ES3A 5CHJA 4WBGA 1FCNA 4N92A 3ZHHA 5A93A 1NJ4A 3VOZA 2Y2MA 3HUNA 1N9BA 1SDEA 1PI5A 1KDWA 3UPNA 3OC2A 5FAOA 3NC8A 4UA7A 4MNRA 4C75A 1LI9A 2HDSA 3P98A 4JPMA 5FATA 4U0TA 2HPBA 1GA0A 3AGDA 2ZQCA 5JYPA 4X69A 3BFDA 4IBRA 1VQQA 1YLZA 1HVBA 4P87A 3GMWA 4QY5A 3WS0A 1JWZA 2Y2NA 2Y2LA 4DE1A 1RCJA 3MKEA 2DCFA 1KE3A 3VOYA 1SCWA 5EOEA 2XD1A 1LL5A 4GDBA 3FKVA 3NBLA 4OP5A 1FOFA 1MWSA 1XA7A 3NDEA 5EE8A 3BLMA 2JBFA 4P0MA 4X68A 1ES4A 1W8YA 4B4ZA 4S2MA 3HLEA 4P85A 4QJGA 3UPOA 1EI5A 3ZVTA 1BSGA 2Y2HA 4OQHA 4R4RA 4B4XA 3IH8A 3RJUA 4WMCD 4EBNA 3EQUA 4OPYA 3UDIA 4S2OA 5CGXA 1WYCA 2OSUA 3IF6B 1KVLA 1K56D 1TDLA 1OMEA 3G30A 4MBKA 4YINA 5FI7A 4ID4A 4LCMA 3WRZA 1BLSA 1FR1A 4X6TA 4UA9A 5DF9A 5E2HA 4NK3A 4PMAA 2I72A 3WRTA 4GDNA 3CZDA 3HUMA 1E3UA 4KZ5A 4X53A 4JF6A 4BL2A 1MBLA 1LL9A 1VM1A 4OVDA 2Y2OA 3GSGA 5GLCA 3IF6C 1NY0A 3HLWA 5KZHA 3V5MA 2V20A 1IYOA 1K38A 4X56A 3O86A 1W7FA 2BLSA 4IVKA 3O88A 3PBNA 5FQJA 2XF3A 2FFYA 1CI9A 3IQAA 1BLHA 5GL9A 1ES2A 3FYZA 3UE1A 2P9VA 3CG5A 3PBOA 2C5WB 1N4OA 1YMSA 4U3TA 4Y0TA 3E2KA 4CJNA 4Q8IA 3OCNA 3IXBA 1IKGA 4KQOA 1XX2A 1K6SA 2ZC3B 3GVBA 5A92A 1LLBA 2J7VA 3WWXA 1O07A 2EFUA 5FI2A 5AQ7A 3SH8A 4ZAMA 2WZZA 3N8LA 3S1YA 5M18A 1FCMA 3A3EA 5TR7A 2XFSA 5I94A 2PBYA 4FH4A 3N4IA 4E3LA 1W8QA 3VP0A 1TVFA 3AGFA 3CJMA 1MY8A 2G2UA 1YLYA 2R9XA 2WGWA 2JC7A 2ZC4B 3BECA 3PBSA 3HUOA 4BQMA 5CEBA 2H0YA 4OKPA 4RVAA 2HP5A 5FSRA 5GHYA 1PWDA 2H0TA 4N1XA 2WZXA 2IWCA 3GV9A 1H8ZA 1M6KA 3VFFA 4DDYA 4C3QA 3OPRA 5HW3A 4K0WA 4OQIA 3MXRA 1NXYA 4KZ3A 3A3JA 3VP3A 3IF5A 4B88A 3MZEA 1ESUA 5CEDA 4EBPA 4YFMA 1G6AA 3Q7VB 4CPKA 5AQ9A 3UDXA 4JLFA 2ZD8A 4XUZA 2DRWA 4E3JA 5G18A 4QY6A 2XFTA 4S2PA 1J9MA 3OCLA 1HD8A 4KZ6A 4N9KA 1LHYA 5CXWA 5E2EA 1TEMA 4L0LA 1RP5A 3DWKA 4LV0A 5FAQA 3UN7A 5GLAA 1S0WA 2DNSA 2UWXA 4IEDA 3TSGA 5CTNA 2QZ6A 4HBTA 1GHPA 2C6WB 3ITBA 2IWBA 3N7WA 3UE3A 3BFCA 5EVIB 4E6WA 3FWLA 4E3OA 2HP6A 5CGSA 4Y7PA 3BYDA 1ERQA 4K0XA 2P74A 1I2SA 4JXGA 4DXBA 3ZGAB 4OLDA 4DDSA 5BOHA 1BUEA 1KVMA 1K55A 1PZPA 2ZMAA 4UA6A 1H5XA 1YLTA 4WMCA 5FQIA 1BLCA 1K56A 4KZ9A 4O7DA 1AXBA 1BLPA 5EVIC 1PIOA 1E4DA 1RGZA 3HL9A 1IEMA 3GTCA 4PM8A 1NZUA 4WZ5C 1PI4A 3UE0A 3OPLA 4DF6A 2J8YA 3BFGA 4OH0A 4E3KA 5CTMA 3EQVA 4Z9QA 3VP2A 3FKWA 4BD0A 3A3FA 3S22A 1CEFA 1I5QA 4F94A 4Y0OA 3QHYA 1L0GA 2OLUA 2IWDA 3IHAA 4HBUA 4MBHA 2E8IA 1HZOA 5EVLA 2HDRA 3DWZA 4RYEA 4LV3A 4BL3A 1DY6A 1RGYA 3BM6A 3G34A 3NI9A 1EROA 2FFFB 4JF5A 1KGFA 4JBFA 2ZQ8A 4HEFA 1CEGA 1WYBA 3G35A 4S2IA 2ZC6B 1FSYA 5EUAA 4ZJ3A 1I2WA 1G68A 3NCKA 2ZM0A 4JF4A 4OOLA 1PW1A 5AQBA 3MBZA 1KGGA 3FV7A 4WELA 3ZG5A 5HAIA 2X01A 3WS1A 3ZDJA 2EXAA 1KGEA 2XD5A 3V3RA 1XA1A 3IXHA 2XR0A 3A3IA 1PW8A 1YLPA 5EVID 3A3DA 5TGFA 4LV1A 4RX3A 3ZG9B 5L2FA 4EV4A 2Y2IA 3G32A 5F83A 3C7UA 4GKUA 2WAEA 5FASA 3NDGA 3Q81A 3GR2A 5E2GA 5GHXA 3BFFA 3MZDA 5FI6A 1XGIA 4GD6A 4DE3A 4FSFA 4IVIA 4E3MA 1K54C 1MPLA 3C4PA 3IF6A 4S2LA 1IYQA 3BLSA 4WZ4A 3PBTA 3VFHA 4BD1A 4N9LA 4OOMA 1E25A 5DTSA 3W8KA 1GA9A 5FQ9A 5CECA 1JTDA 1SHVA 3JYIA 4MLLA 4N1HA 2WK0A 4E6XA 2Y2PA 4MEZA 3FZCA 1JTGA 1ESIA 4GB7A 5F82A 3WS5A 3SOIA 4OONA 1IKIA 4U0XA 1XGJA 4OP8A 3N6IA 3MXSA 3IT9A 1ALQA 2A3UA 2X71A 1EWZA 4WYYA 4JXSA 2JCHA 4KZ7A 3HLDA 4R0QA 4XXRA 5DTTA 3SH9A 1ZC2A 2H5SA 2XQZA 2Y59A 3IXGA 1W5DA 3LY4A 3N8SA 1CI8A 4GD8A 4OPQA 3Q82A 1Z6FA 3LEZA 3NIAA 5E43A 5J8XA 3ITAA 4OLGA 2JE5A 3M6HA 3HLBA 2Y2JA 3SH7A 4GNUA 1KDSA 2Y91A 3TOIA 1L0DA 5CGWA 4A5RA 1DJCA 3TG9A 1K4EA 2XK1A 2EX6A 2ZLYA 2A49A 1MKIA 2HP9A 3E2LA 2Y2GA 3O3VA 3C4OA 3D4FA 2J9OA 3IXDA 3GRJA 2G2WA 1K25A 4PM5A 3HLFA 1YQSA 3PBRA 3Q1FA 4KZAA 4ZBEA 1DJAA 5HAPA 4C6YA 1ONHA 1WE4A 3G31A 3BRMA 1BTLA 1GHMA 1K6RA 2XDMA 3ZG7B 3QNCA 4QHCA 5DVAA 3AGEA 2QMIA 3ZG8B 3DTMA 4KENB 1BZAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSW A;  4KG6 A;  4OPR A;  1YLW A;  3HLC A;  3LY3 A;  3OPH A;  2ZM8 A;  4EWF A;  3I7J A;  4R4S A;  1FQG A;  1JWP A;  1MWT A;  5D3O A;  4ZTK A;  3SS5 A;  3ZVW A;  3UPP A;  3ISG A;  2B5R A;  2X02 A;  3S4X A;  4UHU A;  4KG2 A;  4PM7 A;  5HX9 A;  3UDF A;  5DTK A;  5HAQ A;  5E2F A;  5EPH A;  1L2S A;  1FCO A;  3MFD A;  4RA7 A;  5U47 A;  2WKH A;  2V1Z A;  4KQQ A;  4ZJ2 A;  3UNW A;  1XPB A;  2Y2K A;  5F1G A;  4LV2 A;  4DRT A;  4OOY A;  1M40 A;  1W79 A;  1K57 C;  4WEJ A;  3M2K A;  3W4O A;  1PYY A;  4S2J A;  4Y0U A;  4S2N C;  5F1F A;  1Y54 A;  3V50 A;  2EX9 A;  3PBQ A;  3Q7V A;  1TDG A;  4JXV A;  1ZG6 A;  2ZM2 A;  1YMX A;  1JVJ A;  5M19 A;  1ZG4 A;  3IHB A;  1ES5 A;  1YLJ A;  2XEP A;  4PM9 A;  1LI0 A;  3OPP A;  4KZ8 A;  5TFQ A;  3ZCZ A;  4EBL A;  