3IFLH

X-ray structure of amyloid beta peptide:antibody (abeta1-7:12a11) complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
214
Chain Sequence
b'QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMSVGWIRQPSGLEWLAHIWWDDDKYYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARRTTTADYFAYWGQGTTLTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
pubmed doi rcsb
molecule keywords 12A11 FAB antibody light chain
source organism Mus musculus
molecule tags Immune system
total genus 46
structure length 214
sequence length 220
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iflH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iflH01
4PJAB 2VLRB 2AJVH 5IEKB 3GUTB 4K3DL 4MJ5A 5J7CC 1XGPA 3OXSB 3V5KA 1CXLA 5D5MF 3PL6D 4P5MB 3L1OL 3PV6B 4H5SB 2R9HD 3C60A 3FB5A 3GBNL 2MPAL 1XR9B 2IANE 1J8HA 1N64L 4Z7QE 3FT4A 1KB5B 1RK0B 1T5XA 3QNYA 4OLZH 5C0CD 2J8HA 4XGZA 1ZHNB 3C8HA 1ZA3B 3ZYZA 3MGTA 2ITCB 3OKYA 3UTTD 1RZIA 1TVDA 5FUCC 4F7EB 5I71C 3M1BA 3TC9A 2J88H 5TQ0H 5IB2B 5GRZA 4JY5H 4ENEC 1XGRA 1P2CA 3GK8H 4LLMA 1YNKH 3AMLA 4M4RA 3LKSA 1RAMA 1UJ3A 3JSSA 2VDRL 3ARSA 1S3KL 1EVUA 2B5IB 3C8KB 3QPQD 5J4MA 3F58H 4XP1H 1IGJB 2A83B 2IPTL 3VXRA 3TBWB 3VW3L 3S8WA 2Z92B 3QUYD 1I1FB 1T1YB 3U4EA 4OT1H 4FQCL 4Z7WB 4WEBH 4NNYB 2XIDA 1UZ8B 1K9TA 5EZJA 1JRHL 1CFTA 4WWKD 1JHTA 4HIJB 1T80A 3S5LA 4OGXH 3KWWB 4QXUL 5D7IF 3FONB 5DJAA 5C7XH 4XWGH 2ZSVA 1OAKL 3ALXA 2DN7A 1YDPA 3V5HB 4X6BB 4AEIH 4ELKB 3K8LA 4P49A 5MEPA 1U3HD 3HUJE 3VFVA 1V7NH 5L88H 3RX7A 3U0WH 3BDBA 3WNNA 1CFNB 3VWKA 2W60A 4TN9A 1I8KB 2NZIA 5I1HH 3TF7C 2XA3A 4IOFD 1H3WM 2YK1H 2HH0L 4WFFD 1ND0A 1OP9A 3D85A 3GDBA 5HHOD 4LCCB 4MCYA 3DXAA 4XCFL 4NDMA 2JB6A 3MOAL 3TN0B 5DQ9B 2YA0A 3V6OA 5DD5L 4QRUA 3MJ7A 5I66A 2FL5A 2AV1B 1VACA 4ELME 1LO4H 3JWDL 2OXGA 2HT4D 4UNUA 3ARRA 3SQOL 1EHLL 5IF0A 3PF2A 4ZXBB 1JPSH 1MLCA 3BEWB 4QRSB 5INCB 1AFVH 3BT2H 3F7QA 3H0TA 4OLWH 5DJ2A 1X7QA 3U79A 1AXTL 3KJ6H 5CAYB 1LO3H 5D7JA 3QNZA 4KXZH 5CJXA 1R0AH 4NQCE 1G9EA 1S7UB 2AXFA 2RJMA 4H20H 3QA3B 5D2LE 3P9LB 5BW7C 3DUUB 2IALA 3KGRA 2PXYA 4LSRL 5CJOH 5DRZB 3B8SA 3BKMH 4CL7A 2XA8H 1Y18B 5JA8B 1YN7A 1MJ8L 4OZHF 1BBJA 1IGTA 3PHQA 5EU3A 2VLJE 1EHNA 3KPRD 1EAJA 3BHBA 1QD0A 1ZT1A 1GVIA 4JHWL 4X5XB 5SWSD 4EDXA 2G60H 1I85C 1S7XA 1ZWIA 4RAUB 4JPKH 4A2LA 5IG7A 1FG2A 2OJZL 1T1XB 1U58A 4P4RB 3CFKB 1QSEA 3X3FH 1JYVA 2AK4D 4RSVA 4RMUA 1TZGH 3B2VH 3ZTJG 5DA4A 3ZT6A 3IXTB 4G9DB 2R1XB 3MNZB 2JCCA 5EU6B 2VMFA 1RUPL 3WFZA 5MI0C 3DMMD 3RVVC 5FXCH 1VFAB 4LAQH 4J4PD 1IKNA 1BFVH 1I7UB 3U4BL 3BPCB 4KZEL 5ESQA 3EGSB 4Z18A 5B8CA 3GI8H 1PKQB 3SDAA 3MA7B 3SDDC 3H9SB 2A2QT 1FLRL 4Y4FD 5ESVB 1X5KA 3G9AB 4JDVB 1G7PB 1QFWH 4PR5B 4PJGB 5KSBF 3KPMB 4MMXC 4Z7UF 4OFYA 5F7UA 2BCKB 4QOKA 1X5IA 5F97E 2DWDA 1IKFL 4K9EC 2AGJL 1H3GA 4KY1H 4OLEA 1KC5L 3DURA 1JE6A 1TTUA 2J2ZA 3EKCA 5IEHB 5T5NF 3GRWL 5CEZH 5T3XH 3VDBA 1NBYA 3DGGA 3V5DA 3PL6B 3VFNB 5F3BB 1KCUH 1UH4A 5FDWB 3C2AH 1HHGB 2BHUA 3OR7A 3LS5L 2P5WA 2CGRL 3QDGB 5ICXB 1AGCA 4Y4KD 3F7YA 3G6JA 4JZJC 1W0VB 4QHLA 4LPTA 4NQXB 1O0VA 1HCFX 3OG6B 2A0LD 4K7PH 3F8UB 2CKBH 2W92A 1NCBL 1T7WA 2EEBA 1K8DA 4HUWB 4O58H 4JPVH 1N3NA 3UBXB 3HE6B 5IBTL 4LLUA 3HAEG 1CICB 2EIZB 2VN7A 4U1NA 1MJ7L 3VE0B 2KQMA 2OI9B 5TF1H 1IQDA 2G9HB 3B3IB 3ECBB 4I3RL 1W72H 3B9EA 2V2WB 5FV2A 3WXWL 4YHLH 2XACC 1B6UA 2DB8A 1WC7B 1FC2D 4AZ8A 1AKJA 1QLRB 1BECA 4JDTL 5C07D 5FK9B 5ACMA 4HPOL 2Y06L 2Y36H 4MDJA 4XVJH 1AE6H 4G8FB 1MRCL 5GS0D 5K9JL 1ZHBB 2DM3A 2XN9E 1BD2D 5DC4B 4I18B 1ZANL 5BJTB 1F8TH 3AS0A 5HHXH 3CDGB 1UVQB 5EG6C 2DM4A 2QSCH 3WJJA 1FL6A 3S4SA 2FYYB 3HZMB 1ES0A 3JZ7A 3VXUD 4ZOCA 1DBBL 5CINL 2ZKHL 3IDNB 3QXUA 1YQVH 4M7JH 1VERA 5DMGC 3WCYA 4YO0B 1NBQA 1EJ6A 1QYGH 3C6LB 3W9DB 4YXLL 1B2WL 4OM1L 5JW4M 2R4SH 3F5WB 3W0WA 1JFQL 1CGWA 4RIRB 5I1EL 2GKIA 4E42B 1CGVA 2V7HA 1JZ7A 3IGAB 2ZUWA 4YDIL 5IHUL 5DJXB 4L4TB 3BH9B 3DO7B 2GUOB 1KCRL 1MRDH 3GSWA 1G9MH 3RWIB 4WCYH 2FR4B 5BQ7A 1Q8MA 3AMKA 4LLQA 1CN4A 1F3DH 5D1ZB 4YZFF 1IM9B 2FECI 1U6AL 3T0ED 2X4TA 4HWZA 5FECB 4ZPVA 3MR9A 2OX5A 3TO4A 4J3VA 1JWSA 5EOCH 5HBBA 4R97C 1A22B 1TIUA 3AB0C 3BDYH 4G8GD 5C0BA 1FSKB 4K3GA 4AK1A 3P4MB 4R0LC 5E2TH 1EFQA 5EFIA 5C92A 1MFNA 1KPRA 3MRDA 3RX8A 1WICA 1CDCA 5AD0B 2DI9A 5MP6L 4QRRB 4LVNB 4NCDA 2MQ0A 2B4CL 2EH7H 5BS0D 2EDNA 4KK8D 4R7DB 3SGDI 4F2MB 1P53A 1UB5A 3FQRA 3ILPA 5KVMC 4NO0B 4PJXB 3VXMD 4X0KA 3WFCH 4H0IA 2BSSA 2Q7NA 1UM5H 1PG7W 1OAXL 1BIHA 4MQTB 4UZGA 4DVBB 3WLWC 1G7HA 3KPRB 4JLRB 2VDMH 5ITFB 3UTZA 4NKIH 1UJTA 1MHEB 4ONGH 3I3BA 4ALAL 4WO4B 5E5UB 1I9JL 4PY8I 5BZDB 3CVHH 5T1MA 3FHAA 5C0AD 3L3IA 2E9WA 3G08A 4HK0A 3AGVA 1FORL 5C6TH 4KAQL 2X1WL 4HK3N 5D71L 1D9KA 5AYUH 4KDTC 3ZO0A 2EZ0C 1NFDF 5AZ2H 3X11A 1CU4L 1CWVA 1FVDB 4HMCA 4N8VA 3SJVE 2IF7A 4KRPC 5ITBH 4JKPL 3ULVE 3E6FA 5JHLL 4ZYKA 4Z5RB 2BXYA 2EYTA 3LD8C 2VQ1B 4KK5D 4NYLB 1ZKAA 5HHMD 1IAII 1PYWA 4E41B 4EDWH 3X12A 2MQ3A 1NCWH 5IBUB 1A6TA 1M71A 4PP2B 1V3KA 1S8DB 4LU5L 5EIVA 2BFVL 1BWWA 1NMCB 2DLFL 3PUCA 2E7LC 2DBLL 3DTXA 3ILQC 5D7KE 4XXDA 2VDQL 5FYJU 3PQYD 4G7VL 2HMIC 3QDJB 4Z6AT 1PQZB 1Z9OA 1FNFA 5D7SH 2YPLE 1UYWL 2VE6B 4ZFFA 5JIKA 