3IFOA

X-ray structure of amyloid beta peptide:antibody (abeta1-7:10d5) complex
Total Genus 45
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
45
sequence length
223
structure length
216
Chain Sequence
b'QATLKESGPGILQSSQTLSLTCSFSGFSLSTSGMGVSWIRQPSGKGLEWLAHIYWDDDKRYNPSLKSRLTISKDTSRKQVFLKITSVDPADTATYYCVRRPITPVLVDAMDYWGQGTSVTVSSAKTTPPSVYPLAPSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVPR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 10D5 FAB antibody heavy chain
molecule tags Immune system
source organism Mus musculus
publication title Structural correlates of antibodies associated with acute reversal of amyloid beta-related behavioral deficits in a mouse model of Alzheimer disease.
pubmed doi rcsb
total genus 45
structure length 216
sequence length 223
chains with identical sequence H
ec nomenclature
pdb deposition date 2009-07-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ifoA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ifoA01
2ARJA 1PLGH 3CUPA 2N7AA 5D7JD 3DSFH 1HHIA 3HE7D 4HHAB 2R39A 3BAEL 2YRLA 1WC7A 5GIRA 3D39A 4YIQA 5F8QC 3TIDB 3NFPB 3WIHH 4ZPVB 4XMLH 4MB4A 4KZDH 2EO1A 4IHOB 4U1JA 3U4EA 4G3YL 2BVOB 4AIXA 4MA1B 1IAII 3U0WL 1PG7L 2Y7QB 5E6IA 4WHCA 4JKLA 3RWHB 5CD5D 4RFOH 3E3QE 3MO1A 1PKQB 3BIKA 5IFAH 3HR5B 4LF3A 3V7AG 3QO1A 1LK2A 1KBGH 4MA3A 4WFGD 4ELKA 1WJ3A 4GH7B 3F62A 3O41B 1IC5L 1XIWC 4MZ2A 1MCQA 1I8IA 4LLQB 1O0VA 3PWVA 5IMMB 4CADA 1D7FA 3MLXL 3AGVA 4U6XA 3BZFB 5H35A 3BZFA 1CGTA 3FMGH 4OCWL 3TIEB 1X5YA 2NZ9D 1AKJA 2AXGB 1B0GA 5ACMA 3LRSA 4LSPH 1LD9B 4ZTOL 1TETL 5GSVA 3AVEA 5C71A 5TPWL 2NXYB 3LEYL 3SKNB 5B8CC 5E8DL 4GUPA 3LEVH 1W8NA 3LKPA 2JCCA 4FN0A 3QXWA 3TNNB 4M5ZH 4N68A 4XP9L 2PYED 4XNZB 1HHJA 4LHUD 3BN3B 3D0LB 2EC9U 1MCPL 3T1WA 1KTRL 2X1PA 4PJCA 2L7JA 5DHVB 2HFEA 4H5SA 2FWOB 4OB5L 2CPCA 5C0NC 3U36A 2UY6A 2Z8WC 3IDXH 4FQ2L 5D1XC 4TUOA 1FL3B 3GEWB 5SWQA 4ERSL 5E2JA 4NUGH 4TUOB 3ARGB 4OCYL 4GAJL 4DTGL 1YN6B 2HN7B 1IGTB 1YMHB 3BFOA 5BZWB 1WT5C 1U58A 1NANI 5E2UH 1CXHA 1C12B 2FATH 3CJJA 1OCWH 3MV9B 3WE6B 4DZ8A 4N9GA 1WQVT 2FJFA 4R26L 3QO0A 1AHWA 5EBWA 2DYPB 2KKQA 4PJHA 3VGAB 5DHXB 4PJ8B 1EFQA 1ZVYA 1AGBA 4ODSH 1EAPA 4FZEH 4KY1L 3U4BL 3OAZK 4HUMB 3RVVC 3AXLB 4JY6B 2BRRH 1FNEA 4QHMB 2VISA 5D1QC 2AEWA 2F53B 2VDRL 5L6YL 2E6QA 1U8QB 5HPOA 3E6FA 4UQ2B 3PIQA 4DN3L 3KLAA 5ISZB 4FQQB 2BDNH 3WDJA 3RFZC 1UB6A 3B5GA 1T4KA 2JJSA 3KVQA 4KRPB 3V4VL 3HE6A 4H20H 3OKEA 2J6EA 1BD2B 3UBXB 2NCMA 1LMKA 2WW8A 2EDRA 4OLXH 1T03L 2XQYK 4P3CH 1YQ2A 5CD3B 3S35X 3FN3A 4UIKH 3TO4B 4NKIL 1L6XA 2EH7L 2I9LB 4WWKB 4D9QE 4XCCL 3QWOB 2NXZB 4HK3N 1JYVA 4IOIB 5E00A 3OZ9L 2ATKB 4KVNL 3KYNB 5FGRA 5JPMB 5D72L 1MFDH 2NYYD 3BRDA 2NY5H 1X5LA 2FEDD 1M7DB 5FYLE 3D9AH 3HCVA 5IOPB 4LL9A 2OR8A 5ACZB 3MR9B 3N1MC 4L3EE 1UQSA 1UZ8B 1YN7A 2J6EL 3A67L 1A1OB 2YPVH 5DHYA 5KSBF 1TTGA 2EYTB 1IC1A 3TBSA 3ET9F 1K3ZA 1KJ3H 4UT9H 4RAUA 5CGYC 4XP5H 4ZPVA 5EOQH 1U41A 4NZUH 3B3IB 1U8MA 2UZXB 1CL7L 3GHEH 3TP4A 3S4SB 1QRNA 4P2OA 3N1FC 1IT9L 2QQKH 3LQMA 4H1LB 2DIJA 3H7BB 1FVDB 3X3FH 4BK5A 1HKFA 3PABB 5KSBE 2E7CA 5F44A 3EYOA 3HS0B 1MY5A 1FYTA 3VXPA 2A6IB 3BP6B 5HYFA 5JDSA 3IDYC 5JUEL 4Y5YB 3ROOB 1EHLL 4RAHA 1L0QA 4N0CD 2DWEA 2GK0B 2SEBA 3UPAA 4MA8H 3ESUF 2VMFA 5FDWB 1IRAY 2OSLB 4TQEH 4AG4L 3HMWL 5BMFH 4PGDA 4YGVA 4P5TD 5DRXA 2X4RB 3QB7C 2QV2A 5K9KA 2CO6B 2R0KH 4X6CF 3FQUB 1F90H 3MC0A 5TGBA 1MQ8A 5HVGB 3PWUB 3DXAA 1KNOB 4PV8A 1CE6B 1PSKH 1CE6A 3MUGA 4XNZC 1PX3A 5H35B 1NGZA 3TVMA 3GJFA 5C0AB 3FT4A 1W72A 2X4SB 3P0VL 1N4XL 2ZUUA 3RKDC 5F88A 3MREA 5KVGL 1H5BB 3C9NA 3KPSE 4YUEL 4ELMA 2KZWA 1A6VL 5KVMC 1RIHL 2BOBB 3KPSB 3TJEH 1OF2A 3DECA 3LKRA 4NC1C 4WFHE 5L88L 3LKSB 4HGWB 4J1UA 4MLSA 2HLFD 2XZAL 3U36B 3K46A 5GGSY 4MNQD 4KQ3H 1JTPA 4RISH 3OKLA 1J8HA 4BK4A 1JGDB 2VE6B 3V5KA 5IHZB 1Z0NA 2FWOA 1CD9B 1A7BA 3SE9L 2BVTA 4NNPH 4PJAF 1P1ZA 2VDKL 2P5EA 2ZUSA 1EVUA 5BS0D 1MFEL 5EIQA 4UDUA 4KTEL 5I8OH 3FFDB 3WKMH 3GSXA 4TOYH 3EYVA 4HUXA 1DQTA 1VADB 1NCWH 5C0ND 3MOBH 4GMSL 2F5AL 4KK9D 5JW3H 5ADPL 2XZCH 3RX7A 