3IFLH

X-ray structure of amyloid beta peptide:antibody (abeta1-7:12a11) complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
214
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMSVGWIRQPSGLEWLAHIWWDDDKYYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARRTTTADYFAYWGQGTTLTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 12A11 FAB antibody light chain
publication title Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 214
sequence length 220
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iflH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iflH01
3SGJC 3S96B 4F2MB 1LP9E 3QUXD 5GGTH 2R1XB 4NNXB 4FQ2L 3EHBC 3F7YB 4AK1A 5B39G 4NNPL 1K2DA 5E9DB 2OI9C 4JZNA 4YR6A 1UM6L 2WBKA 1KCUH 4PJBB 5E56A 2R8SH 1IC1A 4PRHD 5SWZD 4MB5A 3VXSA 3FT2A 2F8OA 1MCLA 1ONQA 3H2WA 5FYKD 4P2OA 3LEVH 3NN8B 5IB2B 4KDVA 3KPLA 4Y2DB 5GRUL 3ZKND 4NSKA 2ARWA 2WIMA 4UDUB 1A6WH 2MPAL 4PJ5D 1QHPA 4LNRA 2D3VA 2P43B 5FF6B 3TPKA 2NPLX 5HHNA 1LO3L 3KYMA 5DC0A 4DN4H 3AAZB 2CDEB 3EYUL 3EDKA 4JKLA 3BN3B 3FO2A 1PQZA 4XVJL 3SY0A 5JW5A 3RQ3A 2XTJD 1QYGH 3LN4A 1CU4H 4XMLH 4U6XA 2A0LD 4Q9QH 2DDQH 4OD3H 4OZHA 4W6WB 3ZTNH 5LGJA 5T3ZE 3X3GH 3TBYB 3VXME 3FT4A 4K7FB 3CDGA 3MRIA 3VXQB 1T0MB 3B9EA 3SHSA 2J6EL 3OB0K 1A02N 4MDIB 1PEZA 1CDUA 3IKCA 7FABL 4BYHA 1IM9D 4HPYL 2VLJA 5LBSH 5BS0A 2C1PB 4XC3H 3KJ6H 3GJFK 5F7FA 5CZXC 4E5XB 1T03L 3TN0B 5IMOB 1NGWB 3CC5A 1KJ2A 3K7UA 4CNIA 1JUFA 2Y7QA 1W72H 5DF0A 4ODUB 3S35H 1RUAH 4WY7H 1H0DB 2OSLA 3OX8B 5MERB 2AEPL 5JHLH 2EKJA 4RQQA 1T7YA 5F9WC 2VKXA 4FQ1L 2MQ0A 4F2MA 1K4CB 4Y4KD 3VXRB 1MJUL 4Q6YA 1HWHB 5KOVC 4E42B 1CGVA 4BUHA 3TO4B 3U9UB 1BD2E 1NAMB 4WO4D 5ENWB 2B20A 2P5WA 3BP4A 2H32A 1KXTB 4JG1H 3NVQA 4J2XA 3FHQA 3OV6A 1C08A 4J8RA 1IC4H 2QQQA 5F1OB 3ZT6A 3QI9C 4LCYA 3H9SE 3KPOB 4XWOD 3SO3B 2UWEB 3KPNB 4F9PA 3FB6B 1BM3H 1XIWC 3OR6B 3PWLB 4D3CH 5FYKH 2CDEA 3MRMB 2C4XA 3WO3B 4HH9B 5EZOH 4DGIH 3TT1L 3V8CA 3JV5A 1J0YA 3TH2T 4KMQA 4PBWD 3BPNB 4LVNC 3IU3B 4K7FA 2VXUH 4F80A 3VXQA 1KCKA 3LKQA 1GCFA 4WHYH 1A7QL 4MDIA 4OFKA 4LCCC 3TH3T 3C08L 3R06B 3TYGL 3IB4A 1B9ZA 3O4OC 4NWUL 2C1PA 1KB5A 5DVOA 1KJMB 1HQ4A 2A83B 5IEKB 5DZOA 3VXUA 5CFHA 4OFDA 5D71H 1H0DA 3OX8A 5MERA 2FX8H 2FNBA 3GJFB 5CINL 1HH9B 3VGDA 3KXFB 1K4CA 1MCEA 3BUTA 5HHOD 2Z91A 1T1YB 3D39A 1MFBH 4U1GB 3CX5K 4GRWB 4NN6C 43C9A 4LAJH 4E42A 5F7EH 3PWUB 4FQCL 2IPTL 4PG9B 2JJTC 3U4AA 3GDBA 3GO1L 3OZ9L 5DYOA 5DJYB 2CLZB 4LLWB 3UTTA 3IDXH 1H3PL 5SWSE 3T2QA 1Y0LB 2E7MA 4BZ2H 4QOKB 1OT2A 4JZOA 2A77H 5DLMH 1ZA3A 3GKWH 3H42L 3MLUL 2FJGB 4TSAL 5CGMA 2X05A 5IFAL 1BAFL 5E70A 1NFDB 2AK4B 1W0YT 2V17L 5HI3C 5C6TH 2ESVA 4ZUWB 4R2GC 2AKRA 3DMMC 3KPNA 1S9KC 3D48R 4H8WC 5D2LF 5FYLD 3JV6B 3ME0A 4KJPD 4MJ2A 5B3JE 3TA3B 2CMRH 4QRRA 5CJQH 4HH9A 2KBGA 3QUZC 3X13B 4RX4D 2DMCA 3Q1SL 3KPSB 1NCTA 3QIUC 3RDTA 4JFYB 1CXLA 4LK4A 3IU3A 4EOWH 3NCJL 2HYMA 5GZND 5ABDE 3QDME 3R06A 1A47A 2ICEB 2PYEA 5IROC 2VN4A 1B4RA 1KJMA 1OAUH 1ULVA 2CPCA 3QULB 2R29L 1BBJB 1PJ9A 1DQML 3RWCA 1BVLA 3S35X 3DVNB 2HFGL 5EPMB 2J6EA 2VXQH 4LLDB 5GRYA 2VQTA 5GXBB 3ARDD 5HPOA 2GK0A 4QEGA 3IDJA 1T1YA 3QR2A 4OF7A 4RWHA 1NEZG 3K0WA 1A6VH 3V0VB 3PWUA 5J57B 4M93B 1RAMA 4PG9A 3HG1E 2I26N 1U36A 2DLTA 3P4MA 3W0WA 3TCLB 4PS4L 2V7NA 1WCQA 2P8MA 4LCIH 1ZWIB 2AW2A 3WIHH 1T2QH 3VMOA 4WEUD 1QUNA 2HT4D 1FORL 4OM1H 2VDRL 1I9IH 1RZ7L 2BVEA 2FJGA 2P1YA 3FQRB 3GMMA 4GRLC 3MV8B 1ZHBB 4GXVL 5JIPA 1RZGB 2AK4A 3AREA 4HWUA 3NFNB 1KN2L 1HHIA 5ACZB 4XWGL 4JCMA 4ZUWA 4JRYB 1BFOA 1LEKA 4MS8C 1GGCH 4A6YH 2Z92A 1WT5C 2AI0H 4OCMC 1R0AL 3TA3A 4O2CB 4OF0A 4U1HA 3V6OC 3IVKA 5IFJB 3CFIC 4NWTL 3X13A 1W2KT 3OKMB 1TVHB 3MOAL 2ZSWA 4P3WA 1IGCH 3HRZB 3ZLQC 5DUPL 3I2CH 1QSEB 5IBUB 5DJ0A 5MI0B 3QDAA 2MCG1 1OAZH 1MRCH 4M00A 3MUHL 5FYLH 4YAQA 1VPOH 3MUGB 3WV0A 4P2YA 3GSXA 5C09D 1GAFL 4Q58C 3RWIB 1U41A 1RU9H 1S78D 4ZFGL 2EE6A 5D96B 3O2DH 3BH8A 2BC4B 4PRIA 1LDPL 1F6FB 2NXYC 5EPMA 4M6OH 4XP6H 1EUTA 1PG7L 2FBJL 4NQCE 5KVMC 1JTTA 1HHHB 3WEXA 3RVVD 4NO0A 1DLFL 5I1EL 4PJDE 1I7ZA 3O11A 5D7IF 5CEXA 1TTUA 1MHHA 5E7FA 3LAFA 4LHJB 1I9EA 5CJBA 5D2NE 3BD3A 2V5RA 3GM0A 5CP3H 4S0TD 1R24B 2HN7B 1AQKL 1MAML 5E8OA 4MXVF 1EEZA 5J7CC 4R4FH 1MWAB 4U7KA 4MJID 4FTVA 1CDJA 3DGCR 1KPRA 4IRJB 5DMIH 2MTPA 4RISH 3GSNH 3MV8A 1S7RB 1HEZA 1I1CA 1MSPA 2VDOL 3HUJA 3MRRB 5ACZA 3INUL 4XB7A 2NR6D 3UC0H 5IOPB 3AMKA 2GJ6D 1QG3A 2VITA 3V5DB 5D9SB 2AVGA 4POZC 4XVTH 5F44A 3SE9L 5L2KD 2VLKB 2CD0A 3L7EB 4K3DH 3MTRA 4Y5YB 3TZVB 4L4VB 2J8UB 4DTGH 3RI5F 5I1JL 1TFHA 4J4PA 3NZHH 5EH1A 4EIZC 5HHXL 1QSEA 1GH7A 3NIFE 5H8DA 3P30L 1TQBC 4JN1H 4PRPD 5IW1B 5IHZB 4RZCA 4LCWB 5B4MC 4B0MM 1ZGLB 4N0RA 4WWKB 3L3HA 3BEVB 4KKAD 2E9JA 2EEAA 1BZ9B 3DX8B 3QAZB 5CUSH 4ZS6D 2BOCA 3CXHK 3KHQA 1V7NL 2AJUH 5HYJD 2W60B 4YWGL 3R0NA 2WWMD 4NBXB 1A6PA 1H8OA 5CJXC 3VU2A 3NH7L 1RZIB 2D7PA 3BP5A 3BRGC 5DJ2B 4GLRI 3FFCB 5DRNB 1DQLL 2QV2A 3MOQA 1VFMA 5E2UH 4KZDL 1AHWA 2FGWL 4FQXC 4S1RL 1CFNB 1IRAY 5AAMA 4PRHE 5GRJH 4V1DE 4JQIL 1FYTE 1EX0A 4NNYA 1U8NB 1YY9C 1QFOA 5TFSH 2GITB 3ILQD 1HILB 1R24A 2HN7A 5I19L 3HMWH 4ZFZA 2BZDA 4ZUVA 4NRXB 5GHWL 4IRJA 1JNHA 4PJ5E 