3IF6C

Crystal structure of oxa-46 beta-lactamase from p. aeruginosa
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
242
structure length
231
Chain Sequence
VVIRSDWKKFFSDLQAEGAIVIADERQAKHTLSVFDQERAAKRYSPASTFIPHTLFALDADAVRDEFQVFRWVNRSFAGHNQDQDLRSAMRNSTVWVYELFAKDIGEDKARRYLKQIDYGNDYWIDGNLKISAHEQILFLRKLYRNQLPFKVEHQRLVKDLMITEAGRSWILRAKTGWEGRFGWWVGWIEWPTGPVFFALNIDTPNRTDDLFKREAIARAILRSIDALPPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the narrow-spectrum OXA-46 class D beta-lactamase: relationship between active-site lysine carbamylation and inhibition by polycarboxylates
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Hydrolase
molecule keywords OXA-46 oxacillinase
total genus 72
structure length 231
sequence length 242
ec nomenclature
pdb deposition date 2009-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00905 Transpeptidase Penicillin binding protein transpeptidase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.710.10 Alpha Beta 3-Layer(aba) Sandwich Beta-lactamase DD-peptidase/beta-lactamase superfamily 3if6C00
3FZCA 5CXWA 3ZG7B 4E3JA 4LV2A 3OZHA 1PWCA 3HBRA 2DNSA 2B5RA 1IKGA 3M6HA 4RX3A 3ZG0A 4F94A 2X02A 1NJ4A 4KZ4A 4R3BA 5F82A 3CG5A 1BSGA 5FAOA 3VFFA 3UPOA 3A3IA 5EVIC 4WMCA 4HBUA 5HX9A 1JWPA 1LLBA 1H5XA 4WEKA 5TFQA 4FSFA 5GHYA 4KG2A 4B4XA 3G34A 4E3NA 5A90A 3C4OA 5FAPA 1NYMA 1NXYA 2H0TA 4DXBA 2XEPA 3GQZA 5E2HA 5KSHA 2H10A 1MWSA 3IHAA 4BLMA 2WYXA 4BENA 3W4QA 1G68A 4M3KA 3PBTA 1LL9A 2ZJ9A 2ZQAA 3NC8A 1L0DA 4R3JA 4IVIA 3HLCA 4N92A 4EQIA 3ZVWA 1FQGA 3BEBA 4U3TA 1XKZA 3A3EA 5FASA 2XQZA 1YMSA 4YFMA 4P85A 5CRFA 3V3RA 3A3FA 3BRMA 3GSGA 3P09A 4S2OA 4E3MA 5L2FA 1K54A 3ZHHA 4E3KA 4ZAMA 5HL1A 1JTDA 3FKWA 1K57C 2ZQDA 1BUEA 5E2FA 2X01A 2PU4A 1GA0A 3BFGA 1W79A 5FI6A 2GDNA 2DCFA 2HDRA 1EI5A 5J8XA 1DJBA 3SS4A 1FR6A 2ZC6B 4R4RA 2J9PA 4LCMA 4EUZA 1K55C 1NYYA 3BFCA 3IWIA 5CHUA 1IYOA 5D3OA 2Y2QA 4S2LA 3PBRA 4X55A 4PM5A 3DWZA 3HUMA 1GA9A 3AGEA 3GVBA 1LI9A 2ZC4B 2R9XA 1WE4A 2WAEA 2QPNA 4LV1A 3UE1A 3VP1A 1XXMA 3HLGA 3MZEA 4QJGA 4UA7A 2BLSA 2J9OA 2XH9A 4K0XA 3IH8A 5DF9A 3ZVTA 1L0EA 5CEDA 4U0TA 5G18A 3UDXA 1KE4A 3CZDA 3N7WA 3ZG9B 1E25A 4MEZA 1AXBA 2WGVA 3ZG5A 5U47A 3EQUA 1IKIA 1N9BA 3NY4A 1KGFA 4EV4A 1ZG4A 4IVKA 3IF5A 5AQBA 4P87A 3UDFA 2WUQA 3MXRA 3EQVA 4GNUA 4P0MA 4QY6A 3OCNA 4ID4A 4JXVA 1YLTA 2XD5A 3MZDA 3ZNTA 3MFDA 4R1GA 3UPNA 1FSYA 3O88A 3NDEA 4XUZA 4PM8A 5FQQA 3ZDJA 1WYCA 4KZ6A 3UDIA 2XFTA 3ZGAB 2ZLYA 4RVAA 4C75A 2Y2PA 1WYBA 1ESUA 1K55A 1NZOA 1Q2PA 3C4PA 1KE0A 1E3UA 3M2JA 3IF6B 4K0WA 3HLFA 2WZZA 3AGFA 4E3LA 1MKIA 4GDBA 1FCOA 3N6IA 4GKUA 4ZTKA 4RX2A 2ZMAA 4UHUA 1PWGA 1JWZA 1Y54A 1N4OA 3FV7A 4C6YA 4UA9A 4WELA 2PU2A 2WKHA 4KQQA 5EE8A 1YLPA 2J7VA 4LCLA 5CTMA 5EVIB 4ZDXA 1EROA 3VOYA 5GLBA 1RGZA 4BQMA 5DTTA 2C5WB 4OPZA 2ZQCA 3VOZA 4XXRA 1PYYA 3Q7VB 3VSKA 3HVFA 5DF7A 2ZM8A 1K56D 3IXHA 4A5RA 1ZG6A 4N1HA 3VP2A 1KDWA 2Y2MA 1ALQA 3VFHA 4E3IA 3UE3A 2OLUA 1NY0A 2RCXA 3IF6A 3LY3A 3ITBA 3CJMA 5EOOA 1W7FA 3TSGA 2Y2IA 4MNRA 3G35A 5AQ7A 1XGJA 1KGGA 4FD8A 5HW3A 4JF5A 4IEDA 3S4XA 1ONGA 4R23A 4DRTA 3WS5A 3BLMA 1ERQA 1IYSA 4R0QA 2JE5A 2WKEA 1IEMA 5EVID 5DTSA 4LV0A 3RXXA 2OSUA 2Y2HA 3Q7VA 2HP9A 5GLAA 4MLLA 3HLBA 3G4PA 3MBZA 3JYIA 2XF3A 5FATA 1XA1A 4KZ9A 4OOLA 4H8RA 4OONA 3V3SA 1TDLA 5EUAA 1L2SA 5FQJA 1LHYA 2Y91A 3IXBA 2A49A 1MXOA 3BFDA 1YQSA 1BZAA 4QU3A 5KZHA 1L0FA 5AQAA 4ZBEA 3SS5A 5DVAA 2Y2NA 4CPKA 4Z9QA 2FFYA 3QNCA 4ZJ3A 4GZBA 4KG5A 3OPLA 3V5MA 3IXDA 5CGSA 1NRFA 5AQ9A 1CI9A 2P9VA 4Y0UA 3V39A 3G2YA 2WAFA 3MXSA 1W8YA 2G2UA 4MBFA 4X6TA 5FSRA 3QNBA 2DRWA 1CEFA 2BG1A 1PI4A 2C6WB 2EFUA 3IF6C 1ES4A 5GLDA 5EOEA 3WS2A 1J9MA 4OQ0A 3M2KA 1O7EA 5M19A 4BJPA 2OLVA 1L0GA 4PMAA 5KSCA 2EX6A 2H5SA 3VMAA 5CERA 4EWFA 4FH4A 2IWCA 4HEFA 5CHMA 2UWXA 3SH7A 1FCMA 4WZ4A 1RCJA 4ZJ1A 2OV5A 3P98A 3PBSA 4DDSA 4EBNA 4IBRA 5FI7A 1Z6FA 1MY8A 4BD1A 5CHJA 2HP6A 1GCEA 3G2ZA 2HPBA 2IWBA 3DTMA 4ZJ2A 4JXGA 5FQ9A 2XR0A 3UNWA 3OC2A 5CECA 3BM6A 1CI8A 1S0WA 1XA7A 1NZUA 2XDMA 2XD1A 4S2KA 3GRJA 4CJNA 4Y0TA 3Q1FA 4WM9A 4DXCA 3M6BA 3UN7A 3Q07A 1IYPA 4S2NA 2WKIA 5JYOA 3UE0A 3NDGA 3ZFZA 4DE2A 3NBLA 2ZC3B 1HD8A 2EFXA 2ZC5B 4FH2A 4GDNA 2ZD8A 1LI0A 1XP4A 4WZ5C 4JLFA 4OH0A 1I2WA 3W4OA 1FR1A 4KQOA 4BD0A 3BLSA 4OLGA 1K4FA 3AGDA 1H8ZA 3O87A 2WZXA 3SH9A 2WK0A 3CMZA 5IHVA 4HBTA 1HVBA 3Q7ZA 4N1XA 4N9KA 1MBLA 4OVDA 2XFSA 4S2PA 5DF8A 5HAPA 1KDSA 4P6BA 4WEJA 1GHPA 4JF6A 3WS1A 4K91A 3BECA 1KGEA 3N8SA 3D4FA 3N4IA 4KZBA 2VGKA 4MBKA 2Y59A 3S1YA 4OP8A 4S2JA 2H0YA 5CTNA 1OMEA 4JXWA 2P74A 3BFEA 3OPRA 5FA7A 1ONHA 2HDSA 3WWXA 5E2EA 1G6AA 2RL3A 4QB8A 1SDNA 2VGJA 4UA6A 3I7JA 4MBHA 3ISGA 5F1FA 2JC7A 3SH8A 1K6RA 3IT9A 1CEGA 4YINA 2ZM0A 5GHXA 1LL5A 3VP4A 4B4ZA 1MWRA 4Y0OA 1DJCA 1K56A 3IH9A 5DTKA 3VP3A 2XK1A 1BLPA 1VM1A 3QHYA 4KZ3A 1ES2A 1YM1A 2Y2KA 3G30A 4WZ5A 3TG9A 2I72A 4NK3A 3ZG8B 3MKFA 1SHVA 4OPRA 1M6KA 1PWDA 3GMWA 4EBLA 1BLSA 1M40A 4DKIA 3NIAA 3PBOA 1PZOA 2G2WA 3E2LA 1PW8A 1O07A 3W4PA 4PM7A 5FQIA 3PBNA 2EX2A 2V20A 3BYDA 1SCWA 3OPHA 1JWVA 1HTZA 1ESIA 2HP5A 4BL2A 2ZQ7A 4OOYA 3DW0A 1E4DA 3HREA 1RP5A 4R4SA 3RJUA 4KENB 2WGIA 1FSWA 4OP5A 1C3BA 3IWQA 4WBGA 1K38A 3WRTA 4PPRA 3W8KA 3LEZA 5FDHA 1TDGA 3GTCA 4D2OA 1DJAA 4GD6A 4OQHA 3ITAA 3C7UA 5CGXA 5FQKA 1BLHA 4X69A 1PZPA 3MKEA 3OPPA 4DDYA 2PBYA 2ZM2A 3HL9A 3BFFA 1I5QA 2EX9A 3N8LA 5JYPA 2HDQA 2Y2GA 3TOIA 2Q9NA 2Y2LA 3HLEA 4DF6A 2XGNA 4X68A 1Q2QA 3IHBA 5EVIA 3FWLA 4QY5A 2Y4AA 4KZ5A 4JF4A 4OPQA 3RXWA 1EWZA 4OLDA 3PBQA 2CC1A 1I2SA 1JTGA 3IXGA 4X56A 2V1ZA 4N9LA 2E8IA 3HUNA 5HARA 1BT5A 1YLYA 5EPHA 2J8YA 4OQIA 4PM9A 4JPMA 4GD8A 5GL9A 3VP0A 1IELA 2R9WA 1YMXA 3G31A 1GHIA 3LO7A 2ZQ8A 1KVMA 2JCHA 4S2NC 1MWTA 4IBXA 1QMFA 4U0XA 1PIOA 3A3DA 3GR2A 4QD4A 3WRZA 1ZKJA 2EX8A 1MWUA 5M1AA 1K4EA 4LV3A 3ZCZA 5FQMA 1U60A 2Y2JA 4RA7A 3PAEA 1HZOA 3E2KA 3O86A 2Z2LB 3HLWA 3IWOA 4DE0A 3FKVA 4OPYA 4BL3A 1YLZA 3Q82A 1VQQA 2HDUA 3LY4A 5FI2A 4OQGA 4X53A 1K54C 1YLWA 1PI5A 2Y2OA 2ZQ9A 4S2IA 2JBFA 1H8YA 4S2MA 2QZ6A 2WADA 3IQAA 1K25A 4WMCD 1DY6A 3FYZA 5E43A 1W8QA 5EECA 3PAGA 5A92A 4O7DA 5F83A 3ZNYA 3PTEA 4OOMA 2XLNA 3UPPA 3HUOA 3VSLA 1ES5A 2Z2MB 4LENA 1S6RA 3SOIA 2EXBA 3LCEA 5FAQA 5TR7A 3S22A 2P9VB 3C5AA 1BLCA 1GHMA 4KG6A 1KVLA 3SS3A 4E6XA 3MZFA 5HFOA 3Q81A 2EXAA 4KZ8A 5HAIA 1QMEA 3WS4A 4JXSA 3N8RA 4DE3A 1E3UD 5CGWA 1TVFA 5HAQA 3B3XA 3DWKA 4FCFA 5BOHA 3NI9A 4PM6A 4C3QA 1MPLA 5I94A 2Y55A 2X71A 4HESA 1RGYA 2ZC7A 3OCLA 5TGFA 5CEBA 1JVJA 2QMIA 3A3JA 5EVLA 4DE1A 4Q8IA 4OKPA 4EBPA 1FOFA 4GN2A 3UY6A 3V50A 1SDEA 4B88A 1KE3A 3GV9A 3NCKA 1YLJA 1XGIA 5A91A 1YT4A 3HLDA 4E6WA 1PW1A 1ZC2A 4JKTA 1ERMA 4GB7A 1XX2A 4KQRA 1BULA 5E2GA 5GHZA 5M18A 4RYEA 4WYYA 2WGWB 1XPBA 3UO9A 1ES3A 1FCNA 3WS0A 2A3UA 2WGWA 1TEMA 4XUXA 1IYQA 2IWDA 4L0LA 2Q9MA 4E3OA 1W5DA 4KZAA 5F1GA 1CK3A 5GLCA 5KMWA 1SKFA 4UAAA 1K6SA 4KZ7A 2V2FF 3C7VA 3O3VA 4GOGA 4NETA 3G32A 5A93A 1BTLA 2FFFB 1K57A 4JBFA 4Y7PA 4QHCA
chains in the Genus database with same CATH superfamily