2HAZA 2Y72A 1A21A 4PJXF 1UWGL 4BYHA 1QSFD 2C3HA 4G6AC 2B8OT 1S7RA 3MNWB 5FK9B 5GGTH 1NDGB 4EIGB 2AS5M 3B83A 2QADD 3C5ZD 4RMUA 3FQRB 5I15L 4LU5H 1IGCH 5D70H 3N85H 2C4FU 3CPLA 2NPLX 4WNQA 3S5LG 2HTKD 4QTIL 5FYKE 1KXTB 3PWJB 4JPIB 5HGBA 1YUHB 2MQCA 2YPKA 2QKIB 3QEHA 3OHXB 2PCPA 3MRHA 4JHAL 4OF6A 1QG3A 5BJTA 2H2SD 5DUMH 3QISA 2XWJA 2D0FA 1UCTA 1YY9D 3BMVA 1KCLA 4WEBL 4KTDL 1T66D 4JFDA 5AZEH 4XBGA 3MJ8A 4ZPTB 3FQTB 5LCVH 3HI1A 5JHDD 2R2HB 1ZXQA 4I3SH 2OR9H 2EE3A 1WITA 3IDJA 2DM3A 3S35H 3QPQD 2WZPD 3DURA 4NQXB 1UKQA 3G08B 4XCFL 4X80H 3WNPA 2R0WH 3PHOA 1FL6B 3VD4A 3CDGB 1OAYL 3NFSL 3SOBH 4X7TB 1BGXH 3AB0B 3REWB 5KSBB 4YWGL 3DMMA 4MMZC 2Z0BA 4Y5VC 1NAKH 4MSWB 2X40A 4R4BA 1LK3L 4XNYL 3T3MF 4DZBB 3PABA 1KPRB 3BW9B 5EOCJ 1JRHL 5I17B 4JM2F 2F54B 4NQVA 1CIDA 3NACL 3S3PA 1JIBA 5C8JA 3L5JA 1I7UB 3MRFB 3OF6D 1PY4A 3CZFA 1U93B 1BREA 4WW2F 2V9RA 1WBYA 3UJJL 2Y1VA 4OUOA 2QSCH 3TYGL 3IT8D 3L9RA 4Q9RL 4FQCH 1L0XA 4KMQA 5CJ8A 3VXMA 1ACZA 4O00A 1NAMA 3VFVB 1HNFA 4KJYB 1FNAA 3FO0H 1OPGH 5CILH 5JIKA 1B90A 1NCBL 4HBCL 1G9EA 2PYFB 3BKYL 3BPNB 3RRQA 2JKXA 4GMTL 3UJTL 2BVQA 3BHBA 3IFNH 4HUUB 1GIGH 2AXGA 4OGAD 2I5YH 1P7QD 3P0YH 1INDL 4YDVA 5K9JL 4JCLA 3VXSB 2WNGA 2X4QA 3CMOH 5E4IA 5I8KH 3ES6B 2EIZA 4I0PA 2X4QB 3ZTNH 4LVNC 5MEQB 3CK0L 4HH9A 2VXQL 1FC2D 4I18B 1FNSH 1QEWB 2NLJB 2AEPH 5KBNC 3FCTA 4WI9A 3RHWK 1J10A 2Y4SA 1R5WA 3V52H 3RVUC 3W81A 3V95A 4HS3B 3WS6C 4HJ0C 3VW3H 1BIHA 1E6JH 4XBEL 2IF7A 3DX6A 4LHJB 4LHQB 4KK8C 3TT3L 2H8PB 3AAZA 3MLZL 1MREH 4YHYC 4HCRH 2OLDA 4HJJL 4KI5E 5TFSL 5EU6D 4IRZL 3RVWC 3VFOB 3ZDZE 3ULUC 4Z78B 4MCZA 1U8OA 4NO0B 4E9LA 5GRJH 5HHOB 3RJQB 4UDTA 1LO5B 1CDGA 2HFFA 2Z91A 4RFEB 3INUL 5C8JB 1ZA3B 3S88H 4PYHA 1KB9K 2VLJE 1NEUA 2KQNA 4PR5B 5CUSH 5DJ2B 2HLFC 4M3KB 2EE6A 3BWUC 5HHVL 1ES0A 2V2XA 4EI5B 1X5JA 4HXBL 2RB8A 1OD7A 1MJJA 1DCLA 2HT3C 4MAUH 1YYMH 3BUTA 3RGVA 4L9DA 3VMOA 4YLQT 2FLRT 1N6QL 3HUJA 4DK6A 4BSJA 4LSUL 1QUNA 5DJ6B 5IVXF 1UWEL 5JMOC 2LQRA 4J8RA 3OKKA 1NFDE 4ZAKB 4X9HA 1ZHKA 3AMKA 2P8PA 2VDPL 2ZCLL 1CDYA 1IAKB 3RZCA 3ZO0A 4WUUE 4X83A 4NGHH 3NCCB 4Z0BL 5F97E 1DQLH 1LO3H 5TE4L 1SVZA 3LB6D 2EYRA 1QACA 1CD8A 2WSKA 2XNAB 1SBSH 5EA0H 3FFCD 3I2CH 3EO9H 3RWFB 4JQXA 3D3VE 3KPOB 1Q8MA 2X9XA 5INCA 4XPBH 4JR9L 2DQJL 4K3JL 5JXAH 3OKLB 4KK6D 5DK2B 1YUHA 3VFTA 3CUPB 3W9EA 5C2BH 1QLEH 4KJWC 5TH2A 4OF5A 2WBJD 5GQBA 3KYMA 4OFIA 5CJ5A 2DM2A 4NZTL 1CLOH 2Q3ZA 3MRNB 4ODUA 1A47A 1UA6H 4UINL 4YO0B 5CBAA 4JO2L 1KLUB 3HC4H 2R4SL 4M6OL 1X5AA 4X6DF 1IGJA 5F3BA 5HY9B 1EEZA 1RU9L 4TVPL 1BD2A 5C0AE 4I0PD 5MEOA 5GGQH 1A4JB 1WISA 5IBUG 2AJVH 4N5UA 4XX1G 4NWUL 3QG6A 3SGJA 5GRVL 3VXNA 1NGWB 2UYLA 3K81A 2VXVL 5FYLD 1NDMB 4RMWA 4XRCB 5DQDL 1OT2A 4GRLA 3EJJX 3GRWL 3DV6A 3MTRA 5DURB 2ZUTA 3BDYH 1MFAH 2CUIA 1SJEA 2BSSA 2ZSVB 5D7IB 1PG7X 3T4AA 4Z7VA 1MPAH 5DJZB 4PJ5D 4IMKA 2W65B 4YX2H 5FKPB 1G7QB 2X2YA 5IROC 4RNRB 1MIMH 4PGCB 5KVDL 4HUVA 1I1RA 4NWTH 1I85A 5JHLL 3WS3B 5KANI 2DICA 3S8WA 1UC6A 4HIJB 4X9IA 4KKLD 5DA4A 5C0BE 3ROOA 2R9HC 3UDWC 1MJUL 3RY5A 1YEGH 2IH1B 2R4RH 5HYJD 4F7MA 1FBIH 4W81A 3VXUE 5KW9H 1MHHA 1JN6A 4KVCH 2X6MA 1HSAA 3G6JF 1KPVA 1SHMA 4Q7DA 4DKAA 2H2PD 1S78D 2BC4B 3KXFD 1RZKC 1N3NA 2VDOH 2NY2C 5DHVA 1DP0A 1JPSL 5IJVB 3FHAA 2AJZA 4OZHE 3ULUL 1QLFB 4ZQKA 3N1GC 4NUJB 1QYGL 1TCRB 1HSBB 4N8PA 4U1LA 1X5IA 3HZVA 2A9NH 3VFSA 3T0EA 1CDHA 4XNUL 5KVFL 1DEEA 2YHGA 2RIKA 4BM7A 2WQ8A 1YN7B 2IBGA 4JO3H 5GGRY 1X4YA 5IR1A 3BD5A 1WWWX 3SDCA 4PP1D 3WFCH 3F58H 2CKBH 4W4OA 2F19H 4XRCA 3GMMB 3TCLA 4Y1AE 4QCIA 2EZ0C 3QUZB 3TA3D 4N1EA 2AI0L 2CKBB 3DIFB 3LN4A 4H25B 5DEFB 2CK0L 2QADB 3C5ZB 4GRWB 3SDAA 4AQOA 3CFDA 5I9QB 3C8KA 3O3BA 3ARVA 3UXFA 4LCYB 3ROLB 4YXHH 4QHKJ 2BVUA 4HFUH 4IEFB 1A64A 1KJVA 5C70A 5IQ7H 2WV3A 1R5VB 3QHFL 4G8IB 2DQIL 4UB0H 3SGDH 1EERB 1MCSA 4WO4A 1NMCC 4K94H 2DTSA 2NR6C 4ZS6C 4MZ3A 5GGVL 1MFCL 3HNVL 4N90E 4Z5RA 3UC0H 1R24B 4MX7A 2YBRA 3FB8B 4NC2B 1JE6A 4XTRD 3OG6B 4BELD 5C07E 1D6VL 2FLBT 1MF2L 1G7IA 1XF5B 3TYFA 5MI0C 4ZUSA 4FS0A 4MD4B 4EEEA 4PJCE 4JFXB 1PQZA 2IFFL 1QFWH 1DJSA 1ZLSH 3V6FB 