3IFLH

X-ray structure of amyloid beta peptide:antibody (abeta1-7:12a11) complex
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
220
structure length
214
Chain Sequence
QVTLKESGPGILKPSQTLSLTCSFSGFSLSTSGMSVGWIRQPSGLEWLAHIWWDDDKYYNPSLKSRLTISKDTSRNQVFLKITSVDTADTATYYCARRTTTADYFAYWGQGTTLTVSSAKTTPPSVYPLAPGSASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords 12A11 FAB antibody light chain
total genus 46
structure length 214
sequence length 220
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iflH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3iflH01
4GKNA 3VGHA 2HFGH 4RGMB 4BA8A 1IGIH 1HIMH 1Q38A 3DVGA 2ITCA 5FA4A 1WFTA 2FR4A 2CKNA 4HJJL 2DYPB 5AD0A 2PO6A 4JQVC 4I9WD 2A0LD 1UCBL 1FFQA 1CFTB 1IGCL 4NC1C 1R3HA 3IDJB 3TYGH 2EE6A 3BT2H 3TJHD 5D93C 5MEOB 1NBQA 3TM6A 1DZBA 5T1MA 1H3WM 3BP7B 4ALAH 4QHUA 3UTPD 4JDVB 3GK8L 2RFXB 5FM5O 4ZPVB 1FNSL 1IGIL 4WWID 2HFGL 3X13B 4K23H 1PQZA 4EN3C 4AK1A 1AKJB 2ZSWA 4PJ5B 5CJOL 3T65A 4QRTB 3ZT7A 1E4WL 2VE6B 4N0UB 1NFKA 2A6DB 3N85L 5FYLD 3IFNH 1T1WB 4PJGB 2MQCA 2OL3H 1S5IL 1D5BA 5IMMA 4E0RA 1I9IH 2NY4D 3MLZL 2Z91B 1M7DB 1XR8B 5CIPB 1WCBA 4QHLB 4X6CA 4G80A 3VXRB 4LPTA 3CUPB 1QNZL 1S9YB 4TSAL 2EYSB 5INDB 3K2MC 3QQ3B 1K5NA 4KHTL 2V7HA 1JP5A 3OZ9L 4JG0L 4BSVA 1UB6A 4CMHC 3QNYB 3SDYL 1VADA 4RGOH 5KSUA 1TJHL 2UWEE 1JNHA 1N6UA 1OCWL 2CDEA 1T1YA 4ETYA 3BDYL 5MI0C 5AG9A 5INCB 3W82A 3ULUD 2VZSA 2ZCHH 2IGFL 1S7WA 1DEEB 4MJ5A 4HD9A 4YPGA 1J11A 3BD4A 4Y4KC 5CILL 2PETA 1LEKA 3RBSA 3GKWH 5EBWA 2O93L 2IALB 1UM6L 2VKXA 4JRYB 4FFWD 3OX8B 5GISH 1RPQA 4IHOB 1FGNH 2DTMH 3G6JA 3I50L 3RWHB 2FHCA 5EZJB 4NKQB 1J8HE 4LBEA 1NC2D 3A6CH 3L3IB 1B0RB 3DBXA 3DVIA 4HULB 4JFFD 3EGSB 2DM3A 4YJZL 4EVNA 2JCCB 3NFNB 4YIQA 3GSRB 4EKXA 4XPAH 4UB0H 4FMFA 4ZMAT 3QO1B 4F9LA 3VH8G 4FQQA 3GIZH 1A5FL 3RPIB 1LEIB 4U1MB 3GRWL 4YHPB 3OKOB 2DQCL 2FRGP 4LNRB 1QLEH 2VXTH 5C2BL 5IK3B 5ACMA 4NBXB 2Z91A 2HT2D 5JHLL 3NMEA 3JWDH 4Q97A 4CU7A 4OGXH 5LGJB 3MCG1 1F3DH 3AY4C 3ARSA 3ARPA 3C5ZB 2JK5A 1P4BL 3LZFH 3ZDYF 1LD9A 2WUBH 4BZ1H 1KCUL 1F3JB 3RTQC 4ZXBC 4X4ZA 4RWHA 3G6AB 5A16A 4V1DE 3T0BA 2XRAL 5HBBA 4G5ZL 3MFFA 1BFSA 1H5BC 3BKYL 2AQ3A 1A6VH 3ES6B 1FORH 3V5HA 4MCYB 5ESVA 4JM2A 1MCRA 4Z7WF 2L7UA 3LKOA 3QUXC 4GSDL 4MD5A 1FBIH 5GRVK 2V5YA 1DBBL 3BWAA 4L4VE 4ODHH 4WI5A 1A1OA 1KIPA 1N8ZB 2VABB 3EYOB 1JWUB 2R9HC 4G9FB 4PG2C 2CMRH 1D9KD 5J3HC 3BYTA 3RHWK 4U1HA 3ULUL 1KJMA 1MI5D 2FECL 3ALXA 1TJIL 3PQYA 5E6IC 5EBWB 3T0EE 1L0QA 4M6ML 4I3SH 2OSLB 4LGPB 3K7UA 4R7DA 4HLZG 5CEZH 2XV6B 4LCYB 4U7MA 5C6TH 5IBLC 3ZYJA 3U9UA 5DHVH 1JUFB 3PWUB 5CKGA 3MNWB 3STBA 5KVGH 3U30C 4XP9H 5IBLD 3WKML 4FQQB 4JQIH 4K3JL 5I2IA 3TP4A 2I27N 2DQDL 3IJHB 4K55A 4P5KA 3DROA 2X7LB 4P2QB 2W60B 3LV3A 2W9EH 1D7FA 2NZ9C 5I1EH 1PJ9A 3L3JA 3RVTC 5IW6A 5ALCL 1UQSA 1HQ4A 1QR1B 4P2OC 5CSZB 4LQFL 4X6DB 2XQYG 4WV1B 1NCTA 5C09A 5C0IB 1QKZH 1JHTA 3IDYB 4IIQC 1T20A 3HRPA 4KI5E 4M7KH 5E4IA 1EXUB 5JNYA 3CCHA 3QPQC 2R0WH 4HXAH 2WQ8A 1FO0L 5D96C 3DXAD 3QSKB 3QUZB 4P23B 5L0QB 3BRFA 1A1OB 1KIPB 1N8ZA 4LQFH 4APQD 4TTDD 3ULVD 3CZFA 5IQ9A 4G6AC 2A77H 3R0NA 4LSTL 4OFPA 3TPUA 1EK3A 4LSVH 1ZT4B 2Q20A 4NBZB 3JWOH 3L7FB 4DQOH 5M7QA 3CK0L 1E6OH 5D7LD 2DQDH 4LLYA 3VFVB 4NNXA 4PPTA 1A6TA 1U8QA 2CLVA 4H26B 1DLHB 1NFIB 5KVGL 2AJ3B 3R0MA 3LEYL 4NQCD 5I8EA 5DJ6B 5F7EL 4WFGE 4J3OC 4XCEB 5CEZL 2APVA 3PUCA 4OF3A 3SEPA 4FZEL 2XZCH 5KSAC 1HHIB 4TNWF 5DJ0B 5DI8A 4JPKL 5JXED 5KS9F 1TJIH 3WEXB 1CU4H 4MQTB 3PF2A 4V2BA 3BVNA 3RX8A 2QQNL 3TA3A 1MY5A 5HGHB 4ODHL 4RGNC 5LWYL 3Q6FB 2A1WH 4JHBA 4WV1A 4GSDH 3OG4B 1FORL 1A6VL 1KJ2A 2OR8A 2PYEE 3ZKND 3KPQA 4Z5RB 3GMLA 3RX5A 4XPFL 5HYJD 4NSKB 5JXAH 4YC2C 5DD1L 1EGJA 4IOIB 4GS7B 2B2XL 1KCUH 1E6JH 4MXVF 4AEIL 4BZ1L 1CTNA 4NWTH 5MEPA 3GI9H 5JTWA 1G9MH 4LLWA 2Q86B 5D4QA 2CDFA 4WFEE 1I8MB 3NZHH 1WQVT 3QUKB 2K3TA 3PHQB 1CLZH 5JW5B 1R5IB 1ZS8B 3C5ZD 1S7XB 3OKNB 5B8CC 2PUQT 5A3IC 4ODVL 2CDEB 1VGEL 3TBTB 1OHQA 3CFBA 3JTTA 5C1MB 1U8KB 5I6XC 3VGAC 3GIZL 5DWUL 3B43A 1PX4A 2JB6A 4ZOBA 3BGMA 4PJEE 4ONHA 4XPAL 1BF2A 3D39B 4UT7H 4X0KA 3FOLA 2PO6D 5GGUB 3A6CL 4P2RD 2NR6C 1WIUA 4R2GC 2IAMB 5C92A 1S7RB 1I3VA 1MNUH 5DJ0A 5GISL 3KYNA 4JVWA 2GJ6B 2YN5A 5IB4B 4GT7A 4PRPA 3GKWL 4X5WA 3SO3B 2V9RA 1KTDB 1T3FB 3VG0H 1OLZA 2NYYC 4YHZL 1RZIA 2V7NA 3QB7C 1FNHA 3E2HC 1J0KA 5E4EB 4KJPC 1P84J 1EAJA 1HYSD 1C08B 4JFDA 1TJHH 3QUKA 3DI3B 2OR9L 1U95A 3MRNB 4NKIL 5I1KL 2C9AA 5T5FL 3VXSB 5CHNB 4X7FC 1YMME 3QUYA 2XKNB 4TSAH 1CLYL 3QWRA 3D6GA 3P0YH 1X3DA 1FYTD 1YYLL 3VFMA 5IBTH 1BX2B 5CJ5A 2JJUA 1KIRA 1A1NA 3BW9A 3QIWA 5E8EA 4WWKA 2CQVA 4FQIH 2XTLA 1EJ6A 2HTKD 2VLKA 2DICA 4XPHL 1CL7H 5SWSB 5FCUL 2OL3L 4ZS6C 1XZ0A 3NPZB 4LKXB 2GSGA 3I6KB 4HLZH 3IFNL 1Y18B 3JVGC 4OCXH 3SKMB 3FN9A 1F6AB 3UPRA 4Y4HB 4GKZB 3BE1L 4CGTA 2ICEB 4K23L 4L8BA 2A2QT 3E6HB 1FNSH 1X9QA 3GK8H 4P2RA 4YHPA 1BVKB 3S9DB 5DR5H 4XRCA 1HQ4B 1UH2A 4ALAL 5HHOD 1VCAA 1KFAL 5HJ3B 1LQSR 3MLTA 3BT2L 2M26A 2H32B 3QIUC 3ETBF 4L3EB 1IGCH 3N06B 3QXAB 5FCSH 1AI1H 3F62A 4PJEF 1IKFL 4U2ZA 4Q6IC 5I75C 2YKLH 1U58B 3D0LB 1HIML 1VEOA 3DYMA 2IFFH 5I15L 5E6ID 5A2IH 3WXWH 4GAGH 4CADB 