5I1KH 1NMBL 1LK2A 2ATPA 4PJ7B 1WT5A 3CMGA 2CLZA 2IMNA 5CCKL 5EBWA 2NY2C 3CH1B 3HZVB 4PJAA 3CJJA 1V05A 3H3PH 2APWA 4L8SC 4PRAB 5IEKA 3BJ91 4M7KL 5IVNA 3GUTA 5KVFL 3C5ZD 1QBMH 2P47B 4P5MA 3PV6A 4CVZB 4H5SA 4GMTL 2OZ4L 2X1XR 2R39A 3QFJE 2Q6WB 1CVSC 4CJ1A 2W0FB 5L2KB 1CFQB 1JUFB 1YYLH 4YC2C 5SX4I 4JAMB 1KB5A 1KT2B 1RK0A 1S5HB 5KVEL 4P57B 4AYFA 1DQJA 2OP4L 2H6PB 2VDPH 3L5XL 1HKLH 5E1HB 1ZA3A 3REWB 5F7EL 2ITCA 1TXKA 5ACLA 3DRTB 4NBXB 2IFFL 5F7KC 2WBWB 2WQ8A 4DKEH 5C08E 4HXBH 2NXZC 3HR5B 4RZCB 5IB2A 4M3KB 5F8QC 2XRAH 2Y72A 5T33L 3LKQB 1WAAA 4XAWH 2VKWA 5IFHL 4LSUL 3GSXB 2BVUA 3C8KA 2Z8VC 1IGJA 2A83A 1TQCC 2X09A 1LO2L 3AU1B 4JHAH 1I3RB 3PGDB 3TBWA 2JJUA 1CQYA 2Z92A 3A0OA 3WSQH 1I1FA 1ADQL 2OJEB 4Z7WA 4GBXB 2EIBA 3DPBA 4L29B 3BZFB 4DOHB 4JFDB 4UTAL 1UZ8A 2HFGL 2GAZB 4UOW1 4S1DD 4O4YH 5IMOB 1IILE 3VFGH 5BRZB 4QRTB 2NY6B 3KWWA 2R29L 3I50H 3FONA 5HYIA 5C0FB 2AEPL 1KXQE 2EYRB 1L7TH 2HVKB 4LVOB 3V5HA 3GSQB 4X6BA 4ELKA 3BIAX 1KJVB 4OKDA 4JO2L 1H5BA 3O45B 1CFNA 2OBGA 4BUHA 3WO4C 1I8KA 5IKCA 5F7YC 4G8GB 15C8L 2C1OB 2PW1B 1U8PB 5C0JB 5JNYB 1CE1H 4X6CF 1DLHB 4JM2F 3TN0A 5JTWA 4X99B 5DQ9A 1U95B 2AV1A 3V8CA 4ODHL 3SE9H 2IGFH 2P24B 1RURH 3WYRA 4ZXBA 1T7VA 4MJ4A 1FPTL 2UWEF 1OSZB 4HJ0D 5INCA 2DYPB 4EBQL 4P2QB 2HFFB 5F3HB 4HS3B 3HNTH 3IYLW 3LPGA 4TTGA 2XZAH 4S1QL 4MQSB 4OLYH 3QDME 2ZG3A 3DV6A 5DMJB 1CIUA 1G7LB 3ZDYE 3DECA 4TRPH 4YHZH 3P9LA 4WHCA 3DUUA 1FRGH 2E6JA 3NFSH 5HI3D 2PTUA 3LQZB 5DRZA 2WINB 4OUUB 3P4NA 1BVKB 1D6VH 1QACA 1UA6H 5ADPL 4NUGH 3CVIH 4FABL 3RVVD 5GGVH 5E95B 4NZTH 3WE6B 1FO0H 4QGYA 1FZKB 1QRNB 2WBKA 4UILL 2YD9A 2VDLH 2QQQA 3SDDD 3H2WA 1J0ZA 3TCXA 1U2HA 3E3QC 4RAUA 1T2JA 4M6NL 1T1XA 5IMMB 4P4RA 3CFKA 5HHMB 4L5FL 3TESA 4NN5C 4CW1A 1P7HL 3ZE2E 1MCHA 2YPKB 3IXTA 2P8PA 4G9DA 4R26L 4OD2B 4Z7VF 2UV3A 2R1XA 2VDKH 5HYJA 5KS9B 3MNZA 5E2WL 4IMLB 1ZGLB 4ODWB 2R0LL 1VFAA 2PO6C 3MBXH 3MRCB 1I7UA 3BPCA 2DQUL 3EGSA 2QQNL 2OMBA 3H9SA 3L7EB 4K9EL 3BQUC 4KI1A 5ESVA 1G7PA 5F9OH 4PJGA 3KPMA 5I1IH 5TE4L 1XGUB 2BCKA 4FZ8L 1U8HA 4N9GB 2NTSP 4PRPB 1R5WB 1XF1A 2MHAB 1O7VA 4P23C 2Y07L 1YUHB 5IEHA 5F1IA 5H35B 2XWTB 3D3VB 5SWQB 3GSUB 4QO1A 5F3BA 3KYKH 3VFNA 5FDWA 4JQIH 2CPCA 1HHGA 4LSPL 1HZHL 3QDGA 5ICXA 3HCVB 3FO2B 2NQCA 1MI5E 2CRMA 4YDKH 5ISZA 4Q2ZB 4NQXA 1QBLL 4GKNB 3CX5J 1TZHA 1WCBA 3GKZA 1LK3H 4I3GA 1EUUA 1MCJA 4PJCF 2QR0B 2DQFB 3DX8B 3P0VH 3F65A 4HUWA 3MRQB 1OLLA 3UBXA 3HE6A 1MREH 1LQSR 1N7ML 1C5BL 3EJJX 4LHUB 2XTJD 1CICA 2EIZA 4OAWB 3VE0A 4XAKE 4M7LH 5FYJD 4DGYH 1LO0L 4KGJA 2G9HA 3B3IA 3ECBA 5JXEC 3CX2A 2V2WA 4HH8A 4FFVC 4POZD 5IWLA 1WC7A 1PG7L 1QLRA 1S9WB 4MHHI 3VDAA 4Y1AD 2W07A 1J0IA 5I8KL 3DX7B 2AXGA 2IEPA 3IDUA 4PJHF 4G8FA 5JDSB 5IR1B 1F4XH 4YX2H 1ZHBA 2R23B 3OJMB 5L8LB 2A73A 4I18A 3MMEB 5B39A 4LARL 4LIQL 3VI4E 1F5WA 4M1DL 3WFBH 5C6WH 5BJTA 5A16B 1MHPH 3ABZA 3S5LG 3CDGA 1UVQA 5GRJL 5BOPA 1DL7L 2FX9H 4E0RB 3CLEH 1DR9A 2JIXB 2W9DL 3IU4H 4R90L 3BUYB 3CSGA 3HZKB 5LXGL 3QO0B 3OXRB 4CN6A 2EXYD 3IU3B 3EUUA 3MRJA 4BFIB 3IDNA 1IM3B 4KJPD 3U9PL 4YO0A 2WP3O 5ILTL 1T1WB 3W9DA 4QRPD 1JTOA 4MHHG 4RIRA 1E6JL 2APFA 4J3WA 4E42A 4PJFF 3EJYC 3TZVB 3ESUF 1UM6L 2N7BA 3IGAA 5DJXA 1ZT4B 3BH9A 4L4TA 3IFNL 3K1KC 1CIDA 4OFPA 4I0CC 4WGWB 5CIPH 3GIZH 4OLXH 2W9LA 1OTSC 2QKIB 3K8KA 1IC4L 3RWIA 2FR4A 3BKCL 3IAPA 1PG7X 4KKNA 5D1ZA 4K94L 1IM9A 3BIKB 1IGFL 4KTDL 5FECA 4HUVA 4NQDE 5FEBA 2F53B 1RPQA 2XKUA 3KPSD 2I5YH 3NACL 2G5BB 4D0CB 3WLWD 3PWVB 5FYKE 5KW9H 3JUZA 3VFOA 3O11B 3GSVB 2AABL 4OKVB 5J57B 3DVNB 5AD0A 3EOAB 5LQBL 1EO8H 4QRRA 2C5DC 1A64A 4GLRH 1KENL 5CJQH 4P99A 4F2MA 4R7DA 3KPTA 5DD1H 4RQQB 1AQKH 4O5LL 1T83A 2C4FU 4NO0A 4PJXA 1QO3B 4H0GA 5MERB 5BZWB 5A2JH 3CMOL 1N4XL 2DIBA 5IVZB 4IJ3C 1LD9A 4KDWA 4HGWB 4DVBA 2VDNH 4JLRA 1I9RH 1RJLB 5ITFA 3WS3B 3MLUL 4LCIL 3FQWB 1MHEA 2RQ8A 4LGPB 4OZGE 3GI9L 4HUMB 4NJ9L 3SGJA 2XKSA 3JV4A 5KOMC 4HWEH 1CD1B 1T04B 3H42L 4XPTH 1B0GB 1H3VA 4WEMB 4L3AA 4ZTPH 4GXUN 2FX8L 1GGBH 4MNHB 5I1JH 3HNSL 4KROB 3Q5YA 4MS8C 5MENB 2DICA 1FFPB 2BERA 4XPHH 5DDHB 3DUSB 4PJIA 4LEXL 2FH6A 2C1PB 1NDMB 1PEWA 1F90L 5FDYA 1FVDA 4FTVB 4OGAD 3BRFA 2HMID 4OUOA 1MUJB 4DUXA 1H8OA 4W6XB 5DGRA 3RY6C 5GRXG 4Z5RA 3CZFB 1INQB 3PP4H 3GRWA 2VQ1A 4NYLA 5BMFH 1UQSB 3B4NA 4U1GC 5CEXA 4MAUL 3BWAB 4E41A 1KB5H 3O4LE 1G9NC 4UV7L 2YD2A 3STLA 1TLKA 1GZQB 2NY2D 3VI3E 4D94A 4XPAL 5ANME 2X5PA 1VFUA 4YNYB 5E00B 3QUKB 4QXWA 3TM6A 3CFCL 4KMLB 1GAFL 4OI8A 4NOBA 1TTFA 3U7WH 1EERB 1PQZA 4N1EA 4NKMB 3I9GL 3PP3H 1MY5A 2VE6A 3RPIA 1ZLWK 1T6WA 4M1GH 4PJ7A 5MEQB 5E6IB 3WHXB 2BHYA 4HHAB 5B3JF 3NGBC 3FB6B 4M5YH 1QP1A 2DI7A 3P11H 4HQQL 4OCWL 3VGFA 4EUPH 4NCC2 1T7XA 2FBJL 1OSPH 3LQAL 4FG6D 2OM5A 3RGVC 4PRAA 1CT8B 3MLXL 2NXZD 3O9WC 3CFEB 1K8IA 4CVZA 4TTDC 1II4E 1MCDA 1LILA 2Q6WA 2W0FA 2B39A 3RWHB 3T0WA 2KZ1B 4OZFB 4EXKA 5L2KA 1F42A 1CFQA 4P2RB 4J12A 1JUFA 1CI5A 3QEGL 1MAML 4JAMA 1KT2A 3FZUC 4GQ9L 4YDLC 1KBGH 4P57A 2H6PA 1U92A 2KZWA 3BD3A 3PXHA 5CEZE 5E94B 4MDIA 1DBMH 3K1DA 1IAMA 3M17B 3REWA 5C1MB 1JGVL 2XZQL 3DRTA 1ZAGA 1PZUB 5T5FL 1E4KA 4U1MA 4NP4H 3MLSL 1AR1C 4NWUL 3ARDD 4QWWC 1NL0L 4Q58C 3OAUL 3LKQA 3ARFD 2D31B 3LMJH 