3QG7H 1N26A 4OZFH 4MA3B 1IL1B 4LLVA 4K3EH 3B4NA 1X5IA 4KZEH 2X1QA 4NRZB 3LRHA 2Q1EA 3S8WA 1T7VA 1UQSB 2DQIH 1HHJA 4PD4J 4AL8L 1WWAX 3L7EA 4KHXL 2HAZA 1KYOJ 1YYLL 5GGTL 4I1NB 1E28A 1ZT7A 1XR9B 3SJVE 1N59B 4OCLC 4U0RB 5IW1A 5KJRL 2R8SL 5LQBH 5HGHA 4MXQC 1MI5A 3KYKH 4Q9RH 3UPRA 2OTWB 4LCWA 4ISVA 5IM7B 5FKAA 1ZGLA 3LEVL 1ZTXH 3BEVA 4YE4H 3UX9B 2DRUA 4L4TB 1KEMH 4S10A 1OQOA 1S7XB 1UB5B 1G7LB 2HWZL 3IDYC 4RNRB 1I4FA 3QQ9C 4U6HA 1UWEH 5DJ2A 2BK8A 4GMTH 3T4YB 1KTLB 2EH8L 5C8JA 4UDTA 1WZLA 1MCPH 3VGHA 4JY6B 2Q7YB 2JB6A 4FHBD 5EU6E 1JIBA 2BJML 5I16B 5HI5D 3MNVA 1CU4L 1ES0B 4QHLA 4PJAE 2JJWA 3ZTNL 3X3GL 2GITA 1RURL 4YBQD 4ZAKC 3NCBB 3L95B 1IGMH 2ZUXA 3CFDB 4DGYL 5B21A 4JM2A 4AG4H 4YQXH 3CJJA 2GUOA 1LMKA 4WI4A 5HVHB 3K4ZA 4UBDC 4PJHE 4WV1C 3ZKMC 4HLJA 4XC3L 1IL1A 3KJ6L 35C8H 4PJEB 3MJ9A 2GK2A 8CGTA 1LHZA 1R5WB 5C2BH 4YH6A 2X70A 5C3LD 3I02B 3C5JB 1CI5A 2CIKA 2ZPKH 1U58A 4PRBA 4EIGB 1RUAL 4WY7L 4WFFE 4DUVA 4APQD 2BFVH 5IMMB 3VFTB 3BMVA 4NDMB 5BOZG 4HD9A 2X4PB 3SEPA 1ADQH 3BIKB 2BHZA 3FO9B 3M45A 1XR9A 1UKTA 5A3ID 2FSEA 1U95A 1N59A 2H45A 1KB9K 3VXNA 4HPOH 5EC1B 4NQEE 1RIUH 1U3HA 1NGXA 2I9TB 1IARB 4G6KL 3SDXE 4EDXA 5IGXL 2B7DT 3U83A 2W9LA 3VWKB 2PXYD 5DQJB 3WUWG 2YA1A 1X5YA 1UB5A 1IC4L 4PY8I 5DD3H 4UNVA 4OIAA 1A7BA 1FFQA 4HEME 2XQBL 2ZG1A 1UWGH 4WI8A 1NBVH 1MFDH 4PLKC 1RHHB 5I66B 1HE7A 1BM3L 1ZA6B 5FYKL 3UTSB 1Q38A 2Q7YA 4JY6A 3QXDB 5JW4Q 4KXZH 4S0SD 2CJUH 2VXVH 5I16A 1F8TH 4CMHC 3QZWG 4OZFG 4JLRB 3TBTB 1KIPA 1FGVH 1T5WB 4U1SA 2VXUL 1YQ2A 2BVYA 3SPVA 3L95A 5DJDB 4ZPVA 2GY7B 4YNYB 1DN0A 1TMCB 2H3NB 1KXVC 5D1QD 5C6PB 5GGRB 1EPFA 3LD8B 4QY8B 4NQVA 4TVSa 3SE8H 1L7IH 4LBEB 1KNOB 1RUQH 1NGQL 2P5EB 3LMJH 1CXEA 1R5WA 4QT5B 4XI5D 3LS4L 5ADOH 5A2FA 3G5VA 3IJYA 1RUPL 3CSBA 4OD2B 4Z7UF 1JZ3A 3C5JA 3KG5A 4YBLB 5JOFA 1NGPH 5C3TA 1NMCB 1FP5A 1XEDA 5E2VH 4NDMA 3BO8B 2X4PA 4WRLA 1O7SA 5DJAB 5CKAA 3U46A 1HKFA 3SBWA 2CLRA 1CG9B 4IBLT 4YBHA 1S7TB 2NY4C 4GBXC 1EH9A 5DSCB 3OPZH 3CFJB 1BOYA 2VE6A 5L9DH 5C0AD 5J1AB 2I9TA 3VE0B 3RZWA 3VWKA 5LWYL 3MRPA 3FONB 5DQJA 1F2XK 3MBEB 4BZ2L 1F3DJ 2HT2C 3J8F7 4P2QE 5BRZA 2C3HA 5DJZB 5GGTA 5DLML 1RZJC 1CLCA 2DB8A 3CSPA 2XRAH 4D0BB 4MD5B 3ULVL 1OM3H 3VDBA 3QNXA 3QUMH 1I8MA 3AM8C 2X41A 4YHLH 5J4MA 4LSPH 1P6FA 4LDEB 4M5ZL 5B8CC 4L1DA 2IFFH 1ZSDB 1S7VB 3QCVH 4PBVC 2NYYC 4MSWA 3L3JB 1MCSA 4JRXB 3ZE1F 5CJQL 1G7IB 1DBAH 2XWTA 5IESH 5ISZD 2WLZA 3TBTA 1YEGH 3PHQA 4GS7C 1FAIL 1KFAH 3VFNB 4EI5C 3OXSB 1P4BH 4XP4H 4HIJB 5ALBL 1UXWB 4YNYA 1NJ9A 1LGVA 5DD1H 5D72L 3PJSB 1PLGL 4U1LA 1G7PB 1KELH 3V9FA 2N1KA 5EOTB 2HFFB 3LY6A 3O4LD 2VJXA 4OUOA 3GSQB 3U4EB 1OAUL 2DM2A 2R0LH 1DCLA 5JHDE 1FN4B 4OGZA 3RJQB 2WBJA 5IBTL 2DLFH 3EKCA 1JGUL 3QA3A 4G6JH 2VXQL 3TIDB 2AQ1A 4TNWF 2EYTB 3V52H 5BV7H 3OG4B 3BO8A 5C2UB 5EUKA 5I1GH 2GY5A 2ZUTA 3OJVC 3CAFA 4UIKL 2IEPA 4KKBD 2CRMA 1WTLA 3F5WB 32C2B 3S34H 4NOFA 4Y89A 1W72A 3ULUE 3CFJA 2CSPA 5C0ND 5E1AB 4ORZC 2DWEB 1F13A 1UJ3A 4G9FA 3WIHL 1T2QL 5GGRY 3FONA 1Q0XL 3MBEA 3O45A 4OM1L 1WEJH 3LKSB 1UKQA 5DD5L 3K80A 5IHUL 1OTTD 2YD4A 4MD5A 4LVOB 5CJOL 2EYSA 1FBIH 1A1OA 3EIFA 4OCXH 4TYUA 1GGCL 1P7QA 5SV3A 2AI0L 2IWGA 1PYWA 4I9WD 4OQTH 4QRSA 4NN5C 3SCMC 1S7WA 1AJ7H 3QUXA 2NY6B 1D5MB 3A67H 1B6UA 1BIIA 2HTLC 3QO1B 3WFCH 5C0BD 5JR1L 2BNQD 3QDJE 3LKOA 3VFNA 1A4JB 5SWZA 3OXSA 4BSWB 1G6RH 1MRCL 1PKOA 1YY8B 1TCMA 5HVFB 2AXGB 3KPMB 1NMAL 5FYLL 5IWLC 5I9QC 1IEHA 1VPOL 2Q8AH 2OI9B 1WSST 3ZYOA 1G7PA 5EOTA 1LEGB 3MV9E 4WFGE 4Z7WE 3GSQA 1RU9L 3DXAB 4GSDH 4N0CC 2ZCLL 4RAVB 1FN4A 1X5XA 4UINH 1R3JB 2N4IA 4M6OL 5L2KE 1EHLH 4XP6L 3DV4A 2QEJA 1WFOA 3WLWD 1EGJH 4W4NA 1PSKH 3CFEB 5L6YL 12E8H 5EBLB 3DUSB 1JK8B 1C16B 3F5WA 5DVLA 2YD5A 32C2A 2BHYA 1WVZA 4LLQA 4PRPE 4J7RA 4FQLH 4JPVL 1REIA 3JZ7A 4PJ7E 2JCCB 4X6DF 2GKIA 3WE6B 2BVQB 1IM9A 4BZ1H 4R4FL 1AC6A 4KKLC 5J9PA 4X83A 5IEHB 5BW7C 4RISL 4YHNB 5HGDA 4CVXB 4R8WH 1X5FA 3MO1B 4KRPD 3C6LC 1FCCA 1MREH 3ARPA 1LK2B 4MJ6A 1E0OB 4NGHH 4DZBB 5ILTH 5GS2D 1QLRB 4XVTL 1TITA 4Y4KA 3W11C 4IRSD 3U7WL 4LKCB 5HI4C 5CJ8A 5FA4A 3ZHKA 4DTGL 3MX0A 3BPLC 5LJYH 1DUZA 3NZHL 2WP3O 5D2NC 3PL6B 3PWPB 3PQYB 5F9WB 4N8VA 4WO4A 1P7KB 1J8HB 4LU5H 3GM8A 4DQOH 4BSWA 5ADPL 3GMNA 1YY8A 3AY4C 5EUOA 1ZHNA 3QQ3A 4JQVA 4TUOA 1TCRB 3IAGC 3N85H 2P8LB 4C56D 1TNNA 1QBAA 4UILH 1TETL 5F6IC 1AO7B 1D5BB 4H8WL 4RAVA 3E2HC 5INCB 5CUSL 3VGAC 3NBNA 2AJUL 3K3QA 5E7BA 4HK3J 4G8IA 5DJ6B 3TVMD 3CFEA 5DQDL 3QI9B 1MCHA 1F97A 3DUSA 3LQMA 4BH8B 1JK8A 1HSAB 3ELAT 1C16A 3OAZH 2PW2B 1QSZA 1XIWB 4P23C 2CK2A 4PJFB 5GRJL 1J05A 2JCCA 2BSRA 2X4NA 5TFSL 4YHZL 4FFWD 1UXSB 4M43H 3HMWL 3FZUC 2OXHA 3CD4A 3UBXI 2R23A 4LVNB 2BNRB 4HV8A 2B0SL 2FJHA 3RUGF 3BX7C 2ICWI 3QG7L 2VLRD 4LCCB 4U31A 1I8KA 4K3EL 5IB4A 4OLUL 3O4OB 1LK2A 1UYWH 1WBZA 2QADC 4KZEL 2CGRH 3WIHA 3T04D 4YHKL 2HJKA 1A1MB 1QLRA 4QYOB 4R9HA 1D5IH 4QF1A 4NPYB 3KLHC 1BQUA 5F3HA 2X40A 5HHOA 4W68A 3QEUB 4DN3H 2FB4L 2NY7L 3T3PF 3B2UD 3PL6A 3PWPA 3PQYA 5KG9A 1GSMA 5IP4A 1AGFB 1J8HA 3HR5B 5FUOH 1FV1B 3BZEB 4A6YA 1D6VH 1FL5B 4BFEA 1J9CT 4Y5XA 1JGLL 1MQKH 3KHOA 5LQBL 3DUUB 5HPMA 4Q9RL 5GS2H 2EDFA 3O3BA 3QSKB 4QNPF 1OGTB 3MXVH 