5JW4M 5T1LD 4Z9KB 1QRND 1U2HA 1HKLH 3LOWA 1JRHI 4NKDB 3IVKA 2EO1A 4N0RA 1MWAH 4GOSA 1DUZA 3V52H 5D9SA 3VXMD 3S35H 1DTUA 2BJML 3MLWL 4R3SA 3WNNA 3LS4H 2DQTL 5HHXH 3VE0B 4KZEH 4ZUVB 3RZWA 4I3GA 4PS4L 1XF3A 1UXWA 4JLRA 5IJKA 2E3VA 2OJEB 3RWFA 4XNXL 2APWA 2PXYC 4C58B 3IT8D 3RZCB 5IESL 3U36A 2WBKA 5E95B 2CDFB 1UH3A 1NC2A 2OS7A 2CLRB 1X5KA 4QHLA 2W92A 4O58L 3UTTA 1I3UA 4HF5L 4YHNA 4KQ4H 3RA7H 1JHKL 4PRNA 3TN0B 3EYFB 1PG7W 3VDCA 3QFJB 1X6LA 2X4TB 4MJID 3P9WB 3L5WA 4OLUL 4DKEL 1XR9A 5HJ3A 2VH5H 4KTEL 2ED8A 3QNZA 1QFHA 4GXVH 4HCRA 4NM8H 1C12B 4GW4A 5D70L 2ICCA 15C8H 4ZFOB 3SE3A 3L3JB 1ZA6A 3FB5B 4D3CH 1YNKH 4XP4L 4RMUA 2E7BA 1Q9LA 1KB9K 5EZOL 2BHYA 5FYJE 3QO0A 4I48A 1X5IA 3SE4A 1NCAH 4EXKA 3W2DH 1A4KA 5F7DB 1C7TA 3NN8A 4DGVH 3FQNA 4X6EA 2LAAA 3C8KB 3UC0L 1DN0B 3NCYP 1INDH 1EO8H 2Y25A 5A3ID 4LSDA 4V2CB 5D7IA 4O02H 3DYOA 1PKQE 1JRHH 3VFPA 4YDKH 2CKBB 2R1XA 3T0XA 5D7KD 4LARH 4IM8A 3OB0K 3RDTA 3H2WA 1ONQA 2FWOA 3QQ9C 1NBVH 1R5VB 4MJ6B 3KPQB 3MRNA 3PWNA 4Y16D 5I66A 5KTEL 1H9VA 2X1WL 3MJ9L 4PRIB 3MLRH 2AABL 3NZ8A 4K3EH 4HZLB 2VMFA 4X9FA 5DC0A 5HYJE 5K9QI 4UZGA 3TH4T 2YD5A 1F11A 3O9WC 4Y4FB 5JO5B 3ILPB 4R2GD 1IEHA 1UZ6F 1NDGA 1HHHA 1YEHL 2E6PA 1YYML 4FQCH 2HT2C 3MUGA 4PJ7A 3FAXA 3BZDA 1K3ZA 5BV7H 3K8MA 4MNHA 4ZAKA 2VRAA 3QI9D 3FQXB 2I60L 4MXWH 35C8L 5IHLB 1T3FA 1C16A 2NX5B 4YBQC 5EWIL 1BOGA 1XMWA 5FO8B 4FP8L 1VPOH 1AGCA 3KPMB 2R4SH 4F7EB 2Z8VC 1FGVH 4JHWL 4UU9B 4RA0C 5DRWB 3WSQH 2KPNA 1NL0L 4P5TC 1IC4L 3I02A 4HDIB 1RUQH 3QHZH 3VXOB 4HWBA 4O2EB 3TBYB 3VRJB 3EBAA 3REWB 2B8OT 2P5WB 4XVTL 4XPBH 4WEBH 3LY6A 5D5ME 5HHMB 5L2JA 5CWSB 3R8BB 4I3RL 1NLDH 5IROA 1MCWM 1S7TB 1SVZA 4QNPF 5B8CA 5JOPE 4LRNH 2MOVA 4OKVA 2XWTB 2X4PA 5GXBB 1SBSL 1GOHA 1MCFA 4FZ8L 4PJXF 5ERWB 3DSNA 2A6KB 1MRFH 3IETA 1EBAA 1DVFA 5FGCB 4L8BB 3OKNA 4HEPG 4MJ4A 5HVGB 3AS1A 4B0MM 1MJ8H 4NZRH 3S36H 1YPZB 3GRWA 1OOAA 2ATPB 1QSFA 3MV9E 3SCMA 4NQTA 1U8KA 4F9PC 3QHTC 1NGYB 3UJIL 5LG1A 2Y6SC 3IFLL 2NW3B 2EH7L 5DRZA 5FKAA 1GHFH 3MLXH 3QDME 3U79A 1LP9F 2AJSL 4QCIB 2LU3A 4KI5C 3KAAA 5GSRA 3S34L 5EU5B 1FRGH 4KJWD 5EG6C 3UJJH 3HZKB 1T7YA 2VR5A 1N6QL 3KPNA 4NN7B 1OT1A 3O41A 4GQ9L 3MO1A 4HS3A 4MQSB 3H0TA 4OQTL 2FR4B 5BRZA 4YGAB 4JGJA 1KCRH 4IIQA 4WDIA 1FFRA 5CP7A 5MI0B 43CAA 4S0TD 3P3YA 4K7FB 4LKCA 4DGIH 3AY4A 1T22A 4XP5L 3ARWA 4ZFGL 4KFZC 1CVRA 3HCVB 1VEPA 3TCXA 4U31A 1UACH 3ARFD 1JWMB 3P11L 5C0CE 1K4DB 3S4SB 4CMMA 1A8JH 1ZLSH 4W6WB 5C86A 1I1AB 1UZ6E 3DXAB 3QUZD 4P23D 4P59H 3C60D 2DTSA 1MIML 4Y2OA 3JWDC 1CWVA 3CVHH 4BQ6A 2FX9L 1HQRA 5E99H 2QADC 4Y89A 3SDDB 3MRMA 1DVFD 4ONGH 5HGGS 2ID5A 3ULVE 5TE6H 1JK8B 3W9DA 4LLDB 3CH1B 5D2NB 1YEGH 1QFUL 1M1SA 4Q0XH 2AK4D 2OBGA 3SCMD 4JAMA 1DSFH 3BEWB 3DYPA 4ENED 5IOPA 3QZWA 5IUSA 4HQQH 3PWJB 3HPJB 1JNLL 5IMOA 1GAFL 1KPVA 1A47A 5FDYA 1XF4B 4KUZH 5A40E 5FM8A 1PX3A 3T04D 4PV9A 3PV7A 2O5YH 5F6IC 5F70A 4L4TE 4NDMB 1U95B 1AQKH 2LVCA 1ZVSB 1EGJL 4JB9L 1DQJB 4XMKH 2VITA 3TWCH 4GRWB 1YNLL 4Y4HC 4RAVB 1A7NH 1F02I 3CIQA 5JR1L 5B22A 1YUHA 1EH9A 1DR9A 3BKML 2HLAB 3AXLA 4NO3B 4X6DA 5D2LB 4M93C 3QEQA 2CGRH 5BXFA 4YWGH 1KB5A 3GSXA 4OF6A 1FL6A 4TTDC 3WFCH 3PGDA 3DLQR 3ZTNH 5DLML 1U6AL 3D25A 2J7LA 4IOFD 3SDXA 3MUHL 3EDFA 2EIDA 4R26H 1TQCB 1HHKA 2WWKO 3OAZK 3S5LB 3VI4E 1LP9A 5EUOE 2NXZB 5CZVH 2YPVL 3N9GH 1XGTA 4QOKB 2NY5C 2EH8H 5LJYH 4FXKB 3U7WL 1MFCL 4Y19A 1FCGA 4F57L 4QWWC 1V05A 3WN5C 3MV8B 1BVZA 1NAMB 3MRCB 3KYMA 4XNZB 2ZOKB 4U1IA 4JQXC 1INEH 3M1BB 5F96H 4YXHL 3WFDL 3MPCA 1I9RL 1JWUA 2ADGB 2X4RB 2YR3A 4BFIB 4H5SA 4MJ2A 4LVOB 4HK0B 3VE0A 4JPIA 3BP6B 4M43H 4PGEA 1M6OA 4L5FL 3ZTJG 3P77B 4O00A 3ZE0F 3VXUD 1R24A 2HVJB 5FM5M 4H8WL 2IG2L 2VAAB 2MTPA 5T3XD 1QFOA 2KQNA 4NQDD 1NEZA 3MOAH 5FHBH 1CGXA 5C7XL 4C56D 3FB7B 2AI0H 3ZL4H 3SE9H 1RURL 2YEZA 4YR6B 3U4EB 3MOBL 5IVNA 3TT1H 3WUWG 5LGJA 1YQVL 1MCOL 1WFOA 3VFGL 4ZO9A 2VAJA 1MAMH 3SDXB 1JN6B 4FQ1H 2DLFH 2Y23A 5AAMA 4Z7UB 2Z4QB 1JZ8A 2CUHA 2W9DH 4MQ7A 3FFCB 3V0WL 5HI3C 5KVEL 3KYOB 3CLEL 3V5HB 1GGUA 2DB8A 5IJVB 5D5MB 5EORL 3GI8L 4HFUH 3ROLB 1R3LA 4ZUWB 1BOYA 4P3CH 5IVXE 4Z8FL 4FQ2H 4HH8A 4NKMB 3E0GA 2QEJA 5JIHA 5B4MC 2UV3A 4HKJA 4U7SA 2YUVA 4AIOA 5DD3H 5DS8B 4PY8I 4WGVB 5E8OB 3HAEB 5TDOB 4W4OC 4M3KB 5CMAA 2M8XA 4D9RD 3VXTA 1FO0B 1HCFX 2J5LB 5JMOC 1TETL 3GZKA 4WY7L 5TGBA 4NCC1 4LPVA 3TFKC 4ZUSA 4GO6B 3OMZA 2YPKA 4HS6A 5MHSD 4OZHA 1IAIL 4PREA 1M7IA 4KK5D 4NQVA 3FRUB 2EXYD 3BD3A 1Z3GL 2XY1A 4KQ3L 4HBQA 5D1ZD 3TZVA 5ABDE 1Q9LB 4OLZL 4S1DD 4QTIH 4O5LH 4NZUL 3S88H 2YRPA 1K8IA 1RUML 4UOJA 4HIHB 4LHQB 3PGFH 1A6AB 1QFWI 4D0CA 2DD8L 5FF6A 3VFSB 4R2GB 3RU8L 3DX6B 3ZHLA 2OMNA 1WZ1L 2NCMA 1T20B 2JJWA 4L3ED 4IRSB 5T3ZH 3OKDB 5BV7C 4YHKL 5EBLA 2VDML 5GGRA 2EXWD 1B90A 2HLFC 2NXYB 2GK0A 3ARFC 4OTXH 4XMLL 4AIZB 5CZKA 1EVUA 1G6RL 1PQZB 5IHUL 4QRTA 2DBLL 3KS0H 4OGAC 4YLQT 4WI2A 1FLRL 2DJUA 1J9CT 3HMWL 3FQRB 3VXPB 3CVHB 1GSMA 3AC0A 1H3PL 3E8UH 3GUTA 1CLOL 3MYJA 3BN9C 1A14L 4O2CB 1B4JH 3O45B 3RJDA 3UTPE 4DK3A 5MEND 2DAVA 4MA3A 3VXNA 3I85A 2DMKA 1NCWL 2NLJA 1FE8H 5MERB 1KYOK 4GG6A 5JPNA 1VB9A 3O6LH 3BYYA 4BELD 1GPOL 1KTLA 3BP7A 3QFJE 5IT2H 3KWWA 2JB5H 4UT9H 2Y06H 