3QHFH 3MA9L 3S4SG 3MSPA 3P4LA 1DJSA 3GSXA 1AGDB 5CZVH 5TDPB 3OKEB 3MLTB 3KS0H 3ZHLA 3OWEA 1YEHH 1MFBL 3BZDA 1K3ZA 5ADOL 5DJ8B 5DZNA 1H15B 2OR7A 3AU1A 4IRZL 3PGDA 1Q94B 4R97B 2OJEA 2VTFA 5F8RC 4GBXA 4NQCD 4P59L 2O5ZL 4MNQB 12E8H 4JFDA 4R4ND 2XXCB 4LSDA 4PJDF 2GAZA 3VFWA 1SBBA 5IMOA 5BRZA 5DLMH 3TFKC 4KRMB 5C0FA 1CR9L 4DGVL 2EYRA 2HVKA 3SO3C 2DL9A 3LPFA 3MLZH 5JW4Q 3O2VH 2CUHA 1MCKA 3BP7B 2CQVA 5IM7B 3U7YL 1PZ5B 1P4IH 1KJVA 2VLJD 3E6HA 4XCEB 2FX7L 4JKLA 5DZLA 1DANT 1L7IH 2J4WH 5LBSL 2CDGB 4H88L 2C1OA 2PW1A 2VZOA 3RBGA 1U8PA 1Z5LB 5C0JA 5DRWB 4JREC 1E4WH 1YNTA 3L3GB 1KB9J 5DUBB 2IAMA 3FFCB 5BVJA 3O0RH 1U95A 4P9HH 3O2WH 1I1RA 1EBAA 4RGNB 3WXVH 2ZOKB 1FGNH 2X4SB 5DVLA 2P24A 2ZJSH 2XNAB 4MJIB 4U7KA 2DYPA 4P2QA 2ERJC 3H7LA 4HMEA 2LAGB 3MACL 5FIEA 4XXCC 4KRPB 5F3HA 4HS3A 3UTQA 2GFBB 3GGWB 3B2UC 5D7IA 3O6KL 3H3KA 4R9HA 2I9LB 1A7OL 2G5RA 5T3ZL 1CFSB 2DTSA 2I07B 3LD8B 4WTZA 1G7LA 3I3DA 3CC5B 4XB8A 2DI8A 2V7NB 3PP3K 1NUDA 4GQPH 2QADC 5J6GB 3RHWF 1TNNA 2LVCA 3LQZA 1F11B 3MRFB 3HMXL 2WINA 4OUUA 2VKXA 5DEGB 1BVKA 4N8VG 3SDXF 4ODTL 1FZKA 1QRNA 2E3VA 3A6OA 1FNAA 2GJ6B 4JGJA 2VSDA 2AJSH 3UC0L 4GH7B 1ULVA 5F7WC 3PDOA 3L9RB 5IMMA 2DQEL 3MJ9L 1V3LA 1QSFE 2NY1C 2ATKB 1F02I 3SOBL 4UV4L 2XG5A 4XI5C 4JM4H 1SJHB 4KJQC 4NM4L 2DD8L 4LPVA 2GT9B 4OQTL 2YPKA 1JI2A 4MVBD 4OD2A 4FQXA 4X6EB 5KS9A 4XC3L 4JPWL 1DTUA 4IMLA 1NLBH 1R24B 1S3KH 4ODWA 3MRCA 5KVDH 5KN5B 2VITB 4DQOL 3U46B 4LHQB 3S34H 2VYRE 5FYLL 5EU7E 4JJHA 3GSRB 4L3CB 3FRPA 1OL0A 5C0GB 3OKNB 4FQCH 4JN2B 5DHXB 4YC2B 2BVEA 4UDTB 2R0ZL 1N2RB 4PD4K 2XN9D 1XGUA 4YQXL 4Z7NF 4ORGB 4N9GA 1VPOH 1YEFH 1NAMA 4WI5A 4NQTA 5IGXH 1R5WA 3WNLA 4LRNL 1KG0B 2VLKB 4RNRB 2MHAA 1YUHA 5HGGS 3WIFB 4YXHH 2ZPKH 1EPFA 5H35A 2XWTA 3D3VA 4NZDA 3UZEA 1S9YA 1BFOB 1X44A 4KI5E 5TGBB 3LS4L 3FO2A 4OD1L 1SJXA 4TULH 4UINL 2EE2A 4GW5A 4Q2ZA 4YHNB 2E8ZA 1HILB 3O4OC 1FNSL 3Q1SL 4GKNA 4Y5YB 1TQCB 2D4FA 2FJFB 2HH0H 2DQFA 4P48A 3DX8A 4NFCA 3T4AB 2NTFB 4XCFH 4XNMB 4AEFA 5SV3A 3MOAH 3MRQA 4N5EC 3SBWC 3AS1A 5A2KH 4YAQB 4LHUA 1EHLH 4KV5E 3VXOB 2NYYD 4OAWA 2ZG2A 1QUNA 3LKPB 4ZUTB 5EZOL 2Y5TB 5I15L 1ADQA 2I26N 3UAJC 2PKDA 1ZEAH 4QF1B 1I4FB 3VXRE 1FIEA 4ZUVB 2YKLL 5D7LB 2ZUYA 5IJVB 1AXTH 1K4CB 1S9WA 3MTRA 4QTIL 1RUKH 1MNUH 1FDLL 2Y4SA 5FA3B 4LCYB 3DX7A 5FM8A 1P84J 2EDTA 2AEWA 5IR1A 1FBIL 3ALWA 3SKNB 1H0DB 3MMEA 3EJYD 2UYLB 5A16A 3MRIB 4RGOL 1JGLL 3HC4H 5I1LB 4NJAH 5IMKB 3NA9L 1GC1C 2R8SH 4E0RA 2JIXA 2C3VB 3BUYA 3HZKA 3RVUD 3CPLB 4LLVB 3QO0A 1U8MA 3OXRA 2NY0B 3IU3A 1I8IB 1CXKA 4D2NA 3EDDA 3WFDL 1IM3A 4KK6C 5IESL 2OJZH 1AD0B 1T1WA 3FHQA 5IB4B 5L7XH 1HH6B 4NC0B 4Q74A 1DFBH 4C4KO 3TZVA 2DQDH 3V6OE 1ZT4A 5GRVL 1RUPH 4XNQB 1UWXH 2QKIA 4TOYH 5BW7A 1HKFA 2WLZA 1BQSA 3BIKA 3UROR 3SJVD 4NZJA 4PB9L 5JPNB 2WV3A 1MPAH 4TVPE 3ULVD 4XVUC 2F53A 2NY4C 5E8NA 4XX1G 4KTEL 2G5BA 3V4UL 4D0CA 3PWVA 4X6DE 3O11A 3GSVA 4KVCH 3KLHD 3RY5A 4OKVA 25C8H 3C87A 1KC5H 5E2UL 5FHBH 1A1MA 3NCCB 4DKAA 3DVNA 1SY6H 4KMQA 4M6OH 5IMLB 4J3UA 4X9GA 5C2UB 1MCBA 1AP2B 2X40A 4NN5B 1KJ3L 4RQQA 5D7KD 4LFHG 4MS8D 1KTRL 2KH2B 4PYGA 2BSTB 3WLBA 4RFNC 5MERA 5IVZA 2W1NA 3NZ8A 2YPLD 5E1AB 4HGWA 4K07A 4QHKI 5GSRB 4JG0H 2PO6B 4PJBE 1R5VB 5FKAB 1RJLA 3BXNB 4UNTA 3LN5B 3WS3A 1DSFL 3FQWA 5HI5C 1QSEE 1HH9B 2D2OA 3BQUB 2NNAB 1R3IL 5MEOB 1CD1A 2ZCHH 3KAAA 3W5MA 1B0GA 1NBZB 3B9VA 2E6QA 1BZ7B 4HCRL 3T3ME 4BELD 2WUBH 1IVLA 3INUH 4MNHA 1BP3B 2FO1A 3MRKB 1CTOA 5MENA 2VQUA 4LP4A 4XPGH 1FFPA 5DDHA 5KZCD 2ARJQ 3QFJD 2C1PA 1NDMA 4P23B 4FTVA 3MLYL 3MRNB 2CK0H 3GJEB 4RX4D 2DDQH 4EI6B 3B6SB 1FN4A 3MZTA 2EE9A 1G9NL 2J8UF 3CZFA 1INQA 2APVA 1BAFH 1F45A 4QOKE 4PRHB 3RUGF 4MLIA 1UQSA 5DUML 1BJ8A 1MWAL 4G6FD 2RBLA 3BWAA 5CJBA 1YMME 4ZS6C 1TVBB 5E4IA 5C08D 3DHMA 3MUJA 3DBXB 3RGVD 1MCOL 2P45B 3GSNH 5KSVA 2DQTH 4YNYA 3QEHB 4JQVC 5E00A 2FEEI 5GS0H 3QUKA 4HZAA 1DBBH 2P5WE 3O9WD 4DW2H 5A43C 3S36L 2J1KA 4TTDD 4Y4HD 1AXSB 1U9KA 1DCLA 4NKMA 2E9IA 1JFQH 2GHWB 1G6VK 5MEQA 5E6IA 3TA3C 3WHXA 4HHAA 1FH5H 1T4KB 2PETA 3DYPA 4JFYB 1NJ9B 4KRLB 4U6VH 3UJTL 4O2FB 3BKJH 4M62L 3GNMH 3S96B 1NFDA 1KCRH 3BAEL 2YD3A 4R7NB 5KSAD 1KIPA 3ZDZF 2DKUA 1CT8A 4ZUSB 3CH8A 5CP3H 1IL1A 1AR1D 4Y5XC 5DK3A 3GMNB 3HG1D 4QWWD 2OS7A 3CFEA 3D18B 2CDFB 5JHDB 2HRLA 2W91A 2FATL 5ID0B 1MHHB 1CTNA 2HRPL 4P2RA 1WZ1L 3EYQD 5I9QC 5HPMA 3ARGB 1RVFL 5DJDB 3GJFH 3ZZ1A 4R3SB 4PJ9C 4V1DB 1UWXK 4RFOL 5F7DA 2ZCKL 4LPCA 4KXZI 3WJLC 2P7TA 5F6HI 3M17A 5AYQA 2Q86B 1FL3B 5B39G 5HGDB 1VA9A 4WI3A 2LVEA 2IG2L 4P4KC 3MOBL 4MQXD 4Y7MA 3S36X 2D0GA 2HJKB 3TFKD 4HJJH 4EOWL 2Q3AA 4NT6B 2FLBT 1AQDB 1AGDA 5TDPA 3OKEA 3EYFB 1U3ZA 3MLTA 5ERWB 2OL3L 3T09A 1VGEH 5DJ8A 3W0WE 5I30L 3MV01 4ALAH 1H15A 4B7LA 1Q94A 3HKFA 1F3JB 1YA5A 3QDMD 2XPGA 4MNQA 2BOBB 1FORH 3SY0B 3BN3B 3VFSA 4I4WB 5GJTH 3NIDE 2DQGL 4LGRB 4DAGL 4UT9L 1A9BB 2BRRL 1S7RB 2OTWB 2B20A 4GAFB 3QR2A 3NVQA 5IM7A 4HWNA 1WIUA 5JHLH 1PZ5A 2J12B 3ARVA 4ZPTB 2VSCA 4YFEA 1FG9C 2HN7B 5JR1L 3KXFA 1WQVT 5JQ6L 3OAZK 4XCEA 5C0BE 1SMAA 5FUOL 5FM5O 3WKNA 4BSVB 3MLWH 1VFBB 2IQ9L 4IJ3B 4TUKH 4A6YH 3QG7L 1QFWI 4HW6A 5KTEL 1IEAB 1FAIL 3RZCC 3QO1B 3Q6GH 2CDGA 1S9XB 3B2UD 3MBEC 3H8NA 