1PQZB 3IU3B 5IFJA 1IKFH 4YK4C 3QDHA 5E2TL 4M1CD 2B4CC 4KRLB 3JWDC 2ENYA 4PJ5B 2NX5B 1JPFA 5C0EB 4PTUB 1WEJH 1AC0A 2GUOA 3NZ8A 4R6UA 4F57L 1OW0C 3G5VA 4GQ9L 5ILTL 3QIUC 2NY2D 3P4OB 4IJ3C 4PJXA 4WCYL 3VI4F 4Y16A 4LASH 1TZHB 4XCNB 1FVDA 5F1NA 3VXRD 1GGCL 3TBTA 3L3KA 1XGTB 1XZ0A 1ZLUH 1CGYA 1K5NA 4NJ9H 3BPOC 7CGTA 2VDMH 4WIQA 2C7UB 4PJIE 4FQJH 4YHOL 5J3HC 3BZ4B 4QHNA 4QOKD 3F12B 1R3LA 2B39A 5GZOC 3VFOA 3GIZL 3DETD 4UNUA 1YA5A 4S1QL 4ZXBB 1WIOA 3TVMD 5IWLC 4J4PD 4KKCD 1RFDL 3PWPA 4HS6B 3E8UL 4U1GC 5CZVL 2AV7A 2P8MA 1EA9C 5HHXH 1QBLL 4O51B 1H3PL 2XTJE 1OAZL 2D4FA 1S7SA 1V3LA 3DJ9A 5F7EH 4M00A 3VFGL 3C09C 3QG6B 5GHWH 4D3CL 3I6KA 1G6RB 4I9WD 2X70B 3B5HA 4L4TE 2FBJL 2FJGB 5TF0A 5DRZB 1IGMH 3HZKB 1R6VA 3EOTH 1V7NH 3FO1A 3H9HA 1TVDA 2ESVE 3GMRB 4KJPD 3K80A 4S2SA 5DD1H 4GBXA 4I18A 3BKJH 5FGBC 1V05A 3SPVB 4UTAL 2J4WH 1JWMA 4PJ5E 3RPIA 2HFGL 5B38A 1XR8A 4PRHB 4LEXL 5CSZB 4FXKB 5I1HH 4QRPB 3ZL4H 3V0AC 3PQYB 4RWYL 2I07B 4YHMH 3GSUA 1QRND 3QUMH 4U0RB 4PJAA 1UM4L 2K7PA 3LQAL 4PJCB 5K9OA 3T2NL 4XPFH 4WUUD 4YHPA 4ZS7L 5F9WC 1SY6H 3LS4L 2AK1H 1AO7D 5IM7A 2EDYA 1MEXL 5F1SA 5B3JE 1IMHC 4OF3A 4XH2A 3FZUC 3MRDA 5AZ2L 1DLFH 4G6FB 5C7XH 5CGMA 1WIPA 1ONQB 1I1YA 2RCSL 3ARZA 4ZSOB 1YNLL 2IMNA 4MS8C 2BOCA 4GLRH 5TQ2L 1MCKA 4PUBH 1MRDL 1LDSA 5ICYB 4CU8A 2HMIC 4FG6D 4X6DA 4MXQD 1CXFA 4YDJB 3BGMB 3CDGA 2CKBA 1AQDA 4PJHE 3QIWD 3WNMA 2BFVL 5E9DD 1NCCL 2XT1B 1KTDA 3DMMB 1JCKA 3GSQA 2OI9C 4J3UA 5E8PA 5GZOD 4IOSD 4U1IA 4PRDB 1ZWIB 3GSVA 4PJFB 3TVMC 2NTFB 1OQXA 2IANB 5A16B 4OLWL 3MRLA 4KI5D 1CLYH 4X6CE 1FGNL 3T8XA 2VABA 1GGBL 3SJVD 4M8VA 4ZO7A 4PJEA 2CK2A 1HILA 3BKMH 5IB5B 1U8HA 1HILB 5T3ZE 1NGPH 4LSRH 2VLJD 4LSQH 4OM1H 5BXFB 5ESVB 2ED7A 4YFEA 3H9SA 3EFFA 2H41A 1OB1A 1YMMB 2V2WB 3S34H 1VEOA 1EO8L 4R4FH 4F7MB 1G7JB 4WUKL 5F89A 3T65B 1U8LB 3LKOA 1AR2A 3IFLH 5AYQA 4HPOL 1E4XH 1A14H 3N9GL 4U1NA 5CEZD 1TJIH 1RK0B 1DVFB 1CDUA 2YWYA 2R1YB 5C0DB 4LLUA 1VACB 4ORGA 3GJEB 4M7LT 3LS5L 3B9DA 2LAGB 2X1WL 3Q6FA 3FN9A 3EHBC 1T6VN 2NX5A 3H3PH 1D5BB 2WAHA 3EYVB 5C0CB 1FZOB 3P9MB 3RVUD 4OCSH 2ILLA 2K7QA 3MRCA 1MIEH 5CWSB 4NFBA 4QLRA 4FA8A 4PG9B 1F42A 3VFTB 3B9VA 4Q6YA 1EO5A 1GZPB 8FABB 2EXYD 5D1QA 4KMTL 2EDKA 5HDBF 1QBMH 4U7KA 1J0JA 4IRJC 5SV4A 4LOUD 2I27N 3MJ9L 3ULUD 1CGWA 5DWUH 3QYCA 3RAJH 1FSKC 2H1PL 3DHMA 43CAB 4G43A 4L4TA 3VA6A 1ND0B 5CJXC 1XGYH 4QYOA 5JXEA 4NM4L 1VPOH 4YDLB 5HI3C 5IMLA 4Q0XH 3PWJA 2QQLL 3T2OA 3GHBL 5M95B 5ENWA 1GYAA 5TE6H 4JDVA 1ETZA 1T5WA 4H8WH 3QCTH 5L2JB 1DBJH 4HLZG 3IDJB 4V2BA 5CJBA 3VCLA 4M61B 3SCMA 2X10A 4P2QD 4G8EA 3VG9C 1FG2A 4FTVB 4D0CB 5CEXA 3MLVH 1RPQA 1ZMYA 3LN5A 4XBGB 4O2CA 4FMFA 3O4OC 5JXED 2XKNB 1RZFH 1IC7L 4WFHD 2X89D 3MGTB 1BJ1H 4FZ8H 4Z7WA 1YEKH 3BRFA 5IR1B 4Q2ZB 2YEZB 2PTTA 1BM3H 3RHWF 1NBYB 1XGUB 1DDHA 2ZOLB 4X7SH 1UH3A 3UTSD 4IIQB 5DVKA 3IF1B 2AQ2A 1J1XL 2J8UE 1A3LH 1CFSA 25C8L 4WY7L 5IBUB 5T1KB 4XNXL 1FNEB 3AAZB 1FZJB 4PJDE 5IHZA 1IILE 1N64H 4WFEE 3EFDH 1MI5B 1NMAL 4GXVH 2FIKA 4X6EB 1F5WA 2P7TA 5GISH 4QF1A 1QQDA 1DBBL 1FFNB 2P45B 4P99A 1NBVL 1QO3B 1ZAGA 4CJ1A 1XIWA 4DW2L 5TQ0L 4LIQL 2IPTL 3SGKC 4CVXA 3U0PB 2CQVA 4X8JA 3GBNL 5EFIA 3PGDA 1HEZA 4HKXB 2CD0A 5E6IC 1CE1H 2NYYC 5DK0B 1KEGH 2V9TA 4P4KD 2F5BH 3C6SB 2W07A 2E9JA 2W65A 1J0YA 1Z3GH 4XXDB 5JPMA 1CF8L 3AREC 2NW2B 4PJFF 4DVRH 4JPKL 4IMLB 1JHTA 1LO4L 3CFCL 3MLUH 5FKAA 1FC1A 4NP4H 5E95B 3PXHA 1XCQB 2F8XC 3DOSA 2YD4A 4OCRL 1J0HA 3WN5A 5GXBB 5FCSH 4LCWE 1EZVX 2FX8L 3QHZL 2NY7H 3S36X 1EEYA 3QI9D 4NKQB 1EXUB 2DQUL 2D7QA 3ILPA 5DJDA 4MQTB 1UCBH 1OAUL 1T21A 1XGQB 5JXEC 5C0GA 2O5XH 2ADJB 2HH0L 4NRXA 3ARUA 4F7CA 1NGYA 5SV3A 3TIDA 4DUXA 3SHSA 3FHQA 4KI5F 2VIRA 4R96A 2BY2A 4NQDE 1S7UA 4B0MM 2R1WA 2IQ9H 1GSMA 1OLLA 3PV7A 5IVXA 3UTQA 1JWSA 3GJFK 3VDBA 4KROB 5T3XD 3S4SG 4FRWA 4MGXA 5EZIL 5IK3B 4W70A 3I84A 5HJ3B 5MENB 2QJDA 1MVFA 3IDMB 4JRXA 4ZO6A 2QTEA 5IVZA 5GGUB 5JORB 4M62H 4APQC 1MRFH 2DJ4A 3IDNB 2DN7A 1YECL 2P8PB 2CUMA 3GKWH 4TUKL 3JWNC 1RY7B 4JDTL 4U49A 4L4JA 4YPGB 4C56A 1K8DB 1WBXB 3V0VA 4JE4B 3UYOD 4G8IA 5IEHA 3MNVA 2XPGB 2IBZX 3LIZH 