5ERWA 4YNYA 5DJXB 1G6RA 4MS8D 2NY1B 1WCQA 5BVPL 3UCRA 1G7MA 2GHWB 4M1CC 5F9WB 3ULUF 2EDJA 3X13A 1UM4L 2R9HD 3SY0A 3GHBL 3VMOA 4MWFB 5IP4A 4FABH 5ISZD 2H1PL 5CLTA 2OZ4A 4PGJA 3LMJL 2WIIA 4RAVA 3O3EB 4LAQL 4JFFB 4YGVB 4XAKD 5I19H 1RZ8A 3P73A 4RISL 1MCBA 3FHQA 2FL5B 4HIIA 4HIXH 1HH6B 3HE6D 2G9HB 2Z31A 3MGOA 3GM8A 4XBPA 1L7TH 1JV5B 4O51B 3BQUA 1F4HA 1G6VK 2F58L 3ZT6A 4GBXC 3W81A 3SDCB 4POYA 4HS3B 6FABL 2R0LL 5HI5D 1CE1H 3MCKB 1VADB 4PRNB 4DUVA 4KC3B 4E41D 5DO2D 1A7RL 2QSTA 2WQRA 4M48H 3MV01 2AJYH 1AC6A 5KSAD 4GW5B 2FX7H 3MX0A 4PJ9C 2GSIB 3X12A 4Y5XC 2VLJA 4HIEA 1Q9WB 2BMKB 4XCYB 1C7SA 1NFIA 3QWOB 3NGBB 4NNYB 4K7PY 4WUUE 1WISA 5AYUL 4J8RA 1I1AA 4KRPB 3LN4A 3OJDB 5I18H 1KLGA 2EDTA 1U8PB 3MRGB 1X7QA 1AH1A 5F9JB 2LAGB 1YDPB 2I9TA 1X44A 4P46D 4KKLD 1I85A 1EO5A 1MFNA 3QCTH 4LVEA 8FABB 3Q3GB 1CG9B 2Q87A 3RNQA 3MBEB 5SX4I 4MLSA 2OXGA 3ALPA 1VHPA 4XHQA 4ZOCA 5BW7C 2QADB 3SJVA 1F2QA 4XC3H 1R3KB 4QXWA 3ZKNC 1R3JB 3OKOA 4O9HH 4G7VH 4X5LA 5FYLH 1IEBB 1OSZA 4HS6B 1G84A 5TF0A 4Q7DA 5JLZB 2XA8H 4OF7A 4L8CB 2ZOLB 4NT6B 5DHYA 3BPNB 1OP5K 3U1SL 3RY6C 3JTSA 5MEQB 5CD5C 3EKCA 4R7DB 5EPMA 1ETZB 1FZJB 3U7YL 3PWPD 7FABL 3MLTB 2RCSH 1OGAE 2L0DA 3QEQB 5ACLA 4XNQB 1IAOB 1RU9L 4NM4H 5EZLB 1D5XA 2Q6WA 2AV1A 3VFOB 2OYPA 3AU1B 3Q1SH 3RVVC 1WCBB 1SMOA 1KLGB 2X4OB 1RJCA 3D48R 5FKPB 4JFEE 4X7SH 1Q0XL 5GS0D 1AGCB 3KPMA 1JF1B 3GSVB 3G5YB 2ZJSL 2ESVA 1NUNB 2BFVH 5E2VH 4K94H 4M7ZC 3H9SA 4AMKL 4Z7VF 4ZFFA 4PJ5D 1OSPL 3O4LD 2GTWB 4KHXH 2EDKA 1A7BA 3MGAA 2HH0H 4G8GB 2M1KA 4X4YB 1TQCC 1YY8B 2BNUB 3PWVB 1D5MA 1OARL 1NC4A 4FG6D 2XZZA 4U1NB 1YEDA 5BCAA 5FFLA 4M5YL 2Q3AA 1D6EB 1ZMYA 4KJPD 4OF5A 1ZWIB 5EBMA 5DEGA 4PJHA 2D2OA 3Q3GA 3R4DA 1D6VH 4N8VG 3FONA 5DUPH 1LO4H 4MVBC 2V2TB 3O9WB 3CLFL 4YK4C 1SQ2N 4S1QL 5EO1A 1FYTA 2FX8H 4AL8H 2SEBB 3U0WL 5IV2A 2IH3A 3PV6A 4U6XB 1GGBL 2JCCE 5GRYA 3NAAH 1WBXB 1HINL 4WJ5B 4EUPG 5FO9B 5IHBA 4JREC 1Y6KR 5SWQA 1S7QA 4XCNA 3QWOA 3WO4C 3BHBA 1AR1C 1JN6A 4XI5D 3VWJC 1PSKH 2M2DA 5LBSL 3UDWC 3W5MA 4KY1L 4JRYE 4LLVA 4ZDHB 1GJIA 1ROWA 2EDOA 4QHKI 4K3DL 3ZHDA 1E4XL 1YJDL 1EZVX 3GSNL 5BS0E 1SJVA 5SX5H 5EFIB 5JUEH 4FTVD 1TCRA 5AZ2H 3DI2B 5A2KH 2X4SB 2BVEA 1P6FA 2DQEL 1JHLH 1BZ7B 4OGZA 3DSFL 3LRGA 4QRPE 4APQB 3DECA 1UEYA 5D1XC 2P8LA 4KGJA 1CF8L 5A2LH 3VFTA 5GGRY 3W11D 5F21B 1BQHG 4L4TB 4XBEL 1JZ5A 1KPUA 1DQLL 2D7PA 4UINL 5GIRB 1AE6L 4C59B 1WAAE 3FN3A 1HSBB 1NGXB 4MZ2A 4PRHB 5CSGA 5DRXB 5JLZA 2IH1B 2ZWLT 3MNVA 3INUH 3IJYA 12E8H 3TBVB 4NFBA 5GJSH 1QSEA 3T1WA 1R0AL 3GJEB 1WIOA 1PEWA 2VNCA 4OCYL 4CVXB 1AO7D 1VGKB 3UTTE 1NAMH 3U6RB 4M61A 5C0EB 3X14A 1KIRB 1JMZA 1TTGA 4JFOA 4PTTB 1BM3H 1KPRB 4KTDH 3VFRA 3QG7L 1T1WA 3NIGE 2ZNXA 5CUSH 3EYQD 3SOBL 2XQBH 4P3WA 3D9AH 1KCSL 2B39A 5L6YH 5TF1H 2CUIA 3HI1A 1NBZA 4IRJC 1D9KA 4MA1C 5IMLA 4UTBH 4QY8A 1G7HB 2F5AL 4TULH 4ODTH 2PNDA 3H9SE 5HHMD 4JE4B 4AT6A 1IZJA 1DBMH 3PWJA 2VC2H 3GNML 2ED7A 1CDCA 1CD1A 5GZND 4OLWL 1P5VA 2HJFA 3B9AA 4HEME 2P4AB 4NPYB 3P73B 5L9DL 4K7FA 4LF3A 4LU5L 1OAKL 2P48B 3MRFA 3T8XA 4N1HB 5CJQH 2ENSA 1NAKL 1UJ3A 5MP6H 1CXIA 1MHPH 1EEUA 3KR3H 1SY6L 4C4KT 4F3FA 5EU6A 4JO2L 1B88A 1CGSH 3GMQA 4F7MA 5IHZA 4HCRH 4JFEB 1KB5L 1K6QL 3SKOB 3PWPB 3MCKA 1JGUL 3C08H 3MRQA 1YPZE 1WFUA 4PRIE 5ACZA 2DQFB 3O2VH 4G6KH 1IAMA 4WW2C 2R29H 4EVNB 4P2RB 5FDWB 1UCTA 3UO1H 5JQ6H 4Z7UA 4K7PX 3TBSA 3KNBA 2YD6A 1BD2B 4TVPD 5DD0L 4EDXB 5BS0A 5CEZE 4OUUB 5C08B 2Q8AL 4YX2H 3F58H 2GJZB 4UOW0 5HTSA 4K8RD 5EN2A 3BH8A 3QPXL 4PJIB 5FYKU 3THMH 1AHWA 4G9DB 3DX7A 4PRPE 2XZAL 4M8QB 1IRAY 3J7HA 1N64H 4RRPA 4O4YL 3MJGX 4NO5B 4XNUL 5EO9A 5D7IF 5BOZG 4S1RH 5EUKA 4K7PH 2NY5H 1M05B 2FJGB 5EH1A 5MERA 4L3CB 2VLRA 2CR6A 4FQPA 3ZHKA 1KIQB 1WTLA 2BXYA 1MJUL 3FTGA 2P5EB 1C12A 4GW4B 4L29B 1MRDL 5GGTA 5CBAB 4JJ5B 2CRYA 4V1DB 1DUYB 3SPVB 1B0GB 5DF0A 5ESAB 3VFRB 2DM2A 1ZT7A 2NXZC 1UJ3B 4GBXB 2A6KA 2DQGH 1ETZA 4TTGA 2NY3B 1U93B 4NNYA 5BO1L 4OCSL 3B9KA 4RMWA 2W9LA 3IDGA 1QLFA 1NCBL 3RVUC 4EUPB 2VLKE 2VZ1A 1U58A 1Q0YH 3RZCA 1ZHKB 1U8NB 3HUJF 3T0DA 4LQ1A 4LPUA 4KRMB 5F1NB 2AJUL 4JFYB 5DQ9A 1KLUA 5GJTL 3OR6B 1RY7B 4KRPC 4MAUL 4GRLB 5ILTL 4DKAA 3MRDA 2WAHA 3SKJL 4TRPL 3VXOA 4XAKE 3VXUB 3F7QA 1HXYB 3ZDXE 3SHSA 2ZUTA 1H3UA 2YUZA 4Y1AB 2ZKHL 3B2VH 3BIKA 4IDJH 3TIDB 3SKNB 4UILL 2XACC 3FO1A 1OWWA 4JZOB 4LOUC 4RX4A 5EFIA 5GRJL 1RQ5A 4NUJA 3OKKB 5CZXD 4ZTOH 3DHJA 4J3SA 1MF2L 4MZ3A 4CL7A 1CBVH 1QBBA 4DCQB 4UV7L 1T0NB 1WK0A 1IAIM 1YEJH 1B3JA 4DW2L 3C60C 2HG5A 1BHGA 1KIQA 1S5HB 2Q76A 4NO3A 5E5UB 3N1MC 1WBXA 5FXCH 4GAJH 3RNKA 3LS5L 5I8OH 5JPNB 5FO7B 5DVKA 4FFZL 2UUDH 1GIGH 1CGTA 1BZ9A 4XHJC 2DN7A 4G7YH 3HNSH 5IWLC 1CFNA 3HG1A 3WIIL 5IBUB 1J88A 3SCMC 1EHLL 3B3IA 1P1ZB 1E4JA 4KK9D 1RK0A 1I9JL 4G6JH 4PLOB 4KI5D 1H0DA 2QHRH 4Z5RA 3O3EA 3Q5TA 4YGVA 2X1XR 5TQ2L 1HHJA 4JFYA 4ERSL 2B4CH 1J5OL 1PLGH 4RRPG 2MCPH 1AJ7L 5BZDB 4XVSH 5DMYA 2BVQA 5GGVY 3P0GB 3FRPG 3IAPA 1V7NH 4WFHD 2ZSVB 4K3HA 1QACA 2EEDA 4F7PB 4PR5B 3WJLA 5JW4Q 5E24E 4I0KA 3BQUD 3BXNB 2HT3C 1M71B 4M9OA 1J1OH 1SJHB 4OCRH 4A6YA 4OZIF 3V7AE 3HE6B 3NCJH 4F7TB 2UWEA 5DO2C 2MSPA 4KJQC 3H7BB 1EJOL 4MDIB 4D0DB 2Z93A 4NPYA 3QUMB 3HB3C 