1Z5LA 5DRWA 1KNOB 4FFZL 3RGHA 5CD5C 3L3GA 5DUBA 2DLFH 4KUZH 3FFCA 4CMHC 2DBLH 2VXVL 1J05B 4BH8B 2QADD 4LSTL 1IAOB 1OW0C 2X4SA 1XZ0A 3QQ9C 2XNAA 1CLOL 4MJIA 1NMBH 3GIVB 5C6PB 3WMSA 4MGXA 4RISL 3VRLF 2XG4A 2YSSB 2HVJB 1CZ8L 1IGML 3V6ZB 2I9LA 1LEKB 1CFSA 2I07A 1J87A 35C8L 3CC5A 3LN4B 4KKCC 1W2KT 3L95B 4NOFA 2V7NA 4LF3B 4XI5D 1J1OH 4GMTH 5DTFB 2OZ4H 2J5LB 3HMWL 4BZ2L 1EZVX 1F11A 2IH3B 1GZPB 3MRFA 3D69B 4GG6B 1I75A 1RULH 3CDCA 3WUZA 1MWAB 1J88A 1X5GA 4HS6B 2E7LA 3OAYH 5I1CL 1MI5D 3LZFH 4B53A 1SEBB 2GJ6A 3SKUD 1SJVA 1JPFB 4JM2A 4G43B 1GL4B 4DK6A 4XNZC 3L9RA 3O6ML 1V3JA 1UH3A 3PJSA 3TPUA 1D5BB 5IBUG 4WU5B 1ORQB 4WW2C 3U0TB 4ZFGL 5DC0A 3C60C 3PWLB 2UWEA 5T1KB 5ID1B 2GT9A 3RHWK 1A6UH 1DQDH 1DE4A 3GJFK 5DJCB 5D2NB 4X6EA 4NQSB 3NCBB 4XNXL 5K59E 5JXAH 1MFEL 1R24A 4CN1A 4ONOA 4KI5C 1I7ZB 1EGJH 1QKZL 5C8JB 3EYVB 5KN5A 4MJ2A 4P5TD 3TT3L 3U46A 1G7MB 1RFDL 2NXYD 3GSRA 4L3CA 4XMLL 5C0GA 4JN2A 2JB5L 2FJHB 4L4VB 1B4JL 1E4XH 4UDTA 1N0XH 2GSIB 3U82B 4G3YH 1N2RA 4YDLB 4PJAE 4JHBA 3HI6L 2ARWA 2VLRE 4JFHE 4ORGA 5DEZA 3PWUB 4ORZC 2K3TA 1UWGH 5GISL 2AEPH 1KG0A 5KANG 1UKTA 2VLKA 4RNRA 5K9OB 1ZV5A 3AFLA 5FM5M 3WIFA 1L6ZA 5E08L 4PS4L 5GZNC 3HG1B 4JFZL 1WGOA 2DQHH 1RV6X 43C9B 5GIRB 3UAJD 4Z7QF 2HKHH 4J8RB 5TGBA 3C09C 3JBG7 3V4PL 2X89A 5E8OB 5FOBB 4X9HA 4YHNA 3TV3L 1PY4A 1HILA 4AQ1B 3VCLB 4Y5YA 1N8ZB 4MSWB 2DMKA 2FJFA 3LY6A 2Z35B 3T4AA 4Z7VA 2NTFA 3SKJH 5I73B 1H3TA 2OL3B 3GHBL 1D3CA 1NANI 2UY7A 4EN3B 4YAQA 1WAAE 2DJUA 1G0DA 3MXVL 5F1KC 3VXOA 5H94B 3MUHL 3LKPA 2FHCA 1FJ1B 4ZUTA 1FPTH 2EO9A 4KWUA 4DZ8B 3AREB 4I0PD 4QF1A 1B4RA 4ZUVA 1NFIB 3O6FD 1Q9LB 2O26U 2X9XA 4NQDD 4UIKH 3O3AB 5D7LA 3VWKC 4DKDC 4EIGB 1K4CA 2X4OB 3LKOB 5KVGH 2B1HH 1Q9OB 5C0EB 1JHKH 4I77L 5FYKD 4S1QH 1UFUA 1TTGA 4Z7WE 4LCYA 4KPHL 3H6JA 5J11C 2VL5B 2H8PB 4XCNB 3SKNA 3V6OC 2F74B 1H0DA 1C5CL 3GMOB 3BSZL 2H41A 2UYLA 3MV9D 4AT6A 3GHEL 3MRIA 4YHOL 5I1LA 4Z0BH 5IMKA 4JREB 5JZ7C 4Y16B 2P43B 3TH3T 3WIHL 1C8PA 5HDBE 5HXMA 2C3VA 5ADPH 2ED9A 2C4FT 2XOTA 5FOJA 3CPLA 4L1DA 4LLVA 1KELH 4ZO6A 1I8IA 5FB8B 3HUJF 4HT1H 4TPRL 4XMKL 2GI7A 5F9WB 5D7JC 5CJXC 1NH6A 4G6AC 1AD0A 5IB4A 1UC6A 1WTLA 1A1NB 3RNQA 1MRFH 1HH6A 2Z31D 5CWSB 3ARBB 3RTQD 3QUZC 5LCVH 1RIHL 2H9GB 3IDJB 4K71B 2FECL 3IFLL 4R26H 1E6OL 1U2CA 3WHE0 5AUMB 1K85A 4XNQA 5C3TA 2R0LH 4ELMF 3FTGB 3HI1B 4J1UB 4UB0L 2FJGB 3WIIL 4LQFL 1OGTB 4XX1E 4LDEB 1F4WH 3O2DL 1I7TA 4G6KL 4LOUC 5DR5H 4IRJA 5TE4H 1QR4A 4GS7C 3ZKNC 3UTPE 1J0YA 4WTZG 3O4LD 1FL5B 5IMLA 1HXMB 5D2LF 3EAKA 4FP8L 2C4XA 4NC1E 1DQMH 2DF3A 1VEPA 2VIRB 2NY1B 1AP2A 5A40E 1NAKL 4S1RH 1IKNC 5DFVD 3KPPB 4LSPH 4U1JB 1DUZA 4PGDB 2BSTA 3DUHA 3MJ9A 7CGTA 4PB0H 4JN1L 2WAHA 4PJFA 5E1AA 1YY9C 1CXEA 5F6HJ 2PO6A 1R5VA 5FKAA 4OQTA 3O3BA 3BXNA 2HLFC 3LN5A 4OCXL 1J86A 5CLWA 1HH9A 1T1ZA 3RP1A 2NNAA 1YPZB 5MEOA 1MCLA 2COQA 2QL1A 2IWGA 3EZJB 3ZHDA 1GSMA 2BMKB 4JFEB 3MRKA 5EU6E 3BMVA 2BVQB 2FEDD 4Q9RL 2Q76B 2NZ9C 1WISA 4NHUB 3K8MA 1PG7H 1LDPL 4MQ7B 4P23A 4PPTA 1HE7A 1PKQE 3MRNA 1UM4L 4O02H 5TDOB 3H9SE 4QEGA 4I48B 3IF1A 1IAIL 4EI6A 2Y6SC 2FSEB 3B6SA 3CUPA 3RIAF 3FRPG 5GRYA 4WWKA 4PJGE 5TDNB 5FYJH 3IDMB 1A6WL 5CEZD 3TA3D 3JVGC 4PRHA 4OZFH 1WWWX 4ZNEA 4LARH 4M1DH 4R8WL 5TJWK 5K9KB 3C08L 3NPSC 4X4MA 1TVBA 1DQLH 3WEXB 4R90H 3DBXA 1SJEB 5LXGH 4LRIA 3QEHA 3FO0L 4F58L 1CF8H 4WU7B 3IVKB 3PE9A 3QDGE 2VISB 1AXSA 3U9PH 4RMTA 4YHKL 4JO3L 2OTUB 2WQRA 3TJEL 5HHOA 1RI8A 3L5JA 3RWCB 3RL2B 4U3XA 1NC2D 2VAJA 1T4KA 4HKBB 1UM6H 1B9ZA 1P1ZB 4JFYA 2UZIL 1NJ9A 4PJ9D 2DWEB 2Z9TA 4FQ2H 4PRBB 3KYNB 1FC1A 2YUVA 4O2FA 3QXWA 1OAQL 3TBSB 3S96A 3BUTA 4Y5VC 3QCTL 1IC4H 3BKCH 4ZUSA 2PYFB 4LHUG 2QQLH 1K3IA 2OK0L 4WFGE 4JKKA 4KTDH 4HFWB 1PD6A 1VADB 5JHDA 4LPUA 3CXDH 5ID0A 1MHHA 3LHPL 3NACH 5IFAL 5D1XC 4R4FL 4RDQF 1BM3L 1KFAL 3ARGA 3RAJL 1CFVH 4NRYB 3K2UH 5DJDA 4KKLC 4WY7L 4R3SA 3RKPA 2AJXH 4V1DA 5HD8C 2H2PC 3LH2H 4PIRF 2YD8A 5C0NC 5C0IB 1YN6B 1A5FL 4QHNA 2BVTA 5FA4B 1KENH 2Q86A 1FL3A 1KIRB 3MLRL 5DD6B 4YUEL 5HGDA 4K23L 4OM0H 2ITDB 3CFIC 4LSVH 2J6EH 5HI4C 1GHFL 4BYHA 3ZTNH 5KOVC 2Q8BH 3MV9B 1RZJL 1P7QD 3TO4C 2HJKA 3CCHB 3QHZL 1ZVHA 4NT6A 1UEMA 3BH8A 4WI8A 1ZT7B 3EYFA 3HFML 1YC8A 5ERWA 4LCIH 1P5UA 5EZLA 3BE1L 3TYGH 4NQEA 3DJ9A 3W39B 8FABA 4JKMA 2NX5B 3QNXB 4QXGL 3T1FB 4LGSB 2NY4B 1F3JA 2A9ML 3ZSTA 3HC3H 4OTXL 3A6BH 3RZCD 1OTTD 2BOBA 1A4KB 4L4TE 2FX8H 1INEH 3HNSH 4MA3A 4E5XB 4P46D 4I4WA 1A2YB 1A9BA 2Y9RT 1MLBB 3PWPB 1BBDL 3TYFB 1S7RA 1T7ZA 2OTWA 4M48L 4DJMA 1NCCH 2EDXA 2HN7A 4HX1B 3ARZA 1VFBA 3D2UB 4MAUH 4YK4C 5AZEH 1IEAA 4F9LC 3QO1A 4D9LL 4QRRE 1IEBB 1S9XA 1PLGH 1QSFD 3I6GB 1KNOA 1D9KC 2DJ4A 2D0HA 1F3DJ 3DX9B 3CFCH 1KTKE 3B9KB 1GAFH 1J05A 4PJXE 4BH8A 1KLFA 5EOCJ 3I75B 1IAOA 5GS2H 1JZ2A 1S7QB 2D7TH 3NAAL 3F6LA 3NPZB 3GIVA 3S7GA 3KPRE 4WWID 1A0QL 1DZBA 1U8OB 1OD9A 4HCRA 4P0DA 1EO5A 1YEEH 3FB8B 4H1LH 5FFLA 3HNVH 4YH6A 5JW3H 2FBJH 2HWZH 4UT7L 1LEKA 3RQ3A 4HWBH 1EXUB 1DP0A 1P6FA 3LN4A 3EDJA 5CBAB 3L95A 1EEQA 3MUZ1 1SM3L 4LF3A 4LCUA 3C60D 5DTFA 4D0DB 4J6RH 2IH3A 3D69A 3VG0L 4GG6A 4K8RC 4Z8FH 3P4OB 1MWAA 1XCQA 2GYSA 3X14B 1QFUL 1MF2L 4HS6A 4JHZA 2D7NA 3ULVF 1WT5C 4KI5D 1BD2A 2X44D 