3BRFA 2P8LA 5EU4B 3OMZA 2OJEB 4OLYH 4YE4L 1AO7A 1KEML 1NQBA 2EE9A 1AXTL 1U3ZA 5FDWA 2BRRL 1T0NB 4CW1B 5D7JC 1WAAF 4IEFB 3PE9A 1OD9A 4NM4H 4ALAH 3FRPG 1HINL 4BFIB 1UWEL 2Z8RA 4UMGA 5JDSB 2KZ1B 1CVRA 5I1IH 1CYGA 4R2GB 5JLZB 5C07B 2PW2A 3Q0HA 2GAZB 3DMMB 3EJZD 2BERA 3O2DA 2MFNA 4NQDB 4NC2B 5TF1H 4PJFA 3V0WH 1ZT1B 3BI9X 1NUFA 4HWZA 3QUZB 4NIKB 3L3GB 1HZHH 3QIUB 1NUNB 4DZ8A 1U91A 1IGML 4MCYB 3KPRD 4PR5B 4ENEC 5IJVB 5HHMB 2DF3A 4HUMB 3VFGH 3BN9C 3KWWB 1SJXA 1YMHA 4PYGA 4QXTB 3IS0X 3D9AH 3WNOA 4HS6B 35C8L 2G60H 4HUWB 5FYJD 1MJJA 5CP3A 1T0PB 4UNTA 1OT1A 4QYOA 3ARDA 4NPYA 1OARL 3KPQB 2BFVL 3WDJA 1XF4A 3FOMB 3GSNA 5KS9F 1V3MA 3ARTA 2VDMH 3S4SB 5C9KA 1J10A 1AGFA 3HR5A 1FV1A 3I85A 2Z31D 3W39B 1BX2A 3IGAB 1KCSL 3QEQD 4HPOL 4X99B 4Y7MA 3DUUA 3UPAA 2E6JA 1RIUL 1OGTA 5EU4A 2JJTA 4PB9H 4AQ1B 4OB5L 2OJEA 5T33H 4PJ9C 1M05B 3TYFB 4XCCL 2FEEI 3AXLA 2FEDD 1LE5B 1CXKA 2HVJB 3D5OF 4X5XB 1U8HB 3REWB 1UWGL 4GRLB 3L3IB 1NBVL 4BFIA 1F4WH 4QRUB 3LIZH 4D9LH 4HGKC 5JDSA 5JPMB 2CXGA 1OB1A 4OFYD 1RMFH 4Y16B 4UOW0 4KJQC 2KQNA 3C2AH 2CJUL 3GNMH 4NQDA 3QHFH 2VXVL 1KLUB 2D0FA 1F8TL 4IHOB 5F8QC 3LDBC 1FFRA 1XGQB 3GHEL 3L3GA 1DN2A 3KNBB 3WDHA 2Z35B 4PR5A 2ZKHL 5C09A 2EO9A 3X14B 5HDQH 4FG6D 5MEOB 1JMZA 4UI2A 4AEEA 1Z6JT 4QXTA 3R4DA 3GGWA 2FHFA 1RUQL 4HUWA 2GFBA 3LMJL 4S2SB 1EEYB 5ADOL 3HC0B 1SY6L 4XX1G 4I77L 1Q9WA 1VGEH 2D9QB 1NGPL 5EWIH 5D2LE 4D9QD 1S3KH 1G6VK 2NXYB 3LRSB 4HIEA 4YIQB 3FTGB 2ITCA 4J23A 3S4SA 4OZFA 5E8NB 1ZGLP 5DZLA 4JGUA 4GG6B 3AU1A 5IKCB 4FXLA 3W39A 1U9KA 4NKQB 4PY8J 3B6SA 3OPZL 3IJSA 1HH6A 3QCTH 4XP5H 2NY1D 4MJIA 3PGCA 1CQKA 4K9EH 3VFVB 4J3UA 1T1ZB 1G84A 2D4FA 1M05A 4ZS7H 3BJLA 1TTGA 4KKNA 4QKXB 4WU7A 5CSZB 3SGDI 4ZNEA 2HVJA 2XRAL 4GLRH 1OM3L 4X5XA 3K4DA 3VXPA 4YHLL 4P2RE 2F54B 4LSPL 2GJ6A 1BMGA 5CEYB 5IQ7H 2YEZB 4Y16A 2R0KL 3QXAA 4LOUC 3DSFH 3JTTB 3LKRB 1DBAL 5DR5H 3ORJA 5IESL 1XF2B 1JHTB 3NIDF 4CVWA 4ONHB 1RULH 1M7DB 1XGQA 2BVPA 1RV6X 2XN9B 1YEGL 1J0KA 3OKNB 1KFAL 1LDSA 3PP3H 1FZJA 1P4BL 3NGBC 4XP4L 3PP4H 5DD1L 4PG2C 3T65B 4JY4B 3LPGA 5CMAB 4XAWH 1TQBB 1G1YA 2C5DC 2LVCA 3BP6A 5HYJA 3B9KC 4OLZL 3HC0A 1R3KA 3C2SA 1YEEH 5C08D 5IR1B 2E7CA 1J1XH 1ND0A 4Y1AB 3WS3B 1AGCA 4G6JL 4PJXA 2QHLA 4XCYA 3DIFB 3LRSA 3V52L 2YBRB 1BWMA 2HTKD 2Y6SD 1KEGH 4J3TA 5E8NA 1N4XL 4LLYA 4GG6A 3RWGB 3S34L 1QFWH 5IMLA 4Y19E 2P7TB 4FQXB 1KTKE 3KLAB 5HVGB 2AJ3A 3P9MB 1AD9B 3RWFA 1K8IB 3ILPB 1T1ZA 1CD0A 2YPLD 5IF0A 1ADQA 1FZMA 1X5HA 5CSZA 1WEJL 4O02L 5FO9B 5ID0B 4HIXH 3SDAC 4NKOB 4WI9A 3WNPA 3O2WL 4E0RB 1FBIL 1RSFA 1AQDA 4OZIF 2JKXA 4IDJL 5T1MA 1NCNA 3O6MH 4MA1C 3S37L 5E1HB 5IHLB 1YC7A 3QPQD 1SJEA 5D7IE 4F58L 5T3ZL 1AJ7L 4JGMA 1GC1C 4MNQB 1JHTA 4XVUD 4C4KT 3WFCL 1M7DA 1R3HB 3C09C 1MLCB 3RPKA 2P24B 3CLEH 2LE9A 4XCEB 2ORBH 3ULUC 4RRPA 4TVPE 1LK3L 4FQJL 4TOYH 5E0QA 4HUVA 2FHBA 2YA0A 2A73A 1H3UA 4MXVE 1F45A 5IB5B 1QVOB 3CH1B 2Q8AL 3RKPA 5IW6B 1VDGA 3EJYC 3BZ4A 4XX1E 4H25A 4I4WA 1OCWL 3SE3C 3TFKD 1T89C 2VXTH 4G9DA 4NRYB 5IBLC 1MFCH 3V5HA 1ZLVH 3L3KB 3HNVH 5CKGA 5DA0B 3EOAA 3DO3A 3IDYB 2YBRA 3MROB 3OR7B 12E8L 1KG0A 4FFVD 4NCC2 1P5VA 1CICB 2FBOJ 2X4RB 4JFFD 3RWGA 1URLA 1ROWA 3VFUA 1DLHA 4R4ND 3KDMB 1SBBA 4L8SC 5BO1L 1Q0YL 4IOSD 1MELA 1K8IA 4MB3A 4OCRH 4DJMA 2B5IC 5HHPB 1JPGA 5DURD 4XPHH 4KC3B 4K71C 3IDNA 4NKOA 4HCRL 4C58B 2I60L 4ZAKB 3GSUB 3HS0A 4R8WL 4XT1C 3D85B 4E0RA 4JFPB 2YPKB 4MHHG 4P59L 2ZUQC 3WFBH 4JANB 2YC1B 4WV1B 4NGHL 4R3SB 4APQA 5I8OH 1S7UA 5ILTL 3D0VB 4JVUA 2XXMB 4OCSL 4ZO7A 3QT2A 4OTXH 5FYJU 2VR5A 1LD9A 3PWJA 4MNQA 4PUBL 4P46D 3QUMA 3MODH 3TBSB 4WHDA 3V4VH 1EZVX 2CKBH 4YK4C 1Q1JL 1CGSH 5TH2B 5I6XC 4YHIA 4Y4FC 3IFLH 4Z76B 5F70A 4M7JH 3BXNB 1ITCA 5A16A 3CH1A 5IB5A 2PXYA 5D1ZC 3N85L 5H94B 1QRND 3VXMB 4TNVK 4UILL 2WWMC 3T77A 2E9WA 2J7LA 1NCBL 3MRBA 5E6IC 3RX5A 3UDWC 4C55A 4K94C 4WFED 4HJJH 3TM6A 4ZUUA 2DLIA 3BZFA 1NKOA 3MROA 1TZGL 4P49A 4YHMH 3I3DA 1PG7W 4L8BB 3FQNA 4YO0B 1CICA 2LVEA 1I7TB 2EE2A 5HHVH 4PRAA 3RX8A 1E4XI 1JCKA 3ILQC 5EA0L 1LILA 2I9LA 5DD6B 5I75C 2WV3A 3AFLA 5D1QA 4M43L 4CMHB 5DMYA 1E27A 1H8SA 2NW2A 3VJ6A 1BD2B 1B2WH 4HW6A 4NJAL 1WFTA 3T4AB 5KBNC 4X6EB 2VDLL 4O00A 5E00B 2C1OB 3D85A 4B7LA 3LKPA 4X9IA 4FA8A 1T1WA 5EN2A 2H2SD 3F12B 1QBLL 3DX7B 1JGEA 2CGRL 2IC2A 2XG5A 2YC1A 1R5IB 5L88L 3PV6B 3THMH 4G42A 3STBA 1DJSA 1KENH 1KSRA 4G7VH 4RIRB 3H9SB 1KUMA 1SJVA 3TBSA 4KROD 1QO3B 3QNYA 4WUKL 1QSFE 5TH2A 5FUOL 1FRGH 4HKBA 2YD8A 1VFOA 5F7NC 1CFTB 4OZHF 5C0AA 4AIOA 4RGOH 1MQKL 3CPLB 4HG4K 3BXNA 4OQTA 3L6FA 3PABB 4MQTB 2NY4B 4GBXB 1Z0NA 4OF8A 5HYIA 1RHFA 2FJFA 4HXBH 5KSBA 3HFML 5FYJE 4HF5H 5F1NB 1WV7T 1AGEA 5AEAA 2V5MA 2D7TH 4RWYH 1A14H 5KSVB 1G6RA 3X3FL 1NDMA 4UUJA 4MNGE 1DQQB 5D5ME 1J11A 1DFBL 2VC2L 3QDGD 5J6GA 2DMKA 1JHKH 4HUNB 3L5HA 1CLYH 5B8CB 3BZDA 3Q5YA 1RK0B 4DUXA 1IZKA 4KI5F 5B39B 4IMKC 3V0WL 4KTEH 2M8XA 3MUZ1 4JPWH 5DD6A 1LO4H 4W81A 3MA9H 2R2EA 1HZHL 4PP2A 1EGJA 1RK1B 2NXZD 2IMMA 2IAND 5IFHH 3ARZA 3S5LG 1BF2A 4LRIC 5LVEA 2ICCA 5DK2B 4JY5H 5GSVA 4OZ4B 4GS7B 3VFGL 4EI5B 4B41A 3O4LA 5D1XC 5KVGH 1KTRL 1FL3B 5A2JH 2K3TA 3MGOA 2B1HH 3PXHA 1T83A 2G60L 4RCAA 3DX7A 5F9OH 2DKMA 5HDOA 