2NXYC 2D4FA 3SDCD 1HWHB 4U1NA 3QIUD 4QLRA 2W91A 4KAQH 2FB4L 4J6RH 4NGHH 1MCSA 1EBPA 5DJZA 5C6WH 5HVHB 1T83C 1BD2D 3CUPA 1MJ7H 5ICXB 1FAKT 2EIEA 1T2XA 2J4WH 3RGHA 1J1PH 3WS6C 2HVKA 1ZOXA 4PRHA 4U7KA 1CXKA 4F15C 1L6ZA 2VQ1A 1JPTL 5J89A 1LE9B 1KBGH 5CLWA 1RUPL 1RULL 1FZKB 4KMLB 5L2KB 5HY9B 2C1PB 1FP5A 3ARDD 4DFIA 4ODXA 3FFDB 2D0GA 1JZ2A 1P4IL 3BXNA 3BZ4B 4ZD3H 4XBGA 1FNFA 3U6RA 5B38B 1LO3H 5KJRL 4PB0L 4I5BA 3TNMB 1CQYA 3L3OB 2A9NL 1KC5L 1XIWD 2V2WB 1FJ1A 4KJYB 2F53B 2R4RL 1Q72H 2NNAA 1JYXA 3A6BL 3CZJA 4XX1E 5JA9A 1FPTL 2GJJA 1XIWC 1HXMB 4TPRH 4PJ8B 1OF2A 2AJVH 1YEKL 3MBEA 3ARFB 3C5JB 1U91A 2VDQH 3P4OB 3KLSA 3F6IA 2X09A 3SE8H 1YMMD 3G5VA 3MLVL 3CFCL 1JGEA 4JKLA 1JUFA 2FATH 1LD9B 4O2EA 2G60H 4MD0B 4ODUA 1BGXH 5TE7L 3E6HA 3BKJL 3W39A 3D0VA 4HIJA 4JPIB 1ONQB 4DVBA 5EOCJ 1TTUA 2IPUG 2PCPB 4PJBB 3RL1A 4RFNC 3PJSA 1Q94B 2VIRB 2ICWA 3V0AC 4HWBL 1PYWA 5IMKB 2VXUL 4JN1H 3SDAB 4ELMB 3F7YB 5IB5B 3UTZB 3P30L 4F58H 4ZQKA 1T0NA 1NGQL 3SBWA 1A1NB 3BW9B 5I1IL 5IF0B 3CXDH 4CVWA 1OY3B 4GLRI 5DZOA 1RK1B 3IDIB 2AK1H 1F97A 2GY5A 1FG2B 3SO5A 3SGKC 4MA7H 3U0TA 1U3HC 2DQIH 2NLJB 4RWYH 3DUUA 4H20L 4OIIH 3DJ9A 3IF1A 3WNKA 3O6FC 4OZ4A 2ATPA 1QLRB 4Y1AA 2EDXA 2Z31D 3SDDD 4M1DL 3DRQB 5FM4A 1LMKA 4R4BA 2GKIA 1M6OB 3IJHA 2VITB 1JFQL 2NTFA 2VXQH 5HYSB 4TUOA 3QFDB 3EYUL 3QDJD 4KRLB 5HYQB 3CDGA 1FV1A 1NKOA 2EDHA 4WW2B 4G3YL 1T6VN 4X8XA 4L8CA 1ES0A 3RKPA 3MV9B 4NYLB 2VERN 3BPNC 5FYKE 5T1KB 5EOCL 3DTXA 2MKLC 1OAQL 1W0YT 4NQSB 1FZJA 1CGYA 4QXGL 4P5TA 2R0KH 2Y36L 3UJTH 5TFSH 3WNOA 4JANA 1T1ZB 3U83A 4CU6A 3N50A 1BAFL 3H8NA 4JFQA 3LRSA 1EHAA 4JDZB 1NMBH 3JUZA 2X05A 4Q9RH 3B6SA 1LVEA 1A9EB 5H8DA 3ARDA 3SPVA 1WC7B 4IDLA 2WW8A 4F7TA 5ALBL 2X41A 2DLTA 4V1DA 4RMQA 1YEIH 5D1ZC 3U0TB 1FVEB 2PYEB 1U8LB 1C8PA 1G7JA 3NH7L 4S1DC 1ZLUH 1DL7L 1DEEA 3RUGE 3VH8A 1P9MC 4EOWL 4Z0BL 4Z76B 2VDNH 4JEGB 1UVQB 3TV3L 5FA3B 3WL9A 4BFGA 5LGKA 2QQKL 5CINL 1F8TH 4QOKD 3LD8B 1MUJA 1W0VB 5C0CD 1XF1A 3HC3H 5I1JL 4YQXL 1P5UA 1BLNB 4PG2A 3FL7A 2VZ3A 3BEWA 4JJHA 1BP3B 5IKCB 2D0HA 1KGCD 5JIKA 1AFVH 5KVMC 4D0BB 4K2UH 3SGKA 4P48A 2DOCA 2F8XC 3FB8B 3PDDA 4YFLF 1X5LA 4YHMH 1JGLL 2K1MA 2R2HB 2ZUYA 3H3KA 2I5YL 2OLDA 4LHUD 1BBJA 3VD7A 2CJUH 5KVFL 4JREB 1I3GL 5B38A 2RBLA 4R96B 4PJFE 3IDXL 1IGTA 3UZQA 1XGYL 2IJ0C 3DXAA 2LU4A 3FMGL 2R2EB 3P9LB 1IQWH 3F12B 1I4FA 4NJ9L 2E8ZA 1UEMA 4R4FH 2NY2B 1IGYB 3QEGH 4RFEA 1U8MB 4TSBL 5F7DA 3ZYIA 2DF3A 2VZTA 1R5WB 4CAGA 4PJ8A 4Y2DD 1RZGB 1QYGL 4YNYB 5ITBH 1M7XA 1AGEA 5DQJA 3Q6GH 1CE6A 3OKEB 4JZNB 2KQMA 2X10A 3L5JA 2VDRL 1F4XH 1RZJC 1Y6MR 2GYSA 1JF1A 2J88H 5E1AA 4OD3H 3WFBL 5K59F 1GGIL 3P9MA 2ERJB 1CDHA 2WMPA 3VJ6B 2B1AH 1L9MA 3LCYA 5KSVA 5HI5C 1C5DA 1CIDA 1XEDA 1OTUC 1P7KA 2V2XA 3ROOB 4RQQA 4X7CC 2Q7YB 4JFHE 4MA3B 3CMOL 2FECI 2YXMA 3V95A 2YPLB 4XGZA 5BVJA 4QWWD 4H1LH 4DAGH 1JL8A 4HX1B 3NACH 1VFOA 3MNWA 1A1MB 2F54A 3RWEA 1CVSC 4MCZA 4UT6H 3IU4L 3SDAD 3WFHA 4TNWK 2OL3B 3J8F7 1S9VA 3BDXA 3MACL 3B5TA 1OM3L 1ADQL 4GW5A 4HMEA 4LSRH 4XP6L 4K9EH 3NFSH 4HIEB 4QYOA 2V5MA 1MFDH 4CJ1A 1YN6B 5I30L 1N5YH 4PJ9A 1O0VA 3BGMB 3IXAB 1GGYA 1NMAH 4N0FA 1GC1L 4GFTB 2YD9A 4L4VD 1IKNC 4JO1L 3CFDB 2P43B 3EO1A 5DUBB 4ETQB 3X3FL 2H6PB 5IFHH 4NKOB 3TNNA 3QAZB 5JW3L 5LXGH 1J87A 2Z31B 2HJLB 1JGDA 3QEQE 4APQC 2X42A 1AGFA 2KBGA 3HI6H 3LH2H 4HKXB 4HS8H 4LPYA 1J1XH 5IVZA 3QH3A 1FCCA 1R3IL 2P46B 4HGWA 5DVLA 4JY6B 1FIEA 4NJAH 3VD5A 3MCLL 4L9DA 2Y5EA 2OP4L 2DKMA 4Z78B 2R56H 4LDLB 2ZSVA 1VFUA 2OR7A 2NY7L 2XYCA 4TVPH 4AH2A 4M62L 5F1IB 1DN0A 2MFNA 2JTDA 1REIA 3HZMB 4X4XA 2N7BA 1OPGL 2GEEA 3OGCB 4K8RL 5LAXB 4DZ8B 5BOPA 5C0AB 2E6JA 5GRUH 4JRXE 1AIFA 3D3VE 2ICES 3LB6C 1MWAA 2V2XB 4KK8D 3OV6A 3RWIB 3TZVC 4TOYL 3I3EA 3WV0A 2VN7A 3VW3L 3BGFC 1MHHB 2BRQA 2KKQA 4WWKC 1C5BH 1G7PB 4XCCH 2DQFA 2UZIH 4I9WE 1ZTXH 3EDDA 4N8CL 4WJ5A 5EULV 1F6AA 2MCG1 1QPXA 4M6OH 4X6DF 5E9DB 4CMMB 5BMFL 1EHXA 2WWKT 3OWEA 3VFUB 1UWXK 3RGVA 3L3GA 1PGRB 5KG9B 1ZAGA 2V9QA 3WXVH 4MJIA 4LCCB 4XPGL 1J0IA 5B39A 4DTGL 4PV8B 1BLNA 1JNNL 4HMDA 3QDGD 1IC5H 1T0PB 1ZWIA 5TQ0L 4HKJB 1MCEA 5JOPD 4LASH 1LDSA 4MA8H 3K2UL 4U2YA 3VXUA 2HFFB 1RZ7H 3CFIC 4KKCC 5EU3B 3BISA 3O6KH 3QIWD 2PCPA 4PJBA 3T2QA 4HV8A 4WI6A 4BSWA 1AD0B 1OTSD 4JFXB 4EI5C 1HEZA 3LPGA 4JFDE 4YDLC 3S4SA 4ONOA 1UKTA 1QSEE 3G5XA 5EZIH 3VMPA 1Z5LA 4LHUA 4Z7WB 4WNQB 1X4YA 4JANB 3EOAB 1OAYL 1CN4A 3VCLB 2B1HL 3D2UB 3ZKSD 4S1SH 1UJTA 4TQEH 2FO4A 1LHZA 4L1HA 4ONFH 5IEHA 1NCCH 5E2TL 3S5LG 1CXEA 5HPMB 5KSBB 3KYNB 5I71B 1PW3A 3WKNA 1LWRA 2BVOA 4JFED 3HA0A 1XCQB 2OK0L 3TEUA 1IGFH 3OB0H 1V3MA 2OJEA 2CXKA 1LO0H 5JA8B 4PRAB 1FAIH 1D5IL 2GAZB 2FJHA 5L0QC 5ESAA 1AP2B 2ZPKH 4MS8C 3PHSA 1NEZG 3GSWB 4I77L 2VR4A 4MMZC 3O3AA 5ID1B 3DVFA 2ZZUT 1C5CL 4NQEB 4YHLL 3PHQA 1F5WA 4HWEL 4ZS7H 3VDBA 5DQJB 1FH5H 4PBXA 1R5IA 1ZS8A 5HGDB 4Y7MA 3SGEH 1NGPL 4KWUA 1BVLA 1G9NC 2EDWA 1T0MA 4PRBA 4N9GA 4ZUTB 2Q8BL 3WLBA 3QT2A 1S3KL 2QQLH 4WNQA 4NQUA 4XI5C 1QSVA 5B3JF 4LLDA 3PHOA 1V3JA 4HH9B 3UTQB 2L7JA 1QFWH 3DMMB 3EOTL 3KPLB 4GQPH 5T1MB 5A43C 3DRQA 4BFEA 4JKWA 1VERA 3LKOB 2C3VB 3QRFM 4WU5B 3BIKB 4WV1C 1N3NB 4XB7A 1T5WA 2PXYD 2YD3A 2FWOB 3QH3B 