3KYAA 1BQHB 1GYAA 3WD5H 3VFRB 5D9SB 1SEBA 3P9MB 3ZKXC 1QLEH 2VL4A 1JPFA 1JGVH 4E41E 4G43A 3NCYP 3F12A 1CBVL 5GZOC 1D5BA 1INDL 4NWUH 2EDWA 4WU5A 1ORQA 1KN2L 3PWLA 3OAUH 5T1KA 5ID1A 2WBJA 3MA9H 3IDYC 5DJCA 3AXLB 4YIQB 1TCRB 3QDJE 2HG5B 5D2NA 4DN3H 4NQSA 4D3CL 3UMTA 4WI2A 5GZND 1S78C 1DBKL 3K2MC 4B0MM 1MFBH 4PG9B 3VXRD 1I7ZA 2D9CA 1XR8B 5JW4R 4JVWA 1DQTA 4DGIH 1G7MA 1U8JB 1DLFL 1GRWA 3DVGB 3MCG1 3Q5TA 3NTCH 4PJ8B 4EQ3A 4P59H 2BVYA 2Q7YB 4L4VA 1IQWH 2O5ZH 5I9QB 4XWOC 2GSIA 5TE7L 4ODUB 1MCIA 5EORL 1BLNA 5KAQF 2E27L 1J5OH 3PWUA 1RZKH 3BKYL 1HQ4B 3JWOL 4DGVH 3ZLQC 5K9OA 3K4ZA 4BJLA 4P4KB 5FGBC 5J89A 4M4PA 5L2KE 5TQ2H 3IAGC 3LB6C 4J8RA 1ZLVH 4PBVC 5E8OA 4M8VA 3VWKD 3RL1B 5LBSH 3UEZA 5FOBA 4C54A 3VCLA 1N8ZA 3A6CH 4MSWA 5E99H 3D85D 5FV1L 1NGXB 2Z35A 3W11C 3QJFB 4YPJA 4XPFL 2OL3A 3QDHA 1JZ4A 4OCRL 1NBVL 2ADJB 2CLRB 1PX3A 4GLRI 4FQ1L 3O3DA 4EN3A 4FQPA 3UDWA 3WS6A 1CXIA 2JF1A 5H94A 3T2NL 1CYGA 5HGAB 5JZ7D 1FJ1A 1TJHL 1H5BC 1AY1H 1Q1JL 5E2VL 4DZ8A 3AREA 5J1AB 1XIWC 5A2FA 3AAZB 4TVPD 4M9PA 1NFIA 1Q9LA 1XT5A 3QPXH 3LKOA 1SBSL 4H8WC 3BVNB 5C0EA 5JMRA 3TIDB 2V9RA 3D9AL 1Q0YL 3IFOB 4DOHE 4JFDE 4P3CH 2VL5A 4KK9C 2H8PA 2HFTA 3ULSB 3TN0C 5F21B 5CD3B 4GXVL 4HH9A 4RMQA 2F74A 5BRZE 3GMOA 5FCUH 3V8OA 2PXYD 4HF5H 1AI1L 3MBEB 3Q0HA 5IBLD 3HMXH 4ZXBC 5IJVA 4Y16A 3MGOB 1DEEB 3OPZL 1J8KA 3HB3C 4CMHB 3DRQB 2W9EH 1I9IL 4EIZC 1H3PL 3ZE1E 2RIKA 4ODTH 4XCCL 5FB8A 2AERT 5C71A 3T77B 4XBEH 1VCAA 4G8GE 5I8OL 2DQEH 1A7RL 2BNQB 3L5HA 1QSED 3FT2B 1FGVL 4OF3A 5IHLB 5CWSA 3ARBA 4XXCA 4MJ6B 4UV4H 4MX7B 1NGYB 2H9GA 3ZKND 5GJSH 3IDJA 4NM4H 5FF6B 2YMXH 4GUPB 4KKAC 4Z7OE 1EFXB 4HUNB 1J11A 7FABH 2F58H 4XC3H 4JPWH 4AL8L 4HIEB 5AUMA 4GRLC 3N1GC 5CJ8A 3OB0H 3ZL4L 5BV7C 3FTGA 4PRDB 4HXAL 4J1UA 2EH8H 4P2QE 2FJGA 1T5WB 5FYLH 3SDAD 1IBGH 5JPMB 1DVFA 1OGTA 3VG9B 2AXJA 1M1SA 2BY3A 3EFFA 1XF4B 3MUY1 2OXHA 1YY9D 1YEKL 5J13B 4ODSH 4OFYD 3VA6A 4QOKD 3MJ6A 2AQ1A 4RAVA 2HLFD 3HE7C 3ZDYF 1YMMD 1FL5A 4XNZB 4N8CH 4DWHA 4U33A 1FCCA 4WW2B 5DHVH 4FQJL 3KPPA 4OLVL 3FB5B 5KG9A 2P5WD 4F9PA 4PGDA 1RUQH 3A67L 1ZXQA 4YE4L 1NSNL 2NW3B 3LS4H 4OD1H 3VGDA 1J8HB 1QRNE 2FGWH 3F7PC 3FN9A 5GHWL 3QNYB 2FHBA 4PJEB 1EAPB 1NLDH 2MSPA 5DVKA 3SN6N 2RCSL 1A47A 5HHME 3TWCH 5IB3B 1KB9K 2QTEA 3LPWA 2C26A 1YPZA 3RPKA 1HSAB 3QULB 1RZIB 3ZKQD 3M1BB 3ZE2F 5E8PA 1ZLVK 3VWJD 2BMKA 4R2GB 3OJ2C 4QCIB 1GGTA 4JFEA 3CDFA 5I15H 3EDFA 5KS9E 2BVQA 4LLMB 2WP3T 1F58H 2Q76A 2YKLH 3SE8L 2CRIA 4JO1L 4MQ7A 1AKJD 3DVFA 1A9EB 4QTIH 4I48A 1FDLH 4MA1C 1YYMH 2ILLA 2VB5A 1O5DT 1A14L 3OKKB 5TDNA 4XTRC 1FBIH 3IDMA 3C09B 4IDJL 3HE6C 1QBBA 3V7AG 5HPOA 5D72L 4PRPE 4XP9L 1IGCH 1JPST 2UZXB 5EO9B 5JOPE 4RGOH 5K9KA 1CFTB 2W0LA 1IGIL 3S5LB 5FUCE 3KDMB 1JWMB 3ZE0E 3LEYH 4W4OC 3HI5H 1D5ZB 4Y19B 1SJEA 3D3VE 5EPMB 1F4YH 3SBWA 5IWLC 3GM8A 3THML 1YDPB 3WFDH 4WU7A 1QQDB 3HS0B 3IVKA 4NKQB 3DNKA 5IESH 1NCAL 4HIIB 2OTUA 4G9FB 3W0WD 5DMIH 3RIAK 3RKDD 5DI8B 3VWKB 1GCFA 2NW2B 2W60B 4I18C 3RL2A 3RWCA 4G6JH 4HKBA 1P1ZA 5INDA 3WN5B 3MYZA 2DWEA 5EOTB 5HD8D 4ZSOB 2H2PD 4PRBA 3KYNA 2QEJA 5C0ND 1Z0NA 5EZIL 4MCYB 5TE6L 3DXAB 5CP7A 1OCWL 2JB6B 3KPNA 4J2XA 2PYFA 3QWRA 5HI4D 4CJ0A 1VACB 4CU7A 1ZGLM 3F7VB 2YXMA 4PLOB 2H1PH 4HFWA 1MLCB 1OAUL 1V8HA 5ETUB 1VADA 4NPYB 1CVRA 5D4QA 2N56A 2QBWA 3BZ4B 3AROA 4Q6YA 4V2CB 5C0BD 3CXHK 1DN0B 3NN8B 4NRYA 1QNZH 3WIHA 5D7JB 5C09B 3QNZB 4OZIB 4KHTH 4WFEE 5C0IA 1YN6A 2AXFB 3DHJA 3MGAA 3VI4F 2C7UB 1KIRA 2HT3D 3QUZB 1KJ3H 2ITDA 5D1ZC 2IALB 3E8UH 3RA7L 5HGHB 3IDXH 1ZMYA 4DKFL 2CO7B 4NCC1 3CCHA 1ZT7A 3N06B 4HBCL 4BKLB 4OCSL 1FSKC 1JMZA 2EDFA 4GAJL 4BZYA 4ZAKA 3V0WL 1HXYB 2PUQT 4JY6B 1ZWIB 3W39A 2UY6A 2NX5A 3QNXA 3T1FA 2FO4B 4YWGH 4ETYA 2GTWB 2Y23A 4KMTL 3S35X 4HCRH 2L7UA 2K9UA 4GS7B 4GJTB 5A3IC 1G7QB 4E5XA 4NWTL 2IADB 2F5AL 1A2YA 1T83C 1D9KD 2DTMH 3O2DA 2PTTB 4FFYH 1IT9L 4F7TA 1MLBA 3PWPA 2JCCB 3BJLA 3TYFA 3MLYH 2H32B 4UQ3B 3HLAB 4NUJB 4UAOB 1WVZA 4CU6A 5JLZB 2F53E 1P9MA 1D5XA 2WWMC 3J8F7 1G9NH 3SGJC 3RDTC 1OPGH 4HX1A 4F7PB 1QRKA 3DYMA 2EDKA 3D2UA 3P0YL 1C7SA 2YZ8A 5ALCH 1CG9B 4N90E 4NNPH 5TFSL 3MODH 5DD3L 1ROWA 4MXWL 2DWDB 1IEBA 3WFEH 3VFTB 3PGCB 3WUWB 2JJWA 2R0KL 3I6GA 4M6ML 3DURB 2OYPA 3NFNB 2W59A 3DX9A 3MLVL 5T1LB 4XVTL 3GMPB 3B9KA 1MQ8A 4DN4H 3S36H 3G5YB 3RWEA 1HINL 3I75A 1NBYB 1S7QA 2FIKB 4C83B 3G6JB 1MIML 1U8OA 1I3VA 3UJJL 3QIWB 4JRXB 2F54B 4X98B 3FB8A 4J3OC 3EBAA 4JEGB 4OZGF 4M62H 3VXNA 4ODVL 2ICES 3BEVB 4JFHD 2F8OA 1DBJH 2F8VA 5LAXB 1N3NB 1NMCC 1YJDH 5DJYB 5CUSH 5I18H 3GO1L 4K8RL 1EXUA 5GZOD 5CBAA 5MENE 1RMFL 5I76A 5GGTA 5I19L 3QIUB 3NPSB 4D0DA 2FATH 4FTVE 4NKDB 2HRPH 3P4OA 4RMVA 3SCMC 4PBWD 3X14A 1AKJB 1T2QH 4RWYH 1BQHA 1NGPL 4RFOH 4UT6L 2R56H 3VFRA 3H9HA 5D9SA 3P9MA 2JJTA 2BRQA 4YPGB 5I1GH 4OIIL 1MQKH 2IG2H 4XRCB 1I9EA 3VGAC 3OL2A 3VI3F 3QISA 2GIYA 2XZCH 4Y5VB 1TCRA 2J3SA 2HG5A 2VC2H 2OL3H 1ES0B 3SKOA 3TVMC 4KQ4H 4M5ZL 5IQ9B 5LJYH 3HR6A 1XR8A 2YA2A 3FAXA 5A2LH 1J10A 1KEML 1U8JA 3DVGA 1OWWA 5EOQH 1JNNL 4PJ8A 5D1XB 2Q7YA 4PGZA 2B2XL 2XQYK 1K6QL 2H2SC 1I3GL 2DLEA 4ODUA 1FLTX 2DQCH 2VOTA 2DQGH 1OARL 4GRMB 5D70H 5GRUL 4UT9H 3T08A 2EIDA 1T89C 1JNLH 3MRLB 1HQ4A 