5CXWA 4LV2A 3HBRA 2B5RA 3CITA 3BQAA 1NJ4A 3C8CA 3CG5A 5FAOA 5HX9A 1LLBA 1XFNA 2KOIA 5A90A 2H0TA 2XEPA 2JKFA 3H82B 2WYXA 1G68A 2BASA 5F6AA 3RTYA 4N92A 3ULFA 3A3EA 1GSVA 2XQZA 3V3RA 2J80A 3P09A 4I3IA 1L3LA 4E3MA 2V0UA 4ZAMA 3FKWA 4NXBA 2ZQDA 2HZ5A 1T18A 1W79A 1FR6A 2ZC6B 3UMDA 2D01A 5CHUA 4PM5A 3DWZA 2EA9A 3T4QA 1GA9A 1LI9A 2VGLS 2R9XA 4LRZE 1STZA 5L10A 4K0XA 3ZVTA 5DF9A 3UDXA 2B02A 3N7WA 4NKPA 3ZG9B 3ZG5A 3EQUA 3IF5A 4UQIM 4G3VA 3MXRA 4P0MA 3FPVA 3T4TA 4ID4A 3MZDA 3D9YA 5AVEA 3NDEA 5FQQA 1WYCA 3UDIA 3ZGAB 4RVAA 3C4PA 2PYPA 3HLFA 3AGFA 5F68A 4E3LA 1FIKA 1TS8A 5HD5A 2ACGA 4FUWA 1PWGA 3KX0X 3ZYTA 4UA9A 1Z09A 4KQQA 4Y15A 1YLPA 2FH5A 3UB5P 4ZDXA 2C5WB 2OOLA 5HDDA 4JGOA 4XXRA 5DF7A 4A5RA 2J3TD 1ZG6A 4NXEA 1KDWA 3UB9A 2RCXA 4MNRA 3F1OB 3G35A 1KGGA 4FD8A 3BLMA 1OTEA 2JE5A 2OWJA 2WKEA 3RXXA 2OSUA 3Q7VA 3HLBA 1TS7A 1XA1A 4OONA 2XROA 1TDLA 2Y91A 5KZHA 3KSIA 2GJ3A 2ZL1A 1H3QA 3JVVA 5DVAA 4Q0IA 5CGSA 5AQ9A 4R38A 1CEFA 3F1PA 2EFUA 3BQ8A 4OQ0A 1DRMA 1MZUA 2OLVA 2H5SA 3VMAA 2D02A 1H8MA 1PFLA 1TS6A 2UWXA 3NOTC 4WZ4A 3SH7A 4ZJ1A 4BD1A 2HP6A 1DP8A 3DTMA 2W3FA 2B95A 3BM6A 1S0WA 3G6OA 3KSFA 2XD1A 4S2KA 1J3WA 3VE3A 5LBRA 1XP4A 4OH0A 1I2WA 3W4OA 3BLSA 1K4FA 1H8ZA 3O87A 3SH9A 2WK0A 3CMZA 5IHVA 4HBTA 2V0WA 3Q7ZA 1MBLA 2XFSA 5HAPA 2VEAA 2B18A 1GHPA 1OTIA 3BECA 1KGEA 3N8SA 3D4FA 4XT2B 1VEUA 4GLQA 4QWOA 3TE8A 4MN7A 4ZRRA 2RL3A 3EEAA 4QB8A 5KIZA 3ISGA 2O9BA 4HY8A 3UB8A 1OJGA 3NHQA 2JC7A 1K6RA 1CEGA 1D06A 4YINA 4LLOB 4O0PA 4B4ZA 1MWRA 4HI4A 3IH9A 2XK1A 1VM1A 2GX5A 1ES2A 2I72A 3KSHA 4OPRA 1M6KA 1M40A 4CLCA 3W4PA 2DMWA 2VX8A 2GZAA 2M7VA 4X25A 5FL3A 2ZQ7A 1KOUA 2K31A 1NWZA 2WGIA 1FSWA 3WRTA 3EGDC 4PPRA 4D2OA 5CGXA 2JKGA 4R3AA 4EETB 4X69A 4GHIA 5F69A 4JGQA 3BFFA 1I5QA 2HGVA 2VZWA 4DF6A 2XGNA 1S4SA 4KZ5A 4JF4A 4OPQA 3RXWA 3PBQA 3E98A 3IXGA 3LIAA 4N9LA 1BT5A 2LB5A 2J8YA 4OQIA 4JPMA 4GD8A 5GL9A 3DBAA 3R7WB 4S2NC 1MWTA 3T1SA 4IBXA 1W63Q 5TBMA 4QD4A 1MWUA 5M1AA 3ZCZA 5FQMA 3DTIA 2Z2LB 3HLWA 3FKVA 4BL3A 3Q82A 1VQQA 2L1MA 2HDUA 2KLIA 4X53A 3LEQA 4L9FA 1H8YA 4S2MA 2WADA 3IQAA 3IBRA 2PD7A 3CPTB 5E43A 3U4LP 5EECA 4O7DA 3MQOA 3HUOA 3E4OA 5HD3A 3EWKA 3OOVA 4LENA 1VHMA 1OTAA 2EXBA 4KG6A 3W2ZA 1KVLA 3SS3A 4E6XA 5HZHA 2EXAA 4KZ8A 1W63M 1D1JA 4MN5A 3N8RA 4IUHA 5HAQA 4FCFA 4Y13A 4C3QA 5I94A 4HESA 1RGYA 3A3JA 1CF0A 4EBPA 3V50A 4NXFA 3LIBA 1ODVA 1XGIA 5A91A 1ERMA 1XX2A 4ME4A 5GHZA 4RYEA 4WYYA 2WGWB 3UO9A 3WS0A 2A3UA 4XUXA 1W5DA 4F3LA 5F1GA 1CK3A 2MJ6A 5KMWA 1N9OA 1SKFA 4UAAA 1G6OA 4P6ZS 3QP6A 5EFWA 4JBFA 4Y7PA 4KQDA 4E3JA 4KUOA 3OZHA 1PWCA 2DNSA 3P01A 3M6HA 4F94A 4KZ4A 3KO6A 3UPOA 5F82A 5DFXA 5EVIC 3S7NA 4WMCA 1JWPA 4KG2A 3G34A 4E3NA 5FAPA 2V9AA 3LGOA 4DMZA 4I3AA 4DXBA 3GQZA 5IT5A 1MWSA 4BLMA 3W4QA 4M3KA 4R3JA 4IVIA 1LSXA 1P0ZA 1T1BA 3B33A 4YFMA 3MS6A 1UWNX 3SW1A 4P85A 5J4EA 3A3FA 3BRMA 3GSGA 1K54A 4E3KA 5HL1A 1BUEA 5FI6A 2GDNA 5J8XA 1ZTUA 1XJ3A 4EUZA 1NYYA 2W1RA 3MFXA 3PBRA 4CLCD 4L9EA 5EM1A 3HUMA 5HPIA 2QPNA 3UE1A 3HLGA 4QJGA 4R70A 2J3WA 3IX8A 2PRFA 2XH9A 1VETB 3KSGA 5CEDA 5G18A 5C5KA 3CZDA 4XT2A 1E25A 5U47A 1N9BA 3NY4A 1X0OA 4ESPA 3EQVA 3K2NA 3B47A 5K5BA 3UPNA 3ZDJA 2ZLYA 4C75A 2Y2PA 4EERA 4R6LA 3M2JA 3RFBA 3IF6B 4EESA 1FCOA 3N6IA 4YOFA 3FC7A 3FV7A 4C6YA 3DTEA 2EWVA 2J7VA 1EROA 3VOYA 1OT9A 4BQMA 5J3WA 4EW7A 5DTTA 2ZQCA 1OPXA 2ZOHA 3VSKA 1F5MA 3UE3A 3IF6A 3O5YA 2R78A 3L9KA 1XGJA 4PKYA 4DRTA 5EVID 4Q0JA 3IBJA 4LV0A 2HP9A 5GLAA 4Y17A 3G4PA 5FATA 5EUAA 5FQJA 2V1AA 1EW0A 1MXOA 2JKTM 4ZBEA 2YKFA 2FFYA 4ZJ3A 1LSVA 2V1BA 3IXDA 3EEHA 4Y0UA 3G2YA 2WAFA 4MBFA 3QNBA 2DRWA 2BG1A 4ARZA 3SZTA 1AWIA 3WS2A 3M2KA 1S1ZA 2QHKA 4BJPA 1L0GA 4PMAA 2ZMVA 5CHMA 3EOIA 4HHDA 4BMWA 4IBRA 5CHJA 2IWBA 3G2ZA 3LR4A 4ZJ2A 4JXGA 5FQ9A 4EQ1A 3OC2A 2ZL1B 4EUVA 4HP9A 3FG8A 1T1AA 1XA7A 5IS1A 1NZUA 2XDMA 2A2LA 4I3JA 3GRJA 4WM9A 4DXCA 1IYPA 4YWZA 5JYOA 2INWA 3ZFZA 4DE2A 2EFXA 2ZC5B 4FH2A 1LI0A 3LI9A 4KQOA 3AGDA 2WZXA 1OTBA 4N1XA 1CQAA 4OVDA 1FILA 4S2PA 5DF8A 1ZHHB 3LFVA 3N4IA 4IUKA 4KZBA 3S1YA 4S2JA 1OMEA 4JXWA 4PKYG 2P74A 2HDSA 3CUEA 5E2EA 1G6AA 3UMEA 1SDNA 1WA9A 3I7JA 5F1FA 1YPRA 3VP4A 3T50A 4G3WA 4M4XA 4KZ3A 1YM1A 3H7WA 3TG9A 4NK3A 1DP9A 1PWDA 3GMWA 1BLSA 2A24A 4DKIA 3UB6A 1PW8A 1O07A 2V20A 1ESIA 4OOYA 4L9GA 3JPUA 2P7JA 1E4DA 3HREA 4K08A 2CMNA 2PDRA 3W8KA 2QYBA 5HWTA 5EM0A 3C7UA 2V8CA 4HNBA 3LR0A 3MKEA 2XRNA 5TBMB 2HDQA 2Y2GA 3TOIA 2Q9NA 2Y2LA 1NRJA 1Q2QA 4QY5A 4EEUA 2PR5A 1HLUP 2CC1A 1I2SA 4X56A 2V1ZA 2E8IA 1YLYA 4GS9A 5EPHA 3K3CA 1YMXA 3G31A 1GHIA 1S66L 2ZQ8A 3LO7A 4CLCC 2W1TA 2G7UA 4FOFA 3GR2A 3WRZA 3MR0A 4I39A 4LV3A 4I5SA 1U60A 4RA7A 3PAEA 4OPYA 1YLZA 1SZVA 4OQGA 4S2IA 1YLWA 4GS9B 2W3GA 1DY6A 3ZNYA 4OOMA 2Z2MB 1LL8A 2Q0OA 2P9VB 3S7QA 4ETXA 3MZFA 2M7UA 4JXSA 4DE3A 1LT0A 4KUKA 2HF6A 3DWKA 5DKKA 4PM6A 1MPLA 2X71A 5DFYA 2QMIA 4DE1A 5EVLA 4HJ6A 4OKPA 4GN2A 2P08A 3NCKA 3D72A 1ZC2A 4KQRA 4HP4A 1BULA 4DJ3A 1TEMA 1IYQA 4LPZA 4E3OA 2VLGA 5HWWA 1TF1A 5DJTA 4NETA 4ARZB 4O8GA 5A93A 2QWSA 1K57A 4QHCA 3FZCA 1V9YA 3VFFA 1BSGA 2XA7S 3A3IA 4HBUA 3VOLA 5TFQA 4FSFA 4FTXA 5GHYA 1NYMA 1NXYA 3E4PA 3K3DA 1G28A 1T19A 2ZJ9A 3T4KA 1L0DA 2K2NA 4EQIA 3HLCA 3ZVWA 3C30A 1FQGA 5MC7A 2JKTI 1XFQA 4S2OA 4LFUA 5G4ZA 2OAQ1 5I5LA 2UV0E 3GDIA 4UEYA 5L2FA 3ZHHA 1JTDA 3CHWP 4I38A 2X01A 2PU4A 2PD8A 1EI5A 1DJBA 1XJ4A 1YAXA 3PXPA 4R4RA 4LCMA 1K55C 3U2AA 3LICA 2VK3A 2Y2QA 4X55A 2XSSA 2WKPA 3GVBA 2ZC4B 1F98A 1WE4A 2WAEA 4LV1A 3VP1A 1XXMA 3MZEA 2BLSA 2J9OA 3C2WA 3IH8A 1L0EA 4EU0A 4U0TA 4MEZA 4EV4A 2KX6A 2Y79A 2YKHA 4B93A 3UDFA 2WUQA 3V67A 3OCNA 4JXVA 1YLTA 2XD5A 5HDSA 3ZNTA 4BBTA 1FSYA 3O88A 3LI8A 2P04A 4DJ2A 2XFTA 1Q2PA 1E3UA 4K0WA 2WZZA 3L7HA 4GDBA 5TJJA 2L0WA 2W27A 4GKUA 4HJ3A 1Y54A 1N4OA 2O9AA 1S67L 5IU1A 3CLOA 4LCLA 5CTMA 5EVIB 4BWIA 1RGZA 3VOZA 3Q7VB 1K56D 1F2KA 2Y2MA 3VFHA 3LY3A 3ITBA 1G5UA 3CJMA 3R7WA 3TSGA 2Y2IA 1UGUA 3F1OA 5AQ7A 5HW3A 3QP1A 1ONGA 1SKOB 3WS5A 2QJ7A 2AVXA 1IEMA 2Y8HA 2Y2HA 3JVUA 3NOUC 3JYIA 3KYEA 2VV8A 4OOLA 2BTFP 3IXBA 4QU3A 1BZAA 1PRQA 1L0FA 2IA2A 2Y2NA 4Z9QA 1XJ6A 3QNCA 3OPLA 3V5MA 4JGRA 1NRFA 1CI9A 3V39A 1W8YA 2G2UA 1K0KA 4X6TA 2L4RA 5FSRA 3LR5A 3IF6C 1ES4A 5GLDA 1J9MA 2WKRA 3NULA 5KSCA 2NUTC 5CERA 4EWFA 4FH4A 4HEFA 2Z6DA 2XA7M 3PBSA 4DDSA 4EBNA 5FI7A 1UWPX 5HWVA 1MY8A 1IFQA 2HPBA 1CJFA 2XR0A 3UNWA 5CECA 4EXOA 2H28A 3RH8B 4BBUA 4Y0TA 4Y5FA 3M6BA 3UN7A 4S2NA 3UE0A 3QP5A 3KYZA 2J3TC 4Q0HA 4GDNA 4WZ5C 4JLFA 1FR1A 4H6JA 5FDSA 4LRYC 4CQHA 1HVBA 4N9KA 4JGPA 4P6BA 4WEJA 4JF6A 3ZQ5A 2Y59A 5CTNA 1D7EA 2OWHA 1P9WA 3BFEA 4P6ZM 2OAP1 4WL9A 4MDZA 4E04A 2E8JA 3IT9A 2ZM0A 3VV4A 5AVFA 5GHXA 4Y0OA 5HPFA 2QJ5A 3G30A 4MCWA 3ZG8B 5AJGA 5HSQA 1H0MA 2WKQA 3PBOA 1PZOA 1LSWA 2G2WA 4Z1WA 3E2LA 2EWWA 1OT6A 4CLCE 2EX2A 3BYDA 1JWVA 1HTZA 2HP5A 1RP5A 3RJUA 4KENB 4OP5A 3IWQA 4WBGA 1K38A 5FDHA 2M1CA 3ICYA 3GTCA 3ITAA 3TJZC 3D3OA 5DKLA 4DDYA 4QPRA 2ZM2A 3F1PB 5JYPA 3NECA 4X68A 1VEUB 3IHBA 5EVIA 2HJ9C 3T4SA 1A0KA 5HL6A 4O01A 4OLDA 3MJQA 5FEGA 1DP6A 