5IJVA 1I1RA 1IGMH 2X89D 2IMMA 2FJFB 1WTGT 2J6EL 3BP6A 5DMIL 3LIZH 1VKXA 2OSLA 3DVGB 1F4WL 1NBYB 1RVFL 5D1XA 1JPGA 4AENA 5DUMH 1OB1A 3H7LA 4OBRA 2BVQB 1SM3L 3REVA 5LGHH 4X4XB 4N90E 4XP1H 3UX9B 4MHHI 4N5ED 4BUGA 2A6JA 1N0XH 3TPKA 3X11B 1DBJH 2V5TA 4MNHB 1U3YA 4FTVB 1MI5E 3QI9A 4JM2C 4DGYH 4YXKL 5BRZB 3L5HA 2PKDA 4XB8A 1JWSB 4XWGL 4OGYH 1T04B 5CJXC 4KDVA 3WIHL 3KVQA 3O6ML 4OIBA 4ELKA 1U42A 1YZZA 1CDIA 4HH9A 3IFOA 4P2RE 1A6UL 1DUYA 3MBXL 4HT1L 4XGZB 2A6IB 3L95A 5TPWL 5CSZA 5TE4H 4HFWA 4WTZG 2DLEA 1A4JB 2X1QA 2MHAB 5LQBL 2HLAA 1U3HA 4NOFA 3OR7B 1TENA 3RVUD 1KEGH 4KPHL 2D7TH 1AO7B 3M8OH 2HKFH 4M1GL 1EEYA 4DN4L 1MFAL 1GZQA 3T0WA 2NY2C 2BX5A 4H25A 2FEDC 3QRGH 1RUAH 5I1CL 4JHAL 1M4KA 2F5BH 5IROC 4J4PA 1DLFH 1UM5L 3WMSA 3R1GL 1W8OA 3MV7B 3O9WD 3IGAA 3HE7B 1UKSA 1JBJA 3RRQA 3TVMA 5GGVL 3D39A 3LQAC 1DQQB 1LO2H 4NZTH 4M00A 5DEFB 5HGAA 3P9LA 2R2EA 2AJXL 4J1UA 3D3VD 1FIGH 2P8PA 3WBDA 5AZEH 4NQXA 1KUMA 3ZE1F 3S7GA 1WEJL 4W81A 3PGCB 1DQML 1I7TA 3LN5A 3V4PL 5CCKH 3H42H 5D6DA 1FG2A 4Q74A 4PJGA 3W9EB 1YECH 3GBNH 3P4LA 3VD9A 3T2NL 5CP3H 4OLYL 2GUOA 4IRSA 1XIWB 4B5EA 4OAWA 3WHE0 3BFOA 3IDMB 3U30B 4P4KB 4HGKC 2XTJD 1U93A 4GMTL 4I0PB 3UTOA 5ENWB 3GJFH 2BSRA 4OIAA 1X5YA 3QQ3A 4Y5YC 1WZMA 5KSVB 2B0SH 2BDNH 5HVHC 1F3RB 4OT1L 1DBAH 1WBZB 3EYOA 4DVRH 1KIUA 3A67L 3GMLB 3D0VB 4G9FA 1BIHA 3DRTB 3PP4L 1KN4L 3C2SA 1U8OB 4OSUH 4PG9A 4QNPE 2R8SL 4L4VA 4QO1A 3VFNB 4G43B 4L3CA 3VI3F 1ZKAA 3O2DA 3I6GB 4MNGA 5F7HA 3O0RH 2IQ9H 1CYGA 4R6UA 5E1HB 2E9JA 1G7LA 2JF1A 1NCDL 2NY3D 4L8DB 3EO9H 5I1LB 1MIEH 3HNVL 1HHIA 1NFDF 1WWBX 2AEPH 4XAWH 5D7JC 4Q9QH 3TO4C 1FC1A 4OF0A 3QJHB 1EX0A 3BP4A 1A3RL 3FO2B 5E6IB 3IDUA 3NCEB 1BD2A 4EDXA 5BS0B 3VXSA 3DURB 4J1UB 1ZHLA 5KVDL 1YMHA 5KW9H 3TFKD 4P2CG 2KDGA 3RKDC 1DJSA 3NCYS 4U0RB 4DKFL 3F8UB 5FUCE 3BKCL 2R69H 2FSEA 2A73B 1B6DA 4GG8A 4CUCA 1ACYH 2HT4C 5F7LB 4ZPTB 5E8DH 4BK4A 1DFBL 4YE4L 8CGTA 2D03H 5E9DD 2QBWA 4LSSH 4ENEC 3VWKC 1ZLUK 1SJEA 4U6VL 4BZ2H 1Y18A 3D1MC 4X5WB 1UG9A 2NQCA 2BCKA 2IALA 4JRYA 4NWUL 1VFAA 2Y7QA 2NPLX 1MCNA 1P7HL 5H94B 1VA9A 2Y07H 2XWJB 3KWWB 3NABL 4R8WH 3ZO0A 2X4PB 2O5ZH 3S5LA 5B3NA 4KK6D 5HYSG 5JORA 3VXRD 2VDKL 3IDYC 3LHPL 3HZYA 2BRRL 3S3JA 5EA0H 3L95B 5FHAH 4UTAH 1QTYT 3NA9L 3QCVL 3H3PH 3I9GL 4Q6IB 1W72B 4N0YH 3LN4B 1V7MH 2YSSA 1I1FB 1JIBA 4MCZB 4EI5B 1ZANL 4OM0L 5AWNH 5C0BA 2HKHH 2VE6A 1OAXH 4L9LA 5EUOB 1T1XB 2VQUA 2I07B 32C2B 2EEAA 2A6JB 5KN5B 3CSYB 4LSQH 3RAJL 3BAEL 1PEZA 3KJ6L 1D5BB 1MH5A 1DUZB 1RMFH 3CVIL 2VDPL 1JZ4A 1YQ2A 2DYPA 3MMEA 2F54D 1MREH 4XC1H 4YPJA 2AW2A 4G8GA 5E8OA 1MI5A 3GGWB 3QDGE 4P0DA 2ZG2A 1P6AB 1UWEL 4ORZC 4S10A 4YXLL 1ORQA 1I7ZA 5I71C 3MODL 1NGZB 2VABA 5AD0B 1IM9B 1YPZF 3KS0J 4J4PD 2F19H 2FBJH 3UP1A 5GGTL 4YXLH 2EYTB 4YHIA 4Z95H 3DUHA 3P4NA 5T1KA 5L88H 4MQXD 4MSWA 3TJHC 4PJAB 1IFHH 3WUWA 4XCEA 4XC1L 4TUKL 1MAJA 2H26A 4KI5F 2UYLA 5JZ7C 4P5MA 1Z2KA 1YEFL 1QQDA 1RZKL 3SDXE 4P9MH 4WHYH 1JMXA 4U1SB 3BJLA 5E6YA 1O7VA 4NHCH 3GBMH 3NTCL 5AWNL 5I73C 1JYWA 4C56A 4YDVA 4LAJH 4HFWB 5TDNA 1V7ML 3G6JF 5IW1A 2BVUA 2OX5A 5FYJL 3WD5L 5B4MD 3RWFB 3H3PL 4R96A 3NA9H 2AKRB 4JN2B 2PYED 1EFXD 1FDLH 1RD6A 3ZKXC 2R0ZL 4X8JB 4I2XA 1KJ2H 1MFEH 4E41B 1RJZB 3VXME 1F42A 1NC4D 4OZIB 5KOMC 2IPKA 1NSNH 2I26N 4L8DA 4F33A 5HD8C 3MZTA 5AEAA 1RZJH 3MV8E 1AXSB 5IKCA 5FYLE 5EOQL 3FB6A 2XPGA 3RL1B 5JORB 3V5KA 2XG4A 5HD8D 4NWUH 2APBA 4ZXBD 3JBG7 2MPAH 5IM7A 5GGSB 1I7RB 1MPAL 1RZKC 4G6MH 4BZ2L 4NP4L 1CLCA 4S0SD 1S7WB 1ZK9A 2AXJA 3X12B 4NQCE 3WS3A 1RI8A 5JIPA 3OHXA 3IKCB 3O11B 1WT5C 4ONHB 2G2RA 4X5XB 4UQ3A 3MV11 3T77B 3TPUB 1KB5B 1P7KB 3GSXB 2FD6H 5DT1H 4JO3H 1EZVY 3BSZH 1S9WA 2P7TA 2XZQL 3OJVC 3ME0A 4PGBA 1S9KC 2DQJL 4GLRH 3C2AL 4APQA 3RWCB 1UADC 3HG1D 3OKMB 2VXSH 3UTTD 3GO1H 1A3RH 3VXQA 2FO4B 2HTKC 1HZHL 2RAMA 4FQLH 2W65A 1CE6B 3OKEA 4YBLB 1HI6B 1K2DA 4LCYA 4NQED 4P5TB 5HDLA 1OD9A 4H1LA 1A6PA 2CDGA 4JKPL 1T1ZA 1MIEL 1CFVL 1C1EH 3EO9L 2JIXB 3I75A 2F8VA 2AEIT 1RIHL 4G8GE 4CU8A 4WCYH 1AXSA 4HUXB 2AXFB 1CD8A 2IQ9L 2YD4A 4ZFZB 4JVUA 3FB6B 1CICA 3MRJB 3IFOB 5CWSA 5EU4A 3CFBB 3W0WD 4WO4C 4EXPX 2A6IA 4MD5B 3BPCB 1KN4H 2IBZX 5K9QG 1BQLL 1MAKA 5GS1C 2MHAA 1KENH 3O3UN 4PR5A 3G6AA 1G1CA 1N5AA 5EC2A 5FGSA 3RZCC 1PVHA 2BY2A 5ID0B 4EZMA 4GMTH 4MVBD 2J8UF 4L9LC 2DLHA 2HLFD 4LIQL 4UI2A 4ISVA 4F7EA 1N2RB 1MCPH 4OLVL 2FYYB 4HPOL 3RZCD 4JR9H 5IFAL 2IQAA 4WUKL 3QCUL 1E28A 1YECL 3GBNL 4JPWH 3GFUA 3VFPB 3LKRA 1PZUB 4DVBB 2EE2A 1ITCA 2J2ZA 3HC4L 1RZIB 5DD6B 2DL2A 2KZWA 4FS0A 3U0PA 4XX1G 5JW4R 5F7UA 1SYSA 3K1KC 5K59E 5DHVA 2IF7A 3FO0H 1A6WL 3SDAA 5I75B 2BZDA 2X4QA 3G9AB 1EFQA 1NDMB 4CDGC 2AJXH 4Z7NF 2YWZA 1AGDA 5FGBA 5EU5A 4GRMA 5FUZH 5DYOB 1IGJB 3O3AB 1OAUH 2J6EA 4NQXB 1JTOA 4YDLB 4UV4L 3X17A 3QQ4B 5HYFA 1UXSA 4KK5C 3ARDB 3R1GH 1U41A 3CFEA 3KYKH 1EO7A 1KT2B 3FHAA 4LBEB 1UWGH 4ZO7A 2BXZA 2YRZA 2F5BL 3C6LC 4LCIH 4DEPB 4PP1C 4JM4L 5HHOA 3W11C 5ADOH 1G0DA 25C8L 4EQ2A 3UYRL 3WFHB 4DN4H 3GMRB 3QFJA 4NQVB 3M8OL 4GW1B 1UWXH 1N7ML 1P1ZA 2ED9A 3VG9C 3O2WL 2IMNA 3T0VA 4F8TA 3ESUF 4ISVB 3MC0A 3PNWB 4NDMA 3GM0A 3DETC 3HTLX 4LCCC 5D72L 1FV1B 4WW2A 4LHUG 1N7MH 4FFVD 2VXVH 