2YK1L 3D3VD 3H3BC 1JVKA 4L3AA 2DQHH 4NZDA 1BOGB 4CL7A 4NO3A 1I8IA 1ZAGA 1QEWA 4DVBB 3QUYC 4XXDA 1NDGA 2VDML 1E4KC 3VFRA 3FB5A 4LHUB 1JZ4A 3QEGH 4R7DB 3QISA 4DK6A 4HC1H 4FS0A 2GT9A 1KIUA 4PB9L 4LARH 4H1LH 4LSTH 3MRJA 5F1NA 3AUVA 4NKIH 4OF5A 5KSVA 4CRPA 1R3LA 4Z7UE 5E94B 1DQQA 1DUYB 4S1DC 3LIZL 4WI6A 4EN3B 1RMFL 4WI3A 2DBJA 3MLZH 1MLBA 3HZYB 5HD8C 3PWVB 4Z78B 5C0BA 2O26U 3C5SB 3QHFL 2BNQA 3RKDD 3HHRB 4DVRL 3LRGA 5IVNA 4NQSB 4NN5B 3SCMB 4NQUA 1YQVH 5EORH 2VERN 4JZJA 5BJTA 2ADIB 4CN4A 4LPUA 4OZ4A 4Q2ZA 3B8SA 3HG1B 4Y4HD 1P53A 4HZLB 3TIEB 3SOBH 3OAYH 1FL3A 2C4FT 2IQAA 5I9QB 2EZ0C 4K3JH 1CXHA 4YXKL 4WW2B 1W0VB 3RU8H 3I75A 4GUPA 4J1UA 5EO9A 1CGWA 3KYNB 2UWEF 3LQAH 1H15B 5EZLB 4X8XA 3W2DL 3ZE1E 1IE5A 4CU6A 3GB7A 4DVBA 4MXWL 4BSVB 4AM0A 4LP5A 1I8LC 5TE4L 5E5RB 4UQ2B 4U05A 2X4TB 5HBBA 1A9BA 4R7DA 2WUCH 4I3SH 2DL9A 4CAGA 2FL5B 3L3OB 3MRDB 4M6MH 5E4EC 2VYRE 4HKZA 1IBGL 3H9HA 4P5MB 5H35B 4MAYC 2NTFA 1UWXK 4XNQB 3UAJD 3MV7B 1EVUA 1DZBA 1YEDA 3U0PB 5C0CD 3RAJH 1AFVH 4O51B 5JDJA 1XR8B 1HOCA 3MV11 5LKNA 4ZOAA 1M7IA 2YN3A 4EN3A 1RD6A 3TV3H 4IRSA 3GI8L 3DSFL 1JV5B 3AS0A 5L2JB 1NCCH 2GIYA 4K3HA 1PY9A 4HIIA 4GRWF 1FIEA 4NQSA 3WIFB 4L9DA 3VD7A 5FA3B 2WANA 1Y18A 3FB8B 3JWOC 5CGTA 3BPLB 4WNQB 4G8FA 2D03L 5GJTH 3W9DA 5D2NB 1ZLSH 1KC5H 2ATPB 4C56A 1TZHB 3PP4L 3GZKA 5BZWA 1I9RH 1C8PA 4BFBD 4K7PL 5JPNB 1GVIA 5CGYC 3VMPA 4XAWL 3EUUA 1B0GB 1J1PH 4Z18A 2WUBL 4HJGA 4WW2A 1W0VA 4NZRL 2X89D 1KGCD 3BH9B 4ORGB 2G9HA 1DBBH 2DD8H 3FT3A 4X5WA 1YEEL 1J1XL 3TVMA 3TF7C 1OAYL 5F6IB 4ELKA 1CLOL 4JN2B 3WJJC 1H15A 3E2HB 4M02A 3VGAB 3DGGA 3NIGE 1BQLH 1UM5H 5BZDA 1FG2A 1G7MB 1DQDH 1KEGL 2NZIA 4LQFH 4H1LG 3C5ZC 4OUUB 3CIQA 1JF1B 1QFWL 2X4TA 4AEFA 5J3HD 4J6RH 4FFYL 1KACB 3B43A 1NANH 2IG2H 1LO5B 2HJFA 4YGVB 2FO1A 4KJWD 4P23B 2Z8VC 3BEWA 5LCVH 5KTEL 3X12B 1FHGA 5IJKA 1HYSD 5H35A 5E2TH 2NY0D 5A2KH 4XNQA 1CVSC 2VLRA 2XY2A 3CFKA 4XRCA 1L0XA 2IBZX 3MV7A 1GGIH 5HYSG 4RGND 1N3NB 1OP3H 1G9NH 2IQ9L 1Y6MR 1DANU 2R9HD 3CZFB 1YUHB 4O51A 1XR8A 1RZFH 3SE4A 3SDDD 1SQ2N 4HIHB 4JFFE 3CMOH 1LNUB 4XP9H 1H5BA 2QADB 3RJDA 4FOMA 5JIHA 1B0RB 1S7SA 2C3VB 1U8OB 4K23H 4M3KB 5I8EB 3O81A 1ACYH 1M1SA 4G43A 3WIFA 3ISWA 3RGVD 3CLEL 2SEBB 3T0DA 2ORBL 4WHCA 4WI2A 5DJ8A 4TOYL 4YGAB 4QCIA 3CMGA 1TZHA 2LV4A 5CILH 4KQ3L 4D9RD 4V1DB 3G5YB 3WN5A 1FYTB 2XZQH 5JPNA 5FV1L 2DQUH 1MVFA 3I9GL 2XZAH 3KS0J 4QXGH 2VXTL 4ORGA 1W8NA 3HUJF 2IBGA 1IAKB 4Y5VC 4X4XB 1MFCL 3OKLA 4HX1B 1VACB 2AJVH 5DD0H 2QSTA 4M6NH 1VSCA 5D7JB 1JYNA 2IAMD 4ZXBD 3SQOH 1PZ5B 1ZLVK 4XPBH 1G7MA 4X80H 1FSKC 1ZOXA 4RA0C 4OUUA 3DX9A 3V4UH 3DECA 3D2UD 1JF1A 1OP5H 4M1CC 1FH5L 1YJDH 2X4QB 1I1AB 3KPRA 4G6MH 1OP9A 2EC9T 4XBGB 4OCRL 3P0VL 1GPOL 3SJVB 3V95A 5IMKB 1NKRA 4EI6B 1VKXA 4FFZH 1DL7H 3V79C 1JPST 4WFEE 2PTUA 4XTRD 3OKOB 3HE7C 3G5XA 3SKOB 3UTPD 1L0QA 3MRNA 1VADA 3WUZA 1YUHA 1N2RB 1MOEA 3TBWB 2AJXH 5GIRA 4WEBH 2VR4A 3QHZH 4YFLF 4W6YB 1B0RA 1EK3A 1XGYH 1OSZB 5I8EA 4KJYA 4DOHE 2Z31A 3V4VL 4P9HH 3U6RB 3UJTH 3F7VB 3WHE0 1CGSL 3IT8D 1DSFH 3QEQA 2PN5A 5E2JA 5EU6B 3IFLL 4ZMAT 2AP2A 2AJZB 2ENYA 4M7JL 2Y5TA 4WI5A 4PJAB 1ZT4B 1EXUB 1KCRH 3WFZA 5I18H 4JFDD 5DQ9B 3DJ9A 5ESQA 4QTHA 4PJ9B 4K8RC 3CK0L 1MVUB 4HX1A 4PJHB 3EO0B 5KSAD 3SDCD 4OFYA 4DKEH 4OQ1A 2Q6WA 2YS4A 3QFDB 2DOCA 1G7JB 2BSSA 5E6YA 4YHML 3MC0A 1B88A 1UZ6E 4CVZA 1LEIA 3MNZB 2FIRT 5HHVL 2K7PA 3QFJE 4NYLB 4F15C 3U1SH 1NBQA 2B4CH 1IAII 4G8GE 2X4QA 1EIBA 4LF3A 1I1AA 1QR1B 4HS3A 5DJXB 4JPKL 5GS3A 2CDGB 1G0DA 5K9JH 1FNFA 2LU3A 1B2WL 1HWGB 4KHTH 4NQEB 5GJSH 3P0GB 4H20H 1PVHA 2F53D 3O6FD 2GW5A 4N0UE 5J06A 2FX7H 3PNWA 3SKOA 4P2OD 4ZQKB 1WAAE 3QDGE 1N2RA 3TBWA 2VB5A 4LIQE 4MA7H 3OWEA 1QNZH 2JE8A 1HCFX 3PHOA 4K7PY 2UZYB 1KENL 4PRDB 4G7VL 1V7MH 4X98B 4R26H 4UOW1 3V7AG 1NCDL 1EA9C 2LTQC 3I6LE 2L7JA 5F7HA 1FRGL 4JHBA 1CGYA 1VERA 3DO7A 2WM0A 4N90E 43CAA 3O8XD 3L5JA 1UT9A 2YPVH 5I17B 3BUYB 1ZT4A 2ATKB 4P0DA 1EXUA 4PJ8D 2LAGB 4JM2F 1SEBB 4P4KD 1E4WH 2WK2A 4QRQB 1MHCB 4HF5L 5E8PB 5SX4H 3GBLA 4Q9BA 4RWYL 2HVKB 5T3XE 1AXIB 3BWUC 3EO0A 2HMID 1IT9L 1GC1L 5BMFH 1A1NB 3N1PC 4ODVH 2E5EA 5HGBB 3WSQH 1G7JA 3MRKB 4YZFF 2AQ2A 4EEEA 1HSBB 5KZCB 4LDOB 3ULUL 5KS9E 1W8OA 2FH8A 1BECA 3JUZA 1FZKB 5T1LD 5F3BA 4JPWL 3VFPA 1QR1A 3AB0C 4KI5D 4R90L 1EBAA 3DYMA 5C92A 2CDGA 3FN9A 5IFHL 2EDRA 2P44B 3ZYJA 2GTZA 2E27H 4HUUB 2D7NA 5E9DD 3VD9A 4JY5L 4FABL 4MYWB 3UTQA 1SJHB 3BHBA 4AIXA 1S9YB 3NGBB 5EULV 1JJUA 1SEQH 5KVGL 4WUUE 1QLFA 1S5IL 3MRGB 3H6JA 2B1HL 4ZQKA 5C08A 4HAFA 3R8QA 4GW4A 1XF1A 3GBMH 2E9BA 3ALWA 4ZFFB 4P2QB 1KJ3H 4Y2DD 3VFOB 3VXTA 3F8UB 1AE6L 5DHVB 2DQHL 4LVEA 3B9KB 3AROA 4PRDA 5DTFA 2VWEE 2APVA 5CIPB 3U7AA 2JTDA 4X98A 3WHXA 3MLTB 4ODTL 1RZ8B 5DWUH 2PUQT 4DCQB 4MVBC 3C8DA 3QEGL 3IFNH 2E7LC 4OI8A 5FGBC 4HGMA 1T04B 3GEWB 2G2RB 1IC5H 4HC1L 3OGCA 1T7WA 4PJCA 3VDCA 2YPLA 3TPUA 2ATKA 1BQHG 1EO8H 3ESUF 4YXLH 1C12B 4AQOA 1I7RB 1QPPA 4U1MB 4LARL 5DEFA 4QRQA 4N1HB 1N6QH 1C1EL 5E8PA 1AR1D 1YECH 3BDXA 4U1KB 4W4OA 1ZHKA 2K7QA 2HVKA 4ZUSB 3WIIH 4N5EC 3EO9H 3SDAB 2EC8A 4NO2A 1E4JA 1IKNA 4X8JB 3TJEL 3GMPA 3TN0D 5JHDB 2G5RA 1MH5A 5DS8A 3VI3F 4PREA 3MLZL 3HE6B 