3HUNA 3LIDA 1IELA 2R9WA 2JCHA 3PHYA 4U0XA 1PIOA 2JHEA 2EX8A 2PHYA 2Y2JA 2O99A 3O86A 4X1MA 3IWOA 4EEPA 1TS0A 3MF0A 1IOUA 3IS2B 5FI2A 1K54C 1PI5A 2Y2OA 3IX4A 2QZ6A 1K25A 2VV6A 2HV1A 3PAGA 5A92A 3PTEA 2XLNA 3UPPA 1ES5A 5FAQA 5TR7A 3LCEA 4IJGA 1N9NA 3C5AA 3LYXA 5HFOA 3Q81A 5HAIA 1Y4OA 5L07A 3WS4A 1E3UD 5CGWA 1TVFA 3B3XA 5BOHA 3NI9A 5A8BA 1GSWA 2Y55A 3QP4A 3OCLA 4G3KA 2FZ0A 5CEBA 1JVJA 1P97A 3T4LA 3A0SA 1FOFA 3UY6A 1SDEA 1KE3A 3GV9A 4PAUA 4B9OA 1YT4A 3C38A 1PW1A 3LR3A 4JKTA 4HQAA 5E2GA 2WGWA 2IWDA 4HH2A 2Q9MA 4L0LA 4KZAA 5GLCA 2PT7A 1K6SA 2W3EA 4KZ7A 2V2FF 3C7VA 3HJIA 4YNRA 1BTLA 3ZG7B 1IKGA 4RX3A 3ZG0A 2X02A 4R3BA 1H5XA 4WEKA 3MQQA 4IHQA 4B4XA 3C4OA 5E2HA 3DAVA 4II7A 5KSHA 3F1NB 2H10A 3IHAA 1SKOA 4BENA 3PBTA 1LL9A 2ZQAA 3NC8A 1PNEA 3T12B 3LIEA 3TRCA 1Y28A 3BEBA 4U3TA 1XKZA 5FASA 2KDKA 1YMSA 3KYQA 5CRFA 1VETA 1K57C 1XJ2A 2A24B 5E2FA 3T4OA 1GA0A 3BFGA 3H9WA 1GSXA 4D60A 1S1YA 2DCFA 2HDRA 3SS4A 3TW8A 1MC0A 2J9PA 2VA0A 3BFCA 3IWIA 5D3OA 1IYOA 4GCZA 4S2LA 3AGEA 3PYPA 3R4KA 4LGWA 2K7SA 3E4QA 1BYWA 4UA7A 3T1QB 5F5YA 2NUPC 1KE4A 1AXBA 2WGVA 1IKIA 1KGFA 2JKRM 1ZG4A 4IVKA 3VE4A 1TD5A 5AQBA 4P87A 3BJNA 4GNUA 4QY6A 3FPWA 3MFDA 4R1GA 4XUZA 4PM8A 4KZ6A 1WYBA 1ESUA 1K55A 1NZOA 1KE0A 1MKIA 3T1XA 3HCYA 4ZTKA 4RX2A 4WLAA 2ZMAA 4UHUA 1JWZA 2PYRA 3IS2A 3A0VA 4WELA 2JN7A 2PU2A 2WKHA 5EE8A 3T4JA 5GLBA 4OPZA 1PYYA 3HVFA 4HJ4A 2ZM8A 3IXHA 4N1HA 3VP2A 3A0RA 1ALQA 4E3IA 3P7NA 2OLUA 1NY0A 4MN6A 5EOOA 1W7FA 4JF5A 4IEDA 3S4XA 4R23A 1ERQA 3DTKA 1IYSA 4R0QA 4AFIA 5EV0A 5DTSA 1P9RA 1N9LA 4MLLA 3MBZA 3LUQA 2XF3A 4KZ9A 3MQ0A 4H8RA 3V3SA 1L2SA 1LHYA 2A49A 4NG2A 3BFDA 1YQSA 5AQAA 5J7EA 2O9CA 3SS5A 4WUJA 4CPKA 4GZBA 4ETZA 3HJKA 1JNUA 2PR6A 4KG5A 2P9VA 4F3LB 3MXSA 3CAXA 1YKDA 3BY8A 1PI4A 2C6WB 5EOEA 4H6JB 1O7EA 5M19A 1T1CA 2EX6A 2IWCA 1FCMA 1RCJA 2OV5A 3P98A 3BW6A 4GW9A 4HIAA 1Z6FA 1GCEA 1CI8A 3H82A 3LIFA 4Y3IA 4CJNA 3Q1FA 3Q07A 4WN5A 4NEED 2WKIA 4GJ4A 1F9IA 3NDGA 4UQIS 3NBLA 1HD8A 2ZC3B 2ZD8A 4BD0A 4OLGA 1NLZA 2W3HA 4NXGA 2ZOIA 3CPTA 3BWLA 3BY9A 4PHTA 1KDSA 4GHIB 3WS1A 4K91A 3QP2A 1YSQA 2VGLM 2LB9A 2W0NA 2VGKA 4MBKA 3H7WB 4OP8A 2H0YA 3OPRA 5L09A 4MMNA 2V8FA 5FA7A 1ONHA 3WWXA 2Z6CA 4CLCB 3UE6A 2VGJA 4UA6A 4MBHA 3SH8A 3MXQA 1LL5A 3VP3A 1DJCA 1K56A 5DTKA 1BLPA 3QHYA 2ZBBA 3E0YA 3QP8A 2Y2KA 4WZ5A 3MKFA 1SHVA 4BBVA 4EBLA 3NIAA 3T1RA 4PM7A 5FQIA 3PBNA 3CI6A 1ACFA 3OPHA 1SCWA 2PAVP 4BL2A 1MKMA 4Y2FA 3DW0A 4R4SA 2VJWA 1C3BA 3LEZA 3NJAA 1TDGA 1DJAA 4GD6A 4OQHA 2ZMFA 5FQKA 3IX3A 1BLHA 1VB6A 1PZPA 3GECA 3OPPA 2W1TB 2PBYA 3HL9A 3N8LA 2EX9A 3HLEA 5EVEA 3F1NA 3FWLA 1S4RA 2Y4AA 1EWZA 5CX7A 1JTGA 2GNXA 1YSPA 5HARA 5HDCA 4PM9A 3VP0A 2W3DA 3PR6A 1KVMA 1OJ5A 1QMFA 2PBDP 3A3DA 4WF0A 5FEFA 1ZKJA 1K4EA 4DN0A 1HZOA 3E2KA 3OLOA 4DE0A 2O0YA 3MMHA 2JKRI 3LY4A 3UB7A 3OBFA 2ZQ9A 3NOPC 2I9VA 2JBFA 4WMCD 2VV7A 3FYZA 1W8QA 5F83A 3MSHA 3VSLA 1S6RA 3SOIA 2VKSA 3CUEC 3S22A 4X1LA 1BLCA 1GHMA 2QKPA 1V9ZA 4HOIA 1QMEA 4HH3A 1NLYA 3S7PA 3S7OA 2ZC7A 5TGFA 4Q8IA 5G4YA 4B88A 1YLJA 3HLDA 4E6WA 4GB7A 5M18A 4RQ9A 1XPBA 1ES3A 1FCNA 1OTDA 4LRXC 3CWFA 3B42A 5DJUA 5L8MA 3O3VA 4GOGA 3G32A 2HJEA 2FFFB 3EGXC
chains in the Genus database with same CATH topology
3FZCA 5CXWA 3ZG7B 4E3JA 4LV2A 3OZHA 1PWCA 3HBRA 2DNSA 2B5RA 1IKGA 3M6HA 4RX3A 3ZG0A 4F94A 2X02A 1NJ4A 4KZ4A 4R3BA 5F82A 3CG5A 1BSGA 5FAOA 3VFFA 3UPOA 3A3IA 5EVIC 4WMCA 4HBUA 5HX9A 1JWPA 1LLBA 1H5XA 4WEKA 5TFQA 4FSFA 5GHYA 4KG2A 4B4XA 3G34A 4E3NA 5A90A 3C4OA 5FAPA 1NYMA 1NXYA 2H0TA 4DXBA 2XEPA 3GQZA 5E2HA 5KSHA 2H10A 1MWSA 3IHAA 4BLMA 2WYXA 4BENA 3W4QA 1G68A 4M3KA 3PBTA 1LL9A 2ZJ9A 2ZQAA 3NC8A 1L0DA 4R3JA 4IVIA 3HLCA 4N92A 4EQIA 3ZVWA 1FQGA 3BEBA 4U3TA 1XKZA 3A3EA 5FASA 2XQZA 1YMSA 4YFMA 4P85A 5CRFA 3V3RA 3A3FA 3BRMA 3GSGA 3P09A 4S2OA 4E3MA 5L2FA 1K54A 3ZHHA 4E3KA 4ZAMA 5HL1A 1JTDA 3FKWA 1K57C 2ZQDA 1BUEA 5E2FA 2X01A 2PU4A 1GA0A 3BFGA 1W79A 5FI6A 2GDNA 2DCFA 2HDRA 1EI5A 5J8XA 1DJBA 3SS4A 1FR6A 2ZC6B 4R4RA 2J9PA 4LCMA 4EUZA 1K55C 1NYYA 3BFCA 3IWIA 5CHUA 1IYOA 5D3OA 2Y2QA 4S2LA 3PBRA 4X55A 4PM5A 3DWZA 3HUMA 1GA9A 3AGEA 3GVBA 1LI9A 2ZC4B 2R9XA 1WE4A 2WAEA 2QPNA 4LV1A 3UE1A 3VP1A 1XXMA 3HLGA 3MZEA 4QJGA 4UA7A 2BLSA 2J9OA 2XH9A 4K0XA 3IH8A 5DF9A 3ZVTA 1L0EA 5CEDA 4U0TA 5G18A 3UDXA 1KE4A 3CZDA 3N7WA 3ZG9B 1E25A 4MEZA 1AXBA 2WGVA 3ZG5A 5U47A 3EQUA 1IKIA 1N9BA 3NY4A 1KGFA 4EV4A 1ZG4A 4IVKA 3IF5A 5AQBA 4P87A 3UDFA 2WUQA 3MXRA 3EQVA 4GNUA 4P0MA 4QY6A 3OCNA 4ID4A 4JXVA 1YLTA 2XD5A 3MZDA 3ZNTA 3MFDA 4R1GA 3UPNA 1FSYA 3O88A 3NDEA 4XUZA 4PM8A 5FQQA 3ZDJA 1WYCA 4KZ6A 3UDIA 2XFTA 3ZGAB 2ZLYA 4RVAA 4C75A 2Y2PA 1WYBA 1ESUA 1K55A 1NZOA 1Q2PA 3C4PA 1KE0A 1E3UA 3M2JA 3IF6B 4K0WA 3HLFA 2WZZA 3AGFA 4E3LA 1MKIA 4GDBA 1FCOA 3N6IA 4GKUA 4ZTKA 4RX2A 2ZMAA 4UHUA 1PWGA 1JWZA 1Y54A 1N4OA 3FV7A 4C6YA 4UA9A 4WELA 2PU2A 2WKHA 4KQQA 5EE8A 1YLPA 2J7VA 4LCLA 5CTMA 5EVIB 4ZDXA 1EROA 3VOYA 5GLBA 1RGZA 4BQMA 5DTTA 2C5WB 4OPZA 2ZQCA 3VOZA 4XXRA 1PYYA 3Q7VB 3VSKA 3HVFA 5DF7A 2ZM8A 1K56D 3IXHA 4A5RA 1ZG6A 4N1HA 3VP2A 1KDWA 2Y2MA 1ALQA 3VFHA 4E3IA 3UE3A 2OLUA 1NY0A 2RCXA 3IF6A 3LY3A 3ITBA 3CJMA 5EOOA 1W7FA 3TSGA 2Y2IA 4MNRA 3G35A 5AQ7A 1XGJA 1KGGA 4FD8A 5HW3A 4JF5A 4IEDA 3S4XA 1ONGA 4R23A 4DRTA 3WS5A 3BLMA 1ERQA 1IYSA 4R0QA 2JE5A 2WKEA 1IEMA 5EVID 5DTSA 4LV0A 3RXXA 2OSUA 2Y2HA 3Q7VA 2HP9A 5GLAA 4MLLA 3HLBA 3G4PA 3MBZA 3JYIA 2XF3A 5FATA 1XA1A 4KZ9A 4OOLA 4H8RA 4OONA 3V3SA 1TDLA 5EUAA 1L2SA 5FQJA 1LHYA 2Y91A 3IXBA 2A49A 1MXOA 3BFDA 1YQSA 1BZAA 4QU3A 5KZHA 1L0FA 5AQAA 4ZBEA 3SS5A 5DVAA 2Y2NA 4CPKA 4Z9QA 2FFYA 3QNCA 4ZJ3A 4GZBA 4KG5A 3OPLA 3V5MA 3IXDA 5CGSA 1NRFA 5AQ9A 1CI9A 2P9VA 4Y0UA 3V39A 3G2YA 2WAFA 3MXSA 1W8YA 2G2UA 4MBFA 4X6TA 5FSRA 3QNBA 2DRWA 1CEFA 2BG1A 1PI4A 2C6WB 2EFUA 3IF6C 1ES4A 5GLDA 5EOEA 3WS2A 1J9MA 4OQ0A 3M2KA 1O7EA 5M19A 4BJPA 2OLVA 1L0GA 4PMAA 5KSCA 2EX6A 2H5SA 3VMAA 5CERA 4EWFA 4FH4A 2IWCA 4HEFA 5CHMA 2UWXA 3SH7A 1FCMA 4WZ4A 1RCJA 4ZJ1A 2OV5A 3P98A 3PBSA 4DDSA 4EBNA 4IBRA 5FI7A 1Z6FA 1MY8A 4BD1A 5CHJA 2HP6A 1GCEA 3G2ZA 2HPBA 2IWBA 3DTMA 4ZJ2A 4JXGA 5FQ9A 2XR0A 3UNWA 3OC2A 5CECA 3BM6A 1CI8A 1S0WA 1XA7A 1NZUA 2XDMA 2XD1A 4S2KA 3GRJA 4CJNA 4Y0TA 3Q1FA 4WM9A 4DXCA 3M6BA 3UN7A 3Q07A 1IYPA 4S2NA 2WKIA 5JYOA 3UE0A 3NDGA 3ZFZA 4DE2A 3NBLA 2ZC3B 1HD8A 2EFXA 2ZC5B 4FH2A 4GDNA 2ZD8A 1LI0A 1XP4A 4WZ5C 4JLFA 4OH0A 1I2WA 3W4OA 1FR1A 4KQOA 4BD0A 3BLSA 4OLGA 1K4FA 3AGDA 1H8ZA 3O87A 2WZXA 3SH9A 2WK0A 3CMZA 5IHVA 4HBTA 1HVBA 3Q7ZA 4N1XA 4N9KA 1MBLA 4OVDA 2XFSA 4S2PA 5DF8A 5HAPA 1KDSA 4P6BA 4WEJA 1GHPA 4JF6A 3WS1A 4K91A 3BECA 1KGEA 3N8SA 3D4FA 3N4IA 4KZBA 2VGKA 4MBKA 2Y59A 3S1YA 4OP8A 4S2JA 2H0YA 5CTNA 1OMEA 4JXWA 2P74A 3BFEA 3OPRA 5FA7A 1ONHA 2HDSA 3WWXA 5E2EA 1G6AA 2RL3A 4QB8A 1SDNA 2VGJA 4UA6A 3I7JA 4MBHA 3ISGA 5F1FA 2JC7A 3SH8A 1K6RA 3IT9A 1CEGA 4YINA 2ZM0A 5GHXA 1LL5A 3VP4A 4B4ZA 1MWRA 4Y0OA 1DJCA 1K56A 3IH9A 5DTKA 3VP3A 2XK1A 1BLPA 1VM1A 3QHYA 4KZ3A 1ES2A 1YM1A 2Y2KA 3G30A 4WZ5A 3TG9A 2I72A 4NK3A 3ZG8B 