4H88L 1BFSA 1EGJH 5E6ID 5EBMB 3VWKA 5HDQH 3L5XH 5T33L 5IVOA 1JBJA 4YBHA 3O6FD 4M02A 1MSPA 5IB2B 1IAMA 1UB5B 5IB5A 3GSNB 2RR3A 5ICXA 4JKPL 1ZEAH 3ZE0E 1LEGB 2LTQB 2ZUQB 2CLZA 5L9DL 2NY3B 2GAZB 5E99L 2E9BA 1L0YA 4LOUC 3DX8A 3GK8H 3HCVB 2DM7A 2CLRA 2F74A 3T4YB 2XKNA 5L7XH 5SWSD 3FQNA 4PJGA 4Z7UF 1KG0B 3HLAB 3K8LA 1A3RH 1A1OA 3O2WL 2XZQH 3C09B 1A1NB 2DJSA 3SCMB 3UBXI 3WFEL 1NCDL 4PJDA 2WBWB 5FO7A 4PJHB 1SYSA 1FJ1A 5C09D 3RVXC 2P5WD 4MJIA 4H26B 3O4LD 4XPTL 4D9LH 3LZFL 4PRPA 2QLVB 5CIPA 1FNGB 2YD6A 3IFOB 4F7PB 3ECBB 4ZSOE 4YPJA 4H1LH 2NTFA 4F37K 2J12B 1I9EA 4O4YL 4RGMC 4YHZH 5IF0B 1QBAA 3UBXA 3UYRH 1UVQA 2IAMB 1E4WH 5F7DB 1ZHLA 3F7YA 3V5HA 1FAIL 1R3JB 4NPYA 1EHNA 5D2NB 1EV2E 3VDCA 3D0LA 3O8XD 4JG0H 4X6DB 1FLRL 3RQ3A 3MUJA 5IKCA 4HLZH 3HRPA 5D9SB 5JQ6H 1IM9A 3B5TA 5JLZA 4KROD 3HNSH 5C3TA 4U1LB 5EORL 3L5HA 3BH9A 3NCJH 5CZXC 2XRAH 4J8RB 3IKKA 2X4RA 2W0FB 2JIXD 2PO6D 4M7LH 2DTML 1H3UA 4QRRD 5IGXH 2P8LA 3KS0H 2DLEA 2VRAA 4C57C 4F9LA 4DZ8B 4RGOH 3BEVB 4GW5B 4LP5A 4NQDB 2Q76A 3MUGB 3MRGB 5DJCB 4BZ1L 4LAJH 1JYXA 3LSOA 3SDXF 2VOTA 2R8SL 2I25N 1EDQA 5DJDB 1QSZA 1KXVC 4BSWA 3I3BA 3BH8A 1PKOA 3H2WA 4KV5F 5BXFA 2AJUL 4F15C 3MV8A 2VLKB 1NGQH 4MD0B 4O02L 1DSFL 4QT5B 5SX4H 1U36A 1FRGL 2AAVA 2VDNL 3JV4B 3CMGA 4HUWB 2BZDA 4Z77A 5C0RL 1S7TA 3TZVD 4MCZB 2CR6A 4NO0A 1A6TB 4I3RH 3O6FB 3IXTA 4FNLH 5DI8A 4Y4FA 5DRNA 5ALCL 2QL1A 3HNTH 1UACH 3QZWG 4KJWD 4ONGH 4WHTB 1IGYB 2ADIA 3P9LB 2A6JA 2OK0H 3KLHD 2BNQA 4G42B 2IPUG 1W0YT 3KPRD 5MENA 5C9JB 3GB7B 1NAMH 5TDPA 4I0PC 4NCC1 4PB9L 4Y2DD 5ANMA 1YEEL 1LILA 5MP6H 3IS1X 3VXME 7FABH 1UJ3A 3U1SL 3VWJD 3T3PF 4CVXB 2DI7A 4P9ML 1QNZH 3UO1L 1PEZA 4M7JH 2E8YA 4G5ZH 1SJVA 4JGMA 4HWZB 1JPFB 3CVIL 1ITCA 2HN7A 4LLDA 3T0BA 4PJHF 4WTZA 1AIFB 4ZOAA 3CVHB 1GVIA 4Y0GA 1L9NA 4LLMB 5D7JB 3KLDA 2DDQH 4HZLB 4WEMB 5IT2H 4GG8B 5C9KA 1CBVH 4YHIB 2BSED 2XA8H 5IM7B 3ULUE 1Z6JT 4NC0B 4ZO9A 4R8WL 5FYLH 1UT9A 4IHOA 4NNXA 3MRCB 5HVHC 2HWZH 3QXDB 1TZGL 2FX7L 5IV2A 1KCRL 4X7EC 4XP4L 5KVEH 2H8PA 1F4HA 3GSUB 1ZV5A 1MOEA 1MI5D 1XMWA 3EYSL 4S0SD 3OBAA 3TBYA 5BO1L 3MV01 2AK4B 2QQNH 1F8TL 4YC2C 2XFXB 4O2FB 4HQQL 5HBBA 4LHUG 4EDXB 2OL3B 1H5BC 1HOCB 3HRZA 3EBAA 2NW3B 1AQKH 4PJ9C 3ARBC 4Y89A 5L8KB 4K23H 4LLUB 5HYSG 1Z9LA 3VDAA 5E9DA 4QRRB 3I6KB 4M48L 1HNGA 2XN9D 3O2DH 4TTDD 4EI5A 3DO7A 1ACYH 3DSFL 1E27A 4NQXA 1LNUB 4JFPB 3UX9B 4K8RD 4ELKB 3UZQA 4NQDD 4OUUA 1T7YA 5DJXB 4XBPB 4ZFZA 3CCHA 3WIHL 2BHUA 3D2UB 4KZDL 1QR1A 2WQRA 2MFNA 5JDJA 2W9DL 1PG7H 3QUZC 5F7WC 1DLHA 5SX5H 4KK5C 3HG1B 5IFAL 5BW7C 4RA0C 4HUVB 1X5XA 4OT1L 2D7NA 4LLWB 1A7RH 1KBGL 4OSUH 4IRJD 2YEZA 5E2WH 1KENH 1OQOA 3VRLE 3U7AA 1YEJL 1AXTH 2X4OA 4U31A 4KKAD 3MLXH 3FN0L 5DZLA 2VQTA 1G9MC 4KRPC 4G9DA 1HINH 5CKAA 2CJUH 4HWNA 4LSTL 5D8JH 4OM0L 4CDGC 1ZHBB 3GSRA 4K7PX 3JTTA 1U8KA 2CIKB 2P8LB 3V6BR 3ZTJH 1Y18B 2M26A 1IKNA 3RGVD 1N5AB 1T5XA 3IKCB 3IU4L 4LRIC 1BOGB 3TFKC 3LEYH 5IIEB 4D0DA 3QNZB 3DV4B 2YXMA 4UBDD 3RUGA 3Q0HA 2A9ML 4XC1L 1C8PA 1I1YB 4JN1H 5E70A 3MNZB 4LCIL 1XFPA 5T3XH 5ISZE 4G7YL 3JWDL 3SY0A 1P9MC 4GRLB 3QEGH 3HC0B 2WUCL 3U7WH 2ICEB 1VGKA 1VESA 4WGVB 4FQ2H 3O81A 1A02N 2AJ3B 1SM3L 1M05A 3AS2A 2R2EB 2MCG1 4LSSH 2PYEE 3AM8A 2ZJSH 3VFNB 1EZVY 3DRQA 4FABH 1GHFH 3DRQB 2EE9A 1M6OA 3CGTA 3CFKB 2CGRL 3WUWA 3LKRB 2YUWA 4MJID 2NY6B 5F9JB 2MMXA 3OKEB 4F7EB 4UMGA 1UM5H 3S5LA 3X17A 1GC1C 1T20B 2R0LL 2YKLH 1OSZA 3QIUA 4FZEL 3KPRE 4JRYD 4MD5A 3MYJA 1T83C 2B1AL 1T0MB 4K55A 1F6AA 2ZG3A 5FXCH 5BS0E 2VNCA 2DM4A 4DN3H 3BSZH 1BFOB 2EH8H 4P23B 3KXFE 4KDTC 2FJFB 4K7PL 4X7CC 3ZKMC 3G5XA 3DV4A 2IG2L 2PTVA 4G6ML 2FD6L 4DQOL 2XIDA 2EZ0D 1C16A 3MV8B 4QRTA 1E6OH 4HPYH 4BFIB 2UZIL 1DBKL 4TPRH 3S96B 3C5JA 3WFHA 4E41A 1XF3A 5D6CB 4PJXB 3LSOB 3RGVC 3WJJC 4UUJB 5D6CA 5I1JH 2EDFA 4X9GA 4PLJD 4QHLB 1FZKA 3TBTB 3O3EB 4L4VD 3DROB 2J5LC 2NY5L 2VR5A 4J3OC 1FFPA 2Z92A 3QIWA 3ZYIA 4HWEL 2OJZH 1MI5E 5EC1B 4Q9BA 4Y5VB 2J6EH 2F58L 4PJ7E 4YDIH 3RGVB 1FVCA 2JK5A 3MRKA 2C26A 3WO3B 5BCAA 2UWEA 5F7MC 4U0RC 1C08A 1CDIA 1IAOA 1KFAL 4PJIF 3THMH 4QRSA 5DLML 1KCUL 5C09E 4MJ5B 