3BYTA 5MP6H 4F7MA 1FZKA 4MA1B 1U8JA 3TC9A 5F6HI 3SGEH 1V8HA 3HZMB 3VXRD 1YQVL 5EORL 5H2BB 4EUPG 5JUEL 3TO4D 5FUZH 3C09B 4D8PB 1QRNB 4OLXH 5AUMB 1Q8MA 4GKNA 4XNYH 2DMBA 3WUWB 1S9YA 4X0KB 3F6LA 3BWAA 4K94L 4E41E 3WFHA 5C0CE 4BQ9A 3MRGA 3EO1B 1OTSD 1FLRH 4K3JL 3K2MC 3GBNL 3RU8L 3OAYK 2EDNA 1JFQL 1OW0A 1MNUL 3FQWA 3NTCH 1PKQE 1TJIH 1X4XA 5GSRB 4MNHB 1CE1L 4ZODA 2FGZA 6CGTA 3MLTA 4PV9B 5GS1B 1NC4B 2YZ8A 3CXDH 2EDJA 3NIDE 2Y1VA 4FNLH 4HK0A 2H9GB 3O3DA 2G2RA 2VDKH 2WUCL 4GAGL 2UZXB 3T8XB 3MXWL 2ZOLB 2PW1B 2OL3L 3ARBC 3QDJB 1C12A 4X6DA 1I7RA 4JGJA 4L8SB 4M6ML 4J3WA 4DFIA 2OZ4H 4QRPE 4JFXB 1CD1A 1D9KB 1P9MC 2B5IB 4ZUSA 1YN7A 3VH8G 15C8H 2F58H 3RNQA 2Z8SA 4K71B 4XAKD 4GQ9L 3MV9B 1YEIH 4ODBD 4X8JA 4Z7WB 2DQDH 3MRQB 5BQ7B 2APWA 1V5JA 3G6AB 2DTMH 3TV3L 2RHEA 2ZUQB 5GZOC 2VLLB 3HE6A 1C7TA 1NCCL 1SHMA 1F90H 3LS5H 4NP4H 4PLJD 3RVTC 4Z7VA 3KXFD 3HMXH 3HZMA 3GHBH 2AGJH 5DDHA 5DK0B 1BJ8A 5I1CH 3C60B 2QHRH 4D8PA 5FM5M 1F00I 4YK4B 2AQ3A 1ZLSL 1KC5L 1UZ8B 1QRNA 4WEMB 5AUMA 3HZVB 5FK9B 5I6XB 1ITBB 1I9RL 3RPIB 4RGNE 1G9MH 4I3RH 4PJ7B 4Y4FB 1CIUA 5DRWA 3VWJC 4MCZB 1J1PL 4KY1L 3GSVB 4HJ0D 5GQBA 3EYOB 1CR9H 5D1ZB 1T3FB 5M7QA 4QOKD 2MCPH 1DBBL 2DD8L 2IPUG 4KH2A 3SE3A 3P9LB 5D7LB 2AK4D 5HGAB 3WJLA 4BA8A 5GS0D 1BQLL 1NAMH 2X7LB 5E6IB 5GS1A 1NC4A 4JPIB 1DQDL 4GH7B 4LQFL 4JO2H 4POYA 4KFZC 3BISA 3TA3D 4RGMC 4L1HA 4J6RL 2H9GA 2YUVA 2Z4QA 2D31B 1XF5B 3KPSD 4KK8D 1HDMB 2ZOLA 1T6WA 1A7PH 4NNPH 3WD5L 5LCVL 1CFQB 2X1PA 4P4RB 1EFXB 1SYSA 1XGUA 1DQTA 1CFSB 4ELMA 5TE7H 5I75B 5E2TL 1DBJH 1UC6A 1D9KA 4R0LC 5GPRA 4GJTB 2OYPA 3RUGA 1OOAA 3D25A 2ADJA 1KIQB 4HC1A 3MRQA 5BQ7A 1RZFL 2FD6H 2OL3B 1EEUA 3MOBH 3G6AA 4H1LA 1YEKH 1LO3H 2YZ1A 4HBQA 2W0KA 1PW3A 4LLMB 1ACYL 2NX5E 2BNUA 1RJLB 2HRLA 3C60A 1JPFA 3HI1B 3T2NL 4BKLB 1UZ8A 1SBSH 4I0PC 4MX7B 5MEPB 2EXWD 5L7XH 3U36B 3RPIA 4Y4FA 3A0OA 3DI2B 2J6EH 3BPCA 3UTPE 4MCZA 5ESAA 3K74B 3GJFH 1JWMB 4HLZH 2XZAL 3UBXB 4QXGL 1EO7A 3RWHB 3UJIL 3OQ3B 2VZVA 1HHGB 3CU1A 1KIRA 3MV8D 2ICWB 3UTZB 5D7LA 1FYHB 4GRWH 5HGAA 5J6HA 4CADA 2AJVL 5FB8A 3ECBB 2VQ1A 4M6NL 4JRYD 5E6IA 1A22B 5GISL 4JPIA 4XPBL 4R4NC 1HI6A 4X80L 1IGTB 3L3DB 4GG8B 5ESVB 5B38A 2P47B 1HHKA 3MYJB 3V4UL 1IQWH 2VUOA 3UJJL 1MJUH 1MF2H 3S98A 2IANA 5DEZA 2FEEL 4J4PD 5EBWB 4G6ML 5EUOF 1CFQA 2ERJB 1QSED 5GS0H 4QWWC 2V7HA 5IVZB 1YNLH 2Z93A 3QNZB 3B3IA 1IAOB 2XFXA 5DFVC 5DO2D 3FN0H 4PGCB 4F7PB 4FFZL 1DL7L 5FUCE 5GGSA 5BVPL 4AEHL 3H7BA 3D3VA 4BZYA 1KIQA 3NABH 4M03A 5D1XB 3QWQB 2AJXL 2CLVA 2OL3A 3F65A 4ZUTB 1FFOB 1OTUD 3QHZL 4CMMB 3FAXA 4P46C 2COQA 1YEJH 4O2FB 4TQEL 5IVOA 3RVWC 3WL9A 4YHYC 5F7KC 3HCVB 1D6EA 4C4KO 1XGYL 2VL5A 1L6ZA 2KH2B 1RJZA 5E99L 4P48A 1N64L 2AEIT 4R96B 1DSFL 1R3IH 2AABL 3QUYB 3TT1H 2BSTB 2J5LC 2JCCF 4BKLA 1JE6A 4HXAH 5MEPA 3HB3C 2OBGA 3VXSE 1DVFC 3FRUB 4ZNCD 1KCRL 5GGSY 4JAMA 1A7QH 3OL2A 4O2EA 1VGKA 4OGXH 3TYGH 3UBXA 3HZKB 5CSGA 4NWUH 3RWHA 4UAOC 4X9FA 4IRJD 1HHGA 2OTUB 1K5NB 2XA8L 4AZ8A 4YXHH 1B4JH 5EU7E 2J12B 1PY4A 2DKSA 3ZT7A 1L7TH 1INEH 1IGTA 4GG8A 5FO7B 1K85A 3JWOL 5CINH 1YEHH 1S5HB 3MYJA 2D4DA 3MJ6A 4Y8DC 3IF1A 3FJTA 3U1SL 2VLKD 3TZVD 4JFOB 4Q6IC 2B4CL 3IJHB 4L4VD 5E2WH 2PF6A 1A64A 1MCJA 4JFEE 4UB0L 4OZHE 1QLEH 1RZKH 5EFIB 4CN1A 1CGUA 2G75B 4Y4HA 1J87A 1NBZA 5IVZA 4ONGL 2VLJE 4KV5F 4KHTL 4MQSB 5JNYB 5BS0E 4LCWD 4H20L 1XCTB 3IXAB 2W0FB 5IB1B 5JW3L 1X5ZA 1CS6A 4WWKD 3H42H 4TSAH 4LSUH 4BQBA 2VKWA 1UH4A 3DV6B 4O2FA 1JYXA 5JTWA 1I75A 1KN4L 3NCEB 4R26L 4ODXB 1P84K 5IIEB 3FFCD 5F88B 1BREA 4HLZG 4L8DB 4PJFF 3VFSA 4DKDC 3Q1SH 2CIIA 2I07B 2IMNA 2WAHA 3JWDC 2P5WE 1FNAA 2XZCL 3FRUA 2YPVL 1T1XB 3U4BL 3ZMRA 2MHAA 5CEZH 3ARVA 1JWSA 3F7QA 3NCJH 1TVBB 4YPGB 1JPTL 3WXWH 3ROLA 5ACMA 5E4EB 5D6CB 3BRDA 5D7KE 4KMTL 2CUIA 1K5NA 1AGBA 1IC7L 2ZNXA 3OAUH 4MAYB 4O5LL 3X11A 2Z9TA 1RFDL 2FWOB 1KF9B 2HFGH 3WNMA 4TUJA 3TCXA 5JXEC 2WINB 2X4UA 1W0WB 2YSSB 1S5HA 5EZIH 3N1GC 5D2LB 1MWAH 2M26A 3MMEB 2A6JA 5HYEA 2NXZC 2FHCA 3IJHA 4OZGA 2BCKA 3LEXB 4JFZL 3V5KB 1GRWA 1M7XA 2CO7B 5JOPD 1S9VB 2E27L 4PS4H 4AIZB 4N9GA 1YYMH 2J1KA 5JNYA 1SEQL 2XNAA 2R1WA 2X89A 4JDVA 1JPSH 4G8EB 1BIHA 3GBML 3SGKA 4ERSH 4L4TD 5BOPA 4KKCD 3CGTA 1KJ3L 3VXUE 1G0XA 1IGIL 1FC2D 1BFSA 1INDL 2V5SA 2HG5A 1S9WA 4L9LA 3WS6C 2C3XA 4AENB 4P2RB 4YDVA 5C0JA 5KVDL 4ODXA 2BMKB 4TVPL 1R0AH 3ESVF 5CBEA 3D39E 4PGDB 2NTSP 5DWUL 3MRHA 3MOAH 2PO6C 5J13B 3IFNL 1YDPB 3C5ZB 4HT1H 5DUPH 3OJDB 4C83B 1EO8L 3IXTB 3ZDXF 3UTTE 4YXLL 3BVNA 5DJCB 1N6QL 2ITDA 4ZD3H 4YDJA 3FO1B 4X7CC 4P3DA 1K3ZA 1GAFH 4ZYKB 1KCLA 1ZHLA 2Q76A 3DETD 5IT2H 2ESVE 4ZFGH 3QIBB 4KK6D 4TULH 4OZIA 5KW9H 1AI1H 2VAAB 3DVGA 3QQ4A 4HFUL 2VWEC 3IETA 1W0WA 2YSSA 4QRRE 1UVQB 5CD3A 5MP6L 1NCUA 3QYCA 4LEOA 3RGVA 3M17B 4NZJA 1JZ5A 3GKZA 3CFBB 1NUDA 4FQHB 4EDWH 3EOTL 2GEEA 3B5GA 5C6WH 2DQCH 1JI2A 1JNNH 5FUZL 4PPTA 4Y19B 2PYEE 4OLXL 5CP7A 1AP2B 1CT8A 3LOWA 1F3JA 2FYYA 4XNYL 5IBUG 4CJ1A 4K8RL 4TSCL 4DFHA 1AQKH 2ZOKB 2NQCA 4XAKE 1GIGH 3QG6B 4G8EA 2VABB 3RL1B 3VWKD 1FLRL 4JJHA 4WJ5B 2JIXB 1NGZB 1OAQL 4LASH 1AD0A 2IAMA 3L5WB 3NTCL 4ZXBA 1TJIL 4AENA 4P2RA 4JREB 1CL7H 5IQ9A 3QIWB 1FFPB 3U79A 3WJJA 2R2HA 2KDGA 3D2UA 