3O87 A;  1ONG A;  3CMZ A;  3ZFZ A;  1L0E A;  4R23 A;  2PU2 A;  4M3K A;  3W4P A;  3Q7Z A;  4XUX A;  4DE2 A;  2ZQ9 A;  1ZKJ A;  1JWV A;  4OQG A;  1BT5 A;  3M6B A;  4UAA A;  2EXB A;  5EVI A;  1XXM A;  2P9V B;  3PAG A;  4EQI A;  3NY4 A;  4ZDX A;  1H8Y A;  2Y4A A;  1K57 A;  1ERM A;  1QME A;  1SDN A;  2EX2 A;  4WZ5 A;  4S2N A;  4PM6 A;  5GHZ A;  2HDU A;  3UO9 A;  3W4Q A;  2VGJ A;  3IWI A;  1BUL A;  4FH2 A;  4R3B A;  4RX2 A;  1NYY A;  2EX8 A;  4QD4 A;  1YM1 A;  3SS3 A;  2OLV A;  2WKE A;  5EOO A;  4LEN A;  2ZQD A;  2WUQ A;  2ZQ7 A;  5AQA A;  2Z2L B;  2XGN A;  3P09 A;  3RXW A;  3BFE A;  3MKF A;  2WAF A;  4BJP A;  3C5A A;  1NRF A;  4GN2 A;  5CER A;  3G4P A;  2Y2Q A;  1XKZ A;  4JXW A;  4E3N A;  4S2K A;  3IH9 A;  4KQR A;  4R1G A;  4BEN A;  2ZC5 B;  2WGW B;  1IEL A;  2PU4 A;  4LCL A;  4K91 A;  5FA7 A;  5HFO A;  1IYS A;  5FQM A;  3SS4 A;  3LO7 A;  2HDQ A;  3ZNT A;  3Q07 A;  4NET A;  3QNB A;  5A91 A;  4OQ0 A;  4WEK A;  3ZNY A;  3BEB A;  2EFX A;  3C7V A;  3N8R A;  1Q2P A;  2WKI A;  3HBR A;  3GQZ A;  1PWG A;  2GDN A;  3RXX A;  5KMW A;  1L0F A;  1KE4 A;  2RCX A;  4KG5 A;  5CHU A;  3VMA A;  5KSC A;  3UY6 A;  2XLN A;  1KE0 A;  4KZ4 A;  1E3U D;  1O7E A;  1QMF A;  2BG1 A;  3WS2 A;  5FQK A;  4X55 A;  2WAD A;  5DF8 A;  4P6B A;  5CHM A;  3VP1 A;  5HAR A;  3VSK A;  1YT4 A;  3VP4 A;  1NZO A;  1Q2Q A;  3OZH A;  3HRE A;  4MBF A;  4BLM A;  3DW0 A;  4QB8 A;  1IYP A;  2ZQA A;  2QPN A;  3PTE A;  4FCF A;  1C3B A;  4R3J A;  3V39 A;  1NYM A;  2J9P A;  1XP4 A;  4FD8 A;  4GZB A;  5HL1 A;  3WS4 A;  1CK3 A;  2V2F F;  4EUZ A;  5GLD A;  2VGK A;  1HTZ A;  1GCE A;  1S6R A;  3G2Z A;  4E3I A;  1K54 A;  4JKT A;  3IWQ A;  1MWR A;  5JYO A;  4DKI A;  1K4F A;  4KZB A;  3ZG0 A;  2Y55 A;  4PPR A;  5DF7 A;  3PAE A;  3VSL A;  2Z2M B;  2ZC7 A;  2Q9M A;  3M2J A;  2RL3 A;  2XH9 A;  2WGV A;  1DJB A;  5FQQ A;  5CRF A;  5GLB A;  2Q9N A;  2WGI A;  2WYX A;  2ZJ9 A;  2H10 A;  1MWU A;  3HVF A;  3IWO A;  3V3S A;  4QU3 A;  3MZF A;  3LCE A;  4DXC A;  5FAP A;  1SKF A;  5KSH A;  2OV5 A;  5M1A A;  1GHI A;  3B3X A;  4HES A;  4OPZ A;  1FR6 A;  4DE0 A;  3G2Y A;  1K55 C;  4D2O A;  2R9W A;  1PWC A;  1U60 A;  4WM9 A;  5FDH A;  5IHV A;  4ZJ1 A;  5A90 A;  1PZO A;  2CC1 A;  4GOG A;  4H8R A;  4IBX A;  3HLG A;  1MXO A;  5EEC A;  1ES3 A;  5CHJ A;  4WBG A;  1FCN A;  4N92 A;  3ZHH A;  5A93 A;  1NJ4 A;  3VOZ A;  2Y2M A;  3HUN A;  1N9B A;  1SDE A;  1PI5 A;  1KDW A;  3UPN A;  3OC2 A;  5FAO A;  3NC8 A;  4UA7 A;  4MNR A;  4C75 A;  1LI9 A;  2HDS A;  3P98 A;  4JPM A;  5FAT A;  4U0T A;  2HPB A;  1GA0 A;  3AGD A;  2ZQC A;  5JYP A;  4X69 A;  3BFD A;  4IBR A;  1VQQ A;  1YLZ A;  1HVB A;  4P87 A;  3GMW A;  4QY5 A;  3WS0 A;  1JWZ A;  2Y2N A;  2Y2L A;  4DE1 A;  1RCJ A;  3MKE A;  2DCF A;  1KE3 A;  3VOY A;  1SCW A;  5EOE A;  2XD1 A;  1LL5 A;  4GDB A;  3FKV A;  3NBL A;  4OP5 A;  1FOF A;  1MWS A;  1XA7 A;  3NDE A;  5EE8 A;  3BLM A;  2JBF A;  4P0M A;  4X68 A;  1ES4 A;  1W8Y A;  4B4Z A;  4S2M A;  3HLE A;  4P85 A;  4QJG A;  3UPO A;  1EI5 A;  3ZVT A;  1BSG A;  2Y2H A;  4OQH A;  4R4R A;  4B4X A;  3IH8 A;  3RJU A;  4WMC D;  4EBN A;  3EQU A;  4OPY A;  3UDI A;  4S2O A;  5CGX A;  1WYC A;  2OSU A;  3IF6 B;  1KVL A;  1K56 D;  1TDL A;  1OME A;  3G30 A;  4MBK A;  4YIN A;  5FI7 A;  4ID4 A;  4LCM A;  3WRZ A;  1BLS A;  1FR1 A;  4X6T A;  4UA9 A;  5DF9 A;  5E2H A;  4NK3 A;  4PMA A;  2I72 A;  3WRT A;  4GDN A;  3CZD A;  3HUM A;  1E3U A;  4KZ5 A;  4X53 A;  4JF6 A;  4BL2 A;  1MBL A;  1LL9 A;  1VM1 A;  4OVD A;  2Y2O A;  3GSG A;  5GLC A;  3IF6 C;  1NY0 A;  3HLW A;  5KZH A;  3V5M A;  2V20 A;  1IYO A;  1K38 A;  4X56 A;  3O86 A;  1W7F A;  2BLS A;  4IVK A;  3O88 A;  3PBN A;  5FQJ A;  2XF3 A;  2FFY A;  1CI9 A;  3IQA A;  1BLH A;  5GL9 A;  1ES2 A;  3FYZ A;  3UE1 A;  2P9V A;  3CG5 A;  3PBO A;  2C5W B;  1N4O A;  1YMS A;  4U3T A;  4Y0T A;  3E2K A;  4CJN A;  4Q8I A;  3OCN A;  3IXB A;  1IKG A;  4KQO A;  1XX2 A;  1K6S A;  2ZC3 B;  3GVB A;  5A92 A;  1LLB A;  2J7V A;  3WWX A;  1O07 A;  2EFU A;  5FI2 A;  5AQ7 A;  3SH8 A;  4ZAM A;  2WZZ A;  3N8L A;  3S1Y A;  5M18 A;  1FCM A;  3A3E A;  5TR7 A;  2XFS A;  5I94 A;  2PBY A;  4FH4 A;  3N4I A;  4E3L A;  1W8Q A;  3VP0 A;  1TVF A;  3AGF A;  3CJM A;  1MY8 A;  2G2U A;  1YLY A;  2R9X A;  2WGW A;  2JC7 A;  2ZC4 B;  3BEC A;  3PBS A;  3HUO A;  4BQM A;  5CEB A;  2H0Y A;  4OKP A;  4RVA A;  2HP5 A;  5FSR A;  5GHY A;  1PWD A;  2H0T A;  4N1X A;  2WZX A;  2IWC A;  3GV9 A;  1H8Z A;  1M6K A;  3VFF A;  4DDY A;  4C3Q A;  3OPR