3MKFA 1SHVA 4OPRA 1M6KA 1PWDA 3GMWA 4EBLA 1BLSA 1M40A 4DKIA 3NIAA 3PBOA 1PZOA 2G2WA 3E2LA 1PW8A 1O07A 3W4PA 4PM7A 5FQIA 3PBNA 2EX2A 2V20A 3BYDA 1SCWA 3OPHA 1JWVA 1HTZA 1ESIA 2HP5A 4BL2A 2ZQ7A 4OOYA 3DW0A 1E4DA 3HREA 1RP5A 4R4SA 3RJUA 4KENB 2WGIA 1FSWA 4OP5A 1C3BA 3IWQA 4WBGA 1K38A 3WRTA 4PPRA 3W8KA 3LEZA 5FDHA 1TDGA 3GTCA 4D2OA 1DJAA 4GD6A 4OQHA 3ITAA 3C7UA 5CGXA 5FQKA 1BLHA 4X69A 1PZPA 3MKEA 3OPPA 4DDYA 2PBYA 2ZM2A 3HL9A 3BFFA 1I5QA 2EX9A 3N8LA 5JYPA 2HDQA 2Y2GA 3TOIA 2Q9NA 2Y2LA 3HLEA 4DF6A 2XGNA 4X68A 1Q2QA 3IHBA 5EVIA 3FWLA 4QY5A 2Y4AA 4KZ5A 4JF4A 4OPQA 3RXWA 1EWZA 4OLDA 3PBQA 2CC1A 1I2SA 1JTGA 3IXGA 4X56A 2V1ZA 4N9LA 2E8IA 3HUNA 5HARA 1BT5A 1YLYA 5EPHA 2J8YA 4OQIA 4PM9A 4JPMA 4GD8A 5GL9A 3VP0A 1IELA 2R9WA 1YMXA 3G31A 1GHIA 3LO7A 2ZQ8A 1KVMA 2JCHA 4S2NC 1MWTA 4IBXA 1QMFA 4U0XA 1PIOA 3A3DA 3GR2A 4QD4A 3WRZA 1ZKJA 2EX8A 1MWUA 5M1AA 1K4EA 4LV3A 3ZCZA 5FQMA 1U60A 2Y2JA 4RA7A 3PAEA 1HZOA 3E2KA 3O86A 2Z2LB 3HLWA 3IWOA 4DE0A 3FKVA 4OPYA 4BL3A 1YLZA 3Q82A 1VQQA 2HDUA 3LY4A 5FI2A 4OQGA 4X53A 1K54C 1YLWA 1PI5A 2Y2OA 2ZQ9A 4S2IA 2JBFA 1H8YA 4S2MA 2QZ6A 2WADA 3IQAA 1K25A 4WMCD 1DY6A 3FYZA 5E43A 1W8QA 5EECA 3PAGA 5A92A 4O7DA 5F83A 3ZNYA 3PTEA 4OOMA 2XLNA 3UPPA 3HUOA 3VSLA 1ES5A 2Z2MB 4LENA 1S6RA 3SOIA 2EXBA 3LCEA 5FAQA 5TR7A 3S22A 2P9VB 3C5AA 1BLCA 1GHMA 4KG6A 1KVLA 3SS3A 4E6XA 3MZFA 5HFOA 3Q81A 2EXAA 4KZ8A 5HAIA 1QMEA 3WS4A 4JXSA 3N8RA 4DE3A 1E3UD 5CGWA 1TVFA 5HAQA 3B3XA 3DWKA 4FCFA 5BOHA 3NI9A 4PM6A 4C3QA 1MPLA 5I94A 2Y55A 2X71A 4HESA 1RGYA 2ZC7A 3OCLA 5TGFA 5CEBA 1JVJA 2QMIA 3A3JA 5EVLA 4DE1A 4Q8IA 4OKPA 4EBPA 1FOFA 4GN2A 3UY6A 3V50A 1SDEA 4B88A 1KE3A 3GV9A 3NCKA 1YLJA 1XGIA 5A91A 1YT4A 3HLDA 4E6WA 1PW1A 1ZC2A 4JKTA 1ERMA 4GB7A 1XX2A 4KQRA 1BULA 5E2GA 5GHZA 5M18A 4RYEA 4WYYA 2WGWB 1XPBA 3UO9A 1ES3A 1FCNA 3WS0A 2A3UA 2WGWA 1TEMA 4XUXA 1IYQA 2IWDA 4L0LA 2Q9MA 4E3OA 1W5DA 4KZAA 5F1GA 1CK3A 5GLCA 5KMWA 1SKFA 4UAAA 1K6SA 4KZ7A 2V2FF 3C7VA 3O3VA 4GOGA 4NETA 3G32A 5A93A 1BTLA 2FFFB 1K57A 4JBFA 4Y7PA 4QHCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FZC A;  5CXW A;  3ZG7 B;  4E3J A;  4LV2 A;  3OZH A;  1PWC A;  3HBR A;  2DNS A;  2B5R A;  1IKG A;  3M6H A;  4RX3 A;  3ZG0 A;  4F94 A;  2X02 A;  1NJ4 A;  4KZ4 A;  4R3B A;  5F82 A;  3CG5 A;  1BSG A;  5FAO A;  3VFF A;  3UPO A;  3A3I A;  5EVI C;  4WMC A;  4HBU A;  5HX9 A;  1JWP A;  1LLB A;  1H5X A;  4WEK A;  5TFQ A;  4FSF A;  5GHY A;  4KG2 A;  4B4X A;  3G34 A;  4E3N A;  5A90 A;  3C4O A;  5FAP A;  1NYM A;  1NXY A;  2H0T A;  4DXB A;  2XEP A;  3GQZ A;  5E2H A;  5KSH A;  2H10 A;  1MWS A;  3IHA A;  4BLM A;  2WYX A;  4BEN A;  3W4Q A;  1G68 A;  4M3K A;  3PBT A;  1LL9 A;  2ZJ9 A;  2ZQA A;  3NC8 A;  1L0D A;  4R3J A;  4IVI A;  3HLC A;  4N92 A;  4EQI A;  3ZVW A;  1FQG A;  3BEB A;  4U3T A;  1XKZ A;  3A3E A;  5FAS A;  2XQZ A;  1YMS A;  4YFM A;  4P85 A;  5CRF A;  3V3R A;  3A3F A;  3BRM A;  3GSG A;  3P09 A;  4S2O A;  4E3M A;  5L2F A;  1K54 A;  3ZHH A;  4E3K A;  4ZAM A;  5HL1 A;  1JTD A;  3FKW A;  1K57 C;  2ZQD A;  1BUE A;  5E2F A;  2X01 A;  2PU4 A;  1GA0 A;  3BFG A;  1W79 A;  5FI6 A;  2GDN A;  2DCF A;  2HDR A;  1EI5 A;  5J8X A;  1DJB A;  3SS4 A;  1FR6 A;  2ZC6 B;  4R4R A;  2J9P A;  4LCM A;  4EUZ A;  1K55 C;  1NYY A;  3BFC A;  3IWI A;  5CHU A;  1IYO A;  5D3O A;  2Y2Q A;  4S2L A;  3PBR A;  4X55 A;  4PM5 A;  3DWZ A;  3HUM A;  1GA9 A;  3AGE A;  3GVB A;  1LI9 A;  2ZC4 B;  2R9X A;  1WE4 A;  2WAE A;  2QPN A;  4LV1 A;  3UE1 A;  3VP1 A;  1XXM A;  3HLG A;  3MZE A;  4QJG A;  4UA7 A;  2BLS A;  2J9O A;  2XH9 A;  4K0X A;  3IH8 A;  5DF9 A;  3ZVT A;  1L0E A;  5CED A;  4U0T A;  5G18 A;  3UDX A;  1KE4 A;  3CZD A;  3N7W A;  3ZG9 B;  1E25 A;  4MEZ A;  1AXB A;  2WGV A;  3ZG5 A;  5U47 A;  3EQU A;  1IKI A;  1N9B A;  3NY4 A;  1KGF A;  4EV4 A;  1ZG4 A;  4IVK A;  3IF5 A;  5AQB A;  4P87 A;  3UDF A;  2WUQ A;  3MXR A;  3EQV A;  4GNU A;  4P0M A;  4QY6 A;  3OCN A;  4ID4 A;  4JXV A;  1YLT A;  2XD5 A;  3MZD A;  3ZNT A;  3MFD A;  4R1G A;  3UPN A;  1FSY A;  3O88 A;  3NDE A;  4XUZ A;  4PM8 A;  5FQQ A;  3ZDJ A;  1WYC A;  4KZ6 A;  3UDI A;  2XFT A;  3ZGA B;  2ZLY A;  4RVA A;  4C75 A;  2Y2P A;  1WYB A;  1ESU A;  1K55 A;  1NZO A;  1Q2P A;  3C4P A;  1KE0 A;  1E3U A;  3M2J A;  3IF6 B;  4K0W A;  3HLF A;  2WZZ A;  3AGF A;  4E3L A;  1MKI A;  4GDB A;  1FCO A;  3N6I A;  4GKU A;  4ZTK A;  4RX2 A;  2ZMA A;  4UHU A;  1PWG A;  1JWZ A;  1Y54 A;  1N4O A;  3FV7 A;  4C6Y A;  4UA9 A;  4WEL A;  2PU2 A;  2WKH A;  4KQQ A;  5EE8 A;  1YLP A;  2J7V A;  4LCL A;  5CTM A;  5EVI B;  4ZDX A;  1ERO A;  3VOY A;  5GLB A;  1RGZ A;  4BQM A;  5DTT A;  2C5W B;  4OPZ A;  2ZQC A;  3VOZ A;  4XXR A;  1PYY A;  3Q7V B;  3VSK A;  3HVF A;  5DF7 A;  2ZM8 A;  1K56 D;  3IXH A;  4A5R A;  1ZG6 A;  4N1H A;  3VP2 A;  1KDW A;  2Y2M A;  1ALQ A;  3VFH A;  4E3I A;  3UE3 A;  2OLU A;  1NY0 A;  2RCX A;  3IF6 A;  3LY3 A;  3ITB A;  3CJM A;  5EOO A;  1W7F A;  3TSG A;  2Y2I A;  4MNR A;  3G35 A;  5AQ7 A;  1XGJ A;  1KGG A;  4FD8 A;  5HW3 A;  4JF5 A;  4IED A;  3S4X A;  1ONG A;  4R23 A;  4DRT A;  3WS5 A;  3BLM A;  1ERQ A;  1IYS A;  4R0Q A;  2JE5 A;  2WKE A;  1IEM A;  5EVI D;  5DTS A;  4LV0 A;  3RXX A;  2OSU A;  2Y2H A;  3Q7V A;  2HP9 A;  5GLA A;  4MLL A;  3HLB A;  3G4P A;  3MBZ A;  3JYI A;  2XF3 A;  5FAT A;  1XA1 A;  4KZ9 A;  4OOL A;  4H8R A;  4OON A;  3V3S A;  1TDL A;  5EUA A;  1L2S A;  5FQJ A;  1LHY A;  2Y91 A;  3IXB A;  2A49 A;  1MXO A;  3BFD A;  1YQS A;  1BZA A;  4QU3 A;  5KZH A;  1L0F A;  5AQA A;  4ZBE A;  3SS5 A;  5DVA A;  2Y2N A;  4CPK A;  4Z9Q A;  2FFY A;  3QNC A;  4ZJ3 A;  4GZB A;  4KG5 A;  3OPL A;  3V5M A;  3IXD A;  5CGS A;  1NRF A;  5AQ9 A;  1CI9 A;  2P9V A;  4Y0U A;  3V39 A;  3G2Y A;  2WAF A;  3MXS A;  1W8Y A;  2G2U A;  4MBF A;  4X6T A;  5FSR A;  3QNB A;  2DRW A;  1CEF A;  2BG1 A;  1PI4 A;  2C6W B;  2EFU A;  3IF6 C;  1ES4 A;  5GLD A;  5EOE A;  3WS2 A;  1J9M A;  4OQ0 A;  3M2K A;  1O7E A;  5M19 A;  4BJP A;  2OLV A;  1L0G A;  4PMA A;  5KSC A;  2EX6 A;  2H5S A;  3VMA A;  5CER A;  4EWF A;  4FH4 A;  2IWC A;  4HEF A;  5CHM A;  2UWX A;  3SH7 A;  1FCM A;  4WZ4 A;  1RCJ A;  4ZJ1 A;  2OV5 A;  3P98 A;  3PBS A;  4DDS A;  4EBN A;  4IBR A;  5FI7 A;  1Z6F A;  1MY8 A;  4BD1 A;  5CHJ A;  2HP6 A;  1GCE A;  3G2Z A;  2HPB A;  2IWB A;  3DTM A;  4ZJ2 A;  4JXG A;  5FQ9 A;  2XR0 A;  3UNW A;  3OC2 A;  5CEC A;  3BM6 A;  1CI8 A;  1S0W A;  1XA7 A;  1NZU A;  2XDM A;  2XD1 A;  4S2K A;  3GRJ A;  4CJN A;  4Y0T A;  3Q1F A;  4WM9 A;  4DXC A;  3M6B A;  3UN7 A;  3Q07 A;  1IYP A;  4S2N A;  2WKI A;  5JYO A;  3UE0 A;  3NDG A;  3ZFZ A;  4DE2 A;  3NBL A;  2ZC3 B;  1HD8 A;  2EFX A;  2ZC5 B;  4FH2 A;  4GDN A;  2ZD8 A;  1LI0 A;  1XP4 A;  4WZ5 C;  4JLF A;  4OH0 A;  1I2W A;  3W4O A;  1FR1 A;  4KQO A;  4BD0 A;  3BLS A;  4OLG A;  1K4F A;  3AGD A;  1H8Z A;  3O87 A;  2WZX A;  3SH9 A;  2WK0 A;  3CMZ A;  5IHV A;  4HBT A;  1HVB A;  3Q7Z A;  4N1X A;  4N9K