4KVCH 5FV2A 3MUJA 4E42B 4M5ZH 5TE4L 25C8H 3RWCA 1YMMB 1G7IA 4LLUA 2DQHH 2E8YA 3RNQB 5I1GH 5ADOL 4JM4H 4Y4FC 5ICZB 1KJ2B 5E03A 2OI9B 5KANI 5IG7A 2EKSB 2OQJA 3S37H 1WSST 4UV4H 3NIFE 1LNUA 1ZA3A 2CUMA 4UIKH 1OTUD 3UBXG 2R1YB 1DBJL 2E27H 4KJQD 3MRQB 3V4UL 4FTVE 4KV5E 3NCMA 4XP1L 5LGHL 1A6WH 1SM3H 3FO0L 5FK9B 3SKNA 3F65A 3RVTD 1F6LL 2BVYA 2X9WA 3EFDL 5E2UH 4GBXA 3V6FB 4ZNCD 2ICWJ 3F7YA 5IW1B 1BQHB 4JRYD 4KMQA 5I74B 2Z8WC 2VLJE 1MLCB 1IGML 3EUUA 1RJYA 4OUUA 4JR9L 4W70A 4HPOH 4X4ME 5I8EB 5I17A 3GSQB 2VDOL 5IQ7L 1QP1A 4BSJA 2E6QA 4LIQH 5F1NA 5DVMA 4XXCC 1U8NA 3WNLA 1QD0A 1JK8A 4I18C 4BJLA 1T80A 1CXFA 3OJ2C 4OZ4B 5DHXB 5CIPH 4X6CB 1TXKA 2PXYA 4RCAA 1IAKA 4RIRA 3IB4A 5AUMB 2DM7A 4GRWE 2VL5A 1U0QA 2C4FU 3HFML 2C3XA 4Y4HA 5HDQH 4I0PA 3OF6D 3VGEA 4XNYL 4IOFC 3OGCA 2AERT 5CD5D 1TQBC 4R90H 3PL6C 2NY4B 3WL9B 1C5CH 1H0DB 5D7SH 3WJJA 1C1EL 2J5LC 5C9JA 1CFVH 3BEVB 2E7LA 3R06A 3PL6D 3IDNB 3QG6B 5JPMB 3HI5H 1NPUA 5E9DA 4OCWH 5E08L 4JY5L 2YHGA 3DARA 3GO1L 3U82B 3UTSD 4HC1A 4NKMA 3RJQB 5J1TC 1J8HB 5CHNA 3C2AH 1IGFL 3RWIA 3B6SB 2WSKA 5L8LB 2DWDB 3VRLE 5FO7A 2XZQH 1XCTA 5CJ8A 1ZGLB 5L7XH 3V4VH 4PLJC 3L3IA 1G0YR 3CFDA 2P5EE 5DFVC 1T83A 2UZYB 4P46C 3S96A 3IETB 1KCKA 1F58L 4JFZH 1FFPA 4WFGD 3PHOB 5DJ8B 5HVFB 2BNRB 4X83A 5F71A 4S1SL 2WLZA 1AGBA 1MHEB 4LPWA 4MQ7B 5GRZA 1BIIB 1CZ8H 3TN0A 3RGVB 2LQRA 2PO6C 1N59A 2NYYD 4JQVA 4AM0A 2QR0A 2G2RB 4IRZL 4X5XA 1UVQA 3RTQD 4IRSD 2D7QA 5HPMA 3L7EA 4G6ML 3RPIA 1MPAH 1OAYH 3F12A 3TBYA 3HMXA 3MGTB 2MPAL 2X4NA 2NXZD 3QUMH 3P0VL 1G7QB 2Y6SD 3ARUA 5I1HH 3RKDD 4H5SB 2VQTA 1QSFE 4JG1H 2J8UE 3DX8B 4M8VA 1F3DJ 4QXUL 1EAPA 1DBKL 5I0ZA 1S9XA 1NSNL 1B0WA 1OAZL 4JPVL 1KT2A 1MY7A 5JDSB 1MFEL 5EUOF 5GS0H 3G6JB 3EIFA 4KRNA 3QIWC 3I2CH 3JTTB 3MRDB 4DN3L 4JZJA 4MA8L 4Y5VC 1OVZA 4KGLA 3BGAA 1A3QA 4WVRA 2CD0A 2CH8A 4N1EA 4N8PA 3WD5H 5EIIA 3QYCA 1DQDH 4PTUA 1MCLA 5IEHB 2CRIA 1JNNH 3NTCH 3GBML 4FQXA 4YDVB 4DTGH 1Z0NA 2EEBA 5F9WC 4Y5YB 1BWWA 4G8FA 4LP4A 3WXVL 1RZKH 2CSPA 5C0CA 4JN2A 1XCTB 5BMFH 1YY8A 2BNUA 1IM3B 1IFHL 1D3CA 4WRLA 5IVXF 1GVIA 1ZTXL 1IQDA 3DX7B 3FQNB 5DZNA 4JFQB 5GGTH 1KCVL 2VYRE 4HJ0D 1HILB 2AV7A 4M1CD 1NFDE 3MFFB 4K8RH 4G42B 1YC8A 2EE3A 4LLQA 5DK2B 2LFGA 4TVPL 4WHCA 1AR2A 1HDMA 3WHXA 4KMTH 2OP4H 3UTQA 1CR9H 4QXTB 3AVEA 5J11C 1MREL 5DTFB 1KEML 4YBHA 1OQOA 4M7JH 1R3IH 3BHBB 4XNZC 1CDGA 2VDPH 4D9LL 3CAFA 1RMFL 2OJZL 3BAEH 4LSQL 3RAJH 3U2SB 5LXGL 4LVOC 1YY9D 1U8MA 4P9HL 3NIDE 3MGOB 2QJDA 3FB5A 4WTXA 5C0JA 5HHPB 3QIBA 2Y4SA 4WHTA 3HC0B 1YY9C 4JDTL 3ARFA 3C5JA 1FYTE 1GC1H 1NMAL 1HOCA 1T2JA 3T0ED 1WGOA 3VWKB 1WWWX 4YHOL 4I4WA 4N0YL 2JCCA 3FCTA 4YIQB 1KLUB 3NFSL 4K9EL 3QCVH 5HYJB 5FHAL 4UTAL 2FNBA 1YEDB 4PGDA 4IJ3C 3K8KA 4BKLB 3LHPH 5D8JL 5J6HA 3NCBB 1XF2A 3IU4H 5EO0B 3SQOH 4NQDE 3LDBC 4NC1E 1CICB 1CFBA 4R8WL 3JTSB 4K71C 2CK0L 5HGDA 3JWNC 3VFMB 1ZHBB 2YBRA 1BFOB 3NOIA 4PP2A 1JHTB 4M6NL 3AS3A 5E0QA 1A1MA 3D39E 2PW1A 3VFOA 4TN9A 4HZAA 1RJZA 3L3KB 3QNXA 4Z77A 2D03L 3VFWA 1A2YB 1SEQH 3IYLW 2J88L 4JDZA 2ILLA 4NUGL 3L3DA 2DIAA 4RAUB 1J8HD 3SKUD 4XXDB 2DIJA 4PJ9B 3VGBA 3MV7E 2WWMC 4FQXB 1EEQA 5CD3A 4LDEB 5KW9L 1WF5A 2XNAA 3PNWA 1CD9B 4K8RC 3S35X 4H25B 1ZHKA 3OHXB 4MJIE 4M7ZB 3QFDA 4Y2DB 1F90H 1QR4A 4FFYL 3VCLA 3FMGH 3O8XA 4XAWL 4L4TA 1BZQK 4GG8B 1D5XB 1EEYB 4I1NB 3QA3A 1A22B 4BUHA 3O4OB 4HUUA 43C9B 3LRHA 3O0RL 2B5IB 4F33B 2I5YH 5JHDE 4QRSB 4C83B 1SJEB 3P4NB 1J8KA 1LEGA 4JZJC 4OSUL 3PP4H 4PLKC 5K93A 2DI8A 2BHZA 3A67H 4IRSC 1C16B 2YD2A 4DVRL 4IS6A 3FN0L 4LHJB 1WV7T 2B0SL 2BDNL 4XCYA 4YFLI 5HI4C 5C9JB 4KVNL 4X99A 5I1JH 3QDHA 3HC3L 3HZVB 4RBPK 1QBAA 4BH8A 2VIRA 2WIIB 5DD5L 5EIVA 5DEGB 2GQHA 5J12B 1AQDA 3FO2A 4HGMA 5ENWA 3RNKB 4URTB 3TV3H 4NN6B 3QUMA 5IB1B 4EBQL 4OB5H 3TYFA 1EIBA 1CD0A 5D7IE 4M9PA 4PV8A 4GXUM 1X7QB 2VN4A 1R3LB 4PUBH 1XIWA 3H42L 1FVDA 4XBPB 2YK1L 4Q2ZA 4AG4L 4ODSL 1T21B 3ZKXB 3ULVF 5ALBH 3K81A 3LB6D 1JJUA 1YA5A 1FIGL 2EDDA 3V6ZA 5JQHC 5HHVL 4XH2B 4NZDA 4QRRD 5EU7E 1JZ3A 4UQ2B 4MD0A 4R3SB 5GGVH 4HPYH 3CSBA 2ADIB 5TFSL 3T3PF 1WC7A 1WLHA 3MXVH 2R0KL 1IL1A 4QXGH 4U6HA 3AREC 2GJ6D 4F3FB 3H0TB 1AC0A 4Z7UE 4WFHE 5E70A 4Y19B 5C07D 4JHAH 3PGCA 4LLMB 4OGAD 2XIDA 3RHWF 1RUAL 5I1CH 3QRGL 5D1QA 1IT9H 4MDJB 5DMGC 5FUOL 1MFAH 1X5JA 5C08E 4J7RA 4MJ5B 3QDMD 2VXQL 1JFQH 2Q6WB 1MJJA 3MA9L 5F93C 2ESVD 2ZUXA 5FECA 4L8SC 3PXHA 5IB4A 2P24A 4OV6F 2NZ9D 1S9WB 4XT1C 4TVSa 2EC9U 5LQBH 2YA1A 2BVPB 5EBGA 5EC1B 4MMXC 1FFPB 5IGXL 5EU6D 4C4KO 3LAFA 3IXAA 2CK2A 2HVKB 3AS2A 4RWYL 2DQIL 3MBXH 4FXGA 4HT1H 4GG6E 1A6UH 4DK6A 5CSBA 4RDQG 4CN4A 2OZ4L 4OJFH 1T6WA 2EYSA 2MWCA 4ZUUA 5INDA 1T89C 3TVMB 1AHWB 3D18A 1QSZA 3CXDL 5GGSA 2NY6D 1BECA 5I8KH 4TSCH 4GAFB 5DHYB 1NGQH 4YXKH 4C56B 2XTJE 5F6HI 1BEYL 3MRPB 4LCWE 3HLAB 5ELIA 2CRZA 1ZV5A 2PF6A 4EDWH 5BVJB 3QG6A 1N0XL 4U1KA 4UNUA 1ES0B 2P42B 3CX5J 3TN0D 2F54B 4GKOA 4WO4B 4NNPH 1FZKA 1TIUA 5DUML 3X11A 3KXFD 4I2XB 1RVFH 1XGRA 2Y9RT 3SN6N 2XN9B 4U05A 2IBGA 5TE7H 3AB0B 2RFXA 3TIEB 1IEAA 4JFHD 1MQKH 4QTHB 5H2BA 2FH8A 1U8HB 2P5WD 1S7UB 2V17L 4YR6A 2EYRB 2VDQL 3UMTA 2OM5A 2X6MA 4XZUA 4PLNC 1GXEA 3FO9B 4NBYB 3A6BH 3PP3K 5HDBE 4U1SA 