A;  5HW3 A;  4K0W A;  4OQI A;  3MXR A;  1NXY A;  4KZ3 A;  3A3J A;  3VP3 A;  3IF5 A;  4B88 A;  3MZE A;  1ESU A;  5CED A;  4EBP A;  4YFM A;  1G6A A;  3Q7V B;  4CPK A;  5AQ9 A;  3UDX A;  4JLF A;  2ZD8 A;  4XUZ A;  2DRW A;  4E3J A;  5G18 A;  4QY6 A;  2XFT A;  4S2P A;  1J9M A;  3OCL A;  1HD8 A;  4KZ6 A;  4N9K A;  1LHY A;  5CXW A;  5E2E A;  1TEM A;  4L0L A;  1RP5 A;  3DWK A;  4LV0 A;  5FAQ A;  3UN7 A;  5GLA A;  1S0W A;  2DNS A;  2UWX A;  4IED A;  3TSG A;  5CTN A;  2QZ6 A;  4HBT A;  1GHP A;  2C6W B;  3ITB A;  2IWB A;  3N7W A;  3UE3 A;  3BFC A;  5EVI B;  4E6W A;  3FWL A;  4E3O A;  2HP6 A;  5CGS A;  4Y7P A;  3BYD A;  1ERQ A;  4K0X A;  2P74 A;  1I2S A;  4JXG A;  4DXB A;  3ZGA B;  4OLD A;  4DDS A;  5BOH A;  1BUE A;  1KVM A;  1K55 A;  1PZP A;  2ZMA A;  4UA6 A;  1H5X A;  1YLT A;  4WMC A;  5FQI A;  1BLC A;  1K56 A;  4KZ9 A;  4O7D A;  1AXB A;  1BLP A;  5EVI C;  1PIO A;  1E4D A;  1RGZ A;  3HL9 A;  1IEM A;  3GTC A;  4PM8 A;  1NZU A;  4WZ5 C;  1PI4 A;  3UE0 A;  3OPL A;  4DF6 A;  2J8Y A;  3BFG A;  4OH0 A;  4E3K A;  5CTM A;  3EQV A;  4Z9Q A;  3VP2 A;  3FKW A;  4BD0 A;  3A3F A;  3S22 A;  1CEF A;  1I5Q A;  4F94 A;  4Y0O A;  3QHY A;  1L0G A;  2OLU A;  2IWD A;  3IHA A;  4HBU A;  4MBH A;  2E8I A;  1HZO A;  5EVL A;  2HDR A;  3DWZ A;  4RYE A;  4LV3 A;  4BL3 A;  1DY6 A;  1RGY A;  3BM6 A;  3G34 A;  3NI9 A;  1ERO A;  2FFF B;  4JF5 A;  1KGF A;  4JBF A;  2ZQ8 A;  4HEF A;  1CEG A;  1WYB A;  3G35 A;  4S2I A;  2ZC6 B;  1FSY A;  5EUA A;  4ZJ3 A;  1I2W A;  1G68 A;  3NCK A;  2ZM0 A;  4JF4 A;  4OOL A;  1PW1 A;  5AQB A;  3MBZ A;  1KGG A;  3FV7 A;  4WEL A;  3ZG5 A;  5HAI A;  2X01 A;  3WS1 A;  3ZDJ A;  2EXA A;  1KGE A;  2XD5 A;  3V3R A;  1XA1 A;  3IXH A;  2XR0 A;  3A3I A;  1PW8 A;  1YLP A;  5EVI D;  3A3D A;  5TGF A;  4LV1 A;  4RX3 A;  3ZG9 B;  5L2F A;  4EV4 A;  2Y2I A;  3G32 A;  5F83 A;  3C7U A;  4GKU A;  2WAE A;  5FAS A;  3NDG A;  3Q81 A;  3GR2 A;  5E2G A;  5GHX A;  3BFF A;  3MZD A;  5FI6 A;  1XGI A;  4GD6 A;  4DE3 A;  4FSF A;  4IVI A;  4E3M A;  1K54 C;  1MPL A;  3C4P A;  3IF6 A;  4S2L A;  1IYQ A;  3BLS A;  4WZ4 A;  3PBT A;  3VFH A;  4BD1 A;  4N9L A;  4OOM A;  1E25 A;  5DTS A;  3W8K A;  1GA9 A;  5FQ9 A;  5CEC A;  1JTD A;  1SHV A;  3JYI A;  4MLL A;  4N1H A;  2WK0 A;  4E6X A;  2Y2P A;  4MEZ A;  3FZC A;  1JTG A;  1ESI A;  4GB7 A;  5F82 A;  3WS5 A;  3SOI A;  4OON A;  1IKI A;  4U0X A;  1XGJ A;  4OP8 A;  3N6I A;  3MXS A;  3IT9 A;  1ALQ A;  2A3U A;  2X71 A;  1EWZ A;  4WYY A;  4JXS A;  2JCH A;  4KZ7 A;  3HLD A;  4R0Q A;  4XXR A;  5DTT A;  3SH9 A;  1ZC2 A;  2H5S A;  2XQZ A;  2Y59 A;  3IXG A;  1W5D A;  3LY4 A;  3N8S A;  1CI8 A;  4GD8 A;  4OPQ A;  3Q82 A;  1Z6F A;  3LEZ A;  3NIA A;  5E43 A;  5J8X A;  3ITA A;  4OLG A;  2JE5 A;  3M6H A;  3HLB A;  2Y2J A;  3SH7 A;  4GNU A;  1KDS A;  2Y91 A;  3TOI A;  1L0D A;  5CGW A;  4A5R A;  1DJC A;  3TG9 A;  1K4E A;  2XK1 A;  2EX6 A;  2ZLY A;  2A49 A;  1MKI A;  2HP9 A;  3E2L A;  2Y2G A;  3O3V A;  3C4O A;  3D4F A;  2J9O A;  3IXD A;  3GRJ A;  2G2W A;  1K25 A;  4PM5 A;  3HLF A;  1YQS A;  3PBR A;  3Q1F A;  4KZA A;  4ZBE A;  1DJA A;  5HAP A;  4C6Y A;  1ONH A;  1WE4 A;  3G31 A;  3BRM A;  1BTL A;  1GHM A;  1K6R A;  2XDM A;  3ZG7 B;  3QNC A;  4QHC A;  5DVA A;  3AGE A;  2QMI A;  3ZG8 B;  3DTM A;  4KEN B;  1BZA A; 
#chains in the Genus database with same CATH topology
 4KG6 A;  1YLW A;  3LY3 A;  2ZM8 A;  3I7J A;  1LL8 A;  4X1M A;  3T50 A;  1JWP A;  4ZTK A;  2FH5 A;  3EWK A;  3ISG A;  2L0W A;  3S4X A;  1YSQ A;  2ZL1 B;  5E2F A;  5EPH A;  3MFD A;  5U47 A;  3E0Y A;  4HJ4 A;  3NOU C;  1DP8 A;  4DRT A;  3W4O A;  3M2K A;  3TE8 A;  5F1F A;  2EX9 A;  3PBQ A;  5L07 A;  1TDG A;  4JXV A;  1ZG6 A;  4NXE A;  1V9Z A;  2VLG A;  4EBL A;  3T1X A;  2PHY A;  2J3T D;  3SZT A;  4XUX A;  4ARZ B;  4JGP A;  2JKR M;  4EXO A;  1ZKJ A;  4UAA A;  5EVI A;  3BY8 A;  4HP9 A;  1SDN A;  2EX2 A;  5GHZ A;  4PM6 A;  2VGJ A;  3IWI A;  4R3B A;  1NYY A;  3K3C A;  4BMW A;  2KDK A;  3JVV A;  1PFL A;  4K08 A;  5DKL A;  1CQA A;  3C5A A;  2V0U A;  1NRF A;  4GN2 A;  5CER A;  3PXP A;  4E3N A;  4R1G A;  4EU0 A;  4EUV A;  3MMH A;  2XRN A;  5FA7 A;  1VHM A;  4I38 A;  1IYS A;  4NXB A;  3IX4 A;  5TJJ A;  3QNB A;  3T4O A;  2WKI A;  3LFV A;  3UB6 A;  3GQZ A;  2GDN A;  4ETZ A;  3VMA A;  4KG5 A;  5KSC A;  3H82 B;  1UGU A;  2XLN A;  4MN6 A;  3LIE A;  1O7E A;  1QMF A;  3WS2 A;  2VGL S;  2R78 A;  4GCZ A;  5DF8 A;  2JKG A;  3VSK A;  4EES A;  3HRE A;  4MBF A;  1OTB A;  3DW0 A;  2QJ7 A;  4R3J A;  3V39 