A;  1MBL A;  4OVD A;  2XFS A;  4S2P A;  5DF8 A;  5HAP A;  1KDS A;  4P6B A;  4WEJ A;  1GHP A;  4JF6 A;  3WS1 A;  4K91 A;  3BEC A;  1KGE A;  3N8S A;  3D4F A;  3N4I A;  4KZB A;  2VGK A;  4MBK A;  2Y59 A;  3S1Y A;  4OP8 A;  4S2J A;  2H0Y A;  5CTN A;  1OME A;  4JXW A;  2P74 A;  3BFE A;  3OPR A;  5FA7 A;  1ONH A;  2HDS A;  3WWX A;  5E2E A;  1G6A A;  2RL3 A;  4QB8 A;  1SDN A;  2VGJ A;  4UA6 A;  3I7J A;  4MBH A;  3ISG A;  5F1F A;  2JC7 A;  3SH8 A;  1K6R A;  3IT9 A;  1CEG A;  4YIN A;  2ZM0 A;  5GHX A;  1LL5 A;  3VP4 A;  4B4Z A;  1MWR A;  4Y0O A;  1DJC A;  1K56 A;  3IH9 A;  5DTK A;  3VP3 A;  2XK1 A;  1BLP A;  1VM1 A;  3QHY A;  4KZ3 A;  1ES2 A;  1YM1 A;  2Y2K A;  3G30 A;  4WZ5 A;  3TG9 A;  2I72 A;  4NK3 A;  3ZG8 B;  3MKF A;  1SHV A;  4OPR A;  1M6K A;  1PWD A;  3GMW A;  4EBL A;  1BLS A;  1M40 A;  4DKI A;  3NIA A;  3PBO A;  1PZO A;  2G2W A;  3E2L A;  1PW8 A;  1O07 A;  3W4P A;  4PM7 A;  5FQI A;  3PBN A;  2EX2 A;  2V20 A;  3BYD A;  1SCW A;  3OPH A;  1JWV A;  1HTZ A;  1ESI A;  2HP5 A;  4BL2 A;  2ZQ7 A;  4OOY A;  3DW0 A;  1E4D A;  3HRE A;  1RP5 A;  4R4S A;  3RJU A;  4KEN B;  2WGI A;  1FSW A;  4OP5 A;  1C3B A;  3IWQ A;  4WBG A;  1K38 A;  3WRT A;  4PPR A;  3W8K A;  3LEZ A;  5FDH A;  1TDG A;  3GTC A;  4D2O A;  1DJA A;  4GD6 A;  4OQH A;  3ITA A;  3C7U A;  5CGX A;  5FQK A;  1BLH A;  4X69 A;  1PZP A;  3MKE A;  3OPP A;  4DDY A;  2PBY A;  2ZM2 A;  3HL9 A;  3BFF A;  1I5Q A;  2EX9 A;  3N8L A;  5JYP A;  2HDQ A;  2Y2G A;  3TOI A;  2Q9N A;  2Y2L A;  3HLE A;  4DF6 A;  2XGN A;  4X68 A;  1Q2Q A;  3IHB A;  5EVI A;  3FWL A;  4QY5 A;  2Y4A A;  4KZ5 A;  4JF4 A;  4OPQ A;  3RXW A;  1EWZ A;  4OLD A;  3PBQ A;  2CC1 A;  1I2S A;  1JTG A;  3IXG A;  4X56 A;  2V1Z A;  4N9L A;  2E8I A;  3HUN A;  5HAR A;  1BT5 A;  1YLY A;  5EPH A;  2J8Y A;  4OQI A;  4PM9 A;  4JPM A;  4GD8 A;  5GL9 A;  3VP0 A;  1IEL A;  2R9W A;  1YMX A;  3G31 A;  1GHI A;  3LO7 A;  2ZQ8 A;  1KVM A;  2JCH A;  4S2N C;  1MWT A;  4IBX A;  1QMF A;  4U0X A;  1PIO A;  3A3D A;  3GR2 A;  4QD4 A;  3WRZ A;  1ZKJ A;  2EX8 A;  1MWU A;  5M1A A;  1K4E A;  4LV3 A;  3ZCZ A;  5FQM A;  1U60 A;  2Y2J A;  4RA7 A;  3PAE A;  1HZO A;  3E2K A;  3O86 A;  2Z2L B;  3HLW A;  3IWO A;  4DE0 A;  3FKV A;  4OPY A;  4BL3 A;  1YLZ A;  3Q82 A;  1VQQ A;  2HDU A;  3LY4 A;  5FI2 A;  4OQG A;  4X53 A;  1K54 C;  1YLW A;  1PI5 A;  2Y2O A;  2ZQ9 A;  4S2I A;  2JBF A;  1H8Y A;  4S2M A;  2QZ6 A;  2WAD A;  3IQA A;  1K25 A;  4WMC D;  1DY6 A;  3FYZ A;  5E43 A;  1W8Q A;  5EEC A;  3PAG A;  5A92 A;  4O7D A;  5F83 A;  3ZNY A;  3PTE A;  4OOM A;  2XLN A;  3UPP A;  3HUO A;  3VSL A;  1ES5 A;  2Z2M B;  4LEN A;  1S6R A;  3SOI A;  2EXB A;  3LCE A;  5FAQ A;  5TR7 A;  3S22 A;  2P9V B;  3C5A A;  1BLC A;  1GHM A;  4KG6 A;  1KVL A;  3SS3 A;  4E6X A;  3MZF A;  5HFO A;  3Q81 A;  2EXA A;  4KZ8 A;  5HAI A;  1QME A;  3WS4 A;  4JXS A;  3N8R A;  4DE3 A;  1E3U D;  5CGW A;  1TVF A;  5HAQ A;  3B3X A;  3DWK A;  4FCF A;  5BOH A;  3NI9 A;  4PM6 A;  4C3Q A;  1MPL A;  5I94 A;  2Y55 A;  2X71 A;  4HES A;  1RGY A;  2ZC7 A;  3OCL A;  5TGF A;  5CEB A;  1JVJ A;  2QMI A;  3A3J A;  5EVL A;  4DE1 A;  4Q8I A;  4OKP A;  4EBP A;  1FOF A;  4GN2 A;  3UY6 A;  3V50 A;  1SDE A;  4B88 A;  1KE3 A;  3GV9 A;  3NCK A;  1YLJ A;  1XGI A;  5A91 A;  1YT4 A;  3HLD A;  4E6W A;  1PW1 A;  1ZC2 A;  4JKT A;  1ERM A;  4GB7 A;  1XX2 A;  4KQR A;  1BUL A;  5E2G A;  5GHZ A;  5M18 A;  4RYE A;  4WYY A;  2WGW B;  1XPB A;  3UO9 A;  1ES3 A;  1FCN A;  3WS0 A;  2A3U A;  2WGW A;  1TEM A;  4XUX A;  1IYQ A;  2IWD A;  4L0L A;  2Q9M A;  4E3O A;  1W5D A;  4KZA A;  5F1G A;  1CK3 A;  5GLC A;  5KMW A;  1SKF A;  4UAA A;  1K6S A;  4KZ7 A;  2V2F F;  3C7V A;  3O3V A;  4GOG A;  4NET A;  3G32 A;  5A93 A;  1BTL A;  2FFF B;  1K57 A;  4JBF A;  4Y7P A;  4QHC A; 
#chains in the Genus database with same CATH topology
 5CXW A;  4LV2 A;  3HBR A;  2B5R A;  3CIT A;  3BQA A;  1NJ4 A;  3C8C A;  3CG5 A;  5FAO A;  5HX9 A;  1LLB A;  1XFN A;  2KOI A;  5A90 A;  2H0T A;  2XEP A;  2JKF A;  3H82 B;  2WYX A;  1G68 A;  2BAS A;  5F6A A;  3RTY A;  4N92 A;  3ULF A;  3A3E A;  1GSV A;  2XQZ A;  3V3R A;  2J80 A;  3P09 A;  4I3I A;  1L3L A;  4E3M A;  2V0U A;  4ZAM A;  3FKW A;  4NXB A;  2ZQD A;  2HZ5 A;  1T18 A;  1W79 A;  1FR6 A;  2ZC6 B;  3UMD A;  2D01 A;  5CHU A;  4PM5 A;  3DWZ A;  2EA9 A;  3T4Q A;  1GA9 A;  1LI9 A;  2VGL S;  2R9X A;  4LRZ E;  1STZ A;  5L10 A;  4K0X A;  3ZVT A;  5DF9 A;  3UDX A;  2B02 A;  3N7W A;  4NKP A;  3ZG9 B;  3ZG5 A;  3EQU A;  3IF5 A;  4UQI M;  4G3V A;  3MXR A;  4P0M A;  3FPV A;  3T4T A;  4ID4 A;  3MZD A;  3D9Y A;  5AVE A;  3NDE A;  5FQQ A;  1WYC A;  3UDI A;  3ZGA B;  4RVA A;  3C4P A;  2PYP A;  3HLF A;  3AGF A;  5F68 A;  4E3L A;  1FIK A;  1TS8 A;  5HD5 A;  2ACG A;  4FUW A;  1PWG A;  3KX0 X;  3ZYT A;  4UA9 A;  1Z09 A;  4KQQ A;  4Y15 A;  1YLP A;  2FH5 A;  3UB5 P;  4ZDX A;  2C5W B;  2OOL A;  5HDD A;  4JGO A;  4XXR A;  5DF7 A;  4A5R A;  2J3T D;  1ZG6 A;  4NXE A;  1KDW A;  3UB9 A;  2RCX A;  4MNR A;  3F1O B;  3G35 A;  1KGG A;  4FD8 A;  3BLM A;  1OTE A;  2JE5 A;  2OWJ A;  2WKE A;  3RXX A;  2OSU A;  3Q7V A;  3HLB A;  1TS7 A;  1XA1 A;  4OON A;  2XRO A;  1TDL A;  2Y91 A;  5KZH A;  3KSI A;  2GJ3 A;  2ZL1 A;  1H3Q A;  3JVV A;  5DVA A;  4Q0I A;  5CGS A;  5AQ9 A;  4R38 A;  1CEF A;  3F1P A;  2EFU A;  3BQ8 A;  4OQ0 A;  1DRM A;  1MZU A;  2OLV A;  2H5S A;  3VMA A;  2D02 A;  1H8M A;  1PFL A;  1TS6 A;  2UWX A;  3NOT C;  4WZ4 A;  3SH7 A;  4ZJ1 A;  4BD1 A;  2HP6 A;  1DP8 A;  3DTM A;  2W3F A;  2B95 A;  3BM6 A;  1S0W A;  3G6O A;  3KSF A;  2XD1 A;  4S2K A;  1J3W A;  3VE3 A;  5LBR A;  1XP4 A;  4OH0 A;  1I2W A;  3W4O A;  3BLS A;  1K4F A;  1H8Z A;  3O87 A;  3SH9 A;  2WK0 A;  3CMZ A;  5IHV A;  4HBT A;  2V0W A;  3Q7Z A;  1MBL A;  2XFS A;  5HAP A;  2VEA A;  2B18 A;  1GHP A;  1OTI A;  3BEC A;  1KGE A;  3N8S A;  3D4F A;  4XT2 B;  1VEU A;  4GLQ A;  4QWO A;  3TE8 A;  4MN7 A;  4ZRR A;  2RL3 A;  3EEA A;  4QB8 A;  5KIZ A;  3ISG A;  2O9B A;  4HY8 A;  3UB8 A;  1OJG A;  3NHQ A;  2JC7 A;  1K6R A;  1CEG A;  1D06 A;  4YIN A;  4LLO B;  4O0P A;  4B4Z A;  1MWR A;  4HI4 A;  3IH9 A;  2XK1 A;  1VM1 A;  2GX5 A;  1ES2 A;  2I72 A;  3KSH A;  4OPR A;  1M6K A;  1M40 A;  4CLC A;  3W4P A;  2DMW A;  2VX8 A;  2GZA A;  2M7V A;  4X25 A;  5FL3 A;  2ZQ7 A;  1KOU A;  2K31 A;  1NWZ A;  2WGI A;  1FSW A;  3WRT A;  3EGD C;  4PPR A;  4D2O A;  5CGX A;  2JKG A;  4R3A A;  4EET B;  4X69 A;  4GHI A;  5F69 A;  4JGQ A;  3BFF A;  1I5Q A;  2HGV A;  2VZW A;  4DF6 A;  2XGN A;  1S4S A;  4KZ5 A;  4JF4 A;  4OPQ A;  3RXW A;  3PBQ A;  3E98 A;  3IXG A;  3LIA A;  4N9L A;  1BT5 A;  2LB5 A;  2J8Y A;  4OQI A;  4JPM A;  4GD8 A;  5GL9 A;  3DBA A;  3R7W B;  4S2N C;  1MWT A;  3T1S A;  4IBX A;  1W63 Q;  5TBM A;  4QD4 A;  1MWU A;  5M1A A;  3ZCZ A;  5FQM A;  3DTI A;  2Z2L B;  3HLW A;  3FKV A;  4BL3 A;  3Q82 A;  1VQQ A;  2L1M A;  2HDU A;  2KLI A;  4X53 