The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
46
|
sequence length |
220
|
structure length |
214
|
Chain Sequence |
QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMSVGWIRQPSGLEWLAHIWWDDDKYYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARRTTTADYFAYWGQGTTLTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Immune system
|
| source organism |
Mus musculus
|
| publication title |
Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
pubmed doi rcsb |
| molecule keywords |
12A11 FAB antibody light chain
|
| total genus |
46
|
| structure length |
214
|
| sequence length |
220
|
| ec nomenclature | |
| pdb deposition date | 2009-07-24 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins | ||
| Mainly Beta | Sandwich | Immunoglobulin-like | Immunoglobulins |