A;  4KUO A;  4Q0I A;  5F69 A;  5GLD A;  2HZ5 A;  3NJA A;  3IWQ A;  4IHQ A;  5JYO A;  3DAV A;  3ZG0 A;  4PPR A;  1HLU P;  3PAE A;  3VSL A;  2HF6 A;  2Z2M B;  2RL3 A;  3P7N A;  1G6O A;  2WYX A;  2H10 A;  1MWU A;  3IWO A;  4X1L A;  1TS6 A;  3MZF A;  4DN0 A;  4DXC A;  5KSH A;  2OWJ A;  1GHI A;  5M1A A;  3B3X A;  4HES A;  1FR6 A;  4DE0 A;  1PWC A;  3H7W B;  4EQ1 A;  2WKR A;  4ZJ1 A;  4GOG A;  4H8R A;  4IBX A;  2UV0 E;  5G4Y A;  5A93 A;  2Y2M A;  1PI5 A;  3OC2 A;  1LI9 A;  3OBF A;  3TRC A;  3AGD A;  5JYP A;  4X69 A;  3BFD A;  3U4L P;  1YLZ A;  4FOF A;  2Y2L A;  4EER A;  2O9A A;  2DCF A;  1KE3 A;  3VOY A;  1SCW A;  5EOE A;  3UMD A;  3FKV A;  2I9V A;  3MQ0 A;  4PKY A;  4X68 A;  3MR0 A;  4S2M A;  3O5Y A;  3UPO A;  3QP6 A;  3ZVT A;  4WMC D;  2OSU A;  4Q0J A;  3S7N A;  4LCM A;  3WRZ A;  1BLS A;  3BY9 A;  5DF9 A;  2I72 A;  3HUM A;  3EGD C;  5FL3 A;  4JF6 A;  4BL2 A;  1MBL A;  1LL9 A;  4OVD A;  5DKK A;  3HLW A;  2Z6C A;  5KZH A;  2V20 A;  1K38 A;  3KYE A;  2KX6 A;  5TBM A;  1PRQ A;  5FQJ A;  2HJ9 C;  4MCW A;  1CI9 A;  3IQA A;  1BLH A;  1OTA A;  2P9V A;  1YAX A;  2QHK A;  1YMS A;  4U3T A;  4WF0 A;  5G4Z A;  3E2K A;  4Q8I A;  1IKG A;  4KQO A;  2EWV A;  1O07 A;  5FI2 A;  3SH8 A;  4ZAM A;  4KQD A;  4R3A A;  1FCM A;  1F98 A;  3A0V A;  2G7U A;  2XFS A;  5J7E A;  3N4I A;  4E3L A;  3VP0 A;  2R9X A;  2ZC4 B;  1YLY A;  2WGW A;  1S67 L;  3TJZ C;  3R7W A;  2H0Y A;  5GHY A;  4Y13 A;  3VFF A;  2PBD P;  3A0R A;  3MXR A;  1NXY A;  4B88 A;  5CED A;  4YFM A;  4CPK A;  3IX8 A;  3IS2 A;  2V9A A;  1HD8 A;  1TEM A;  1RP5 A;  3DWK A;  2DNS A;  3TSG A;  5CTN A;  2QZ6 A;  4HBT A;  1GHP A;  5DFX A;  3ITB A;  1OT9 A;  1PNE A;  4UEY A;  3VE4 A;  4DXB A;  1STZ A;  1KVM A;  2ZMA A;  1YLT A;  4Y17 A;  1BLC A;  1XFN A;  4O7D A;  3QP8 A;  4KZ9 A;  3KYZ A;  3DTE A;  4WZ5 C;  3OPL A;  3EEH A;  3BFG A;  5KIZ A;  4Z9Q A;  1DP6 A;  4F3L A;  4F94 A;  2OLU A;  1ODV A;  3IHA A;  4LV3 A;  4BL3 A;  3KYQ A;  5HD3 A;  1YKD A;  4JBF A;  5J4E A;  3LID A;  2V1B A;  1MZU A;  2ZC6 B;  1FSY A;  5EUA A;  4ZJ3 A;  2ZM0 A;  3MBZ A;  3FV7 A;  3WS1 A;  3ZDJ A;  1KGE A;  3DTK A;  3UB7 A;  4I3J A;  4HNB A;  3MFX A;  3A3D A;  4HH3 A;  1OT6 A;  4LV1 A;  5L2F A;  3T4L A;  3G32 A;  4JGO A;  4GKU A;  2WAE A;  3T12 B;  1OTI A;  5FAS A;  5DJU A;  3GR2 A;  3BFF A;  4FSF A;  1K54 C;  1MPL A;  4WZ4 A;  3VFH A;  1Y4O A;  2D02 A;  4IUH A;  1GA9 A;  5AVF A;  3JYI A;  4N1H A;  2Y2P A;  4MEZ A;  3FZC A;  3MF0 A;  1IKI A;  2PR5 A;  4KZ7 A;  2Y59 A;  4LRZ E;  1W5D A;  3N8S A;  5HPI A;  1D1J A;  4OLG A;  2Y2J A;  3SH7 A;  4GNU A;  3TOI A;  1DJC A;  3TG9 A;  2EX6 A;  2VV7 A;  3O3V A;  1IFQ A;  4I39 A;  3VOL A;  2G2W A;  1SKO A;  3PBR A;  4B93 A;  3QP2 A;  4KZA A;  2J3T C;  5IU1 A;  4C6Y A;  1OPX A;  5DVA A;  4XT2 B;  1FQG A;  5D3O A;  1MWT A;  1VET B;  4KG2 A;  5HL6 A;  3MJQ A;  4R38 A;  1L2S A;  1FCO A;  4ZJ2 A;  1AWI A;  2Y2K A;  1OJ5 A;  4JGR A;  3ZQ5 A;  2VV8 A;  4WEJ A;  2B95 A;  3JPU A;  3V50 A;  3Q7V A;  1T1C A;  1JVJ A;  5M19 A;  1ZG4 A;  3IHB A;  4HQA A;  3ZCZ A;  1P9R A;  3CMZ A;  2OWH A;  1OJG A;  2PU2 A;  3W4P A;  4GS9 B;  3S7Q A;  4DE2 A;  4KUK A;  2ZQ9 A;  1BT5 A;  1GSV A;  5DFY A;  2A24 B;  1H8Y A;  1K57 A;  4WZ5 A;  4S2N A;  4RX2 A;  3SS3 A;  2MJ6 A;  5AQA A;  2WUQ A;  2GNX A;  3RXW A;  3MKF A;  1H0M A;  3KX0 X;  1XKZ A;  2ZC5 B;  2PU4 A;  4LCL A;  5FQM A;  1LSV A;  3LO7 A;  1Q2P A;  5EM0 A;  4HHD A;  3RXX A;  5KMW A;  1L0F A;  2JHE A;  5CHU A;  4ETX A;  4UQI M;  3UY6 A;  1E3U D;  3PR6 A;  3CWF A;  2WAD A;  4P6B A;  3TW8 A;  1NZO A;  1Q2Q A;  1A0K A;  4IJG A;  4QB8 A;  4FCF A;  4D60 A;  2J9P A;  3F1O A;  3WS4 A;  1CK3 A;  1GCE A;  1S6R A;  1K54 A;  4JKT A;  1XJ3 A;  2Y55 A;  4BBT A;  5DF7 A;  4CLC E;  2V0W A;  2WGV A;  1DJB A;  2K2N A;  2QJ5 A;  3QP5 A;  5CRF A;  2Q9N A;  4QU3 A;  2HV1 A;  4EEP A;  3G2Y A;  1U60 A;  4WM9 A;  5FDH A;  5A90 A;  2QWS A;  3HJK A;  4WBG A;  4HP4 A;  3ZHH A;  3VOZ A;  3C8C A;  4DMZ A;  3UPN A;  5FAO A;  4EET B;  3QP4 A;  4MNR A;  4GHI A;  1WA9 A;  3P98 A;  2ZQC A;  1VQQ A;  4PAU A;  3GMW A;  5L09 A;  1JWZ A;  2VA0 A;  1YPR A;  3S7O A;  3NHQ A;  5F5Y A;  3LR0 A;  2VZW A;  4L9G A;  4HJ3 A;  3D72 A;  4BBV A;  1LL5 A;  1TF1 A;  4X25 A;  3NDE A;  5EE8 A;  5FEG A;  2JBF A;  2W1T B;  4P0M A;  1W8Y A;  4QWO A;  3H7W A;  5J3W A;  4I3A A;  4CQH A;  2O0Y A;  3RJU A;  1DP9 A;  3V67 A;  2P04 A;  3EQU A;  4P6Z S;  5CGX A;  2Z6D A;  5HWV A;  1FR1 A;  4X6T A;  4PMA A;  4O8G