A;  3LEQ A;  4L9F A;  1H8Y A;  4S2M A;  2WAD A;  3IQA A;  3IBR A;  2PD7 A;  3CPT B;  5E43 A;  3U4L P;  5EEC A;  4O7D A;  3MQO A;  3HUO A;  3E4O A;  5HD3 A;  3EWK A;  3OOV A;  4LEN A;  1VHM A;  1OTA A;  2EXB A;  4KG6 A;  3W2Z A;  1KVL A;  3SS3 A;  4E6X A;  5HZH A;  2EXA A;  4KZ8 A;  1W63 M;  1D1J A;  4MN5 A;  3N8R A;  4IUH A;  5HAQ A;  4FCF A;  4Y13 A;  4C3Q A;  5I94 A;  4HES A;  1RGY A;  3A3J A;  1CF0 A;  4EBP A;  3V50 A;  4NXF A;  3LIB A;  1ODV A;  1XGI A;  5A91 A;  1ERM A;  1XX2 A;  4ME4 A;  5GHZ A;  4RYE A;  4WYY A;  2WGW B;  3UO9 A;  3WS0 A;  2A3U A;  4XUX A;  1W5D A;  4F3L A;  5F1G A;  1CK3 A;  2MJ6 A;  5KMW A;  1N9O A;  1SKF A;  4UAA A;  1G6O A;  4P6Z S;  3QP6 A;  5EFW A;  4JBF A;  4Y7P A;  4KQD A;  4E3J A;  4KUO A;  3OZH A;  1PWC A;  2DNS A;  3P01 A;  3M6H A;  4F94 A;  4KZ4 A;  3KO6 A;  3UPO A;  5F82 A;  5DFX A;  5EVI C;  3S7N A;  4WMC A;  1JWP A;  4KG2 A;  3G34 A;  4E3N A;  5FAP A;  2V9A A;  3LGO A;  4DMZ A;  4I3A A;  4DXB A;  3GQZ A;  5IT5 A;  1MWS A;  4BLM A;  3W4Q A;  4M3K A;  4R3J A;  4IVI A;  1LSX A;  1P0Z A;  1T1B A;  3B33 A;  4YFM A;  3MS6 A;  1UWN X;  3SW1 A;  4P85 A;  5J4E A;  3A3F A;  3BRM A;  3GSG A;  1K54 A;  4E3K A;  5HL1 A;  1BUE A;  5FI6 A;  2GDN A;  5J8X A;  1ZTU A;  1XJ3 A;  4EUZ A;  1NYY A;  2W1R A;  3MFX A;  3PBR A;  4CLC D;  4L9E A;  5EM1 A;  3HUM A;  5HPI A;  2QPN A;  3UE1 A;  3HLG A;  4QJG A;  4R70 A;  2J3W A;  3IX8 A;  2PRF A;  2XH9 A;  1VET B;  3KSG A;  5CED A;  5G18 A;  5C5K A;  3CZD A;  4XT2 A;  1E25 A;  5U47 A;  1N9B A;  3NY4 A;  1X0O A;  4ESP A;  3EQV A;  3K2N A;  3B47 A;  5K5B A;  3UPN A;  3ZDJ A;  2ZLY A;  4C75 A;  2Y2P A;  4EER A;  4R6L A;  3M2J A;  3RFB A;  3IF6 B;  4EES A;  1FCO A;  3N6I A;  4YOF A;  3FC7 A;  3FV7 A;  4C6Y A;  3DTE A;  2EWV A;  2J7V A;  1ERO A;  3VOY A;  1OT9 A;  4BQM A;  5J3W A;  4EW7 A;  5DTT A;  2ZQC A;  1OPX A;  2ZOH A;  3VSK A;  1F5M A;  3UE3 A;  3IF6 A;  3O5Y A;  2R78 A;  3L9K A;  1XGJ A;  4PKY A;  4DRT A;  5EVI D;  4Q0J A;  3IBJ A;  4LV0 A;  2HP9 A;  5GLA A;  4Y17 A;  3G4P A;  5FAT A;  5EUA A;  5FQJ A;  2V1A A;  1EW0 A;  1MXO A;  2JKT M;  4ZBE A;  2YKF A;  2FFY A;  4ZJ3 A;  1LSV A;  2V1B A;  3IXD A;  3EEH A;  4Y0U A;  3G2Y A;  2WAF A;  4MBF A;  3QNB A;  2DRW A;  2BG1 A;  4ARZ A;  3SZT A;  1AWI A;  3WS2 A;  3M2K A;  1S1Z A;  2QHK A;  4BJP A;  1L0G A;  4PMA A;  2ZMV A;  5CHM A;  3EOI A;  4HHD A;  4BMW A;  4IBR A;  5CHJ A;  2IWB A;  3G2Z A;  3LR4 A;  4ZJ2 A;  4JXG A;  5FQ9 A;  4EQ1 A;  3OC2 A;  2ZL1 B;  4EUV A;  4HP9 A;  3FG8 A;  1T1A A;  1XA7 A;  5IS1 A;  1NZU A;  2XDM A;  2A2L A;  4I3J A;  3GRJ A;  4WM9 A;  4DXC A;  1IYP A;  4YWZ A;  5JYO A;  2INW A;  3ZFZ A;  4DE2 A;  2EFX A;  2ZC5 B;  4FH2 A;  1LI0 A;  3LI9 A;  4KQO A;  3AGD A;  2WZX A;  1OTB A;  4N1X A;  1CQA A;  4OVD A;  1FIL A;  4S2P A;  5DF8 A;  1ZHH B;  3LFV A;  3N4I A;  4IUK A;  4KZB A;  3S1Y A;  4S2J A;  1OME A;  4JXW A;  4PKY G;  2P74 A;  2HDS A;  3CUE A;  5E2E A;  1G6A A;  3UME A;  1SDN A;  1WA9 A;  3I7J A;  5F1F A;  1YPR A;  3VP4 A;  3T50 A;  4G3W A;  4M4X A;  4KZ3 A;  1YM1 A;  3H7W A;  3TG9 A;  4NK3 A;  1DP9 A;  1PWD A;  3GMW A;  1BLS A;  2A24 A;  4DKI A;  3UB6 A;  1PW8 A;  1O07 A;  2V20 A;  1ESI A;  4OOY A;  4L9G A;  3JPU A;  2P7J A;  1E4D A;  3HRE A;  4K08 A;  2CMN A;  2PDR A;  3W8K A;  2QYB A;  5HWT A;  5EM0 A;  3C7U A;  2V8C A;  4HNB A;  3LR0 A;  3MKE A;  2XRN A;  5TBM B;  2HDQ A;  2Y2G A;  3TOI A;  2Q9N A;  2Y2L A;  1NRJ A;  1Q2Q A;  4QY5 A;  4EEU A;  2PR5 A;  1HLU P;  2CC1 A;  1I2S A;  4X56 A;  2V1Z A;  2E8I A;  1YLY A;  4GS9 A;  5EPH A;  3K3C A;  1YMX A;  3G31 A;  1GHI A;  1S66 L;  2ZQ8 A;  3LO7 A;  4CLC C;  2W1T A;  2G7U A;  4FOF A;  3GR2 A;  3WRZ A;  3MR0 A;  4I39 A;  4LV3 A;  4I5S A;  1U60 A;  4RA7 A;  3PAE A;  4OPY A;  1YLZ A;  1SZV A;  4OQG A;  4S2I A;  1YLW A;  4GS9 B;  2W3G A;  1DY6 A;  3ZNY A;  4OOM A;  2Z2M B;  1LL8 A;  2Q0O A;  2P9V B;  3S7Q A;  4ETX A;  3MZF A;  2M7U A;  4JXS A;  4DE3 A;  1LT0 A;  4KUK A;  2HF6 A;  3DWK A;  5DKK A;  4PM6 A;  1MPL A;  2X71 A;  5DFY A;  2QMI A;  4DE1 A;  5EVL A;  4HJ6 A;  4OKP A;  4GN2 A;  2P08 A;  3NCK A;  3D72 A;  1ZC2 A;  4KQR A;  4HP4 A;  1BUL A;  4DJ3 A;  1TEM A;  1IYQ A;  4LPZ A;  4E3O A;  2VLG A;  5HWW A;  1TF1 A;  5DJT A;  4NET A;  4ARZ B;  4O8G A;  5A93 A;  2QWS A;  1K57 A;  4QHC A;  3FZC A;  1V9Y A;  3VFF A;  1BSG A;  2XA7 S;  3A3I A;  4HBU A;  3VOL A;  5TFQ A;  4FSF A;  4FTX A;  5GHY A;  1NYM A;  1NXY A;  3E4P A;  3K3D A;  1G28 A;  1T19 A;  2ZJ9 A;  3T4K A;  1L0D A;  2K2N A;  4EQI A;  3HLC A;  3ZVW A;  3C30 A;  1FQG A;  5MC7 A;  2JKT I;  1XFQ A;  4S2O A;  4LFU A;  5G4Z A;  2OAQ 1;  5I5L A;  2UV0 E;  3GDI A;  4UEY A;  5L2F A;  3ZHH A;  1JTD A;  3CHW P;  4I38 A;  2X01 A;  2PU4 A;  2PD8 A;  1EI5 A;  1DJB A;  1XJ4 A;  1YAX A;  3PXP A;  4R4R A;  4LCM A;  1K55 C;  3U2A A;  3LIC A;  2VK3 A;  2Y2Q A;  4X55 A;  2XSS A;  2WKP A;  3GVB A;  2ZC4 B;  1F98 A;  1WE4 A;  2WAE A;  4LV1 A;  3VP1 A;  1XXM A;  3MZE A;  2BLS A;  2J9O A;  3C2W A;  3IH8 A;  1L0E A;  4EU0 A;  4U0T A;  4MEZ A;  4EV4 A;  2KX6 A;  2Y79 A;  2YKH A;  4B93 A;  3UDF A;  2WUQ A;  3V67 A;  3OCN A;  4JXV A;  1YLT A;  2XD5 A;  5HDS A;  3ZNT A;  4BBT A;  1FSY A;  3O88 A;  3LI8 A;  2P04 A;  4DJ2 A;  2XFT A;  1Q2P A;  1E3U A;  4K0W A;  2WZZ A;  3L7H A;  4GDB A;  5TJJ A;  2L0W A;  2W27 A;  4GKU A;  4HJ3 A;  1Y54 A;  1N4O A;  2O9A A;  1S67 L;  5IU1 A;  3CLO A;  4LCL A;  5CTM A;  5EVI B;  4BWI A;  1RGZ A;  3VOZ A;  3Q7V B;  1K56 D;  1F2K A;  2Y2M A;  3VFH A;  3LY3 A;  3ITB A;  1G5U A;  3CJM A;  3R7W A;  3TSG A;  2Y2I A;  1UGU A;  3F1O A;  5AQ7 A;  5HW3 A;  3QP1 A;  1ONG A;  1SKO B;  3WS5 A;  2QJ7 A;  2AVX A;  1IEM A;  2Y8H A;  2Y2H A;  3JVU A;  3NOU C;  3JYI A;  3KYE A;  2VV8 A;  4OOL A;  2BTF P;  3IXB A;  4QU3 A;  1BZA A;  1PRQ A;  1L0F A;  2IA2 A;  2Y2N A;  4Z9Q A;  1XJ6 A;  3QNC A;  3OPL A;  3V5M A;  4JGR A;  1NRF A;  1CI9 A;  3V39 A;  1W8Y A;  2G2U A;  1K0K A;  4X6T A;  2L4R A;  5FSR A;  3LR5 A;  3IF6 C;  1ES4 A;  5GLD A;  1J9M A;  2WKR A;  3NUL A;  5KSC A;  2NUT C;  5CER A;  4EWF A;  4FH4 A;  4HEF A;  2Z6D A;  2XA7 M;  3PBS A;  4DDS A;  4EBN A;  5FI7 A;  1UWP X;  5HWV A;  1MY8 A;  1IFQ A;  2HPB A;  1CJF A;  2XR0 A;  3UNW A;  5CEC A;  4EXO A;  2H28 A;  3RH8 B;  4BBU A;  4Y0T A;  4Y5F A;  3M6B A;  3UN7 A;  4S2N A;  3UE0 A;  3QP5 A;  3KYZ A;  2J3T C;  4Q0H A;  4GDN A;  4WZ5 C;  4JLF A;  1FR1 A;  4H6J A;  5FDS A;  4LRY C;  4CQH A;  1HVB A;  4N9K A;  4JGP A;  4P6B A;  4WEJ A;  4JF6 A;  3ZQ5 A;  2Y59 A;  5CTN A;  1D7E A;  2OWH A;  1P9W A;  3BFE A;  4P6Z M;  2OAP 1;  4WL9 A;  4MDZ A;  4E04 A;  2E8J A;  3IT9 A;  2ZM0 A;  3VV4 A;  5AVF A;  5GHX A;  4Y0O A;  5HPF A;  2QJ5 A;  3G30 A;  4MCW A;  3ZG8 B;  5AJG A;  5HSQ A;  1H0M A;  2WKQ A;  3PBO A;  1PZO A;  1LSW A;  2G2W A;  4Z1W A;  3E2L A;  2EWW A;  1OT6 