1IT9H 4HSQA 1JZ3A 3DO7B 3UMTA 5DT1H 4MD4A 2FZ3A 5J57B 1AO7A 3X3FL 3UTTA 5C0IA 3BDXA 5AUMB 3M07A 4JFEE 5BQ7A 3GNML 4OFDA 3DMMC 4GAGH 3B9KB 2GTZA 3GJFH 3QDJE 4JFFD 2EC9T 1YNTB 5JUEH 5E1AB 1CR9L 1A6WH 3X11A 3FT3A 3VD9A 3RTQC 3QI9A 4QWWD 3IYLW 4ELMF 5CSZA 2Q6WA 2AXFA 3UAJC 4P2OB 1XH3A 2C1PA 3MBEB 4K07A 4CMHC 5KZCD 3L3IA 3P4OA 4E41D 3WN5B 3H0TA 1WC7B 4R4BB 3U9UB 4DZBA 4HC1H 5HYQA 4HHAA 2HP4A 4F7PA 2GCYB 2Z8VC 4C83A 4K3GA 1LEKB 5DFWH 5CP7A 1KJMB 4NBYB 3BIAX 3QBTB 2HT2C 3OGCB 4OZIB 1KN4L 1DEEB 1WAAF 1NMBL 3RVVD 3VRJA 3FQNB 2EDOA 1QFHA 3MBEC 4M3JA 3G6JA 1MCHA 4PLOB 3DUSA 1RIHH 4AJ0A 5DXWA 1JGLL 5J6HB 1IGFH 1CD1B 1QZ1A 1YNKL 2JJTC 4X5XB 5KTEL 4KK6C 1HH6A 2W0KA 2XZAH 3P9WB 4NNYB 3PWLB 4PV8B 3L3GB 4UILH 4Y4KA 1NLDL 4JFYB 4JAMA 1KIRB 4JO4H 4PG2A 4P49A 1N6UA 3RNQB 1JGUH 4DGYL 3JV4A 5H2BB 3B4NA 3QDGA 4U6HA 4ACPA 2JJUA 2XN9E 1J05A 5I17A 5EUOA 1CTNA 5ANME 3SE9H 5EZOH 2HJLB 4NNPL 4CKVX 3KPRA 4UIMA 35C8L 4C4KT 4XP1H 5KN5A 4J2XA 4KTEH 5I8OL 1XR9B 3WKML 3U82B 3TBVA 2WP3O 1NCWL 4YNYA 1QRKA 3MOBL 1PYWA 4LPVA 2C1PB 3MBEA 2FB4L 2KBGA 3MCLH 5GSRB 3MRJB 2VXUH 3NN8A 5ESQA 4NQCB 3W9DB 4AL8H 2A73A 4XHJC 2GFBA 2X4NB 4NSKA 3AUVA 5F7UA 2ZUXA 3VE0A 1RSFA 1FLTX 1A0QH 2UUDK 3P30H 4Z6AT 5IK3A 2EIZB 2R56H 2Y07H 1I4FB 2ADJA 1NJ9A 4WW2C 3V6ZA 2NW3A 4R2GD 2CR3A 3TPUA 5A43C 1BQHG 1KACB 3L3DA 3TT1H 3W2DH 1EJ6A 3PP4H 1B4RA 4XCYA 4QRRA 1OAQL 1K2DB 2Z93B 1KJ2H 1T04B 3LKQA 5CJXA 3C2SA 4JFFB 4XVUC 3L6FA 3DVGA 3D2UD 1RURL 1JGVL 1X5KA 4JGJA 3O45B 1KTLB 1A6AA 1SEBA 1VADA 2FO4B 1OP5K 1KJ2B 4S1RL 1ZLWK 3BYTA 5EUOE 1C5DB 3JV6A 4WEBH 3EIFA 3S96A 2PETA 3R1GH 2VXSL 1LO0H 1CDBA 1HE7A 3MBED 3O3DB 1NUDA 3E6FB 4UQ2A 1RAMA 3DIFA 5EC2A 5C0BB 1J1OH 2DQCL 4JFEB 3S35L 3EDDA 2HKHL 3D39D 1A5FL 5C08B 3O3EA 4OCMC 2JCCE 2R0WL 3MSPA 1I1AC 5DC9B 5HGHB 1NCAL 4OTXL 3BGFC 4OIBA 5CJOH 3Q5TA 5KG9A 1BGXL 2HTLC 4NQSA 3ULSA 3VH8G 1E28A 2AJSH 2ORBL 5HDBE 3QDGD 5IQ9A 5EU3A 3KPQA 3O11A 4J7RA 1YPZB 1TVHA 4PRPD 4PV9B 4X4YB 1F4AA 5EU4A 1WZ1L 3SDYH 1DUYA 3FO1B 2X4NA 1S7SB 5KSUA 2XV6B 1NUFA 3VRIB 1FL6A 3RY4A 2A77L 3NIDE 1A9BB 1WZMA 3EHBD 5C86A 5EU5B 3TYGH 2L4OA 3HE6D 3ARED 5E1HB 3C5JB 4HIXH 1AR1D 3EZ8A 3HMXH 3NH7L 4Q58C 5ALBH 1AGFA 2GIYA 2Y23A 4ZFGL 4RGNC 1S7TB 1QFUL 4APQA 2NNAA 2YK1H 4W4OC 4APQB 4LVOB 3JTSB 5HHOA 4BSVA 1Q9WA 3ZHKA 4CVUA 3UJTH 3F5WB 4N0FB 5EB9A 4TNVF 5IF0A 5FB8A 4MA7H 4HK0A 3P0YL 1INDH 1UADC 1ZOXA 4YHLL 3ARDA 4Z77B 1O7VA 3EYOB 1HQ4A 3MZTA 1RVFH 4MQXD 2BVYA 3CK0H 2VXQH 1XGTA 1XZ0B 1FNSL 1J1PH 2NY6D 3P11L 2Q20A 2LAAA 5FOBA 5LWYH 3V52L 1T1XA 4RQQB 4NNYA 2RHEA 1MJ8L 1MUJB 3GMPA 4X4ZA 4KJQD 2CRIA 5MHSD 3G6JB 3TIEA 1UENA 4TNWF 1PLGL 1I1AA 4HCRL 4HJJH 4ZAKD 3HKFA 3CU7A 4P59L 3VXSA 1MJJB 4FQ1H 4RMRA 3VGHA 3O3UN 1SJEB 4W6YB 3RA7L 4YBQD 2BP3A 3UCRA 3LPWA 5K9QI 2A6KA 1TNMA 5GRJL 3ARFA 2HVKB 4G3YH 5GJTL 5GZND 3MXVH 2PYEA 4NQCE 3PUCA 3HFMH 4F7TA 2PYEB 4RFOL 1RMFL 4N1CA 1JZ8A 3EOYG 2GJ6B 5K59F 4NNXB 2A83A 3HE7C 5EBMA 3BMWA 4MAUL 4Y19E 3QPQC 4JFED 3X12B 3D39B 2CDFA 1EGJA 5H37H 3ARGD 4BH8B 2GT9B 4PJEF 3FMGL 4Z7OF 3L3HA 4HKJB 4LSPL 4GBXD 4WU7B 1FVEB 4E41E 1TETH 3PGFL 3MJGX 4M4RA 6FABH 5HHPB 4ORGB 1LO3L 4YE4H 4TVPE 4CDHA 3ZDZF 3LEVL 3TFKD 3IGAA 5L8LB 3MJ9A 5E6ZA 4U0QB 1IM9D 1FJ1B 4AYFA 4PJ8D 3LD8B 3UTZB 4R7NB 4BZ2H 3EO9L 3QQ9C 1U91B 3HPJA 4XPBL 3WNLA 2DQJH 4U1MB 1K8IB 4JB9L 2DIAA 3PGDB 5TE7H 4F3FA 5EH1A 4X6FA 3W39A 3AREB 1ZA6A 2ZCKH 4I3GA 1QLEL 1P9MA 3I6GA 5ID0A 1CFVH 3LMJH 1DE4B 4TN9A 3ZKXC 5JIPA 4DKFL 5LGKA 4NUGL 1DE4A 3EAKA 3KR3H 3WV0A 4QXUH 1A6ZB 2EDTA 1FNHA 2C7UA 4NQEE 3UTOA 1FGVL 2VXTH 2ZCHL 4D9RE 4JY6A 1D6EA 2WBJC 1RU9H 4TVPH 1EAJA 2XPGA 5GGQL 1WT5A 2BY0A 3PHSA 1YEIH 1OCWL 1IAIL 4JPIA 5HGBB 1MHHB 2VXVH 4NYLB 3TO4D 4HT1L 3UTTE 4R26H 5GGVY 2HFEB 4HIEB 1D5IL 1IFHH 1OARL 2ZUWA 2YXFA 4O2EB 3IB4A 4ODSL 1N7MH 2OYPA 1A9EA 1MPAL 4DKEH 5KJRL 1T0NB 2AXHA 3SE4C 2DLTA 4HUUA 2FL5A 5C3LD 2BRRL 4CVWA 5DTFB 4MAYD 2APTA 1QA9A 1ZT1A 5CBEB 3V6FA 4NO3A 2BDNL 4D9QD 4NWTL 1NDMA 3ARYA 5JHLH 3BI9X 2OX5A 3HHRB 1S7UB 5DZOA 3RZCC 5I1EH 3T0VA 3S36H 3EZJB 1BWMA 1YEGL 2R4RL 