A;  4GDN A;  4X53 A;  3GSG A;  3IF6 C;  4H6J A;  1NY0 A;  1P9W A;  2V8C A;  3CUE C;  1IYO A;  2KOI A;  3G6O A;  2K7S A;  2FFY A;  1ES2 A;  3UE1 A;  3CG5 A;  2C5W B;  1XFQ A;  1G5U A;  4EW7 A;  3T4S A;  4CJN A;  2EA9 A;  1ACF A;  4R70 A;  1XX2 A;  1LSX A;  2ZC3 B;  5A92 A;  2J7V A;  2EFU A;  1P97 A;  2WZZ A;  3HJI A;  3S1Y A;  3T4J A;  3A3E A;  2PBY A;  2AVX A;  3BEC A;  5CEB A;  3LYX A;  4RVA A;  1PWD A;  3UB5 P;  2WZX A;  3GV9 A;  1H8Z A;  4ESP A;  4DDY A;  4CLC A;  1W63 M;  3VP3 A;  3MZE A;  1ESU A;  3UDX A;  4JLF A;  3KO6 A;  1J9M A;  3BW6 A;  1LHY A;  4CLC D;  4NG2 A;  4L0L A;  4LV0 A;  5FAQ A;  4HI4 A;  4IED A;  2UWX A;  3MSH A;  2C6W B;  3UE3 A;  5EVI B;  4E6W A;  2K31 A;  3F1P A;  4Y7P A;  1ERQ A;  5DJT A;  2P74 A;  5HWW A;  3ZGA B;  4DDS A;  1BUE A;  2PR6 A;  1PZP A;  4WMC A;  1LSW A;  2ZMV A;  1AXB A;  1T1B A;  1PIO A;  1E4D A;  1IEM A;  4PM8 A;  3NUL A;  1PI4 A;  1KOU A;  4GLQ A;  2O9C A;  1F2K A;  2LB9 A;  3FKW A;  3A3F A;  3S22 A;  3K2N A;  4Y0O A;  1DY6 A;  3EGX C;  1KGF A;  5C5K A;  4I5S A;  4Y15 A;  3RH8 B;  3VE3 A;  3OLO A;  3E4Q A;  2P7J A;  4S2I A;  2V8F A;  4JF4 A;  1PW1 A;  5AQB A;  1GSX A;  4WN5 A;  2EWW A;  2XR0 A;  3FPV A;  3ZG9 B;  2JKR I;  3MZD A;  3CPT A;  4DE3 A;  4IVI A;  3IF6 A;  3C4P A;  3PBT A;  5CX7 A;  4PHT A;  2OOL A;  3CUE A;  1NLY A;  1E25 A;  3RTY A;  2M7U A;  5FQ9 A;  4E6X A;  3MXQ A;  4U0X A;  2A3U A;  4WYY A;  2LB5 A;  2X71 A;  5DTT A;  4JXS A;  3HLD A;  4Y0T A;  4OPQ A;  5HW3 A;  3Q82 A;  1Z6F A;  3LEZ A;  3NIA A;  5J8X A;  3M6H A;  2XSS A;  2Q0O A;  5F6A A;  4O01 A;  2Y91 A;  1L0D A;  1K4E A;  2ZLY A;  2Y2G A;  3C4O A;  3LIF A;  3HLF A;  3Q1F A;  5AVE A;  3E4P A;  3BRM A;  1BTL A;  1K6R A;  3QNC A;  4QHC A;  3AGE A;  3ZG8 B;  2HJE A;  3IBJ A;  1FSW A;  4OPR A;  3HCY A;  4EWF A;  3OPH A;  2PT7 A;  2W1R A;  4YNR A;  3ZVW A;  3UPP A;  2PDR A;  2B5R A;  4HJ6 A;  5HX9 A;  3UDF A;  4Y3I A;  2WKH A;  3ZYT A;  1CJF A;  4KQQ A;  3UNW A;  2E8J A;  5F1G A;  2L1M A;  4LV2 A;  3LR3 A;  1M40 A;  3T1S A;  1K57 C;  2PYP A;  4Y0U A;  4S2N C;  4WUJ A;  2ZM2 A;  5HSQ A;  1VEU A;  1LI0 A;  3OPP A;  4KZ8 A;  3O87 A;  1ONG A;  5A8B A;  2DMW A;  5TBM B;  4DJ2 A;  1JWV A;  4OQG A;  2EXB A;  1XXM A;  2P9V B;  3PAG A;  4EQI A;  3NY4 A;  3BWL A;  2Y4A A;  1ERM A;  2HDU A;  3W4Q A;  4RQ9 A;  2XRO A;  4FH2 A;  3D9Y A;  4R6L A;  2GJ3 A;  1NWZ A;  1NLZ A;  2JN7 A;  1YM1 A;  2OLV A;  5EOO A;  4LEN A;  2XGN A;  1TS8 A;  3BFE A;  2M1C A;  2WAF A;  3G4P A;  2W3E A;  2Y2Q A;  2O99 A;  5LBR A;  2W3D A;  3CI6 A;  1K0K A;  5K5B A;  4S2K A;  2INW A;  4BEN A;  2WGW B;  1IEL A;  3SS4 A;  3R7W B;  1YSP A;  2HDQ A;  2ZMF A;  3ZNT A;  4NET A;  5A91 A;  1S4R A;  2EFX A;  1TS7 A;  4WL9 A;  1PWG A;  1KE4 A;  4KZ4 A;  5AJG A;  5FQK A;  4X55 A;  3ICY A;  2WKP A;  1YT4 A;  3VP4 A;  3F1N A;  4BLM A;  2XA7 S;  2ZQA A;  2QPN A;  3IS2 B;  1NYM A;  3R4K A;  1XP4 A;  4FD8 A;  4GZB A;  1V9Y A;  2V2F F;  4EUZ A;  2VGK A;  1HTZ A;  3CHW P;  3G2Z A;  4E3I A;  4DKI A;  1K4F A;  4KZB A;  2Q9M A;  4DJ3 A;  4PKY G;  2WGI A;  3V3S A;  4GW9 A;  1P0Z A;  1F5M A;  4QPR A;  1SKF A;  2OV5 A;  5MC7 A;  4OPZ A;  1K55 C;  2PYR A;  1Y28 A;  4F3L B;  5IHV A;  1PZO A;  3HLG A;  1MXO A;  1N9N A;  1ES3 A;  2Y79 A;  5EEC A;  4N92 A;  1NJ4 A;  3HUN A;  4HH2 A;  3NC8 A;  4C75 A;  4JPM A;  3H9W A;  2HPB A;  4MN5 A;  1CF0 A;  3A0S A;  1HVB A;  1XJ6 A;  4QY5 A;  2Y2N A;  3MKE A;  3IBR A;  1J3W A;  3W2Z A;  2A2L A;  2HGV A;  2XD1 A;  4OP5 A;  4L9E A;  1MWS A;  1XA7 A;  3BLM A;  3PHY A;  1ES4 A;  2YKH A;  4P85 A;  4QJG A;  2ZL1 A;  1FIL A;  3JVU A;  2Y2H A;  4EBN A;  2VEA A;  1T1A A;  3UDI A;  4S2O A;  1WYC A;  1KVL A;  1K56 D;  1OME A;  4MBK A;  2P08 A;  4YIN A;  4ID4 A;  3T4T A;  3WRT A;  5E2H A;  5L8M A;  4NK3 A;  3CZD A;  1E3U A;  2BAS A;  4KZ5 A;  5HD5 A;  2QYB A;  1XJ4 A;  3V5M A;  4X56 A;  2BLS A;  4IVK A;  3NOT C;  4ARZ A;  3LI8 A;  5GL9 A;  3FYZ A;  3PBO A;  2W1T A;  1N4O A;  3UB9 A;  1SKO B;  4CLC C;  3D3O A;  3OCN A;  1LLB A;  3IX3 A;  5AQ7 A;  1X0O A;  5HDC A;  2W3G A;  5TR7 A;  4FH4 A;  1TVF A;  3CJM A;  1MY8 A;  2G2U A;  2J80 A;  3DBA A;  2JC7 A;  3PBS A;  4BQM A;  4OKP A;  3NEC A;  2HP5 A;  5HPF A;  2H0T A;  4K0W A;  3FC7 A;  3H82 A;  3A3J A;  3IF5 A;  1FIK A;  1G6A A;  3Q7V B;  3LEQ A;  3EOI A;  2H28 A;  4XUZ A;  3MS6 A;  4MN7 A;  2XFT A;  4LGW A;  5CXW A;  5GLA A;  1S0W A;  2IWB A;  2W27 A;  3N7W A;  1EW0 A;  2Y8H A;  3BFC A;  4JGQ A;  