A;  4CLC E;  2EX2 A;  3BYD A;  1JWV A;  1HTZ A;  2HP5 A;  1RP5 A;  3RJU A;  4KEN B;  4OP5 A;  3IWQ A;  4WBG A;  1K38 A;  5FDH A;  2M1C A;  3ICY A;  3GTC A;  3ITA A;  3TJZ C;  3D3O A;  5DKL A;  4DDY A;  4QPR A;  2ZM2 A;  3F1P B;  5JYP A;  3NEC A;  4X68 A;  1VEU B;  3IHB A;  5EVI A;  2HJ9 C;  3T4S A;  1A0K A;  5HL6 A;  4O01 A;  4OLD A;  3MJQ A;  5FEG A;  1DP6 A;  3HUN A;  3LID A;  1IEL A;  2R9W A;  2JCH A;  3PHY A;  4U0X A;  1PIO A;  2JHE A;  2EX8 A;  2PHY A;  2Y2J A;  2O99 A;  3O86 A;  4X1M A;  3IWO A;  4EEP A;  1TS0 A;  3MF0 A;  1IOU A;  3IS2 B;  5FI2 A;  1K54 C;  1PI5 A;  2Y2O A;  3IX4 A;  2QZ6 A;  1K25 A;  2VV6 A;  2HV1 A;  3PAG A;  5A92 A;  3PTE A;  2XLN A;  3UPP A;  1ES5 A;  5FAQ A;  5TR7 A;  3LCE A;  4IJG A;  1N9N A;  3C5A A;  3LYX A;  5HFO A;  3Q81 A;  5HAI A;  1Y4O A;  5L07 A;  3WS4 A;  1E3U D;  5CGW A;  1TVF A;  3B3X A;  5BOH A;  3NI9 A;  5A8B A;  1GSW A;  2Y55 A;  3QP4 A;  3OCL A;  4G3K A;  2FZ0 A;  5CEB A;  1JVJ A;  1P97 A;  3T4L A;  3A0S A;  1FOF A;  3UY6 A;  1SDE A;  1KE3 A;  3GV9 A;  4PAU A;  4B9O A;  1YT4 A;  3C38 A;  1PW1 A;  3LR3 A;  4JKT A;  4HQA A;  5E2G A;  2WGW A;  2IWD A;  4HH2 A;  2Q9M A;  4L0L A;  4KZA A;  5GLC A;  2PT7 A;  1K6S A;  2W3E A;  4KZ7 A;  2V2F F;  3C7V A;  3HJI A;  4YNR A;  1BTL A;  3ZG7 B;  1IKG A;  4RX3 A;  3ZG0 A;  2X02 A;  4R3B A;  1H5X A;  4WEK A;  3MQQ A;  4IHQ A;  4B4X A;  3C4O A;  5E2H A;  3DAV A;  4II7 A;  5KSH A;  3F1N B;  2H10 A;  3IHA A;  1SKO A;  4BEN A;  3PBT A;  1LL9 A;  2ZQA A;  3NC8 A;  1PNE A;  3T12 B;  3LIE A;  3TRC A;  1Y28 A;  3BEB A;  4U3T A;  1XKZ A;  5FAS A;  2KDK A;  1YMS A;  3KYQ A;  5CRF A;  1VET A;  1K57 C;  1XJ2 A;  2A24 B;  5E2F A;  3T4O A;  1GA0 A;  3BFG A;  3H9W A;  1GSX A;  4D60 A;  1S1Y A;  2DCF A;  2HDR A;  3SS4 A;  3TW8 A;  1MC0 A;  2J9P A;  2VA0 A;  3BFC A;  3IWI A;  5D3O A;  1IYO A;  4GCZ A;  4S2L A;  3AGE A;  3PYP A;  3R4K A;  4LGW A;  2K7S A;  3E4Q A;  1BYW A;  4UA7 A;  3T1Q B;  5F5Y A;  2NUP C;  1KE4 A;  1AXB A;  2WGV A;  1IKI A;  1KGF A;  2JKR M;  1ZG4 A;  4IVK A;  3VE4 A;  1TD5 A;  5AQB A;  4P87 A;  3BJN A;  4GNU A;  4QY6 A;  3FPW A;  3MFD A;  4R1G A;  4XUZ A;  4PM8 A;  4KZ6 A;  1WYB A;  1ESU A;  1K55 A;  1NZO A;  1KE0 A;  1MKI A;  3T1X A;  3HCY A;  4ZTK A;  4RX2 A;  4WLA A;  2ZMA A;  4UHU A;  1JWZ A;  2PYR A;  3IS2 A;  3A0V A;  4WEL A;  2JN7 A;  2PU2 A;  2WKH A;  5EE8 A;  3T4J A;  5GLB A;  4OPZ A;  1PYY A;  3HVF A;  4HJ4 A;  2ZM8 A;  3IXH A;  4N1H A;  3VP2 A;  3A0R A;  1ALQ A;  4E3I A;  3P7N A;  2OLU A;  1NY0 A;  4MN6 A;  5EOO A;  1W7F A;  4JF5 A;  4IED A;  3S4X A;  4R23 A;  1ERQ A;  3DTK A;  1IYS A;  4R0Q A;  4AFI A;  5EV0 A;  5DTS A;  1P9R A;  1N9L A;  4MLL A;  3MBZ A;  3LUQ A;  2XF3 A;  4KZ9 A;  3MQ0 A;  4H8R A;  3V3S A;  1L2S A;  1LHY A;  2A49 A;  4NG2 A;  3BFD A;  1YQS A;  5AQA A;  5J7E A;  2O9C A;  3SS5 A;  4WUJ A;  4CPK A;  4GZB A;  4ETZ A;  3HJK A;  1JNU A;  2PR6 A;  4KG5 A;  2P9V A;  4F3L B;  3MXS A;  3CAX A;  1YKD A;  3BY8 A;  1PI4 A;  2C6W B;  5EOE A;  4H6J B;  1O7E A;  5M19 A;  1T1C A;  2EX6 A;  2IWC A;  1FCM A;  1RCJ A;  2OV5 A;  3P98 A;  3BW6 A;  4GW9 A;  4HIA A;  1Z6F A;  1GCE A;  1CI8 A;  3H82 A;  3LIF A;  4Y3I A;  4CJN A;  3Q1F A;  3Q07 A;  4WN5 A;  4NEE D;  2WKI A;  4GJ4 A;  1F9I A;  3NDG A;  4UQI S;  3NBL A;  1HD8 A;  2ZC3 B;  2ZD8 A;  4BD0 A;  4OLG A;  1NLZ A;  2W3H A;  4NXG A;  2ZOI A;  3CPT A;  3BWL A;  3BY9 A;  4PHT A;  1KDS A;  4GHI B;  3WS1 A;  4K91 A;  3QP2 A;  1YSQ A;  2VGL M;  2LB9 A;  2W0N A;  2VGK A;  4MBK A;  3H7W B;  4OP8 A;  2H0Y A;  3OPR A;  5L09 A;  4MMN A;  2V8F A;  5FA7 A;  1ONH A;  3WWX A;  2Z6C A;  4CLC B;  3UE6 A;  2VGJ A;  4UA6 A;  4MBH A;  3SH8 A;  3MXQ A;  1LL5 A;  3VP3 A;  1DJC A;  1K56 A;  5DTK A;  1BLP A;  3QHY A;  2ZBB A;  3E0Y A;  3QP8 A;  2Y2K A;  4WZ5 A;  3MKF A;  1SHV A;  4BBV A;  4EBL A;  3NIA A;  3T1R A;  4PM7 A;  5FQI A;  3PBN A;  3CI6 A;  1ACF A;  3OPH A;  1SCW A;  2PAV P;  4BL2 A;  1MKM A;  4Y2F A;  3DW0 A;  4R4S A;  2VJW A;  1C3B A;  3LEZ A;  3NJA A;  1TDG A;  1DJA A;  4GD6 A;  4OQH A;  2ZMF A;  5FQK A;  3IX3 A;  1BLH A;  1VB6 A;  1PZP A;  3GEC A;  3OPP A;  2W1T B;  2PBY A;  3HL9 A;  3N8L A;  2EX9 A;  3HLE A;  5EVE A;  3F1N A;  3FWL A;  1S4R A;  2Y4A A;  1EWZ A;  5CX7 A;  1JTG A;  2GNX A;  1YSP A;  5HAR A;  5HDC A;  4PM9 A;  3VP0 A;  2W3D A;  3PR6 A;  1KVM A;  1OJ5 A;  1QMF A;  2PBD P;  3A3D A;  4WF0 A;  5FEF A;  1ZKJ A;  1K4E A;  4DN0 A;  1HZO A;  3E2K A;  3OLO A;  4DE0 A;  2O0Y A;  3MMH A;  2JKR I;  3LY4 A;  3UB7 A;  3OBF A;  2ZQ9 A;  3NOP C;  2I9V A;  2JBF A;  4WMC D;  2VV7 A;  3FYZ A;  1W8Q A;  5F83 A;  3MSH A;  3VSL A;  1S6R A;  3SOI A;  2VKS A;  3CUE C;  3S22 A;  4X1L A;  1BLC A;  1GHM A;  2QKP A;  1V9Z A;  4HOI A;  1QME A;  4HH3 A;  1NLY A;  3S7P A;  3S7O A;  2ZC7 A;  5TGF A;  4Q8I A;  5G4Y A;  4B88 A;  1YLJ A;  3HLD A;  4E6W A;  4GB7 A;  5M18 A;  4RQ9 A;  1XPB A;  1ES3 A;  1FCN A;  1OTD A;  4LRX C;  3CWF A;  3B42 A;  5DJU A;  5L8M A;  3O3V A;  4GOG A;  3G32 A;  2HJE A;  2FFF B;  3EGX C; 
#chains in the Genus database with same CATH homology
 3FZC A;  5CXW A;  3ZG7 B;  4E3J A;  4LV2 A;  3OZH A;  1PWC A;  3HBR A;  2DNS A;  2B5R A;  1IKG A;  3M6H A;  4RX3 A;  3ZG0 A;  4F94 A;  2X02 A;  1NJ4 A;  4KZ4 A;  4R3B A;  5F82 A;  3CG5 A;  1BSG A;  5FAO A;  3VFF A;  3UPO A;  3A3I A;  5EVI C;  4WMC A;  4HBU A;  5HX9 A;  1JWP A;  1LLB A;  1H5X A;  4WEK A;  5TFQ A;  4FSF A;  5GHY A;  4KG2 A;  4B4X A;  3G34 A;  4E3N A;  5A90 A;  3C4O A;  5FAP A;  1NYM A;  1NXY A;  2H0T A;  4DXB A;  2XEP A;  3GQZ A;  5E2H A;  5KSH A;  2H10 A;  1MWS A;  3IHA A;  4BLM A;  2WYX A;  4BEN A;  3W4Q A;  1G68 A;  4M3K A;  3PBT A;  1LL9 A;  2ZJ9 A;  2ZQA A;  3NC8 A;  1L0D A;  4R3J A;  4IVI A;  3HLC A;  4N92 A;  4EQI A;  3ZVW A;  1FQG A;  3BEB A;  4U3T A;  1XKZ A;  3A3E A;  5FAS A;  2XQZ A;  1YMS A;  4YFM A;  4P85 A;  5CRF A;  3V3R A;  3A3F A;  3BRM A;  3GSG A;  3P09 A;  4S2O A;  4E3M A;  5L2F A;  1K54 A;  3ZHH A;  4E3K A;  4ZAM A;  5HL1 A;  1JTD A;  3FKW A;  1K57 C;  2ZQD A;  1BUE A;  5E2F A;  2X01 A;  2PU4 A;  1GA0 A;  3BFG A;  1W79 A;  5FI6 A;  2GDN A;  2DCF A;  2HDR A;  1EI5 A;  5J8X A;  1DJB A;  3SS4 A;  1FR6 A;  2ZC6 B;  4R4R A;  2J9P A;  4LCM A;  4EUZ A;  1K55 C;  1NYY A;  3BFC A;  3IWI A;  5CHU A;  1IYO A;  5D3O A;  2Y2Q A;  4S2L A;  3PBR A;  4X55 A;  4PM5 A;  3DWZ A;  3HUM A;  1GA9 A;  3AGE A;  3GVB A;  1LI9 A;  2ZC4 B;  2R9X A;  1WE4 A;  2WAE A;  2QPN A;  4LV1 A;  3UE1 A;  3VP1 A;  1XXM A;  3HLG A;  3MZE A;  4QJG A;  4UA7 A;  2BLS A;  2J9O A;  2XH9 A;  4K0X A;  3IH8 A;  5DF9 A;  3ZVT A;  1L0E A;  5CED A;  4U0T A;  5G18 A;  3UDX A;  1KE4 A;  3CZD A;  3N7W A;  3ZG9 B;  1E25 A;  4MEZ A;  1AXB A;  2WGV A;  3ZG5 A;  5U47 A;  3EQU A;  1IKI A;  1N9B A;  3NY4 A;  1KGF A;  4EV4 A;  1ZG4 A;  4IVK A;  3IF5 A;  5AQB A;  4P87 A;  3UDF