3CU7A 5D71L 5C0NC 1QFWL 1AXTL 4P4KD 2FIKA 2WUCH 1KC5H 4PP1D 1RK0B 3W9DB 3TCLA 4EIZC 5C3TA 4XPTH 1RFDL 3SDCC 2Q8BH 5IHZB 4R0LA 4U1IB 5K9JL 2G9HA 4ZD3L 1NGPH 4QRQA 5DZLA 5IK3A 2ARJQ 3QDJA 3ILQD 3ULVL 4PRBB 4XTRC 2EYTA 2A38A 4YHIB 3D5OF 3KPSD 4OD2A 4G42A 1RULH 3NGBC 2AV7B 2R1YA 2CRMA 1JPTH 2ZPKL 4XTRD 1KG0A 3AROA 4UNVA 5DSCB 4QHMB 1FO0A 1FAIL 1TFHA 3ECBB 4S2SB 5CEZD 3LKRB 1H3TA 5K9JH 2K7PA 2VLKD 4E9LA 1RFDH 3EYSH 1FSKC 1TJGH 3EO1B 5DTFA 3OX8A 2AK4B 3MJ8B 1F13A 2WUCL 4PJDA 1FNGA 4MB3A 4NGHL 4JRXD 4J6RL 5E2TH 5I9QB 5D71H 4GBXD 1XGRB 1QVOB 2DM4A 4ONFL 3LQAH 5F1SA 3QFJD 4MJIB 5DK0A 4KUCD 1D5ZB 2NXYD 3T2PA 5F8QC 2VLLB 1EJOH 5T1DL 5H2BB 1EXUA 4QY8B 3HPJA 3GSUA 3HRZB 1FNEB 3WIFA 3ZSSA 5JDJA 1HK6A 3NCJL 1R24B 4CW1A 2OI9C 4ZYKA 3H7BA 2V7NB 5D7LE 1J1OL 1QA9A 1MQKL 5IG7B 4D0DA 3OKLB 1QSFB 4HC1L 5C71A 4GRLC 1AIFB 4PY7B 2GK0B 3VWJB 1YUHB 2W0FA 1GGTA 2GAZA 4N8VB 4MGXA 4NNPL 4PJIF 3Q5YA 5DDHB 3UYOD 3O6KL 4HUMB 4ZSOB 1PLGL 4AEEA 1T7VA 1DDHA 3K2UH 3ARDC 3T2OA 4P99A 5I74C 2KZ1B 4TSCL 5I8KL 4OI9A 1LE5B 2W1NA 1I1YB 2ZSWB 4PJ5A 1E0OB 3DGGA 3MJ8A 2OZ4H 5EIQA 1ED3B 4QRUB 3CJJA 2HFEA 4OZHF 1G1YA 1CDYA 3QUXD 3FZUC 4UDUB 4NRYA 3WIIH 4IIQB 4WDIB 1L0YA 3WUZA 3C60B 3HNSL 5BZWB 3UTSA 1K8IB 1GIGL 1FLTX 1O5DT 3IKCA 1U3HD 5CBEB 1AXIB 4U1HB 1FL3B 5C0AE 2P44B 4GAJL 4UBDD 1AR1D 4D0BA 3B9EA 4N8CH 1TITA 2VLMD 2IAND 3MA9H 4A6YH 5FGCE 3VGFA 4DW2H 2GJZA 5HYEA 3QIBC 1ADQA 4TOYH 3RDTC 3S97C 4NHUB 5FUOH 3CX5K 4RSVA 4ZUSB 3GHEH 3L9RA 3GBLA 5K9OA 1OPGH 4PJFF 1FVDB 2NY7H 3FONB 2UVEA 3QDJE 4I0PD 5TJWK 5E00A 5T1LA 2ZNWA 1ZHNA 2H26B 4UILH 5CMAB 5D93B 3SJVD 4HPYL 2HP4A 4PJXB 3V6ZB 3ZE2F 3W9EA 2Z92B 3MRKB 2BSSB 4HK3J 4XVUC 4IRJB 3W39B 3DGCR 2JELL 1J1XL 4HS8L 1SYVA 3BZ4A 3VXNB 4KJWC 3LH2L 1ZXQA 2PTTA 4ODSH 5GPRA 4G9FE 2FBOJ 4ZODA 2YK1H 3MUZ1 5IFHL 4P46B 4U1GB 4PRDA 4PUBL 1U3JA 1RAMA 1OGAB 5T3XL 1LK3L 1HSAA 3TJEH 4TNVK 3V6OC 3I6LD 1JI1A 3NIFF 3RGVC 3L1OL 4OB5L 1KN2H 1RZGA 1RIUH 1LK2B 3OAZH 1N5YL 5I30H 2A74A 2ZOLA 1DANU 1OGTB 4OCSH 5DD5H 2XOTA 4DKDC 5J8OA 1BWMA 2NY0B 1D9KC 3N1QC 5J3HD 2HTLC 1IZKA 4HG4K 1QFPA 1AGFB 4EI6B 1JYNA 5KN5A 2IAMA 4GMSH 4KVNH 4MAYB 3UROR 4YC2B 1CK0L 2XFXA 2FGWL 3GJFK 3S3PA 3FN0H 2EXWC 5IQ9B 4GS7C 3TIEA 5IMLB 4W6XB 5D7LA 1MRDH 1CFSB 1T5XA 2J8HA 2IH3B 2YS4A 5GQBA 5HY9A 4N8VA 2WNGA 2X2YA 3FQWB 5IWLA 2H9GA 4JJ5A 4XMPH 4AT6B 1BQUA 2NY5L 3F7PC 3CNKA 3WDJA 4Y5VB 5D6CB 3PIQB 3E6FA 3DV6B 1I7UA 3KPRB 1QFWM 5FOBA 3GUTB 3HZYB 4RAHA 2IFGA 4PRAA 5D9SB 4JFOB 4PTTA 4YO0A 2YWYA 3T77A 2JJVA 1MVFA 4FFYH 2GT9B 5DJDB 3FKUS 4N5EC 2EIBA 1KXTB 3V6FA 1QLFB 3CPLA 5ISZA 3Q6GL 2Q8AH 4WEUD 3MRHB 4H0IA 4PB9H 1HHKB 2IPUK 5JQ6L 5C07A 4PB9L 1TVHB 5DC9B 1X6NA 1MCCA 4GW1A 1BF8A 2EIZB 2R29L 3QEGL 4MNQD 4RGND 2H3NA 4R4FL 3HE6C 4TSBH 3UTSE 4I4WB 4NJ9H 1U8LA 3O2VL 5CEXB 4PJ8C 1J7VR 1SEQL 3G5ZA 1XGYH 1WITA 4LFHG 5MENB 1KB5H 5C0FA 1U8IB 2BSTB 2G75A 3EYQC 2RB8A 1HE7A 4HCRL 3ARGA 4N0CC 4QRPD 3KG5A 4MD4B 4XMPL 1MHHA 3FT3A 3NBNA 1VGKA 5MP6L 4RA3A 2XICA 5CJQL 1JV5A 4JFDD 4K2UL 1IM9A 2EDFA 1QVOA 2CK0H 2QADD 4RMRA 1OAKH 4F8QA 5F1OB 5SX5K 3RTQB 4ZXBB 2YUXA 2FGWH 1CK0H 3SQOL 2X4SA 4ZAKB 3O3DA 5JXEC 1XGUB 4GMSL 5D8JH 3TGXA 3U2SA 3DMMD 4PJ7B 4RMTA 2VB5A 3PDOB 5E8NB 5DJAA 5D2NA 4DOHB 3QJFA 2ITDB 3PV6B 3VXUE 1XT5A 1BBJB 2QQKH 4ODTL 2JJTA 1L0XA 4ODXB 2IWGA 4OZIE 4PLJD 1RIUL 1KN2L 3L1OH 1CFNB 4X6CE 4BYHA 2KUTA 3TJEL 1LK3H 3L3GB 5T3XH 3GMMA 5KG9A 2VLRE 1OP9A 5IIEB 2E7HA 4PJAE 3MUY1 1KCSH 4GKZA 3O6FB 1ZLVH 5JOFA 5D5MA 4R0LC 2Z8RA 4KKLC 3OAYK 1ORQB 5CUSL 1ZA6B 3PQYE 2MQ3A 3T0EA 3GB7B 2OJZH 2FLRT 4XXCA 4XWOD 3PE9A 4AIXA 4D9LH 2JELH 1BM3L 4JCLA 3U48A 3ZT5A 1MCKA 2MKWA 1KEMH 2BY3A 1BAFH 3T8XB 1CR9L 1JPST 1YNTA 3C5ZA 3UJTL 5EBMB 4EN3D 1AO7E 1IE5A 2C7UA 1OAQH 5GJSL 1WUNT 12E8L 5T3ZD 3BIBX 1JTTA 2WANA 2YEZB 4POZC 4X9BA 3GHEL 4G3YH 4P57B 3ARGB 1KCVH 4UINH 3AU1A 3EYUH 4MB4A 3HE6A 3UDWA 3ELAT 1YPZA 3AAZB 3F6LA 5ESQA 2R1XB 1Z5LB 5B3JE 1IM9D 3IJYB 4RAUA 1WWCA 4A6YL 1BMGA 3S4SG 3GSVA 4QHUB 3QNZB 4FQXC 1X5HA 3E1F1 3D69A 2BVOB 3QWQB 4WFFD 4OFDA 3K46A 1JHLL 2BNQA 4OZFA 1U92B 2AV1B 3GMMB 5SV4A 4IMLB 5AZ2L 2A73A 2UZXB 1I1YA 4J3TA 1DE4B 3MR9A 1OP5H 3TO4D 1FJ1B 3NPSB 5F7KC 1MJJB 4K3DH 2Y5TA 3O8XB 2GJ6E 2EDYA 1DQDL 3LKSB 1QEWB 4UUJB 1GOFA 4AY0A 5LBSH 5E7FA 4X98A 5I1IH 4E41E 2BY1A 1NKRA 2XPGB 4LEOB 4DN3H 4DZBB 1EFXA 3I2CL 1BJ8A 1OL0A 3ZZ1A 5L2KA 5TGBB 4FFWC 4IBLT 3U0WH 5FO9A 4TUOB 2FX8L 3KXFE 1OGAA 5E8PA 5B21A 2ICWB 1DBKH 1J18A 1EA9C 4PJBE 3PJSB 3VRJA 4HC1H 1J05B 2ADJB 4JG1L 3O9WA 1JWSA 4NCC2 5I1HL 3AAZA 5ESQB 4QEGA 3QUML 4M5YH 4DCQA 2HFTA 4JY4B 3VA6A 5E7BA 3P2TA 3BH8B 4PJIA 2E9WA 2JIXD 2BK8A 2AJVL 4NO0A 5F88B 3WN5A 5IFJA 2HJKB 5T1DH 4KROD 4NN6C 3ZSTA 2NY6B 4YDJB 4KHXL 1OF2B 3LQAL 1IAKB 4LCCA 1P2CA 2YD8A 4AMKH 4JAMB 4NRYB 4JFZL 4PJ5E 1F58H 2E5EA 1RJLA 4F37F 2ZJSH 5D1XD 3V7MA 2FDBP 4X4YA 1NCUA 4FQHA 5C0JB 2DWEB 1TJGL 1FL3A 3EYSL 4LCWD 5TH2A 3V4VL 7CGTA 4JRXA 4PB0H 5E5MA 4DFHA 4N1CA 5KJRH 2E7LC 4P4RB 2X70B 2W0LA 3MFGB 4J8RB 1ZT4A 2EXYC 1IGTB 4JGUA 1K4CB 5GS2D 3IKKA 4WTZA 5SX4H 1ODAA 4OQ1A 5GSVA 4L3AA 7FABH 1RUPH 4X7DC 4ZFOL 3H9ZA 3PWNB 2PW2B 4L1DA 