4E3O A;  2HP6 A;  5CGS A;  3CLO A;  3BYD A;  1I2S A;  4JXG A;  1K55 A;  1H5X A;  1N9L A;  1DRM A;  1H8M A;  1RGZ A;  1NZU A;  1MC0 A;  4BBU A;  2J8Y A;  4OH0 A;  5CTM A;  3QHY A;  4YOF A;  4HBU A;  5EVL A;  1N9O A;  2HDR A;  3DWZ A;  3BJN A;  3G34 A;  3NI9 A;  2ZQ8 A;  4HEF A;  1CEG A;  5HWT A;  1WYB A;  1G68 A;  1I2W A;  5HDD A;  3NCK A;  3OOV A;  4P6Z M;  3ZG5 A;  5HAI A;  3P01 A;  3F1O B;  2EXA A;  3QP1 A;  2XD5 A;  3IXH A;  5EV0 A;  3A3I A;  2GZA A;  1PW8 A;  5EVI D;  3B47 A;  4RX3 A;  5FDS A;  4EV4 A;  2Y2I A;  3NDG A;  5GHX A;  4E04 A;  4G3K A;  4GJ4 A;  4E3M A;  3B33 A;  1IYQ A;  2VK3 A;  3LUQ A;  4N9L A;  4OOM A;  5DTS A;  3W8K A;  1S4S A;  3LIA A;  5CEC A;  1JTD A;  1OTD A;  4Y5F A;  2VGL M;  4GB7 A;  1ESI A;  3WS5 A;  5F82 A;  5FEF A;  3SOI A;  2FZ0 A;  3N6I A;  3IT9 A;  1ALQ A;  5IT5 A;  1EWZ A;  4XXR A;  1ZC2 A;  2H5S A;  2XQZ A;  3IXG A;  3LY4 A;  3T4Q A;  3LI9 A;  5E43 A;  2JE5 A;  3KSH A;  3NOP C;  3MQQ A;  3E98 A;  5EFW A;  4LPZ A;  1KDS A;  3KSI A;  4IUK A;  5CGW A;  2A49 A;  1L3L A;  1Z09 A;  4GHI B;  3D4F A;  2J9O A;  3IXD A;  2KLI A;  1K25 A;  4HIA A;  2NUP C;  4ZBE A;  5HAP A;  1WE4 A;  1TD5 A;  1GHM A;  5L10 A;  2QMI A;  3DTM A;  2PD7 A;  4KEN B;  3HLC A;  2BTF P;  3ULF A;  4R4S A;  3SS5 A;  2B18 A;  2X02 A;  3LIC A;  4UHU A;  4PM7 A;  5DTK A;  5HAQ A;  3SW1 A;  4RA7 A;  4BWI A;  2V1Z A;  1XPB A;  3C38 A;  1ZHH B;  4OOY A;  1W79 A;  4I3I A;  1PYY A;  4S2J A;  2CMN A;  4FTX A;  3K3D A;  1Y54 A;  1GSW A;  1YMX A;  2OAQ 1;  1ES5 A;  3L7H A;  4H6J B;  1YLJ A;  2XEP A;  4PM9 A;  5TFQ A;  1ZTU A;  4MMN A;  4LRX C;  3ZFZ A;  1L0E A;  3LGO A;  4R23 A;  3DTI A;  4M3K A;  1TS0 A;  3Q7Z A;  3C30 A;  3M6B A;  4ZDX A;  1QME A;  3UO9 A;  1BUL A;  3T1Q B;  2EX8 A;  2PAV P;  4QD4 A;  4ZRR A;  2WKE A;  3EEA A;  2ZQD A;  2ZQ7 A;  4HOI A;  1T18 A;  2Z2L B;  3P09 A;  3FG8 A;  4BJP A;  1S66 L;  2W3H A;  2GX5 A;  4JXW A;  3IH9 A;  4KQR A;  5HFO A;  4K91 A;  2VJW A;  3Q07 A;  1D7E A;  4OQ0 A;  4WEK A;  1XJ2 A;  3BEB A;  3ZNY A;  3C7V A;  3N8R A;  3HBR A;  4CLC B;  3T4K A;  2RCX A;  4NKP A;  1G28 A;  1VB6 A;  2ZBB A;  1KE0 A;  2BG1 A;  2OAP 1;  2JKF A;  5CHM A;  3VP1 A;  5HAR A;  3OZH A;  3LIB A;  1IYP A;  3PTE A;  4LRY C;  1C3B A;  5HL1 A;  2VKS A;  5IS1 A;  1H3Q A;  1MWR A;  3F1P B;  2ZC7 A;  3M2J A;  2XH9 A;  2V1A A;  5FQQ A;  5GLB A;  1MKM A;  2ZJ9 A;  3HVF A;  4MDZ A;  2PRF A;  3LCE A;  5FAP A;  2R9W A;  1S1Y A;  2CC1 A;  4WLA A;  5CHJ A;  1FCN A;  1W63 Q;  2ACG A;  1N9B A;  1SDE A;  1KDW A;  1F9I A;  4UA7 A;  2HDS A;  2L4R A;  2QKP A;  4U0T A;  5FAT A;  5EVE A;  1GA0 A;  3CAX A;  4IBR A;  5F68 A;  2WKQ A;  4P87 A;  3WS0 A;  4DE1 A;  2ZOI A;  1RCJ A;  3UE6 A;  5HDS A;  4XT2 A;  4GDB A;  3NBL A;  1FOF A;  3U2A A;  1VET A;  4B4Z A;  3HLE A;  1EI5 A;  1BSG A;  4OQH A;  4R4R A;  4B4X A;  3IH8 A;  3CPT B;  4NEE D;  2JKT M;  4OPY A;  3IF6 B;  4M4X A;  1TDL A;  4NXF A;  3G30 A;  5FI7 A;  2PD8 A;  3BQA A;  4UA9 A;  4NXG A;  3LR5 A;  3KSG A;  1VM1 A;  2Y2O A;  1T19 A;  3O86 A;  1W7F A;  4GS9 A;  3O88 A;  3PBN A;  2NUT C;  2XF3 A;  3UME A;  2A24 A;  1UWP X;  1UWN X;  2D01 A;  3IXB A;  1K6S A;  3GVB A;  4Q0H A;  3WWX A;  3N8L A;  3E4O A;  2M7V A;  1IOU A;  5M18 A;  5I94 A;  1W8Q A;  3AGF A;  3HUO A;  2XA7 M;  4LLO B;  3BQ8 A;  5FSR A;  4N1X A;  1OTE A;  2IWC A;  1M6K A;  4C3Q A;  3OPR A;  4OQI A;  4FUW A;  1BYW A;  4KZ3 A;  3L9K A;  4EBP A;  5AQ9 A;  2ZD8 A;  2DRW A;  1VEU B;  4E3J A;  5G18 A;  4QY6 A;  5EM1 A;  4S2P A;  3OCL A;  4KZ6 A;  4N9K A;  4EEU A;  5E2E A;  3UN7 A;  4G3W A;  3FPW A;  3FWL A;  4K0X A;  4OLD A;  5BOH A;  4UA6 A;  5HZH A;  1LT0 A;  2B02 A;  4L9F A;  5FQI A;  1K56 A;  1BLP A;  5EVI C;  3HL9 A;  3GTC A;  3UE0 A;  4DF6 A;  2O9B A;  4HY8 A;  1NRJ A;  4E3K A;  4Y2F A;  3EQV A;  3VP2 A;  4BD0 A;  1CEF A;  1I5Q A;  3LR4 A;  3GEC A;  1L0G A;  2IWD A;  4MBH A;  2E8I A;  3VV4 A;  1HZO A;  4RYE A;  4B9O A;  2VV6 A;  1RGY A;  3BM6 A;  1ERO A;  2FFF B;  4JF5 A;  3T1R A;  3RFB A;  3G35 A;  4Z1W A;  4OOL A;  1SZV A;  3F1N B;  1KGG A;  1D06 A;  4WEL A;  2X01 A;  3C2W A;  2YKF A;  3V3R A;  1XA1 A;  4AFI A;  1YLP A;  3S7P A;  4UQI S;  5TGF A;  2J3W A;  2VX8 A;  4O0P A;  5F83 A;  3C7U A;  3Q81 A;  5E2G A;  5FI6 A;  3CIT A;  1XGI A;  3PYP A;  4GD6 A;  4S2L A;  3BLS A;  2IA2 A;  3GDI A;  4BD1 A;  3B42 A;  2JKT I;  1SHV A;  4MLL A;  2WK0 A;  4YWZ A;  1JTG A;  4LFU A;  4ME4 A;  4OON A;  1XGJ A;  4OP8 A;  3MXS A;  4D2O A;  2W3F A;  2JCH A;  3KSF A;  4R0Q A;  2ZOH A;  3SH9 A;  5GLC A;  1CI8 A;  4GD8 A;  3ITA A;  3MQO A;  3HLB A;  5I5L A;  4G3V A;  4A5R A;  2XK1 A;  1MKI A;  2HP9 A;  3E2L A;  4II7 A;  3GRJ A;  4PM5 A;  1YQS A;  3UB8 A;  1DJA A;  1ONH A;  3G31 A;  1S1Z A;  2XDM A;  2W0N A;  3ZG7 B;  1JNU A;  1BZA A; 