4KQ3L 3QBTB 1GGYA 4P3WA 2RR3A 3KPSA 2CXKA 5E03A 4P4KA 2CK2A 2ICWI 4P2RE 4LIQE 2YC1B 2NY7H 3TO4B 2F5BH 5CGMA 4X7CC 5B4MC 4BM7A 4G6ML 3RL1A 1G6RL 1FAIH 5BVPL 1Y0LB 4JR9L 3Q48A 2EXWC 5F1SA 1A21A 1FZMB 2VXQL 1LMKA 2FHFA 2NY6C 3KHQA 4P9MH 1NGXA 3QJFA 1UEYA 3TN0D 2CLRA 2ADJA 3AUVA 4L9DA 4WUUB 5C3LD 3SQBA 1RIVL 1JYXA 3QUXC 4ZXBD 3ILPB 5HGAA 4H8WL 4MD4B 4E9LA 5LWYL 1WEJL 1I1AB 2B4CC 5J1AA 1MFAH 1N0LA 3AAZA 2EICA 4YEEA 2ZUVA 3ZKSD 4I5BB 4TSCL 2X4UB 4HC1H 4AIOA 1WFOA 1CZ8H 4M03A 3UTZB 1FYHB 1CLYL 5JO5B 3TIDA 3IFOA 2IAMC 4MNQE 3UTPD 3ULSA 4OJFL 5DRXB 4YK4B 4X5WA 3BD4A 2IANA 2P49B 2ZG1A 2H45A 3MBEA 1OB1B 3KS0J 3MGOA 2OCFD 3DETC 4QLRA 5DFTA 4O9HL 2KKQA 4XP6L 3DRQA 1NCDL 2KUTA 1C5DB 1I8LA 3RBSA 4OF8A 4J3SA 5I75B 3ULUL 3U1SH 4OB5L 4N1CA 4EZMA 4ZYKB 3T77A 2AJYL 4CU8A 2P46B 3N9GL 1KCLA 3AS2A 2Q8AL 2Q20A 2BNQA 3IAQA 3FT2A 3KLAB 2AXHA 1IC5L 4AH2B 3BRGC 1OT1A 4MJ6A 4ZFGH 4GRWB 1NGYA 2BX5A 5BV7L 3FFCE 1A6TB 5FF6A 1UWEL 1FZJA 2MCPH 4GUPA 2CH8A 1QHOA 4Q0XL 1EFXA 5HYJD 5EU6D 2ZNXA 4HIEA 5IQ7L 4RGNE 3DTXB 2R4RH 4U6TA 5D96C 4PRDA 1JZ5A 4C56B 4MJIE 5TH2A 3MV7B 1JZ6A 5J8OA 3HAEH 1T5WA 4NFBA 5DVOA 2R1WB 3H9SD 1ETZB 2LU3A 2VH5H 2PYEB 1XF4A 2JB5H 2R0WL 3NCJL 1GIGH 3CK0H 3HI6H 3ZKXB 5GISH 3BOVA 4FQXC 5AG9A 5HYFA 3VXPA 4NRXB 5GS1C 2GY5A 5FUZH 2HTLC 4WW2A 4V2BA 3HN3A 4U4BA 3TP4A 3QDGD 1JK8B 2E8YA 2NW3A 3V4PH 3IDYB 5K93A 3RVWC 3IDIB 4S1SH 5ISZD 2AI0H 4CDHA 2GJ6E 3BGAA 1DQJB 3P9WB 4YDJA 2J88L 5TQ0L 4PJEA 1EAPA 1XGTB 2HTKD 4GW1A 4X83A 5IB3A 3GHBH 1HN1A 4ELMA 3GK8L 3HE6D 1HSAA 1YNKL 3QULA 3BFOA 2APBA 1HIMH 4PLJC 3ESVF 1CICD 1KV3A 4QCIA 3F58L 2G2RB 4WFGD 2IC2A 2NY3B 3CSYB 3SGEH 4OT1L 4KKBD 1A9EA 4C4KT 2CXGA 4I77H 4WEBL 1O7SA 2A9NL 5J06A 4ZDHB 2H3NB 3JTSB 3E2HC 3NCFB 3OKKA 1GC1H 1A3RL 2I25N 4G42B 4BZ1H 5C7XL 3CU1A 3FN0H 2FEEL 4BH7B 5EO9A 4AEIL 2VLKE 1EH9A 3KDMA 5FYKH 4IDLA 1JWMA 3T2OA 5JW5B 2VLJA 1G6RB 3U0WL 1ZLSH 1D5ZA 4Y19A 3TBYA 5EPMA 3TT1H 5CKGA 3X3GL 2JKXA 3BMWA 4TPRH 4XMKH 1QQDA 3HS0A 1S5IH 4DUVA 4OCMC 5I1HL 3B9DA 2ZUQC 5IW1B 1H5BB 4KI5F 4WHYG 3C6LD 1A7QH 4HIIA 1BVLB 3LKRA 2VR5A 4G9FA 1XIWB 3QWQB 3FN3A 4PGBB 5DI8A 5IVXB 2NW2A 1NC4B 1XAUA 3H9YA 5IKCB 3WN5A 4JFXB 4ODXB 3V52H 5EOTA 1T03H 4ZSOA 1H8NA 1X5YA 1LP9B 5D1QA 4L4TD 3QCUH 3H7BA 2IBZX 4HEME 2B0SH 1JPSL 5C9JB 3ET9F 3MJGX 1AFVL 3BT2L 5J3HC 4KV5F 4F57H 4OLWL 4I2XB 5D1ZD 1IM9D 4MAYC 1UH2A 3F7VA 3RVXC 2DAVA 5ETUA 4FZEH 3KJ6L 3FQUB 1LO3L 4NPYA 4HGMA 1REIA 4MD5B 3BZ4A 1R0AL 4JY4B 4FFWC 1WIPA 1RQ5A 1HNFA 1DN0A 3NN8A 3TZVC 4NNXB 3SGDH 3EO9H 5JDJA 5LGKA 2P5EB 1I7RB 5C09A 2AK1H 4FP8H 4OZIA 4QRRD 5CJOL 3DV6B 3BKML 3DYOA 2C7UA 3GSOB 2HFEB 2XA8L 3VXQB 3KR3H 3QUZA 5TPWH 4U0RC 5A3ID 1U8IB 3B5TA 5HGHA 4NO0D 2L7JA 5E8EB 4B41A 2G60L 3P4NB 4JN1H 4RWHA 3LVEA 4GRLB 5BV7B 5HHPB 3UTSB 4BKLA 1R3LB 2WWMD 3X3FL 1WZMA 4OCXH 1HXYA 4LEOB 4JY6A 4WO4D 1TZGL 3W9EB 2FD6L 3B2VL 2FO4A 4KJYB 5E6ZA 2GTWA 1QFOA 4UOJA 2EDEA 4CW1B 5C9KA 4LAQL 1G7QA 3Q2CA 4X5LA 2IADA 4ZMAT 3HE7B 4OZ4B 2PTTA 2P8PB 4HS8H 3IB4A 1N6UA 3FQNB 3GI8L 1LDPH 5T3ZE 5HYJB 3SDCC 2H32A 4UQ3A 3EOBB 3HLAA 2O5YH 4NUJA 4CKVX 1QFWL 4M9OA 5JLZA 2B7DT 1U42A 1LE5B 2ENSA 4JRYB 4X7FC 1HNGA 4KY1L 4F7PA 1XGQB 4X6DF 1EHXA 1E4XI 2P42B 4E41D 4GAYB 2HJFB 1CG9A 3C08H 4M7LT 5FO8B 1U8HB 3E3QE 1Z9SA 3P2TA 2BC4A 5T3XL 3VFTA 1IZKA 4KROC 3PGCA 5CILL 3WUWA 1CLZL 1JMXA 5EUOB 1KCUL 2ICWJ 3C2AL 1P5VA 1Q38A 3NFNA 3M8OH 5T1LA 3GMPA 3FO0H 3BP6B 5F1IB 3G5YA 3QDJD 4YHKH 1A6VH 3MO1B 5DMKB 4K7PL 2FIKA 2D3VA 4C83A 3TGXA 3OF6A 5ISZB 4O58L 4PJBF 3QIWA 4JRXA 1IRAY 2F54A 4JPVL 4X98A 2UZIH 1TZHB 1WCBB 1VEMA 4MA1B 2DQIH 3EDKA 4KHXH 5I8EB 3BEVA 2W38A 2A6IB 4WGVB 4OF5A 5LAXA 5TF1L 4LLWB 5DJYA 5FYLE 1W72L 3JVGA 1X5LA 5J56B 3N1MC 3T3MF 2LU7A 1NCUA 5SX4H 4YHLL 3MRMB 4FN0A 3QIUA 4U31A 1ZLUH 2XT1B 4NKDA 5L2KD 1FCGA 2Y36L 1JBJA 4XVJL 2EEAA 3BO8A 3S3SA 1AE6L 1VFOA 5E6IC 2M1KA 2NPLX 4WI9A 3RAJH 1HYRC 4WY7H 4BFGA 4PRHE 3ZSSA 2AXGB 4U1HB 4ZNEE 5HHXL 4PG2C 3P77B 4YPGA 2QSCL 2A73B 4X4ME 1YMHB 3UO1H 2H2SD 4XRCA 5B39B 1GHFH 4MCZB 5F89A 3I02B 3SDYL 3QHZH 3QWOB 4K7PX 4ZO8A 4G80B 1YQVL 4M7JL 4Y5VA 3LDBC 3HFMH 2G75B 4RRPG 2AVGA 2HJLB 3MRJB 5IQ9A 4JO4H 3DGCR 1CD9B 1Y6NR 5DGQA 2WNGA 4K2UH 1NGZB 4GBXD 4XBPB 5D1XA 5IJKA 2HT2C 2AJUH 4JFDD 1G9ML 2VZ1A 2EXWD 4WCYL 4AMKH 3PGFH 4GRMA 3QCVH 5BRZD 2NY6D 3NCYS 1OT2A 3ROOB 3MRLA 5L0QC 5EOCL 3NOIA 5JHDE 3FKUS 4O2CB 3BDYL 2YC1A 4HUVB 1BX2B 4QTHB 1A3LH 2GJZB 3ZT7A 5I0DA 4K94C 2YHGA 4V1DE 3KPQB 1C7TA 5CZXC 3VFOB 1Y0LA 4P2YA 2EH7L 3GMLB 1TJGH 3QP3A 1FZMA 2IAMD 1F2XK 5BO1H 1ZSDB 2YEZB 5JIIA 2KBGA 5IP4A 3WFCL 2I27N 5DVMA 4WUUA 4ZUUB 1UM5L 3PABB 1E27A 4MB5A 4MD4A 5F7NC 1WCQA 2X9WA 3DETD 4XNYH 2VDML 2DYPD 4NKIL 1I1AA 4P2QD 4ONGL 3UXFA 3BPOC 1LD9B 1OTUD 1ZTXH 3WBDA 3PXJA 2IPKB 2XY2A 4I5BA 3CVHL 4NO2B 1HSBA 1YNLL 2X4UA 3W2DL 3EO0A 4UT7H 1SMOA 3K3QA 5JO5A 1A7NH 1HHIB 3RDTB 5I6XC 3JV4B 5AYUL 1XH3B 5DRXA 3M45A 1SM3H 5AZ2L 4F9LA 3NIDF 2YD4A 2VZVA 4RGNC 2AW2A 5ITBL 1OB1A 1N26A 3W82A 2QQKH 4Y8DC 5L9DH 1UZ6E 1QFUH 4PJIB 4ETQB 4XPBH 3OZ9H 5EIIB 1CK0H 3GMRB 4NGHL 5ACZB 1C5DA 2N7AA 2P8MB 1QRND 2R2BB 2HYMA 1HCVA 1V3MA 5CGYC 1CGYA 