5F3BB 3CFIC 2Z8SA 1MCEA 4H1LG 1P5UA 4EVNA 5IMMA 4M1DL 4Y7MA 5I71C 1GJIA 3C6LA 1H15A 4KQ4L 4NKIH 4R7DA 4PBWD 4JQVA 4YR6B 3IFOA 3WFDH 2NY1D 2XWBA 4PY7B 3BZEA 3VFNA 1G9ML 2VDOL 4P2YA 4XCCH 5CIPB 3HUJF 3RL1A 1KLGA 3DYOA 3MXWH 3VWKC 5J89A 3NBNA 1S7QB 1RJYA 5D72H 3IJSB 4LCYA 4TNWK 3ROLA 1G9NC 4OCXH 4XNUH 5KVFH 3D9AL 2EIBA 2BCKB 1XR8B 2H9GA 4JO3L 5HGGS 2JCCB 4U2ZA 3TNNA 4F33B 3A67H 2DIBA 5ID1A 2YPVL 1CICB 2GEEA 2ZG2A 3SKMB 5I73C 5I6XC 5GRXG 1TQCC 3QRFM 5FOBB 1T2QL 3VFMB 3VXQB 5FM8A 1KJ3L 2VZ1A 4UT9L 1IAOB 4JHWL 4JRXD 2IPUK 2P5EE 4U6YB 5C0FB 1IM9B 4ODWB 1DL7L 5INDA 4YXHL 1I1AB 2L0DA 1ZHKB 2QQKL 3WS6A 3C60B 2BSTA 3D6GA 2DI9A 2H45A 1MQKH 3FB7A 1N5AA 5F7HA 1DN0B 1TFHA 3WXWL 2VZSA 3KLSA 2DD8L 3JV0A 5CEYA 4G6JL 1MFCH 4NKOB 4MJ6B 3SO5A 3HNVH 4MNQB 3BUYB 5HYJA 3Q3GB 4TQEL 4AG4H 3HMWH 1CFSB 1MF2H 1BBJA 2R0KL 1VHPA 5CLTA 3GSNH 1F90L 4H1LA 3O4LE 5JZ7D 1ZGLM 1MI5A 4S10A 3NFPA 1U8JB 1AP2B 3STLB 5GZNC 2VLJA 4Y19D 1LO5A 2HFFB 1G7PA 1WVZA 5HGDA 4JRWA 1U8OB 1IKFL 3SKNA 2FEEL 4FHBD 1IEHA 3FTGA 1JWSB 1WEJL 3UJIL 2EIEA 3QJHA 3LKPB 3G6AA 4ZUUA 1EBPA 4KV5E 3OKOB 4OGYH 1YEDB 4X6BB 4XI5D 1UWXK 4C4KO 1VFBB 3RIAF 3S37X 3VXOB 1T0MA 3TJEL 4I48A 5TGBB 4ODBD 5L88H 3FB5B 3KG5A 2B2XL 4WI4A 3PWVB 4PJBF 4I0KA 1RJZA 3HPLB 5GPRA 4F7EA 3K2MC 1I9IL 4F2MA 4RISL 4M61A 3ZDXE 4CVZA 1EUUA 1U8LA 2HRLA 2YS4A 3RKDD 5IMKB 1LEIB 1AE6L 1BECA 1CFNA 4R4NC 3PXJA 4JLRB 2DQDL 3OKDA 3IVKA 4HUNB 3O6FC 5E8NB 4BH7A 3EOAA 2D7TL 5C08A 3I3DA 5EN2A 5CZVH 4YHIA 3I9GH 1T04A 3LKQB 4IOFD 5I1IL 3SKUD 2IGFH 5HHXL 3IDIA 3LOWA 4TOYL 1U8HB 5DD6A 4A6YH 4JFOB 5F88B 2VSDA 5CSBA 3FQWB 5F7EL 1RHFA 4GMSH 2F5AH 5CWSA 5JW3L 5CHNB 5ADPH 2X4UA 5F3HB 3IDUA 1ORSB 2A0LD 3HG1E 2F53A 3V6OC 1BBDH 1UEMA 5DEGA 1CYGA 4PJGB 4XVTH 1EHAA 2F8VA 4W6WB 1EVTC 1P7QB 4CJ0A 5EO1B 4PJGE 2VAAA 4LVNB 1Z5LB 4W68A 4K3HA 3QNZA 5E2VL 3ULUF 3MA9L 1V3KA 5I30H 2UWEB 5DTFA 1XEDA 4U1NB 4KAQH 3N85L 2Z92B 3QIWB 3ZYZA 4RWYH 5E9DB 3ZL4L 2DWEB 2E7HA 4OJFH 4KK9C 5JTWA 3VFUB 2J8OA 4E5XB 15C8L 4JVPA 3LQAH 3T2NH 4XPFL 1OW0A 3QFDA 4Y4HB 4GJTB 4L8CA 3WSQH 3O6MH 1EJOL 4MQ7A 5KS9F 3G5YA 2DQEL 1CG9A 5HJ3A 1P53A 1MEXH 3ZT5A 3QUXD 3IF1A 4IRJA 5DFVD 4N0FA 5EIVA 1DLFL 4Y2OA 1QFOA 3MGOB 4KTDH 4JFHE 5AZEL 4LCCB 5HPMB 5FHAH 3KYOA 5LCVL 1UB6B 4PUBL 4MB5A 3GMLB 5F3HA 4K9EH 5FOJA 5L2KD 3OJ2C 3ISWA 4PRAA 5I74C 2VWEE 4HIJA 4Z7VE 1T2JA 4P3DA 4YHPB 1FYTE 1U8NA 4H8WC 4LNVA 1OAKH 1XGUA 3QJFA 4XCFH 4X80L 1BVLA 3PDOA 5E08L 4HGMA 3GM0A 4MMXC 1OAYH 2ESVB 3NFSH 2IFGA 4AENA 4WO4C 2DQFA 1INQB 1BZ9A 3GMQA 4K94C 3RWGA 1G84A 1BIIB 4P9HC 2BVPB 1KYOJ 4M03A 5EU4B 2X4TA 1OL0A 1OTUD 4TSBH 4Q97A 3TH3T 1JRHH 4LVEA 3SQOL 4LPTA 3VRLF 4YO0A 1GGBH 4OZ4B 3PE9A 2BVQB 3BHBB 3X13B 3EO1A 2Y7QA 4PLKD 3MR9A 3E3QC 3UJJH 4U6VH 1G0XA 4X7FC 4OD2A 1NBZB 5BVJA 3FT2A 2XWTB 1NGPL 5F6IC 4LSRL 4QHUB 4OM1L 4CMMA 3LEXB 1A8JH 3C2AH 3VFPB 5EU6B 3QXVA 4D8PB 5JA8B 4K7FB 1U0QA 2DBLL 3X12A 1GZPA 1FCCA 1P4IL 1Q9OA 4LDOB 2Q86B 4BQ8A 1OPGL 4JEGB 4HBCH 1NCBH 2MWCA 4EJ1C 1DBAL 3LN4B 5JO5B 3KDMA 3SJVA 2R2EA 3CZFB 1U93A 1UYWH 2ZSWB 3VFWB 1FYHB 1GIGL 2IAMA 3MGOA 3IFLL 4HPOH 1E4XL 4Y1AA 1A14L 4ZUWB 4QTHB 4X7DC 5I8KL 4ZNCD 5EU6E 4WI2A 1UGNA 1A6UL 5E94B 1BQLL 5LBSL 4NBXB 2AEPL 3E6HB 1JWUA 2VZOA 3GDBA 5T1DH 4J1UB 1TVHB 2IPKA 3HUJB 1IE5A 3DLQR 1UJ3B 1E6JL 3D48R 4P2OC 4OD3H 3MLTB 4XVJL 4CMHB 4N0CC 5T1MA 12E8L 3GBMH 4X6BA 4QRUB 4G9DB 3MLZH 2PXYD 4OZGA 2BC4A 1MNUL 3FB5A 4LLYB 5IROA 5JLZB 1HWHB 3MQIA 1VSCA 4YBQC 4EUPH 3MACH 3UPCA 1YJDL 2YMXH 2H1PH 3DWTA 4G8EB 1F3RB 4LPCA 1OWWA 4HKZA 2NMSA 3T3ME 4EUPB 3BN9D 3TZVA 1S9XA 4OFVA 1SYVB 5SWZB 4ODTL 1VPOL 3JTSA 4BSVB 2WWMD 3R8BB 3BQUA 2NY1B 3DSNA 1T7WA 4HXBH 3BQUB 4XAKD 5HHQB 2B4CH 3RTQD 3ILQC 4QXGH 1N6QH 4ZYKA 4F8TA 4MXQC 2JE8A 2EECA 1GGUA 4NRYA 4U05A 4YHKL 1DBJL 4LSUH 2WINB 4L8BA 3ZKSD 1K5NB 1KIPB 3EYUH 4G43B 1OGAB 3FB6A 3K7UA 3RX8A 3MLVL 3WIHA 2IADB 1CT8B 1II4E 4UZGA 1RZJH 1J5OH 4Q6IB 3DI2B 1RZFL 1IC7H 5I0ZA 2VC2L 4Z7UB 4NGHL 2H32A 2HT2D 1V5JA 1DQLL 1TCMA 3ZKXB 2P48B 1BM3L 4CNIA 5EULV 5J4MA 3V6OA 4GSDL 1SBSL 5EA0L 3VI3E 4TULH 