#chains in the Genus database with same CATH homology
 1FSW A;  4KG6 A;  4OPR A;  1YLW A;  3HLC A;  3LY3 A;  3OPH A;  2ZM8 A;  4EWF A;  3I7J A;  4R4S A;  1FQG A;  1JWP A;  1MWT A;  5D3O A;  4ZTK A;  3SS5 A;  3ZVW A;  3UPP A;  3ISG A;  2B5R A;  2X02 A;  3S4X A;  4UHU A;  4KG2 A;  4PM7 A;  5HX9 A;  3UDF A;  5DTK A;  5HAQ A;  5E2F A;  5EPH A;  1L2S A;  1FCO A;  3MFD A;  4RA7 A;  5U47 A;  2WKH A;  2V1Z A;  4KQQ A;  4ZJ2 A;  3UNW A;  1XPB A;  2Y2K A;  5F1G A;  4LV2 A;  4DRT A;  4OOY A;  1M40 A;  1W79 A;  1K57 C;  4WEJ A;  3M2K A;  3W4O A;  1PYY A;  4S2J A;  4Y0U A;  4S2N C;  5F1F A;  1Y54 A;  3V50 A;  2EX9 A;  3PBQ A;  3Q7V A;  1TDG A;  4JXV A;  1ZG6 A;  2ZM2 A;  1YMX A;  1JVJ A;  5M19 A;  1ZG4 A;  3IHB A;  1ES5 A;  1YLJ A;  2XEP A;  4PM9 A;  1LI0 A;  3OPP A;  4KZ8 A;  5TFQ A;  3ZCZ A;  4EBL A;  3O87 A;  1ONG A;  3CMZ A;  3ZFZ A;  1L0E A;  4R23 A;  2PU2 A;  4M3K A;  3W4P A;  3Q7Z A;  4XUX A;  4DE2 A;  2ZQ9 A;  1ZKJ A;  1JWV A;  4OQG A;  1BT5 A;  3M6B A;  4UAA A;  2EXB A;  5EVI A;  1XXM A;  2P9V B;  3PAG A;  4EQI A;  3NY4 A;  4ZDX A;  1H8Y A;  2Y4A A;  1K57 A;  1ERM A;  1QME A;  1SDN A;  2EX2 A;  4WZ5 A;  4S2N A;  4PM6 A;  5GHZ A;  2HDU A;  3UO9 A;  3W4Q A;  2VGJ A;  3IWI A;  1BUL A;  4FH2 A;  4R3B A;  4RX2 A;  1NYY A;  2EX8 A;  4QD4 A;  1YM1 A;  3SS3 A;  2OLV A;  2WKE A;  5EOO A;  4LEN A;  2ZQD A;  2WUQ A;  2ZQ7 A;  5AQA A;  2Z2L B;  2XGN A;  3P09 A;  3RXW A;  3BFE A;  3MKF A;  2WAF A;  4BJP A;  3C5A A;  1NRF A;  4GN2 A;  5CER A;  3G4P A;  2Y2Q A;  1XKZ A;  4JXW A;  4E3N A;  4S2K A;  3IH9 A;  4KQR A;  4R1G A;  4BEN A;  2ZC5 B;  2WGW B;  1IEL A;  2PU4 A;  4LCL A;  4K91 A;  5FA7 A;  5HFO A;  1IYS A;  5FQM A;  3SS4 A;  3LO7 A;  2HDQ A;  3ZNT A;  3Q07 A;  4NET A;  3QNB A;  5A91 A;  4OQ0 A;  4WEK A;  3ZNY A;  3BEB A;  2EFX A;  3C7V A;  3N8R A;  1Q2P A;  2WKI A;  3HBR A;  3GQZ A;  1PWG A;  2GDN A;  3RXX A;  5KMW A;  1L0F A;  1KE4 A;  2RCX A;  4KG5 A;  5CHU A;  3VMA A;  5KSC A;  3UY6 A;  2XLN A;  1KE0 A;  4KZ4 A;  1E3U D;  1O7E A;  1QMF A;  2BG1 A;  3WS2 A;  5FQK A;  4X55 A;  2WAD A;  5DF8 A;  4P6B A;  5CHM A;  3VP1 A;  5HAR A;  3VSK A;  1YT4 A;  3VP4 A;  1NZO A;  1Q2Q A;  3OZH A;  3HRE A;  4MBF A;  4BLM A;  3DW0 A;  4QB8 A;  1IYP A;  2ZQA A;  2QPN A;  3PTE A;  4FCF A;  1C3B A;  4R3J A;  3V39 A;  1NYM A;  2J9P A;  1XP4 A;  4FD8 A;  4GZB A;  5HL1 A;  3WS4 A;  1CK3 A;  2V2F F;  4EUZ A;  5GLD A;  2VGK A;  1HTZ A;  1GCE A;  1S6R A;  3G2Z A;  4E3I A;  1K54 A;  4JKT A;  3IWQ A;  1MWR A;  5JYO A;  4DKI A;  1K4F A;  4KZB A;  3ZG0 A;  2Y55 A;  4PPR A;  5DF7 A;  3PAE A;  3VSL A;  2Z2M B;  2ZC7 A;  2Q9M A;  3M2J A;  2RL3 A;  2XH9 A;  2WGV A;  1DJB A;  5FQQ A;  5CRF A;  5GLB A;  2Q9N A;  2WGI A;  2WYX A;  2ZJ9 A;  2H10 A;  1MWU A;  3HVF A;  3IWO A;  3V3S A;  4QU3 A;  3MZF A;  3LCE A;  4DXC A;  5FAP A;  1SKF A;  5KSH A;  2OV5 A;  5M1A A;  1GHI A;  3B3X A;  4HES A;  4OPZ A;  1FR6 A;  4DE0 A;  3G2Y A;  1K55 C;  4D2O A;  2R9W A;  1PWC A;  1U60 A;  4WM9 A;  5FDH A;  5IHV A;  4ZJ1 A;  5A90 A;  1PZO A;  2CC1 A;  4GOG A;  4H8R A;  4IBX A;  3HLG A;  1MXO A;  5EEC A;  1ES3 A;  5CHJ A;  4WBG A;  1FCN A;  4N92 A;  3ZHH A;  5A93 A;  1NJ4 A;  3VOZ A;  2Y2M A;  3HUN A;  1N9B A;  1SDE A;  1PI5 A;  1KDW A;  3UPN A;  3OC2 A;  5FAO A;  3NC8 A;  4UA7 A;  4MNR A;  4C75 A;  1LI9 A;  2HDS A;  3P98 A;  4JPM A;  5FAT A;  4U0T A;  2HPB A;  1GA0 A;  3AGD A;  2ZQC A;  5JYP A;  4X69 A;  3BFD A;  4IBR A;  1VQQ A;  1YLZ A;  1HVB A;  4P87 A;  3GMW A;  4QY5 A;  3WS0 A;  1JWZ A;  2Y2N A;  2Y2L A;  4DE1 A;  1RCJ A;  3MKE A;  2DCF A;  1KE3 A;  3VOY A;  1SCW A;  5EOE A;  2XD1 A;  1LL5 A;  4GDB A;  3FKV A;  3NBL A;  4OP5 A;  1FOF A;  1MWS A;  1XA7 A;  3NDE A;  5EE8 A;  3BLM A;  2JBF A;  4P0M A;  4X68 A;  1ES4 A;  1W8Y A;  4B4Z A;  4S2M A;  3HLE A;  4P85 A;  4QJG A;  3UPO A;  1EI5 A;  3ZVT A;  1BSG A;  2Y2H A;  4OQH A;  4R4R A;  4B4X A;  3IH8 A;  3RJU A;  4WMC D;  4EBN A;  3EQU A;  4OPY A;  3UDI A;  4S2O A;  5CGX A;  1WYC A;  2OSU A;  3IF6 B;  1KVL A;  1K56 D;  1TDL A;  1OME A;  3G30 A;  4MBK A;  4YIN A;  5FI7 A;  4ID4 A;  4LCM A;  3WRZ A;  1BLS A;  1FR1 A;  4X6T A;  4UA9 A;  5DF9 A;  