3VA2C 4W6WB 4WV1A 5IHZA 2X1PA 1CGTA 4YHPB 3B9AA 1EIBA 3KLAA 3PIQA 1CBVH 5DJZB 5CEXB 1ZLUK 4AH2A 4EI5C 4C58B 4OLUH 1HYSC 3T2PA 3STLB 2LTQC 4QRQB 4POYA 4K3JH 4Y4HA 4JB9L 3IFPB 4F8TA 1U8NB 3WNMA 3WNOA 5I1KL 1DBKH 1C1EH 1A7PH 1BOYA 4C56A 1T7YA 5E8DH 4WTWA 3MV7A 2CIKB 3FAWA 1DLFH 4L8DB 4LMQI 2R1WA 1ETZA 4FQHB 3KPOB 1W72B 4JM2C 4W68A 2PYEA 4OSUH 2BZDA 3RPIB 4BK4A 3SCMB 3PV7A 4Q9QH 5TE7H 1YEGH 4NHCH 2O93L 2PF6A 1GGIH 5EU5B 4BQBA 1GOHA 1LWRA 3FB7A 1QBML 5EBGA 5H37G 4PRPD 4YLQT 3BKYH 5JOPD 3MRPB 5J12C 3QHTC 1N5YH 4PLJD 1OAZL 4AIZB 4NRXA 3D3VD 4GG6E 3VGAB 4ENED 3O6LL 1K8IB 3LQAC 4ISVB 4HKZA 1JK8A 2ESVB 1JHLL 1HKLL 1NAML 1K2DB 1OGAB 5HDQL 3MNWB 3IDIA 4KDVA 4JG1H 1BQHG 3TVMB 3JV5A 1U92B 1UXWB 4HXBL 5GSVA 4J7RA 3LRSB 1XGTA 3DSFH 4PV9A 3NABL 4MDIB 5LGHH 2F19H 2XRAL 4XPFH 4U2YA 3QYCA 1B0RB 2WM0A 1MCCA 4XAWL 2IBZY 1MFCH 4L8BA 4G5ZH 4LHUD 4U1MB 5D2NE 1JI1A 5E2VH 2G2RA 1UCBL 4QHUB 5HY9B 1L0YA 3ARTA 1HHJA 5K59F 4QY8B 1B0WA 3CSYA 3VGEA 2B1AL 1KJMB 3NFPA 4N8PA 5FGBA 4P2OB 4Y5YC 4BSWA 1SYVB 4RBPH 3D9AH 3D1MC 4L4VE 4U6YB 4ZDHA 2H3NA 3JTSA 4O4YL 2J7LA 3VFGL 5I8CB 3D39B 4G42A 4HWUA 3I50L 5D5MB 4PJAF 4WFED 4TVPH 2E7MA 1AI1H 4BH7A 4M43H 5AG8A 3VFWB 3LQMA 3MCKB 4Z78B 3BD5A 3GBLA 3OPZH 2E6PA 2JIXD 5JW5A 1G6RA 3B43A 5EIQA 2DMCA 3R06B 3HG1E 5J3HD 1IMHC 1M7DA 5J1SC 4LPWA 4XB7A 3QIBC 1F6FB 3QUXB 4MD0B 4BFBD 5IW1A 4S10A 3E6HB 4HSQA 1LNUB 1BVLA 1FGVH 1CE1L 1XIWA 2GSGA 4PGBA 5IVXA 1NC4A 4R96B 3TZVD 1RU9L 1MHCB 3BISA 4XMPH 4JFXA 1C08B 4ODXA 2Z4QB 1LP9A 1YNTB 1QG3A 5DXWA 2IGFL 4APQC 1RURL 2IAMB 4N0RA 4XCYB 5BVJB 5C9JA 3CVHB 1WAAF 3ZL4H 4P9HC 2NY0C 4Z0XB 4I2XA 2YZ1A 4MA7L 1JZ3A 1KCVH 3HNTL 3FQUA 1EJOH 2F53D 4I9WD 2XZAL 4MD5A 1YEKH 4OLYL 4JY4A 2BSED 4Q9BA 2IMMA 5EA0L 3UTQB 4JDZB 4YHZL 1OAYL 4Z7WF 1JN6B 4NNXA 5D7IB 2P5EA 4N90D 1I7RA 2VWEC 1RIUL 4AG4H 3UYOD 4RGMB 3GSOA 2HFEA 3VXQA 1KLGB 4C57C 1UA6L 1FIGH 3V0VB 5AWNH 5HSFA 4NUGL 3CVIL 5E9DB 3RIFF 5GGVL 3UJIH 1U8IA 4NZTL 4Q6IC 2VZUA 5HDBF 3N50A 3QQNA 4NBYB 3CFJB 5E8EA 5JA9A 1WFTA 2EC9T 4GRLA 4IRJC 2YUWA 1V7MH 5D96B 3UTSA 5HHPA 1R3LA 3CIQA 5I74B 5F9AC 4LEOA 1H3XA 3BIBX 4GFTB 2M2DA 2EKJA 3W9EA 1KEGH 4B7IA 1FVEB 3PDOB 4KJYA 3ES6B 2VLLB 3VFPB 2W0KA 3ARYA 3I2CL 4KROD 5ICYA 5MEND 3MBXL 3HE7A 5HHVH 4OZ4A 2FIRT 3FQNA 4FQXB 4FTVD 5JOEA 4XHQA 4TSBH 3EOBA 2XXMB 5GS1B 3C9NA 1HOCB 5I1IL 1LE5A 4KVNH 1NEZB 4JRYA 1XGQA 3BP4A 2AEQH 4HKJB 4XP9H 4GAYA 2HJFA 5I2IB 2BSRB 3QZWG 5FO8A 1RUMH 2V9TA 4LCWB 5HVFB 2JK5B 4FOMA 1NAMB 4LPXA 3EOTH 3KYKL 4OZHB 5EUOA 5FGSA 1CL7H 4RBPK 4JVPA 4K7PY 4LVEA 3QUYC 3BP6A 4YDKL 4RFEB 1S9YB 3EHBC 3MO1A 3V7MA 5DMKA 1NUNB 2X05A 4WWKC 4YBLB 1MJUH 3P0VL 5E6ID 4GW5B 2CJUH 3V0AC 1MREL 1J0KA 1YPZE 4CGTA 1SEQL 5F93C 5JUEH 1WFNA 4GXUM 3E2HB 1HEZB 5I8EA 4M7LL 3R0MA 3QEQB 3LRGA 2A6IA 2JJSC 1RZ8B 4LLWA 2LFGA 4LRIC 4JFEE 5FO9A 1KXTB 3MRMA 5EBMA 1OAUH 2V5RA 4IOFC 4NO5B 1MEXH 4PUBH 4NBZB 4HPYL 3L6FA 2IH1B 4W4OA 2D03H 4WFHE 4P2RD 5KSBB 1ZA6B 4Z7UB 1JP5A 1B90A 1F4XL 4YX2L 3RNKA 4ZTOH 3ZMRA 3NIFE 3K80A 4ZOBA 5CKAA 5DVNA 4O00A 1KGCE 2NY5H 2ZUQB 4PJGF 3WFBL 5DMGD 4U1HA 1MHPL 5CSZB 1X9QA 2D0FA 3OJVC 3P77A 1EA9C 2VXUH 5DJ0A 1I1YB 2FX9L 1YMHA 3IU4L 4M7ZC 3L3JB 5DJ6B 5IW3A 4MCZA 4FQLH 4U1LB 3I02A 1R6VA 5IB5B 1KJ2L 3QWOA 4JFFB 2YPVL 4G80A 3RZWA 2G75A 1U8MB 3ARGC 2HJLA 4KC3B 2CDEB 4GAJH 4MAYB 2Q1EA 2X70B 3V0WH 1NKOA 3I6LE 1NKRA 1SQ2N 4GMSH 2AAVA 1NGZA 4XBPA 4MNQD 4ZS7L 2MNUA 3FO1B 5B21A 2C9AA 3NIGE 3OKOB 1JF6A 5D8JH 3ROOA 5E24E 4HIXL 4JZOB 1CDYA 2I5YL 1JGEB 2QHRH 4U0RB 4DTGH 1NFKA 4O2CA 1MY7A 4XNUH 3K7UA 3VH8B 3WL9A 2R69H 3UYPA 3KXFD 3VFMA 1BX2A 4QTHA 1Q0XH 2GJZA 5E8NB 4Z76B 3D0VB 3P0YH 3B8YA 3KPQA 5F96H 2V17H 3GMLA 5DD1L 1A1MB 1AQKL 1QBAA 1U3YA 3MLVH 3FFCD 4XVTH 1ZSDA 2YEZA 1YEJH 1EDQA 3MV9E 4Y4FC 5K9QI 4ZUUA 1J0JA 3PABA 3N85H 4RGND 2YWZA 4U7MA 4X8JB 5F70A 3MC0A 3MROB 2VDNL 1JV5A 4MJID 1I9RL 3WLBB 2EZ0D 3AS3A 3NZ8B 3IS1X 4HWEL 3SDCB 1JJUA 4L8CB 4KRPD 2IPKA 4XPTL 3V4VH 4ACPA 1GPOH 4NO2A 2NX5E 5CGYD 4ODVH 3ZDXE 5I1JL 1HHIA 1MCNA 3RDTA 5DK0B 1JGUH 1ZK9A 1XH3A 1ZVYA 4TUOB 4XPHL 1WZLA 4W81A 4JVUA 1RMFH 1NMAH 3GKWH 3PWPE 2DLHA 1RJYB 1TETL 2OSLB 4M61B 1UACH 4IHOB 1FNGB 4JFOB 4RDQG 2AKRB 5K9QG 4ETQA 3N1QC 5EIIA 3ILQD 5DYOB 3QXVA 3PP4L 1T66C 3GMRA 5ACZA 5T1DH 2P8MA 5BMFL 2R2BA 2A77L 1B88A 5HTSA 1R5IB 1XCTB 1FN4B 2GJ6D 1H9VA 2ZCLH 3CD4A 4OIIH 4YHPA 3MXWH 4Y2DB 5DJZA 3V6FB 3MUGB 5GS2D 1ACZA 2IPUG 1M6OB 1L9NA 1AO7B 2V5SA 3WUWG 2PW2B 1EV2E 2J5LC 4QRQA 3U7WL 1S7VB 3WDJA 3IFPA 1U8NA 5KSVB 5GS0C 4PJXF 5GGQH 2ORBH 3MV8B 4LSSL 4W4NA 1NC2A 2CIKA 3UTOA 1KEMH 5EC2B 3Q6FB 4IRSA 4L8DA 4CVWA 2OMNA 5F1NA 4FQHA 3HC0B 3KPOA 1W72A 3P11L 2RGSA 5F44A 3SCMA 4EQ2A 1OSPL 5HHNB 5EU5A 4N0YH 3T8XB 5FGCB 2WBJC 1NFDB 3MRPA 4KQ3H 1T0MB 1KIPB 4MA8H 3NH7L 5D2NC 2VLKD 1VHPA 5CS7A 2EYSA 5DUPH 4AIZA 1IL1B 3GEWB 1KSRA 1JF1B 1KBGL 4PTUA 5L6YH 3X17A 3P3YA 4ISVA 5I0ZA 1UB6B 2ESVA 5DT1H 2X89D 1K2DA 1OGAA 4G6MH 3MNWA 3S37H 1G6RH 3LDBB 5ECJE 5HPMB 4JR9H 5CLTA 5ALBL 3TVMA 1KJ2B 1IAKB 2XQBL 4TNVF 4NP4L 2VXQH 1UXWA 5F7DB 3LRSA 3T0EC 4JANA 1SVZA 3JTTB 2ICEB 3DOSA 3U30C 2P7TB 4X8XA 1P4BH 3OJDA 1B0RA 1P7QA 