2HKFL 2HRPH 5F7DB 3PDDA 3SE9H 5J12C 3DOSA 3UTSD 4FNLL 2X42A 3BQUB 5D7IB 4ZFOL 4YHPB 1FSKB 1YDPA 3W0WE 3T1FA 2ADGB 5EBMA 3P30H 4RQQB 4JDZB 2AEQH 1EHAA 5MENE 2I27N 3ARGC 2OZ4L 1OAKH 3FO1A 2DLGA 4PJIA 2O5ZH 1Q72H 2PCPA 4ETQB 4XCFH 1A3LL 2D7OA 4NKDB 5I71C 15C8L 2F58L 4QHMB 3IFPA 3QIBA 1YEIL 2P5ED 4IOIA 5F6HJ 4PJXF 4YWGH 3ARQA 3HE7B 1IKFH 3NH7H 1II4E 4LL9A 4ZPTB 1J7VR 5BVJA 1AXSB 1DQLH 1F90L 2ZSVA 4TN9A 4GG6F 4L29A 3HMXL 4S1RH 3EYQD 3GHBL 1EERB 4L3CA 4OT1L 5I1CL 2Y25A 4JQIH 5AZ2H 3F7PC 1NFIA 5IK3A 3PDOB 2EDWA 2ZOKA 4JFDA 4N0FB 3RZCC 4Z5RB 4MWFB 3RL1A 2XOTA 1CR9L 1IGJA 5DMGD 2JIXA 3L9RB 3MBED 4GXUN 4PRIE 5I1AB 2VZ3A 5KSAA 1ZK9A 3MFFB 5K59F 3SDCA 3EOYG 1UJTA 4GOSA 1P7HL 2X6MA 3QIWA 5IG7A 5F7DA 4AL8H 2H2PD 4JRXD 3GJEB 4MDJB 2EC9U 3BQUA 3VRIB 1X5KA 2ZG2A 4QHUB 3RIFF 2OJZH 1YYLH 1RQ5A 2D0HA 1HXMB 1HYSC 1A7PL 4F15B 4IDLA 4YFDB 2OQJB 4PJGE 1KJVA 2DQFA 1MHEA 5KJRH 4KDTC 4UIMB 4RDQF 2J8HA 4RGNC 5TE7L 4FTVE 1A6AB 2F53A 1DBJL 4LQ1A 4P5TB 3O6FA 5KANG 3MV8E 2VN7A 1E6JL 1U8LB 4NO5A 3CVIH 3HUJE 3SDDC 4ZFOB 2NY3C 2NZ9C 4FZEL 4QHNA 1VEMA 5DMKB 5F1IB 4WW1A 2A6DB 2HWZH 2FD6L 3MOBL 5F7LB 1PG7X 2KUTA 1YEKL 2JJSA 4JO1L 1JRHI 4I0KA 4ZPTA 1AXSA 1WQVT 1ETZB 2EH8H 1QKZL 2NLJB 1HCVA 2F9BT 2W65A 4EVNB 2HT3C 3P73A 2X44D 2BJMH 2VIRB 3O8XA 4LPYA 3OGOE 2LTQB 1P1ZB 1SBSL 3F6IA 2IPKB 4PJ8A 2LU7A 1SYVB 1IGYA 4P4KA 5L7XL 1RURH 5FGCE 3I84A 4Z5RA 4MWFA 4DGYH 1M71B 2R2BA 2NY5C 2VSCA 3E3QE 3MFFA 2RFXA 4HGWB 4I5BB 4WFHD 4Q0XL 1U8KA 2EYRB 4YFLI 2DQJL 1U0QA 1MUJB 1UCTA 1OVZA 1I3UA 4N8CH 4MQXC 2GSGB 2X4OB 1DQJA 5T1LA 4L8BA 1IQWL 3S96A 2NY6D 2R1XA 4NNXA 4DWHA 1MF2L 2ZUVA 1HXMA 3K4AA 3F7YA 3ULVD 4EQ3A 4LCUB 5E9DA 1FNGB 1QSFB 2OQJA 1T66C 4MJ5B 4PJBA 5GS0L 1CBVH 2OS7A 4MJ4A 4UIMA 5ANME 3AB0B 4XB8A 1A6AA 1YNLL 2VZSA 4P5TA 3EHBD 4G6KH 2YRLA 4X4YB 3FN0L 5IGXH 3NN8A 3O9WC 1U8LA 4XXCC 4EQ2A 5IB2A 1UGNA 1F11B 3OKKB 1BF8A 4UTAH 4Y2DA 4UTBH 3GSRB 3NABL 4DK3A 5F1IA 2A6DA 3DXAD 4I18C 5HYQB 4UDUA 2XQBH 2YUZA 1AY1L 5FF6A 5FCUH 1YEJL 3PGDB 1CFBA 1WICA 3MGTB 3MZGB 2OZ4A 3WLBB 1Z5LB 2WIIB 4IIQB 3AAZA 5D5MB 3CSYB 1T22B 5E8DH 5ICYB 2YXFA 3ARRA 1V3KA 3BMWA 4H26B 1R3IL 2O61B 3T0EB 4OD1H 2A74B 4F57H 4HXAL 1MI5E 3TBYA 3OKDB 2I25N 4IRZL 1T0MA 3KJ4B 3HC4L 4S11A 4OGXL 5FUCC 3HMXA 5HJ3B 4H0IA 4XNXH 5F9JB 4B50A 2R56L 1ORQB 4HGWA 2APXA 1Q94B 4I5BA 4JHWH 4E5XA 1NGQH 1A2YB 4YXHL 3LS4H 1B4JL 2HLFC 3TN0A 5IMOA 1NGWA 1RUPH 1A6UH 4ODUA 1L7TL 1U92B 1INEL 2GSGA 5DK3A 2M1KA 5CZXD 2V2XB 2X4OA 1YEHL 1ZANH 4U6YB 3VXRA 3S36L 4F7EB 2V2TB 5E2WL 2FLBT 5EOQH 3BPOC 3QJHB 3TO4A 3U9UA 1QLEL 1FNGA 1RZKL 1MCWW 3PL6D 2VO5A 3PQYD 1NAMA 3PWPD 4MJ5A 4W70A 5ENWA 2E9IA 1J8HD 4DGVH 4R97B 1QOKA 3G04B 3GSOB 4NHUB 3B83A 1ZVSB 5SV4A 1VENA 3AS1A 4P2OC 4X4YA 5KSBF 2NW3B 5I1LB 5LWYH 3OKKA 2YUXA 2Q86B 2FIKB 3G9VA 4LSUL 1AO7D 1FNLA 3ULVH 2ILLA 5EU7C 2AS5M 4NUJB 3N1MC 3KPOA 4M5ZH 2JJUA 3MGTA 1DDHB 5FHBH 4Z7UB 2UWEA 2WIIA 4IIQA 3FB6A 3OR6A 3PWLA 2EIZB 3C87A 3QI9D 3MRMA 3U9PH 4H26A 3T0EA 1XIWD 5JOEA 4G6AD 1FAIH 2H8PB 5CEZL 4Z7OF 4KWUA 5ALBH 2OCFD 1XCQB 3WXWL 5D72H 3HAEB 2UVEA 3ARBB 5KN5B 1RPQA 1PLGH 1JYWA 2BNRD 1Q94A 1E6OH 2LABA 4MD0B 3LHPL 1WTGT 1A2YA 2A83A 3OAUL 5IEKA 2YR3A 1UM4H 4JQXA 3CLFH 5IBTH 1CXFA 4YUEH 1L6XA 1JGUH 1U92A 5EO0B 3GJFA 1HH9A 3ZTJH 3KXFA 5EZIL 3NPZB 1MWAL 3DTXB 2V2TA 5MHSD 1BFTA 4UIKH 2PTTB 3HPLB 1A21A 4J3VA 3RY6A 3GI9H 2XIDA 1QACA 5DJYA 4LGRB 5HY9B 4H88H 1R5VB 2AERT 4EZMA 5J1TC 2CK0H 2CLZA 1OGAE 3RHWK 4LLWA 4LHQB 4U0QB 5EG6C 1WBYB 1YYML 4JO4L 5LGKA 2E3VA 1MIML 4GW1B 5I1LA 5HVWA 1Y0LA 5ACLA 1Q0XH 2CR3A 4MZ2A 2EDTA 4QOKA 1DEDA 1JPSL 2FIKA 4BUGA 5DD5H 2OR9L 1Z2KA 5IHUH 4ERSL 4P57B 3VWJB 1NFDA 5CJOH 5B3NA 4TNVF 1G7HB 1A0QH 2KZWA 4NUJA 1SM3H 4F9PC 1A7NH 3JV6A 1LQSR 3VI3E 3RBGA 5HI3D 3UYOD 4WHYG 2D9CA 3TJHC 4R2GD 5C07D 3UO1H 3KPSA 3DMMD 3FCTB 4JFYA 2HH0H 2YKLH 4HT1L 5EIQA 4NQDD 5JR1H 5C71A 4RGMB 5AYQA 1AR1C 3QUZD 3KPPB 4XBPB 1T4KB 1BLNB 3QIUD 5FECB 1NMAH 2ICEA 5BRZE 4ZD3L 5KN5A 4JO3H 5HHMD 3MLRL 4L4JA 4MD0A 4LAQH 4FQPA 4HAGA 5IT2L 3QULA 3ALXA 1BBJA 2ZCLH 4R0LB 1JTOA 5FYKU 1IEBB 4U7SA 4DUWA 4TULL 3DVNA 2FATL 5KW9L 1AI1L 5I76B 5EO0A 4LLDA 3Q48A 1ZLUH 5KAQG 3GMRB 4P99A 2X9WA 3G5ZB 1H3XA 5C0DB 5L6YH 2APFA 2ZUUA 1UG9A 5B3JF 5F72S 5JIKA 3V0VA 1EVTC 4EDWL 4CN6A 2DQCL 4JPVH 2DQEL 1JNNL 3TCLA 3MPCA 4LFHD 1U3YA 1ZWIA 4N8VG 4GW1A 3DUHA 4I0PB 1GIGL 4XNZB 5ICZB 3FQRA 3RBSA 3RY5A 1ZHBA 4P57A 1RZGA 3NFNA 4LASL 2EXYC 4UNUA 4GAYB 4I13B 4JRYA 3SO3C 4ZOEA 5DRZB 1G7QB 4X9HA 4GRLD 2PETA 1CL7L 4GKSB 1NPUA 2BVTA 5FOBB 2QSCH 1QFUH 4O2CA 5LGHH 5K33A 5IFJA 1IILE 2HRPL 4Y16D 3QH3B 2QQKL 3OKMA 1TVHA 3U7WH 3RDTC 3LKNB 3HRZA 1TTFA 1VA9A 4G9FE 5ADPH 4XBPA 2AEQL 5FECA 4X6BB 3MUGA 3HR6A 5DEGB 2XWJB 1OAKL 3WO4C 2O5ZL 1Q72L 4XH2B 4XCFL 2A6IB 1I1YB 4WW2F 3RWIA 1TETH 3R1GL 4H8WH 3S6CA 1RY7B 2BC4A 3MRFB 5I76A 4UU9B 3OF6D 4PP1D 1IKFL 3ET9F 1Z3GH 1J5OH 1HHHA 3BIBX 5DQDH 3G5ZA 4KVCH 5C0DA 2NXYD 2WQ8A 1YNKL 4EJ1C 3JWDL 5KSUB 3QP3A 4YHYB 3EW3B 5GGUB 5SWZE 5AZ2L 3VXOB 4HDIB 1DEEB 1UKSA 5FYKE 5TE6H 4OBSA 4YHZH 2AJSH 8FABB 2C7UB 3VGBA 2J5LB 3H7LA 5DRXB 1MWAA 3TNMB 3CU7A 2NCMA 