4X7SL 1EEUA 2CO7B 4KJYA 4PP2B 3B8YA 4PJ7A 1RUPH 5C0FA 4UT6L 3QUZD 5CEXB 1R5IB 3C60D 1BMGA 5IFHL 4BQ6A 4WY7H 5GS0L 3W0WD 1CTOA 4V1DD 1LGVA 5IOPA 2GAZA 5C2BL 4ZOEA 1BJ1J 1N64L 4XMPH 5L2JA 1S5IL 3F7VA 4XCEA 3DGGA 1J8HD 2EXWC 3ME0A 2N7BA 1CLOL 1FP5A 3F7VB 5D7JA 5GISL 3WIIL 1Z9MA 4G6AD 5MEPB 3HC4L 2OBGA 3DTXA 2XNAA 5B38B 4LRNH 3QI9B 3OR6B 3MX0A 2AJVL 4NWUH 5T5NF 3U30B 3HAEA 3LH2H 1OTSD 3PQYA 1B6UA 1RUAL 2O5ZH 1G9NL 3PWPE 3P0GB 3W9EB 1ROWA 2X7LB 4PY7A 4KHTL 3HB3C 1CE1L 2OTWA 1KEGL 1R3KB 1D9KA 5EOTB 1K9TA 1F45A 2NNAB 4G80B 2D0HA 1FN4B 4DEPB 4UBDC 2H6PB 4EN3D 3WNNA 1RZKH 3LKOB 5FYJH 3VXUD 1QA9B 1ZT1B 5F72S 3D3VD 5CBEA 1CF8H 4R3SA 2BMKB 2EDEA 1QKZH 4DVRL 2A6JB 5JW4Q 3G6AB 4NP4L 4PR5A 3DURB 3ZE1F 4PJDF 2P24B 4Z7NF 2HA1A 4ZD3H 4CNIB 3PNWB 2W59A 4RA3A 2EDHA 2AV7B 1Y6NR 4POUB 5F1KC 5IVNA 1FBIL 2GK0A 2SEBB 1AQDB 4L9LB 5DDHA 3T2QA 4KVCL 1AY1L 3H9YA 5F71A 3KJ6L 1I7TA 3QEQB 2EKSA 4EUPG 2Z4QA 3MMEB 1JPSH 5D2LA 1S7QA 4PJ9D 2JB5L 1PAMA 2ARWA 2QR0B 1QYGH 4S1DD 2AQ1A 4P46C 4QOKB 5E56A 3KGRA 1ADQL 2EEAA 1TJGH 1OWRM 2B1HL 4PYGA 4HCRA 3HG1A 3EGSB 3WFCL 3F58L 4M62L 4ISVB 2YA0A 1AGDB 3AS0A 1YECH 5HHMB 1JWUB 1WWAX 3UZEA 2J3SA 1A2YA 1NFDB 4LPWA 1BFOA 1BFTA 2VYRE 4TUKH 4L3AA 3IU3A 2DS4A 2Y06L 3PP3H 3VCLB 3VG0L 1R24A 5E6YA 4XXCC 5IVXB 4UV7L 4OI8A 1PFCA 1I3GL 2NX5D 4WI7A 5LJYH 1B2WH 3AFLA 4HFUL 4KFZC 2FH8A 4ZUSB 5IQ7L 5C07D 4R3SB 2E8ZA 3ZKQD 4Z9KB 5BZDA 5MEOB 4HH9B 1U8KB 1Q0XL 1NJ9B 2DQIH 2G5BA 5I19H 1EGJL 4F58L 4YDLC 3TA3C 3C08L 3O41A 4XMKL 3IDIB 3PGCB 1T2XA 1A6AB 4D94A 2BY1A 3I6LE 4ZDHA 2YD9A 5SX4I 3B6SA 5D2LE 5ACLA 3NFNB 3GO1H 1KJVB 1AFVH 8FABA 3JVGC 5I66A 5F9DC 3RU8L 1KCVL 3EUUA 2IFFH 5ISZA 3O2WH 1MVUB 1CXKA 5EO0B 1BAFL 1T7ZA 5KN5B 1I7UA 1X7QA 2VQ1B 4JG1H 1OP3H 4ZUUB 2EDBA 3PWNA 1RV6X 2CDGA 1I1FA 3MV11 2K3TA 4F57H 4GKNB 2PF6A 5BRZA 3O0RL 2XTLA 3GSOB 3EYQC 1LEGA 5JPNA 4XPTH 4L8DA 4YGVB 5JMRA 5ILTH 3K3QA 5CJQH 4WCYH 3V6OE 2JK5B 5F9JA 2Q7NA 3DMMD 2FYYA 3A6CL 3RJDA 1H3WM 4M1CC 5F96L 1QLFA 3MRPB 1FV1B 1GGYA 4O4YH 4GRMA 4R2GC 4OBRA 4NJ9L 3G08A 1YN6A 1TENA 4FQJL 4YHOH 4I0CC 4JJHA 2WBJA 3STBA 3GIZH 4QRTB 1JMXA 3A6BL 3QUYD 5H37G 3E8UH 1BF8A 1XF3B 1FLRH 1RD6A 5L2KE 2DLHA 2Y5EA 1T0PB 1QBLH 2ICEA 2GCYA 4LKXA 1Q9WB 3ARSA 2F54E 1C16B 1OSPH 4HIHB 4KI5C 3VFGH 4WTZG 5GHWL 4D3CH 1F4YL 1NEZA 1SJHA 3NFNA 2VLKA 1O7SA 3OJDB 1XGPB 3DETC 4R90H 4K3DH 1P4BH 1XF2B 1QD0A 1E4KC 1Y6MR 3EOTL 5A2JH 5B8CA 1C7SA 1HHGA 4BZ1H 1OOAA 2H32H 2HFGH 1CT8A 3H42L 1KIUA 1RUMH 2R8SH 2L7UA 4KDVA 1WGOA 2AK4E 2HLAB 5C07B 3U2SB 1G1CA 2AJUH 3LY6A 2W0FA 1NGQL 4O02H 1FRGH 2N4IA 4MA3B 4ZS7H 5CFHA 3ES6A 3QWOA 2A74B 2C3VA 2VR4A 2HG5A 4HZAA 4I3RL 5D7LB 4D9RD 2X1OA 4Y1AD 4KJPC 1M05B 3STZB 4B5EA 5AZ2H 3KDMB 3SJVB 4M6ML 4XZUB 1PZ5A 5ALCH 3HNTL 1UACL 3HZVB 5E9DE 3TZVC 1KIQB 1YNLH 1KIQA 1NBQA 2BVEA 1ZS8A 4KUZH 3WS3A 3W0WE 4KWUA 4ELMB 5ITFB 3KPOA 1I8KB 1VENA 2UUDH 4NN7C 1HHIB 5FEBA 4U7SA 1NFIB 4QOKA 4GG6B 1W0VB 3EOAB 1AGFB 3HAEH 2D7PA 2EYRB 4GG8A 2FECL 2EDJA 4N0UA 5IMOB 3CH1B 2I07A 1JFQL 5D5MA 2OMBA 4G5ZL 4RZCA 4HKBA 5D1ZB 2ADGB 1WWCA 4X6CB 4Y16D 3TWCH 4ZUTB 3X3GL 4OF8A 4DCQA 4JANA 5FYJD 5AAMA 3GUTA 5FM4A 1DBMH 2VDQH 4OLWH 3O4LA 4F15B 3V4PH 1CLYL 2Z9TA 4JM2C 2P7TB 2VAAB 2F15A 3VMPA 1U6AH 1CBVL 2XA8L 1U58B 5EUKB 1KT2B 1NANH 5ESAA 4Z7OE 4V1DB 1Q72L 2HWZL 1TZGH 3EYSH 2Q86A 4I5BB 4JDZB 5ID0B 4EQ2A 2H26B 4R4FL 5IHBA 1NMCB 4L29B 4WUKH 2QQNL 4LARL 5JO5A 1F8TH 1KUMA 4P3DB 3W0WA 1QFPA 2CXKA 4IRJB 4G8FA 4LAQH 2J1KA 1CS6A 4HKZB 4OI9A 3CPLB 1A7NH 1AQKL 2X89A 4RIRB 1TJIL 4K23L 3RZCB 4QRPA 2A6DA 3K4AA 5D2NC 1KLFA 3LS5H 1L7TL 5FA4A 2K1MA 1D9KC 4WU5A 2X4TB 3H3PL 1FL5B 3V7MA 3B2UD 1I9RH 5IBLC 5T1MB 1R3KA 2YA1A 2ATKA 1MLBA 2FR4A 4OKVA 1Z5LA 1BZ7B 5D1ZA 2W9DH 2I9LA 4HXAH 1ZANH 1GC1H 3A0OA 5D2NE 1F02I 5FHBL 5D5MF 3AU1A 4L4TD 2AVGA 1A7RL 3JWOH 1JGEA 5CGYD 5E2WL 4PGEA 1KENL 3ZYJA 1KB9J 3SGEI 3BPOB 2J8UA 4POYA 1QSEB 1F4XH 4JKWA 3RDTC 1NUNB 4Q0XL 1IAIM 4L8SA 4DGVL 1I9JL 5CEZE 2QBWA 3G5ZB 2WWMC 1OTTD 4NOFA 1A1MA 1HINL 1SBBA 3UTPD 3O9WA 3KYOB 5TE6L 4K7FA 4GT7A 2X4PB 1NC4D 