A;  2WUQ A;  3MXR A;  3EQV A;  4GNU A;  4P0M A;  4QY6 A;  3OCN A;  4ID4 A;  4JXV A;  1YLT A;  2XD5 A;  3MZD A;  3ZNT A;  3MFD A;  4R1G A;  3UPN A;  1FSY A;  3O88 A;  3NDE A;  4XUZ A;  4PM8 A;  5FQQ A;  3ZDJ A;  1WYC A;  4KZ6 A;  3UDI A;  2XFT A;  3ZGA B;  2ZLY A;  4RVA A;  4C75 A;  2Y2P A;  1WYB A;  1ESU A;  1K55 A;  1NZO A;  1Q2P A;  3C4P A;  1KE0 A;  1E3U A;  3M2J A;  3IF6 B;  4K0W A;  3HLF A;  2WZZ A;  3AGF A;  4E3L A;  1MKI A;  4GDB A;  1FCO A;  3N6I A;  4GKU A;  4ZTK A;  4RX2 A;  2ZMA A;  4UHU A;  1PWG A;  1JWZ A;  1Y54 A;  1N4O A;  3FV7 A;  4C6Y A;  4UA9 A;  4WEL A;  2PU2 A;  2WKH A;  4KQQ A;  5EE8 A;  1YLP A;  2J7V A;  4LCL A;  5CTM A;  5EVI B;  4ZDX A;  1ERO A;  3VOY A;  5GLB A;  1RGZ A;  4BQM A;  5DTT A;  2C5W B;  4OPZ A;  2ZQC A;  3VOZ A;  4XXR A;  1PYY A;  3Q7V B;  3VSK A;  3HVF A;  5DF7 A;  2ZM8 A;  1K56 D;  3IXH A;  4A5R A;  1ZG6 A;  4N1H A;  3VP2 A;  1KDW A;  2Y2M A;  1ALQ A;  3VFH A;  4E3I A;  3UE3 A;  2OLU A;  1NY0 A;  2RCX A;  3IF6 A;  3LY3 A;  3ITB A;  3CJM A;  5EOO A;  1W7F A;  3TSG A;  2Y2I A;  4MNR A;  3G35 A;  5AQ7 A;  1XGJ A;  1KGG A;  4FD8 A;  5HW3 A;  4JF5 A;  4IED A;  3S4X A;  1ONG A;  4R23 A;  4DRT A;  3WS5 A;  3BLM A;  1ERQ A;  1IYS A;  4R0Q A;  2JE5 A;  2WKE A;  1IEM A;  5EVI D;  5DTS A;  4LV0 A;  3RXX A;  2OSU A;  2Y2H A;  3Q7V A;  2HP9 A;  5GLA A;  4MLL A;  3HLB A;  3G4P A;  3MBZ A;  3JYI A;  2XF3 A;  5FAT A;  1XA1 A;  4KZ9 A;  4OOL A;  4H8R A;  4OON A;  3V3S A;  1TDL A;  5EUA A;  1L2S A;  5FQJ A;  1LHY A;  2Y91 A;  3IXB A;  2A49 A;  1MXO A;  3BFD A;  1YQS A;  1BZA A;  4QU3 A;  5KZH A;  1L0F A;  5AQA A;  4ZBE A;  3SS5 A;  5DVA A;  2Y2N A;  4CPK A;  4Z9Q A;  2FFY A;  3QNC A;  4ZJ3 A;  4GZB A;  4KG5 A;  3OPL A;  3V5M A;  3IXD A;  5CGS A;  1NRF A;  5AQ9 A;  1CI9 A;  2P9V A;  4Y0U A;  3V39 A;  3G2Y A;  2WAF A;  3MXS A;  1W8Y A;  2G2U A;  4MBF A;  4X6T A;  5FSR A;  3QNB A;  2DRW A;  1CEF A;  2BG1 A;  1PI4 A;  2C6W B;  2EFU A;  3IF6 C;  1ES4 A;  5GLD A;  5EOE A;  3WS2 A;  1J9M A;  4OQ0 A;  3M2K A;  1O7E A;  5M19 A;  4BJP A;  2OLV A;  1L0G A;  4PMA A;  5KSC A;  2EX6 A;  2H5S A;  3VMA A;  5CER A;  4EWF A;  4FH4 A;  2IWC A;  4HEF A;  5CHM A;  2UWX A;  3SH7 A;  1FCM A;  4WZ4 A;  1RCJ A;  4ZJ1 A;  2OV5 A;  3P98 A;  3PBS A;  4DDS A;  4EBN A;  4IBR A;  5FI7 A;  1Z6F A;  1MY8 A;  4BD1 A;  5CHJ A;  2HP6 A;  1GCE A;  3G2Z A;  2HPB A;  2IWB A;  3DTM A;  4ZJ2 A;  4JXG A;  5FQ9 A;  2XR0 A;  3UNW A;  3OC2 A;  5CEC A;  3BM6 A;  1CI8 A;  1S0W A;  1XA7 A;  1NZU A;  2XDM A;  2XD1 A;  4S2K A;  3GRJ A;  4CJN A;  4Y0T A;  3Q1F A;  4WM9 A;  4DXC A;  3M6B A;  3UN7 A;  3Q07 A;  1IYP A;  4S2N A;  2WKI A;  5JYO A;  3UE0 A;  3NDG A;  3ZFZ A;  4DE2 A;  3NBL A;  2ZC3 B;  1HD8 A;  2EFX A;  2ZC5 B;  4FH2 A;  4GDN A;  2ZD8 A;  1LI0 A;  1XP4 A;  4WZ5 C;  4JLF A;  4OH0 A;  1I2W A;  3W4O A;  1FR1 A;  4KQO A;  4BD0 A;  3BLS A;  4OLG A;  1K4F A;  3AGD A;  1H8Z A;  3O87 A;  2WZX A;  3SH9 A;  2WK0 A;  3CMZ A;  5IHV A;  4HBT A;  1HVB A;  3Q7Z A;  4N1X A;  4N9K A;  1MBL A;  4OVD A;  2XFS A;  4S2P A;  5DF8 A;  5HAP A;  1KDS A;  4P6B A;  4WEJ A;  1GHP A;  4JF6 A;  3WS1 A;  4K91 A;  3BEC A;  1KGE A;  3N8S A;  3D4F A;  3N4I A;  4KZB A;  2VGK A;  4MBK A;  2Y59 A;  3S1Y A;  4OP8 A;  4S2J A;  2H0Y A;  5CTN A;  1OME A;  4JXW A;  2P74 A;  3BFE A;  3OPR A;  5FA7 A;  1ONH A;  2HDS A;  3WWX A;  5E2E A;  1G6A A;  2RL3 A;  4QB8 A;  1SDN A;  2VGJ A;  4UA6 A;  3I7J A;  4MBH A;  3ISG A;  5F1F A;  2JC7 A;  3SH8 A;  1K6R A;  3IT9 A;  1CEG A;  4YIN A;  2ZM0 A;  5GHX A;  1LL5 A;  3VP4 A;  4B4Z A;  1MWR A;  4Y0O A;  1DJC A;  1K56 A;  3IH9 A;  5DTK A;  3VP3 A;  2XK1 A;  1BLP A;  1VM1 A;  3QHY A;  4KZ3 A;  1ES2 A;  1YM1 A;  2Y2K A;  3G30 A;  4WZ5 A;  3TG9 A;  2I72 A;  4NK3 A;  3ZG8 B;  3MKF A;  1SHV A;  4OPR A;  1M6K A;  1PWD A;  3GMW A;  4EBL A;  1BLS A;  1M40 A;  4DKI A;  3NIA A;  3PBO A;  1PZO A;  2G2W A;  3E2L A;  1PW8 A;  1O07 A;  3W4P A;  4PM7 A;  5FQI A;  3PBN A;  2EX2 A;  2V20 A;  3BYD A;  1SCW A;  3OPH A;  1JWV A;  1HTZ A;  1ESI A;  2HP5 A;  4BL2 A;  2ZQ7 A;  4OOY A;  3DW0 A;  1E4D A;  3HRE A;  1RP5 A;  4R4S A;  3RJU A;  4KEN B;  2WGI A;  1FSW A;  4OP5 A;  1C3B A;  3IWQ A;  4WBG A;  1K38 A;  3WRT A;  4PPR A;  3W8K A;  3LEZ A;  5FDH A;  1TDG A;  3GTC A;  4D2O A;  1DJA A;  4GD6 A;  4OQH A;  3ITA A;  3C7U A;  5CGX A;  5FQK A;  1BLH A;  4X69 A;  1PZP A;  3MKE A;  3OPP A;  4DDY A;  2PBY A;  2ZM2 A;  3HL9 A;  3BFF A;  1I5Q A;  2EX9 A;  3N8L A;  5JYP A;  2HDQ A;  2Y2G A;  3TOI A;  2Q9N A;  2Y2L A;  3HLE A;  4DF6 A;  2XGN A;  4X68 A;  1Q2Q A;  3IHB A;  5EVI A;  3FWL A;  4QY5 A;  2Y4A A;  4KZ5 A;  4JF4 A;  4OPQ A;  3RXW A;  1EWZ A;  4OLD A;  3PBQ A;  2CC1 A;  1I2S A;  1JTG A;  3IXG A;  4X56 A;  2V1Z A;  4N9L A;  2E8I A;  3HUN A;  5HAR A;  1BT5 A;  1YLY A;  5EPH A;  2J8Y A;  4OQI A;  4PM9 A;  4JPM A;  4GD8 A;  5GL9 A;  3VP0 A;  1IEL A;  2R9W A;  1YMX A;  3G31 A;  1GHI A;  3LO7 A;  2ZQ8 A;  1KVM A;  2JCH A;  4S2N C;  1MWT A;  4IBX A;  1QMF A;  4U0X A;  1PIO A;  3A3D A;  3GR2 A;  4QD4 A;  3WRZ A;  1ZKJ A;  2EX8 A;  1MWU A;  5M1A A;  1K4E A;  4LV3 A;  3ZCZ A;  5FQM A;  1U60 A;  2Y2J A;  4RA7 A;  3PAE A;  1HZO A;  3E2K A;  3O86 A;  2Z2L B;  3HLW A;  3IWO A;  4DE0 A;  3FKV A;  4OPY A;  4BL3 A;  1YLZ A;  3Q82 A;  1VQQ A;  2HDU A;  3LY4 A;  5FI2 A;  4OQG A;  4X53 A;  1K54 C;  1YLW A;  1PI5 A;  2Y2O A;  2ZQ9 A;  4S2I A;  2JBF A;  1H8Y A;  4S2M A;  2QZ6 A;  2WAD A;  3IQA A;  1K25 A;  4WMC D;  1DY6 A;  3FYZ A;  5E43 A;  1W8Q A;  5EEC A;  3PAG A;  5A92 A;  4O7D A;  5F83 A;  3ZNY A;  3PTE A;  4OOM A;  2XLN A;  3UPP A;  3HUO A;  3VSL A;  1ES5 A;  2Z2M B;  4LEN A;  1S6R A;  3SOI A;  2EXB A;  3LCE A;  5FAQ A;  5TR7 A;  3S22 A;  2P9V B;  3C5A A;  1BLC A;  1GHM A;  4KG6 A;  1KVL A;  3SS3 A;  4E6X A;  3MZF A;  5HFO A;  3Q81 A;  2EXA A;  4KZ8 A;  5HAI A;  1QME A;  3WS4 A;  4JXS A;  3N8R A;  4DE3 A;  1E3U D;  5CGW A;  1TVF A;  5HAQ A;  3B3X A;  3DWK A;  4FCF A;  5BOH A;  3NI9 A;  4PM6 A;  4C3Q A;  1MPL A;  5I94 A;  2Y55 A;  2X71 A;  4HES A;  1RGY A;  2ZC7 A;  3OCL A;  5TGF A;  5CEB A;  1JVJ A;  2QMI A;  3A3J A;  5EVL A;  4DE1 A;  4Q8I A;  4OKP A;  4EBP A;  1FOF A;  4GN2 A;  3UY6 A;  3V50 A;  1SDE A;  4B88 A;  1KE3 A;  3GV9 A;  3NCK A;  1YLJ A;  1XGI A;  5A91 A;  1YT4 A;  3HLD A;  4E6W A;  1PW1 A;  1ZC2 A;  4JKT A;  1ERM A;  4GB7 A;  1XX2 A;  4KQR A;  1BUL A;  5E2G A;  5GHZ A;  5M18 A;  4RYE A;  4WYY A;  2WGW B;  1XPB A;  3UO9 A;  1ES3 A;  1FCN A;  3WS0 A;  2A3U A;  2WGW A;  1TEM A;  4XUX A;  1IYQ A;  2IWD A;  4L0L A;  2Q9M A;  4E3O A;  1W5D A;  4KZA A;  5F1G A;  1CK3 A;  5GLC A;  5KMW A;  1SKF A;  4UAA A;  1K6S A;  4KZ7 A;  2V2F F;  3C7V A;  3O3V A;  4GOG A;  4NET A;  3G32 A;  5A93 A;  1BTL A;  2FFF B;  1K57 A;  4JBF A;  4Y7P A;  4QHC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...