3BD5A 2GJZB 3DBXB 4K3GA 1DVFB 5F89B 4XZUB 2B0SH 1S7RA 3AREC 4LLAA 3L5XL 3MRRA 3RWDB 1F6AB 4GAYA 4OLUH 3U48A 4K55A 5IOPA 2F54D 3TA3C 4GKSA 4YHKH 4B53A 3V5DA 5D9SA 4RAUB 3DRTB 3QH3A 2XTJE 4OM0H 2VLKA 3TZVA 4KRMB 4Y5YA 4L4VA 2J8UA 2JK5B 1F2QA 1EDQA 2OTPA 2OJZL 2Y36H 2FB4H 2NY7H 1BVKB 4DOHB 4XPTL 5J56B 4POZD 2XN9D 3A6CL 4Q6IB 1FZOB 1JGLH 2B1AH 2UZIL 1EEQA 5IHZA 5MEQB 4XH2A 4WWKA 1MCOL 3CVIL 1BZ9A 3DX8A 1I85A 1AXTH 1T6VN 3MRFA 5FCSH 2BRRH 2W60A 3OTTA 2Y07H 3BOVA 3TEUA 2ZZUT 4Y1AD 1HINH 2WMPA 1RZIA 4WGWB 3FFCA 5DRNA 2XKUA 4KAQL 3Q5TA 2OK0L 3DURB 2OXGA 1JBJA 3GUTB 1WC7B 1CFNA 1FVEB 5HDBE 2LAAA 1PBYA 3QFJB 3VXOA 5EUOE 4LLUB 1DEEA 1U8NA 5FOJA 3JTSB 2EKSB 1HYRC 3D87B 4G8GB 4FQXD 1HILA 1F3RB 2C7UA 4XVSH 3B5TA 2VLMD 5F96H 4NRXA 3DBXA 2F8XC 1Q9KB 4U4BA 5F89A 2GCYB 1YY9D 4XZUA 4F9LA 3N1FC 3VMNA 3RWDA 4MA3A 4TTDC 1T5XB 2AXJA 3RTQC 4NRZA 1RJYB 4TPRH 1F4XH 1UQSA 3RVUC 1VFBB 4N8CL 3DRTA 1OARH 3CX5J 2E6QA 3NCCB 4U49A 3IDGB 4MNQD 1Q9LB 3WKMH 5ITBL 2JCCE 4U1JB 3GRWL 1WIOA 3U0TB 4Q6IA 3BP7B 1CBVL 1KCSH 1C5BH 2OTWA 5IM7A 5MEQA 4MB4A 4RMSA 4GW5B 3G6JE 3H9YA 4OB5H 1BJ1J 3CUPB 1JI1A 4L4TA 4UTAL 1S7XA 1OTUC 4KVNL 4UTBL 3E3QC 4XCCH 4MXQD 1YMMB 1CDHA 2V9TA 1G7LA 2H26B 2NY2C 3L5IA 4RNRA 3A6OA 4KK5C 5FCUL 4XGZB 5HHOE 1J12A 3T4YA 1KTLA 4U6TA 3IRZA 5E8DL 1AHWC 4Z7QF 3VD3A 9CGTA 5IHBA 3QQ9D 3OKYA 1GHFL 3PWPE 3PQYE 4QTIH 4OCNC 1MIEL 1CICD 5KS9B 3QFJA 2YHGA 4OD1L 4KK9C 4F57L 1ES0A 2XTLA 3S4SG 4JJ5B 3GHEH 1EFQA 2IFGA 1KPUB 1YPZE 2PO6B 4BK4A 1Z9MA 2DI7A 2I5YH 2IALB 4IRJC 2ZKHH 3CFDA 4IOFC 4LFHG 5CZKA 3VFMB 2V9RA 1AO7E 5J0BA 1JZ7A 2GCYA 4XNXL 4Z77B 2A6KB 2EDDA 1T5XA 4JHWL 4PJEA 4ZAKD 3SKJL 3IKKA 4WUUB 4ZTOH 3D85D 5FYLE 1A6UL 2LU4A 1SY6H 3I02A 1VFBA 5F9AC 2DTSA 3GMOB 4I77H 3AVEA 1S9XB 5F93C 2XKNB 1IZJA 3VFTA 5IMMA 5L8LB 2GSIB 1ZANL 4H0HB 2UV3A 3BIKA 4PJFE 2R39A 5T5NF 5JMOC 3FO9A 5EOQL 4KI1A 1X6LA 2P4AB 3RWEB 5KVEH 4XNUL 4HFWB 1TJGH 4GT7A 3BP7A 2WBWB 4DGVL 5EC1A 1FC1A 1FVCB 4XCNB 4M6AA 5IUSA 5M94B 1HIMH 4HZAA 4GW5A 4JKPH 1C5CH 3CVHL 4WI7A 3CUPA 4DKAA 3NZ8B 3QAZC 5T3ZD 3VXMD 1YMMA 1U8MB 2H26A 4G6FB 1O5DT 5DUBB 3QDHA 4NM8L 3QUKB 5FHBL 3OSKA 2VZOA 5J11C 1WUNT 4HWEL 1RHHA 1Y6KR 5I66A 5JZ7D 1WLHA 1ZA6A 1OY3B 1NC2B 3UTSA 2R0KH 2CH8A 3PWNB 5AZEH 3QXDA 3U9PL 1V3JA 1FAKT 4LPTA 3V6ZB 1OL0A 3PDGA 4PLKD 1MEXH 2W07A 4UQ3B 1B90A 1LE9B 4JLRA 1T5WA 1KPUA 4NBZB 3RX7A 5DJDA 4JM2C 1FNEB 3VFMA 2AXFB 2H3NA 3RVXC 4X6CB 1BD2D 2W1NA 3U7YL 5GGRA 4QY8A 2A6KA 4Z77A 3JV0A 1XH3B 1E6OL 3ARGB 4LBEA 4EXKA 2JELH 1KNOA 4E41B 4M1GL 2P5EA 4LSDA 4QT5A 3GMQB 3N1QC 1IVLA 4OLZH 1JF5A 1UM4L 4OD2A 5I71B 2GQHA 3CLFL 3P2TA 5FHAH 4YUEL 3GMOA 2WW8A 2GTWB 2OM5A 4GAJL 2IH1B 5DGRA 1PKQB 4IS6B 1X7QB 4NQDE 1DBKL 5C0RL 3H9SD 3LQZB 1N4XH 3BE1H 5DJAA 4I8DA 1WZKA 4RMQA 3EFFB 1CG9A 1SVZA 3D1MC 2PYFB 3GI9L 3MLVL 4U0RC 1KT2B 1T20B 1S7TA 3K46A 3VRLF 3P3YA 5DSCA 4PLOB 1F02I 4PJCF 1U3HC 4XCNA 4H88L 3ZDXE 5HHME 5C09E 2CK0L 2NY5L 3I6KB 3OKEB 5J1AA 3V4PH 5ERWB 3VE0A 1OPGH 2RJMA 5FDYA 3QRFM 4RRPG 3ARFB 2NY4D 4GBXD 4PY7B 5DJZA 4XMKH 4O02H 3LB6C 1U8MA 4D0BA 3O2WH 1MCRA 1I1FB 4QRPB 4RDQG 3RZCB 5EOCJ 1QSVA 1A0QL 3M1BB 3E6FB 1SM3L 2XT1B 2HT2D 3QUKA 4JE4B 4Z8FL 1ZSDA 4IDJH 1S7VA 1T7ZA 3QJFB 1A7NL 2FECL 3L3JA 5EO1B 2BRQA 4JRXA 3CVHB 3S37H 1TIUA 1G7IA 2Q3AA 4F58H 5T3ZH 3UO1L 3N9GL 4UQ3A 2NYYD 2HH0L 3V6BR 1LE9A 2YKLL 3T2PA 5HSFA 5C0IB 2XKSA 3UXFA 4WVRA 5AWNL 4NUGH 1AC0A 4ZO8A 1LK3H 4FQJH 4MJIE 4HIJA 1FNEA 1UXWA 1RJCA 1EV2E 2VXSH 5HVHC 2MWCA 3PJSA 4X6CA 1IM3B 3HLAB 4JO3L 4ZNEE 3CXHJ 5E6ZA 1N0XH 3ARGA 2HFFA 4EI5D 4E41A 4LAQL 3U4EA 1OCWH 4LSVH 2GJ6E 4MQ7B 5SWSD 3ALPA 4P3CH 2NY3B 3TIDA 3AGVA 3QPXL 1K9TA 2EYTA 2CR6A 5ETUB 1PZUB 1ED3B 1X7QA 3HA0A 1F58L 3D6GA 1FPTH 2XXCB 1N5AB 3QB7C 4DAGL 3SBWC 1ZLUK 1TZIB 3O2VH 1T20A 2WWKT 3E1F1 2OMBA 3P40A 4MA8L 5BO1H 1BQHB 2YUWA 1Q0YH 4U1IB 1L4IA 1F6LL 4LHUD 5E1AA 2Q8BH 3I6KA 3OKEA 2F74B 2DWEA 3P4OB 4UV4L 5D6DA 2FZ3B 5EBGA 3VWKC 3E0GA 3ARFA 1KLGB 4PY7A 3IRPX 3LKSA 5HYJE 4CVUA 2YA2A 4HCRH 3W5NA 2I60H 1I1FA 1F3DH 4OGAC 2NNAB 3N50A 4YLQT 4JHZA 3M1BA 3E6FA 4PJXE 4P59H 4YJZL 5IVXB 4NQXB 4XP1H 2DN7A 5EO1A 2QSCL 1QFUL 2VAJA 5EU5B 4OCSH 5JW4M 5LGHL 4XC1L 4RA3A 4GG6E 4EN3D 3FAWA 4F7TB 4Z7VF 1D5MA 2HFEB 4PUBH 2AJYH 2AAVA 2HLAB 3QO1A 4QO1A 1WF5A 4EUPB 5C0IA 1Q1JH 2RIKA 3SGJA 3STZB 1DE4B 1A4JA 1OF2B 2NX5B 3FQTB 3SCMD 1XF3B 1ZXQA 1RZJH 2AXGA 2HTLD 3KPMA 3LPWA 1IM3A 4H5SB 3HG1D 2UYLB 3IDUA 1LEGA 1LVEA 4KTDL 2WLYA 3DXAA 3EYSH 1JWUB 3DYPA 1CD8A 2WBJC 4NKMB 5EIIB 5K59E 1NCBH 3O9WB 2E6PA 3K8KA 4M1DH 1R3JA 5FIEA 2EDOA 1NMCC 4MMZC 4QGTA 4CJ0A 2NMSA 1MCKA 4NFBA 4I18B 1Z3GL 1J5OL 4N0CD 2ZG3A 4KVCL 5GGQL 1TZGH 5EBLA 4HMDA 1B0WA 3MNWB 2P48B 4JKKA 4P2CG 2D7MA 4F33B 5EA0H 1UJ3C 4PBXA 2F74A 3OHXB 4ODWB 3P4OA 2C3GA 5TE6L 2FZ3A 3WE6A 2AJSL 4HULB 2BVQA 5D7SL 2R4RL 4ELMF 4KXZI 25C8H 2WZPD 4NJAH 5IEHA 3TO2B 3WNNA 4YHNA 3RIAK 2QSVA 4CVXA 2VDLH 3O41B 3MO1A 1P4LB 2GI7A 4Z7WF 3MV7D 1XZ0B 4KKLD 4A2LA 5IVXA 5K9QG 1QBLH 2ZJSL 4NFCA 5L88H 1O7VA 4DZBA 2XY1A 1JGVH 5FM4A 3S37X 3ZE2F 2WQRA 3QUXC 4OM0L 1EO5A 1Y6NR 1XGRB 4LKCA 2HFEA 3U0WL 1KB9J 2Y36L 4WUKH 