5E2H A;  4NK3 A;  4PMA A;  2I72 A;  3WRT A;  4GDN A;  3CZD A;  3HUM A;  1E3U A;  4KZ5 A;  4X53 A;  4JF6 A;  4BL2 A;  1MBL A;  1LL9 A;  1VM1 A;  4OVD A;  2Y2O A;  3GSG A;  5GLC A;  3IF6 C;  1NY0 A;  3HLW A;  5KZH A;  3V5M A;  2V20 A;  1IYO A;  1K38 A;  4X56 A;  3O86 A;  1W7F A;  2BLS A;  4IVK A;  3O88 A;  3PBN A;  5FQJ A;  2XF3 A;  2FFY A;  1CI9 A;  3IQA A;  1BLH A;  5GL9 A;  1ES2 A;  3FYZ A;  3UE1 A;  2P9V A;  3CG5 A;  3PBO A;  2C5W B;  1N4O A;  1YMS A;  4U3T A;  4Y0T A;  3E2K A;  4CJN A;  4Q8I A;  3OCN A;  3IXB A;  1IKG A;  4KQO A;  1XX2 A;  1K6S A;  2ZC3 B;  3GVB A;  5A92 A;  1LLB A;  2J7V A;  3WWX A;  1O07 A;  2EFU A;  5FI2 A;  5AQ7 A;  3SH8 A;  4ZAM A;  2WZZ A;  3N8L A;  3S1Y A;  5M18 A;  1FCM A;  3A3E A;  5TR7 A;  2XFS A;  5I94 A;  2PBY A;  4FH4 A;  3N4I A;  4E3L A;  1W8Q A;  3VP0 A;  1TVF A;  3AGF A;  3CJM A;  1MY8 A;  2G2U A;  1YLY A;  2R9X A;  2WGW A;  2JC7 A;  2ZC4 B;  3BEC A;  3PBS A;  3HUO A;  4BQM A;  5CEB A;  2H0Y A;  4OKP A;  4RVA A;  2HP5 A;  5FSR A;  5GHY A;  1PWD A;  2H0T A;  4N1X A;  2WZX A;  2IWC A;  3GV9 A;  1H8Z A;  1M6K A;  3VFF A;  4DDY A;  4C3Q A;  3OPR A;  5HW3 A;  4K0W A;  4OQI A;  3MXR A;  1NXY A;  4KZ3 A;  3A3J A;  3VP3 A;  3IF5 A;  4B88 A;  3MZE A;  1ESU A;  5CED A;  4EBP A;  4YFM A;  1G6A A;  3Q7V B;  4CPK A;  5AQ9 A;  3UDX A;  4JLF A;  2ZD8 A;  4XUZ A;  2DRW A;  4E3J A;  5G18 A;  4QY6 A;  2XFT A;  4S2P A;  1J9M A;  3OCL A;  1HD8 A;  4KZ6 A;  4N9K A;  1LHY A;  5CXW A;  5E2E A;  1TEM A;  4L0L A;  1RP5 A;  3DWK A;  4LV0 A;  5FAQ A;  3UN7 A;  5GLA A;  1S0W A;  2DNS A;  2UWX A;  4IED A;  3TSG A;  5CTN A;  2QZ6 A;  4HBT A;  1GHP A;  2C6W B;  3ITB A;  2IWB A;  3N7W A;  3UE3 A;  3BFC A;  5EVI B;  4E6W A;  3FWL A;  4E3O A;  2HP6 A;  5CGS A;  4Y7P A;  3BYD A;  1ERQ A;  4K0X A;  2P74 A;  1I2S A;  4JXG A;  4DXB A;  3ZGA B;  4OLD A;  4DDS A;  5BOH A;  1BUE A;  1KVM A;  1K55 A;  1PZP A;  2ZMA A;  4UA6 A;  1H5X A;  1YLT A;  4WMC A;  5FQI A;  1BLC A;  1K56 A;  4KZ9 A;  4O7D A;  1AXB A;  1BLP A;  5EVI C;  1PIO A;  1E4D A;  1RGZ A;  3HL9 A;  1IEM A;  3GTC A;  4PM8 A;  1NZU A;  4WZ5 C;  1PI4 A;  3UE0 A;  3OPL A;  4DF6 A;  2J8Y A;  3BFG A;  4OH0 A;  4E3K A;  5CTM A;  3EQV A;  4Z9Q A;  3VP2 A;  3FKW A;  4BD0 A;  3A3F A;  3S22 A;  1CEF A;  1I5Q A;  4F94 A;  4Y0O A;  3QHY A;  1L0G A;  2OLU A;  2IWD A;  3IHA A;  4HBU A;  4MBH A;  2E8I A;  1HZO A;  5EVL A;  2HDR A;  3DWZ A;  4RYE A;  4LV3 A;  4BL3 A;  1DY6 A;  1RGY A;  3BM6 A;  3G34 A;  3NI9 A;  1ERO A;  2FFF B;  4JF5 A;  1KGF A;  4JBF A;  2ZQ8 A;  4HEF A;  1CEG A;  1WYB A;  3G35 A;  4S2I A;  2ZC6 B;  1FSY A;  5EUA A;  4ZJ3 A;  1I2W A;  1G68 A;  3NCK A;  2ZM0 A;  4JF4 A;  4OOL A;  1PW1 A;  5AQB A;  3MBZ A;  1KGG A;  3FV7 A;  4WEL A;  3ZG5 A;  5HAI A;  2X01 A;  3WS1 A;  3ZDJ A;  2EXA A;  1KGE A;  2XD5 A;  3V3R A;  1XA1 A;  3IXH A;  2XR0 A;  3A3I A;  1PW8 A;  1YLP A;  5EVI D;  3A3D A;  5TGF A;  4LV1 A;  4RX3 A;  3ZG9 B;  5L2F A;  4EV4 A;  2Y2I A;  3G32 A;  5F83 A;  3C7U A;  4GKU A;  2WAE A;  5FAS A;  3NDG A;  3Q81 A;  3GR2 A;  5E2G A;  5GHX A;  3BFF A;  3MZD A;  5FI6 A;  1XGI A;  4GD6 A;  4DE3 A;  4FSF A;  4IVI A;  4E3M A;  1K54 C;  1MPL A;  3C4P A;  3IF6 A;  4S2L A;  1IYQ A;  3BLS A;  4WZ4 A;  3PBT A;  3VFH A;  4BD1 A;  4N9L A;  4OOM A;  1E25 A;  5DTS A;  3W8K A;  1GA9 A;  5FQ9 A;  5CEC A;  1JTD A;  1SHV A;  3JYI A;  4MLL A;  4N1H A;  2WK0 A;  4E6X A;  2Y2P A;  4MEZ A;  3FZC A;  1JTG A;  1ESI A;  4GB7 A;  5F82 A;  3WS5 A;  3SOI A;  4OON A;  1IKI A;  4U0X A;  1XGJ A;  4OP8 A;  3N6I A;  3MXS A;  3IT9 A;  1ALQ A;  2A3U A;  2X71 A;  1EWZ A;  4WYY A;  4JXS A;  2JCH A;  4KZ7 A;  3HLD A;  4R0Q A;  4XXR A;  5DTT A;  3SH9 A;  1ZC2 A;  2H5S A;  2XQZ A;  2Y59 A;  3IXG A;  1W5D A;  3LY4 A;  3N8S A;  1CI8 A;  4GD8 A;  4OPQ A;  3Q82 A;  1Z6F A;  3LEZ A;  3NIA A;  5E43 A;  5J8X A;  3ITA A;  4OLG A;  2JE5 A;  3M6H A;  3HLB A;  2Y2J A;  3SH7 A;  4GNU A;  1KDS A;  2Y91 A;  3TOI A;  1L0D A;  5CGW A;  4A5R A;  1DJC A;  3TG9 A;  1K4E A;  2XK1 A;  2EX6 A;  2ZLY A;  2A49 A;  1MKI A;  2HP9 A;  3E2L A;  2Y2G A;  3O3V A;  3C4O A;  3D4F A;  2J9O A;  3IXD A;  3GRJ A;  2G2W A;  1K25 A;  4PM5 A;  3HLF A;  1YQS A;  3PBR A;  3Q1F A;  4KZA A;  4ZBE A;  1DJA A;  5HAP A;  4C6Y A;  1ONH A;  1WE4 A;  3G31 A;  3BRM A;  1BTL A;  1GHM A;  1K6R A;  2XDM A;  3ZG7 B;  3QNC A;  4QHC A;  5DVA A;  3AGE A;  2QMI A;  3ZG8 B;  3DTM A;  4KEN B;  1BZA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...