5D7SL 4AH2B 3OAYH 5KSBE 4WUUB 1XGQB 3ULVH 4R90L 3V0VA 1J1PL 4OBSA 2RR3A 4XNYH 3VDAA 4G7VL 5CP3A 5HDQL 2YPLD 4U1JA 3HFMH 4EUPH 3Q0HA 5D7JA 4XPTL 3QP3A 1ERNA 3O41B 2AK4E 3GDBA 3RBGA 1AXTH 2CO6B 4ZFOA 5C0EA 5IEKA 3KPOA 1OP3H 4RX4D 4FXKA 5CBAA 1OWRM 3QO1A 3MREA 5DUBA 3DPBA 2WZPD 3L3DB 3VH8B 3HG1E 4XXDA 3OR7A 5HHNB 2WM0A 3KDMB 3KYOA 2UY7A 3KLHD 1NJ9B 5I18L 2DS4A 1IAOA 2V17H 4NSKA 4OCRL 1IQDB 3IJSA 3IGAB 2J3SA 1EAPB 2HT3D 3QEUA 3SDAC 3UPCA 1JNJA 1HWGB 4W68A 2OL3A 3GSNA 1S9VB 2PYFA 1TPXC 5EN2B 3EFDH 5E2UL 1RV6X 2C7UB 2FX7L 4RMVA 3TBWB 3U9UB 1ZHBA 2YBRB 1FNEA 4XVSL 1AJ7H 3V4UH 3RWDA 1A7RH 1J5OH 3FB7A 4M03A 3WEXA 4ELME 4EDWL 4NO2B 4R7NB 4UIKL 1VFAB 5TQ2H 3B2UC 3V0VB 5D2NE 1BEYH 3OG6B 2P8MA 1GCFA 1X5AA 3S37L 1E27B 2GCYB 3ROOA 1M71A 3TLRA 5DURB 5JOFB 3FTGB 3EJYD 2X9XA 3BWAB 4OJFL 4YO0B 4YHYC 1K3IA 1SEBB 1HSAB 1DLHA 2YZ1A 4OFIA 5HDBF 4BQ8A 2XKSA 2B7DT 4RISH 5HHPA 1A21A 4G7YL 4QHNA 5IGXH 4M5ZL 3E3QC 5CJXA 1Y0LA 3LMJH 1KCLA 4MDJA 3RIAK 4OF8A 1N3NA 5ACZB 3T3PE 3R8QA 3B9KB 1R5WA 1HXMA 4UU9A 5DRWA 1UM4H 5ISZE 1QZ1A 3O2WH 4GUPB 4NKDA 1YEJL 3F7VA 3FQTB 4JCMA 3SE4C 1CDJA 1CBVL 3UYRH 1IT9L 1FZMA 4Y19E 2JB5L 3IAQA 1HKFA 4CNIA 4WWKD 2G5BB 2QR0B 3C87A 4ZTOL 1KTRL 2VL5B 4LCIL 5E2JA 3K3QA 3WYRA 1UWGL 2BVTA 3ALWA 4HV8B 3QAZC 1U8HA 3RWDB 1N26A 4X9IA 2J12B 3MXVL 1B4JL 5J4MA 4NOBA 5HHME 5I8CA 4OZHB 4LOUD 5J13B 1ZVSA 4NO5A 3SKOA 5HHVH 3DURA 4TRPH 3ARYA 3TH3T 5ITFB 2ZUQB 4LLWB 1PZ5A 3HMWH 3FQUA 1FLRH 1KOAA 4I13B 4O2CA 3HHRB 4AG4H 4DUWA 5A2JH 1I1AC 2GFBB 2O26U 3ULSA 5F7YC 5I1DB 1AQDB 2JJSC 2AJUH 3EYFA 3HC4H 4IHOA 4L4JA 4C54A 4XMLH 1Q0YL 4WUKH 3TBSB 2NY0D 4EBQH 2BC4B 1NCBH 5IFAH 5M95B 5T3ZL 4OLVH 4X6FA 5FECB 4JKKA 5CBEA 4ZAKD 4AIZA 2DQGL 2XKUA 4HUWB 2HT4D 1KPRA 4D9QD 5T3XE 1RUMH 4NKOA 5DGRA 3TNNB 1U92A 1EDQA 2PTUA 4NZUH 3ZKMD 1BQLH 4JFPA 3QISA 3T1FB 5C0BD 3TIDA 2P8LB 4LHUB 3PQYB 1IL1B 2Y1VA 3IS1X 4XNQA 3N1PC 1MLBB 3P77A 4JHZA 2AJ3A 1S9XB 2P5EA 4OCNC 2NY1D 1HSBA 1NGXA 3TN0C 3CGTA 3DHMA 1FC2D 1N64L 5JOEA 2R15A 1Z9OA 1ZA3B 3HKFA 4JKPH 5BZDA 1KXQE 2UWEF 3BZFA 4Z7VE 1CD1B 1F90L 3QPXH 1I7TB 5E5MB 4P57A 2I07A 32C2A 4K3GA 2BNRA 4HUNB 5DD3L 3VXSE 4LFHD 1W0WB 3EJZD 5DD0H 4FQ2L 2ERJC 4TUJB 4Z8FH 3UO1L 4MXVE 3V2AR 5HHNA 1BD2E 4HFUL 1ULVA 4JVPA 1HNGA 4D8PB 5DT1L 1HNFA 1DN2A 4G6KL 3WN5B 4M8QA 4NUGH 5F44A 3CLEH 2D7MA 3BH9B 3QIBB 1JF6A 4WHTB 4PJFA 4GRMB 3QZWB 1NUDA 3VI4F 1K6QH 4XH2A 5MENE 4FQ1L 3H9YA 5IF0A 5J1AB 1MAML 4JO2H 5DJCB 4M6NH 1MHPL 1YQVH 2FZ3B 2VLJD 1NAKH 3TT1L 3MOBH 1BJ1J 3WUWB 4NQDA 4NQCB 5EOQH 3I6LE 3ZL4L 3K80A 4ACPA 3G04A 1RZJL 5C09D 4P2QA 4MX7A 3S3SA 2JIXA 3I75B 3MOAL 5FHBL 2HMIC 4OZGE 1TDQA 2B4CC 5L2JB 1PZ5B 3GNMH 1FDLL 5I16B 4JM2B 1DBML 2EC8A 4MD4A 4L5FH 3VFUA 4LLYB 4M43L 3VFVA 1QSFD 2BOCB 4QHMA 3VD3A 4XZUB 3RUGA 1ORSB 1I9RH 5FYJH 1XGPA 4YHOH 1BPVA 3TF7C 2D9QB 1INEL 1A4KB 5DA0B 2JKXA 4JDTH 3RY5A 5C0ND 3JZ7A 5L6YL 4NHCL 1D9KB 2EH8L 2XQBL 4OCMC 3SOBH 4P9HH 4YDJA 4KJYA 1UH4A 5CFHA 3DMMC 2F53A 2ZUSA 3MA7A 3N9GL 3RWHA 5HGBB 4P9ML 3U46B 1YEFH 3TC9A 2YXFA 1HHGB 4M7JL 3K8LA 1XR9B 5T1KD 5DJCA 3TO4A 3MNZA 1NAML 3WFCL 2DJSA 3V5KB 4KMTL 2CGRL 4OCYH 4BZYA 5C0AD 4KU1A 3ARQA 2D7OA 2GI7A 4Z95L 2VAAA 2FBJL 4Y5VA 4QHNB 3QPQD 3DV6A 1A7NL 4PJAF 5CEYB 5KSUB 1FVCA 1UQSB 2P5ED 5F7WC 1EGJH 4XMKL 2D31A 3HS0B 5T5NG 1K8DB 3DXAE 5DVOA 4XBEH 4ZNEA 2HRLA 2EDBA 1CF8H 3MJ9A 3D85A 3BPCA 2HA1A 1NBZB 3KLAB 1TNNA 1PDKA 1JNLH 1S78D 3BWUC 1GZQB 2D0FA 4G8GD 3VWKA 4N9GB 3JVGA 4ZUTA 4AJ0A 3JV4B 5JNYB 3BO8B 4ESKA 4U1GC 3KJ6H 4WUUD 3MRRA 5IEKB 5F7NC 3GMRA 2YRLA 1DP0A 2AK4A 5CD3B 4HAGA 2HKHL 1E4XH 3SJVB 3KJ4C 4OM0H 1AGBB 1MHEA 1ZANH 2K7QA 3B8YA 2RHEA 4LIQE 4KDTC 1JZ7A 3D69B 1PSKL 1AP2A 4PLKD 4EQ3A 4P59L 3ARGD 2I9LB 3MYZA 1JE6A 2VZUA 3NAAL 1OGTA 2V5RA 5EA0L 3P11H 5GS0L 2C4XA 5DJ2A 3OBAA 3TZVB 3EJJX 1OAZH 4JPVH 1IMHC 5SWZA 5DUPL 1NGZA 4U6XA 3H6JA 4DGIL 3NABH 5FO8A 4QXUH 1D6VL 1QRKA 1KCRL 4BM7A 4OQTH 2X4UB 3UPAA 4C57C 5E00B 3P0VH 4Z7VB 3FFCE 1H15A 1BJMA 2YOCA 1ZLVK 4KKAC 5IMKA 1YC7A 4QT5B 4LMQI 2BSSA 4U6VH 4LLMA 2LV4A 4IRZH 3UJJL 2HH0L 3KPRE 4QXTA 2XN9D 4LSSL 1CZ8L 3ILPA 2PTVA 3HS0A 5E8DL 3QDGA 2AJSH 3T3MF 3SDDC 3V9FA 3EOYG 3A0OA 3TA3C 1CCZA 1DANT 1HH9A 1Y0LB 4KKNA 4D94A 1Q0XH 4X7SL 2R2CA 1LEIA 1U8PA 4V1DD 5L7XL 4BQBA 1T66C 3ARED 4MNGB 3LKQB 3CXHK 5DFWH 4YHYB 3CVHA 5KZCB 4GKSB 1RZ8B 1MJ8L 2GITB 5D6DC 5D7JD 4WI3A 4JY5H 4OCWL 5E08H 3HI5L 2RCSL 3O3DB 4GG6F 1JI2A 1MI5B 4I0PC 3U7YH 2WBJD 2AEPL 3HNVH 5F1IA 3HZMA 3U1SH 4NHUA 2CKBA 3GSOA 3C8HA 4M61B 1WFNA 3FO1B 3U4EA 2BNRE 5FYLL 4NT6A 5I66B 1I1CA 4XC3L 5SWZD 2XT1B 4ZAKC 4QCIA 4PJEB 4XPBL 1JGDB 5DJYA 3UZVB 4ODWA 1TZIA 4OZFB 1MSPA 2R1WB 1RJYB 5DQ9B 5HI3D 5T5NF 3HRZA 3V8OA 3WIFB 5J13C 4LK4A 2VWEE 3WSQL 3O6FD 1AKJD 4DWHA 1FGVL 4JHWH 4P46A 1I3RB 1ZVHA 3O8XC 3CFJB 1CICD 2VDOH 5IQ7H 2LABA 3MV8A 5ETUA 1SJXA 3WS3B 5AYUH 2XWJA 3IVKB 1QSED 1KPVB 35C8H 2VSCA 4J3VA 1G9MC 3QDAA 5BV7L 3V4PH 5CCKL 3DOSA 3BQUC 1X5FA 3V6OE 1YYMH 1YEHH 4M48L 6CGTA 1FYHB 2CIKA 3BH9A 2E27L 3HAEH 5T1LB 3V79C 2GSIA 4ZQKB 2EKSA 1CE1L 3HUJE 2PW2A 1M7DA 1NDGB 1WT5A 2AABH 3W0WE 1I1FA 1BFOA 2IANE 1ZLWK 3SDDA