5IIEB 1LDSA 3OMZA 1RHHB 3VXSB 3LMJL 3QHFL 5C2BL 5CZVL 1RIVH 5DS8B 4NZUL 2Z8WC 4W6YB 1YEHL 4WNQA 1T89A 5L0QB 4QHUA 5HY9A 5CIPB 2JLLA 5D7LD 4QY8A 1RSFA 3G6AB 1KJMA 2A1WH 4U6XB 2HKFH 5D6CB 4P2OA 1SYVA 12E8L 4AEEA 4HFUH 5I17B 3BDXA 2OR9L 4U6YA 4S11A 5I73C 5I8CA 3D39A 4PP1C 4OJFH 5DLML 3C5SB 4EN3C 5D5MA 3UDWC 2XPGB 3WS6C 2PCPB 1IAIM 2XKNB 3MLZL 3O2VL 1OM3L 2DJSA 3VFSB 1P4IL 3MCKA 4Z78A 5F88B 3AREC 2BJMH 2XI9A 1CGSH 3R06A 2NY0D 2KPNA 5BOZG 4OB5H 1YECL 4H0HB 2J4WL 2XQYG 3QUXA 4MD0A 2FGZA 4XP4L 3KXFB 2R2HB 4NZRH 1QSFA 1UCTA 2Q8AH 1LNUA 1G7IA 1CGUA 2CLVB 3LEVL 1T0PB 3BPOB 2EDQA 1FYTB 1IC5H 3CSPA 1J1PH 1NQBA 2MMXA 4L3EB 5EO0A 4R96A 1MHCA 3NMEA 3VGHA 4LKXB 4FQIH 1C08A 4P9HL 2Z4QA 3O2WL 4Q0XH 4Y16C 3WXVL 1FGNL 2VO5A 4PJ5B 3OKDA 4HAGA 4ZUWB 1WBYB 5I6XB 2V2XA 2ZJSL 4XCYA 5KJRL 1VENA 3CVHA 3RWJB 4KK5C 5IUSA 1X5AA 1R3HA 2L4OA 4Z0XA 4UTBL 4YXKH 2YXFA 3FRUB 5T3ZD 1YZZA 5SWZB 3G6DH 5C0DB 5F9WC 5I1AB 1XZ0B 3QQ4B 6CGTA 4ERSH 2R0WH 2NLJB 4HLZG 4F3FA 4IRJD 1TFHA 5FHAH 1Q9KB 3ARBC 5KAQG 2CUIA 3LEXB 5JORB 4JDZA 1JN6A 3IJHB 4K71C 1G7JB 4KUCD 1VB9A 5GGVY 3TBVB 5J6HB 4K3DH 4G8EB 3STBA 2OTPA 1AGBB 1KLGA 3Q5OA 4EI5B 3V0VA 3L1OH 3ARWA 5E9DA 4HK3J 3GBNH 4U1KB 2FCBA 2LTQB 2MPAH 3IXAA 3R1GL 4L9LB 2BNRB 4S0TD 4P5KB 3STZA 1DVFC 3WHE1 3CFJA 2GQHA 1N64H 3ZE1F 4KTYA 3U2SB 2AJSL 4I13B 4OCLC 4WJ5B 2PO6D 1BHGA 3WKML 1U93B 3C5ZC 4FS0A 4JFQB 4ZD3L 3KNBB 4X6CB 2BNQE 4N5UA 4LBEB 4OBSA 4CAGA 4JM4L 1GOGA 2QJDA 3BQUD 4JM2B 4WW1B 1FVEA 1CDUA 3ES6A 1XF5B 2P8LA 2PR4L 2VLLA 3PJSB 2WLYA 3TPUB 3VFPA 3SEPA 5FYLD 1NLBL 3L3KA 4Z7OF 2UWEB 4EUPB 4F9PC 5KVDL 3RIFK 3T3PE 1DE4B 5J12B 3S34L 2VDRH 4P23D 4FQQB 4OQ1A 1VSCA 4LDOB 5F6IC 5GS1A 3IRZA 1IGYB 2IPTH 2X4QB 5DK2A 3EHBD 1HOCA 1HDMB 2A9NH 1MVFA 3VW3H 1QA9B 1VPOL 1YEFL 1A3RH 1NEZA 1P69B 4PRHD 5IGXL 2CO6B 4JPIA 5EH1A 4HKJA 3CXHJ 2CRYA 5I2IA 1JRHH 2BSRA 4YXHL 4LCWA 2JK5A 2X4PB 2ZPKL 4PRIB 1EEYB 4QXUH 4OZHA 4YBHA 4BSJA 3X3GH 1BQLL 1OAKH 4JZNA 4TULL 4ESKA 2LABA 4RFEA 2WIMA 2JJVA 3VU2A 1J8HE 3U0PB 3GMMB 4S1DC 3VMPA 2VXSL 5JXED 4U3HA 4FFVD 4JRWA 4PJEE 4HIHB 1LE9B 2DM7A 2YRPA 4Z7VB 2GY7B 1HEZA 3QEQA 1RZ8A 4NQVB 2B8OT 2DIJA 5DD5H 1ZEAL 2VDOL 3FJTA 3KLSA 3JWDH 5KS9F 1U8LB 3SQOH 4NSKB 2Q3ZA 4NO5A 1D5IL 5ESAB 5JHDD 1RUKL 1MNUL 3QH3B 1RJCA 2IH1A 4U6HB 4X6DA 2MOVA 1ZA6A 4Z7UA 5KSBA 3ARGD 2VR9A 3BPNC 2VR4A 3D87B 1PX4A 2H26B 3QIBB 4K7FB 4V1DD 3IJYB 3T0VA 5CSZA 4FNLL 3HC4L 4YDVB 2I60L 2QSVA 4NJAL 4LVHC 4DUWA 2Z8RA 2R8SL 4HJ0C 1I1YA 1TJIL 4POUB 4LDLB 4WHDA 3L3JA 5DJ6A 4LSRH 4I3SL 4Y19E 4AT6B 3KYOB 1G1CA 4U1LA 2AJ3B 1T3FB 3ZE0F 3SGKC 4HG4J 5IB5A 4M8QA 4JFFA 1DANU 4APQB 2CRZA 1MJ8H 3ETBF 4PJBA 1OTSD 5L7XL 4CN4A 4PJCB 2CDEA 4MAYA 4JHWH 2X70A 4G9FE 4MXVE 1DFBL 4NQED 4MB4A 2DQDL 5HI3C 2EC8A 2FD6H 3DWTA 2O61B 4QT5B 3RNQB 4ZSOE 4Q9CA 1MSPA 4DVRL 4YGAB 3IKCB 4TOYL 3FO1A 3DXAE 5F7LB 2XICA 1AR2A 3OKOA 4KH2A 3PHOB 1MPAL 3LKNB 5E0QA 4JZOA 3U4BH 1JGEA 1XF2B 4KZEH 4Q6IB 4PJHB 3WNPA 4ZAKC 4KVCL 3VH8A 5HYSG 2AP2A 25C8L 1M05B 1FLRH 2FB4L 4NKOB 5FHBL 1YMMA 4Z76A 1SY6L 1I7TB 3D0VA 4OV5B 4M6OL 3L5WB 4IRJB 5C09E 1MJJB 2YBRA 1BZQK 1FO0A 4OZIE 1IKFH 2AGJH 1XEDA 1YQ2A 1X5HA 5CILH 1KCSL 1CLZH 3IJSB 3MLPA 1NGWB 3RFZC 1G0XA 3GRWH 3SE3C 2EDOA 1P9MC 4NN6C 4X8JA 1PFCA 3LS5H 4JG0L 2MTPA 1DUZB 3MROA 5IW6B 2CGRH 5D6DC 1EEUA 3RU8L 5C0CB 3VD5A 2AEIT 3R8QA 5HGBB 4W70A 5D93C 1T66D 4PJFB 3SDCA 4L8CA 2ZCHL 4WI7A 1NEUA 4D8PB 3UTTB 3QI9A 5GGSB 3O3BB 2YN3A 3CLFL 3OGOE 3VWJA 1NCBH 2WUBL 3INUL 1T1ZB 2DBJA 5DK0A 5IBTH 4QKXB 1S9VB 4XPGL 4TUOA 3T0XA 3B9KC 1CDJA 1LO5A 4JFPB 1MJ7H 1KYOK 2CK0L 2JCCE 1RJYA 2DDQL 2OSLA 4I3RH 4M61A 1JTTA 4IHOA 1FNGA 4JFOA 4U0QB 1EHAA 3WXWH 2AKRA 1A7BA 1RK1B 1QVOA 3PDDA 5DYOA 3SGEI 1BAFL 3QUYB 5DF0A 4JDTH 1KUMA 3ZYJA 2N1KA 3F6IA 3IF1B 1R5IA 4HPOH 2Y06H 2XTJC 1XCTA 3CUPB 1MRCH 3HA0A 4WWKB 5K9JH 1P4LB 1CDGA 1L4IA 2VABB 1VEOA 4Y2DA 1ZANH 3V6FA 3GSNL 3MUGA 4POZC 2DQTL 1Z9MA 5GS0L 2VAAB 1M6OA 2Y7QB 5T1KD 3SDYH 1AO7A 2PW2A 4DW2L 1U3HB 2WBJD 1R3KA 3VRJB 1F6AB 2KL6A 1S7VA 1JYNA 3GBML 1UGNA 2X9YA 3MV8A 5CINH 4I8DA 2PN5A 2ZKHH 2ZSWB 3G6JE 4YHML 1FH5L 1KOAA 5EC2A 2P44B 2VUOA 3Q6FA 4U6VL 5KBNC 3CU7A 2JJTC 1TNMA 4JRXE 2F54E 4IEFB 3HC0A 1B2WH 4OM1H 4YXLH 3BKJL 3C2SA 3GNML 4L4VD 5HHOB 4B5EA 5I1EH 1CD0A 5FYKU 5HHNA 5EULV 4M3JA 3FZUD 4RMRA 2EXYC 3T8XA 4YDIH 5IHUH 5DQJB 3BGFB 4PG2A 2ADIB 4KJPC 1T0MA 2ENYA 1GXEA 3CFDB 4M7ZB 1AHWA 3OX8B 1U6AH 4AQOA 1JF1A 3OG4B 4BQ8A 1UB6A 3IS0X 2ZUSA 1SYSB 4PJ8C 1NANH 2CR3A 2ID5A 2GTZB 1KJ2A 1IAKA 3DVIA 5MP6H 3JTTA 2ICEA 5IIEA 4PP1D 1Z0MA 4QHNB 4HJJL 2VQTA 2B4CH 4EN3D 1RHHA 4TYUA 3VXSA 5DS8A 4M1CC 1CD8A 4JCLA 4ONHB 3S88L 5SWSB 1VGEL 3ARED 3F62A 3X13B 5I1DB 3BH8B 5CIPA 1OAXH 3O8XA 3G6AA 2ICWB 4U6XA 5D6CA 3TCLA 4HDIB 1YNLH 3IT8D 1RZJC 4LHJB 3W2DH 6FABL 3RWFB 4O51B 2AK4B 4I0KA 5I17A 5EZLB 4NQEB 4TNVK 1DBAL 8FABB 1I9JH 5GJTL 1TPXB 1BOGA 3C5SA 3F7RA 1G1YA 3DMMB 2PCPA 2XKNA 4KAQH 4MA3B 4Y16D 5D71H 5F88A 4X9IA 4TUJB 3KYMB 2FDBP 1CU4H 4NGHH 1AGFB 4Y4FB 3MLWL 4JKPH 1UENA 3EYOB 5EC1B 4TUKL 4A6YL 4YEFA 3Q6GL 3I3EA 5F9JA 3ARQA 2R2HA 3HRZA 2CLVA 4N0UB 3L3HA 1OQXA 5C70A 1FYTA 3ARBD 4KUZL