3STZA 3FQTA 1P7KA 2NX5A 3UZQA 1XF3A 1HNGA 3ARUA 3W11D 5TQ2H 5HI4D 3ZKQD 3BPOB 1K2DB 4NN6B 4OSUH 4YR6B 2B1AL 5I0ZA 1V05A 1TCRA 1GXEA 1MAJA 5JW4R 3ZKNC 3VXSB 3FT2B 3HC3H 3HFMH 1ONQB 1FIGL 4Z7NF 1D5BA 4NKMA 4GKOA 5INCA 3ZYZA 5D4QA 3KPLB 2F5BH 3X3FH 4X7EC 2Y07L 5ELIA 1QBMH 5DJ6A 1DFBH 2VC2H 4LNRB 3IS1X 3QI9A 2DJ4A 4XPFL 2XTJC 4BH8A 1HSAA 3MNWA 1TENA 2A0LC 2KQMA 1XIWA 4F33A 1PQZB 3OBAA 1KB5L 2ED7A 5JW5B 1UXSA 4U6XB 4XVSL 4JFEB 4KTYA 1A8JH 1VEPA 4PIRF 3HI6H 5F96L 1I3GL 4P23D 3FT4B 3CDGB 4YDKL 2BNRA 3O41A 3IKCB 2APBA 4LCCA 3HPJB 2VLJB 2O5XL 3FZUD 2X2YA 5BS0B 1XZ0A 3H3KA 3RGHA 4ETYA 5KOMC 4GMSL 2DM4A 2BXYA 2YK1H 4TPRL 1F4XL 1X9QA 1A1MA 1JL8A 3CC5B 1KJ2B 2QQNL 1JUFB 4Y4KC 2F15A 1BBDH 2QADD 3SN6N 4D0DB 2OSLB 3QEUA 1NCWH 3QCUH 4FN0A 1JHLH 4WO4C 1OAXH 3WKNA 3LSOB 3WKML 3KLHD 3UYPA 1AH1A 5I8KL 3BZEA 4JQVC 3ROOB 1FL5A 2ED8A 1C5BL 2H6PB 3BKCH 1MFAL 4RSVA 4MLSA 3ARXA 5DI8B 5F7MC 2W92A 4BQ8A 4V1DD 2P5WB 1FYTD 3BP4B 4UV7L 2XYCA 2F5AL 2H32B 1T0NA 2J3SA 3HI5L 5EC2B 4XWOC 4CW1A 1C08B 1MJ7H 4J8RB 2AK1L 4LPCA 2WSKA 2A1WL 4LCYB 4RFNC 4N1EA 5D7JD 3IAPA 5JLZA 5C07A 2GAZA 3DMMA 4ZO6A 4QTIL 3ZDZF 3O3EB 1WZ1H 1HKLH 4MAUL 3MLPA 4DVRH 1ZT1A 4HMEA 3MV01 5C0AE 4OI9A 1P4IH 1X4YA 3QUZA 4KUCD 5I1KH 1PX4A 3VI4F 3DX6B 3NFSL 1PDKA 3QIUA 4JFEA 1QFPA 1I1AD 3DRQB 4MCYA 2I5YL 4LHUG 5IJVA 5KSBE 1FE8L 4WIQA 3LKQB 3K1KC 3KWWA 5K9QI 3SJVD 5GRVL 3FB7B 2VNCA 3HPJA 2H1PH 5IROA 4HS6A 1IJ9A 4ENED 4YXKH 1CIDA 1KB5B 4ZTOL 5GRVK 3BN9D 4URTB 4S1SL 1HQ4B 1V3LA 4JR9H 4RFEB 3VXUB 3KPQA 5DT1H 2IADB 4TUKL 3FOMA 3W2DH 4D0DA 2VUYA 4OIIL 4X5LA 4MXWH 5ISZE 3PL6C 3DLQR 3LSOA 2Z91B 5TE4H 3ZHDA 5KVEL 2XQYK 3D39B 1TJGL 3ROOA 3MLXL 4Y5XC 4GAFB 4PD4K 3IGAA 43C9B 2L0DA 2H6PA 3ETBF 4X99A 4Z7OE 3F7RA 5EU6D 1KYOK 5DI8A 1UWXH 5DYOB 1HIML 4N8PA 4JKPL 3O4LE 1C5CL 1ZVHA 5F97E 1IBGH 4N0YH 3UTTB 3TYFA 1LE5A 5EC2A 4YFEA 4JZOB 1ZA3B 1U8HA 1YN6B 1CTNA 3REWA 1A7OH 4GRLA 4KJPC 3L3IA 4PJ9D 4QRUA 5T1KB 2ESVB 4KRLB 1JP5A 4Y0GA 3STLB 1IAIM 5JPMA 1CLZL 4LSQH 2AKRB 1WJ3A 3GI8H 3UCRA 5AZEL 3QHTC 1WT5A 3O3EA 4G6AC 1XFPA 4QRRB 1KLUA 5ICXB 4OZGF 4IHOA 4WFFD 5GGVH 3V6OA 4B7IA 5CBAB 1MEXL 2ZUSA 5GZNC 3RA7H 3DX6A 3RDTB 3KNBA 1J8KA 4KJQD 2Z35A 3DRQA 2D03H 3X14A 5MEOA 3ARSA 3FB7A 4K7PH 2PYEB 3G6DL 4LGSB 4NQED 2DBLH 2JELL 5GRXG 2WUBH 4S2SA 4LEXL 1EEYA 4NZRH 3WO4B 1T80A 4QXWA 3OF6A 1MRDL 3NMEA 4I2XB 5FHAL 4XMPL 3ARDC 4I9WE 1OAYH 4RFEA 1BFVL 3RWCB 5K9KB 2I24N 1BVLB 1CLOH 2IGFH 2IADA 5HGGS 1EJ6A 1NH6A 4YIQA 3FTGA 5C0BE 5JQ6L 4LSRL 2BNQE 2GK0B 3BE1L 1OSPH 4G5ZL 3IDJB 5IKCA 2XICA 3Q2CA 4FQIL 4L3EB 4FFYH 2HFTA 4OJFL 1YNTB 2BXZA 1KPVB 4EBQH 5CCKL 4M61B 2HT4C 4S1QL 1FL6B 1KBGL 1ZV5A 2FX9L 5T1DL 3V4PL 1OPGL 3W0WB 3P4MB 1JNLH 5KTEH 1G9EA 3JVGC 2V7NB 3UP1A 3VFVA 2P8MB 3DHMA 3QEHB 1AGDB 4XMKL 1JRHL 4OCYL 3VW3H 5MENB 1X3DA 1YN6A 2IQ9H 3GMMB 2F54A 2PR4H 3AREB 5T1KA 3HRPA 1HHIB 5CEYA 3STLA 5J1SC 2YEZA 1BFOB 1LEKB 1RIHH 2Z92B 2RCSL 3JTTA 3LKRA 5I8CB 1HN1A 2YD6A 5KZCD 3ULSB 4U1HB 5ICXA 1XF2A 3IVKB 5SX5K 5CBAA 4ONHA 5T5FL 3O6KH 1A5FL 4U2ZA 4YDIL 3B2VL 4X4MA 3T08A 2XN9A 1A9EB 4LOUD 2ZSWB 3OKNA 2VSDA 3HNTH 3KR3L 4NUGL 2R0ZL 4HH8A 4NCC1 2DL2A 5DJ0B 4DW2L 2VXSL 3C8HA 4KQ3H 3T65A 3UPCA 4JY4A 1S78C 5CMAA 2JB5L 4YAQB 1N0XL 2ZUYA 1CWVA 3GSXB 1N6UA 3I9GH 4LSVL 5IR1A 4I2XA 1XMWA 4LRNL 4Y1AA 4P3CL 3RVVC 3WS3A 4P2QD 1L9NA 3BH8B 4PRIB 2DQTL 5K9KA 5TQ0H 4PGJA 3DIFA 3CDFA 3B9KD 5D70H 5CJXA 5DVNA 3WEXB 1FPTL 4NO0B 1I7ZB 3O11B 4C54A 2Z0BA 5CEXB 3O2VL 2YOCA 4L3EA 1MHHB 1SY6A 1YNTA 5FM5O 1KPVA 2P7TA 1CZ8H 4FQXA 4JB9H 4M61A 1FH5H 3PHSA 3TT3H 1UENA 1EMTH 2Q8BL 3KLAA 4C56E 1FL6A 1LP9B 3P9MA 1AD9A 2DM3A 3P0VH 3ILPA 1GPOH 3GK8L 3QEHA 4PJGB 4PJIF 1AGDA 5JA9A 5E8OB 5FO9A 1EEZB 1RUMH 5ID0A 5MENA 2NR6C 1PEWA 4FTVB 1KPRB 3BFOA 1HEZB 3HUJB 3LZFL 1DBMH 3WFEH 4Y16C 4XP1L 3SDAD 3RFZC 3RTQB 4M5YH 4LGPB 5I8CA 5JHDD 3ULSA 2VITB 2A9NH 4N1CA 2AJYL 3HE6D 1CN4A 1R3HA 1MLCA 5F71A 2P24A 1A9EA 1G1CA 2APTA 1FQ9C 4GXUM 3BAEL 4XCEA 1RZJL 4WCYL 4K7PX 5IW6A 4KKAC 1QVOA 2VLRE 1I3VA 3ULUD 4ZS6C 1JZ2A 1CGTA 3MV7E 4RZCB 3EYSL 5FGCB 5I30L 3Q5OA 4PP1C 4NRYA 3L3HB 1J1OL 3FL7A 4M1DL 4U33A 1YC8A 3EJYD 1N7MH 2DICA 3L3KA 3CK0H 1WFNA 2BOCB 4EXPX 2NY2B 2EIEA 2UVFA 3BDBA 3OR7A 5IBLD 1DR9A 1NLBH 3BP5B 3GMLB 2X4RA 1NC4D 4L5FL 1AHWB 3KDMA 3RWJB 3NAAL 5J8OA 2DLEA 1LP9A 5T5NG 1RUKH 3MJ9L 1QHOA 4JPKH 4YC2C 2QBWA 5DHVH 5F7WC 4NNYB 3UEZA 5HHPA 4OFPA 5DZNA 25C8L 3VD4A 3QDJD 3MACH 4PJGA 5CIPH 4ZFZB 4ZUVB 5ANMB 4ZAKA 3GSUA 3T0AA 4Q74A 3LPFA 4JFPA 1D9KD 1JNHB 3DVIA 2YPKA 4JANA 4PRNB 4WV1A 4LLVB 4R3SA 5EOCL 3MV9D 1JGVL 3RTQA 4WFGD 3D0VA 2XI9A 3PG2A 2XZZA 1F42A 3VGEA 3MLSL 2H41A 1HHJB 1AKJB 4D2NA 4U1NB 1NCDH 1OLLA 5K9OB 2DAVA 1EJOH 3KPRE 3UZVB 1E28B 5TQ2L 1ZT7B 3N0PB 5BXFB 4NOBA 4Z76A 5I2IB 4OSUL 3C60D 2Y5EA 1HQRB 3QWRD 5H94A 3ZE0F 5HGHB 1MI5B 3OG6B 3VXMA 3UPRB 3HC3L 4ISVB 1MCQA 4Y4FD 4UOJA 5FKAB 4M62H 3BW9B 1NMBH 2EDXA 5D1ZD 2F5BL 4Y88A 3BKYH 4AMKL 1IT9H 1QBML 1GC1H 4HBCL 1I4FB 5D7LD 1RI8A 4A2MA 4U6HB 3CCHB 4G3YL 4YO0A 5FAAA 1I7UB 4U3HA 3GMLA 5E6ID 3ULUH 5HI5C 1I7TA 5J11B 1F4YL 5C8JB 3DROB 4UDTB 3MQIA 3RWJA 3QEQE 5JA8B 1MCDA