4DGIH 4NQVB 3MV7B 2Q1EA 1DFBH 1FIEA 3KXFB 4ZDHB 3C5ZA 3QCVL 2R0ZH 1AO7E 2BY3A 1XF4A 3I6LD 3S4SA 3DX7A 3EOBB 4HK3J 4YXKH 1QLRA 1K4CA 4IS6A 4LCIH 4NQED 1HYSD 3NA9L 5TDOA 5T3XL 3U0PA 3L5WA 3OAYH 1RUQH 4FZ8L 4PJIA 1YEKL 5AAWA 5HHMD 4PJAE 3JWDH 1QR4A 1FH5H 5ITBH 4LLVA 2APXA 4UU9A 2V5TA 2CLVA 1WWBX 1KNOA 3O9WC 4U6YA 3R8QA 4EOWH 1ZLVH 1HKLL 4N8CL 5SWQB 5BV7H 4LSSL 2A38A 5F89B 1P69B 4J4PA 2NXYD 4XNXH 4OZIF 5IUSA 4JFDB 3C60C 4L3EA 3I02A 4LSVL 3L3JA 2CLRB 2F74B 4RCAA 1P84J 5SWZA 5FO9A 5F9AC 4NT6A 4OV5A 1ED3A 2QR0A 1NMAH 5HVFB 2XKSA 2CGRH 5C6TL 1ZGLA 1DBBH 1VB9A 2AXJA 4KGLA 2BNRB 2MOVA 2QEJA 1JYNA 4MNQA 5DD0H 5EZLB 3SJVE 2AXFB 4BSWB 4BH8A 2R0LH 2YKLL 4JPWH 3LAFA 1F97A 5CP3A 4BKLA 1FZJA 3G6DL 3UROR 4LVHC 4OFKA 4EDWH 3WFHB 4Y5YC 3BVNA 1I7ZA 3W5NA 3DRTB 2F5BL 2BNQE 3HZYB 5FM5O 3B9EA 3CVHL 1Z3GL 1DANU 4X4MA 3MRFA 1U95B 4J3VA 4JZJB 3RNKA 2ZKHH 3DX7B 4G6MH 2IG2H 4OZFB 2FD6H 4AM0A 3Q1SH 4DQOH 4ETYA 1Q1JH 5MEND 3WLBA 3NCYP 3CFCH 3MLUL 1QOKA 3VXOA 2UYLB 1R3JA 1OTTC 4XNMB 1WLHA 2X05A 4OCRH 4FXLA 1KN2H 1JNLL 1TQBC 2NY4D 1AGDA 5CCKL 1FVCB 3QHZH 4LCUB 5GRVK 3PL6A 1EFXB 4TRPL 4NKDA 4LGSB 3BOVA 3O3AA 4AIZB 3WHXA 1UCBL 4J6RL 4ETQB 2OZ4H 3BT2L 4Y5XA 1J88A 5EWIH 1GPOH 3O3DA 2HH0H 4JVUA 3CVHA 4I2XE 3HI5H 1UH4A 5FYJU 4KMLB 1LE5A 3DGGB 3SDAC 3MV7E 4H0IA 1MH5B 4YDIL 4E41B 1OY3B 5J6GA 2W60A 3TVMB 3NCBB 3L6FB 4PRIB 1HHJB 4G9FB 1MLBB 5INCB 1OLZA 1KFAH 2UVFA 5I16A 2P42B 4PFEA 1N59B 3RWFA 2IWGA 4G6KH 1KCUH 1YY8B 1BIIA 3SDCD 4NO2A 3IJHB 5FA4B 5ESQB 3OJMB 3GKWL 3D39E 2Q3AA 1TZIA 1ZK9A 4IRSD 4JDTH 2BNUA 2R1WB 2CKNA 2PO6B 4MAYA 3QDME 3T0EB 4NHUA 2NQCA 1DN2A 1M7IA 1XT5A 5E0QA 3F12A 4WU7A 2YUZA 1D9KD 1GAFL 2P5WB 3VXNB 3O4LB 3AC0A 2F8OA 5FUOL 1HHHB 3IFPA 1LK2B 4JM4L 3L5XL 1BFVL 3PQYD 5T33H 2ZNWA 2HKFL 4HC1L 2P49B 3E0GA 2ZUYA 1WFTA 2YN5A 5T1LB 5D2LB 4MJ4A 3WN5C 4HUXB 3FONA 3OKMA 5CIPH 4YPGA 5TF1L 3B3IA 3QZWA 4BA8A 3MRPA 5FM5M 1HIMH 2VZUA 4JQIL 4JAMB 3FO2A 4WV1B 5GGRB 4HUKB 5L0QB 5L9DH 3UTSE 4L8SB 3V0VB 5AWNL 3CXDH 1JHKL 3HA0A 5DJ0A 4F7TB 3CSPA 4L5FH 2GW5A 3C6LC 1A6ZA 4A6YA 2YD5A 2V7HA 1NCDH 3TBSB 1I1FB 5IB1A 1PBYA 4WV1C 4ODWA 1NLDH 5J7CC 4JO4L 4Y2DB 4LRIA 1MCFA 4UT7L 2MKWA 2Z35B 3FQUA 3D3VA 2VB5A 4RSVA 5HHME 1A7PL 1MCIA 4R9HA 1NL0H 1RK0A 1JI2A 5EZOL 5GS1B 2WM0A 1JP5A 1KJMA 1TTFA 5I71B 5D1XA 3ZE2F 4YHZL 3BPCA 5JOPE 2Z8RA 3WD5H 3TBWA 2W9EH 1S8DA 1KJ2A 1CGSL 4NM8H 3O9WD 1X6NA 2G5BB 3RDTA 5F21B 4LSDA 4ODXB 2FB4H 3K2UH 1Q9OB 3MCLL 2ITDA 5JQ6L 4X6FB 2AGJH 2VLJB 3BRGC 1CLZL 5DUPL 5FAAA 2YA2A 2G60L 3NCJL 1I8LA 4PJEB 3P77B 3QQ4B 4WV1A 4AEFA 1A0QL 3P30L 4AT6A 3VXTA 4M7LL 3RZCD 2VISB 1Z2KA 1E0OB 5D96B 1RHHB 3MNVB 2P47B 5HHPA 2C5DC 4LGPB 1OAQH 3ULVD 1DVFD 1KJ2L 3HAEG 1FZMA 1U95A 4X6DE 1ZT7A 2EICA 2YC1B 3VWJB 1MCNA 4N9OB 4V1DE 1QSFB 1MELA 4PJIB 1QSFA 5DHVH 3WNOA 4X4XB 3LCYA 5IW1B 4YDVB 4NQSB 5I8EB 1F3DH 2OXGA 1VEMA 4XPGH 3FOLB 1IM3B 5DJ8B 4MCYA 1ADQA 2A73B 5C2UB 4NCDA 2PYFA 5ERWB 3SKOA 4P4KC 5MEPA 2HKHH 1K8DA 3EDKA 3F6LA 1A5FH 1D6EB 1DDHB 1MHCB 2FSEB 3G9VA 5BS0A 1PEWA 3NZ8B 1INEL 3OKDB 3S3JA 3IVKB 1MHPH 2BX5A 3H0TB 1T3FB 1YEEH 1NBYA 1OGTB 3MV7D 5FUZH 4B7LA 3JVGA 1TZIB 43C9A 5JHDB 3NGBC 3U1SH 4LEOB 4DJMA 5FK9A 3NAAL 3HB3D 1EMTL 4OLVL 3CVIH 3KLHC 2DQHL 5MI0B 2A77H 4GW4A 1J11A 5EUOF 4Q6IA 2H9GB 4TTGA 3HTLX 1RIVH 1MCRA 4XWGL 3MROA 2DKMA 2YZ8A 5ANMB 2DDQL 1ETZB 1T5WB 2Y36L 1A7OL 4NJAL 1PDKA 4ZFGH 4WU5B 4P57A 1OGAE 3ZT7A 2YUXA 3C6SA 4R8WH 2G2RA 4JZJC 4JZNA 3RWDB 5KG9B 5KVEL 3QH3A 1XF5A 4X8JB 3O9WB 4JCMA 3TYFB 3ARDC 3LHPH 3CSBA 1EO7A 1JHTB 4EXPX 5BO1H 5KOMC 4UAOC 4WGWB 3PQYE 1IBGH 3T8XB 3BEWA 4HZLA 4FFYH 1BX2B 4ONOA 4PGEB 1MJ8H 4B53A 3LQZA 1QSVA 3OMZA 5EZLA 2I9TA 1A4KA 4MJIB 4PJAB 3QFJD 2CMRH 1MLCA 4M48H 3O2DL 3MLYH 1S3KL 4P59H 3H8NA 1LE9B 2KZ1B 1A7QL 4FQ1L 1ZHBA 4ENEC 4OZHB 4S0TD 1JV5A 3QUMB 4IDJH 4O5LL 4OKVB 3BVNB 5KSAB 1DQJB 1BOGA 4RX4A 1E4KA 1QBBA 5GJTH 3MXVL 3MA7B 3BXNA 4ZUTA 4NRZA 1RMFH 3MO1B 1I8LC 1BQHB 4OT1H 5ID1B 5TDNB 1ES0B 4NHCH 5HD8C 3PWUA 1ODAA 4X4ME 4H0GA 3P40A 3T77B 1HZHH 2RAMA 1T1YB 1JF1B 3EO0B 3FN0H 4Y4FC 5T3ZL 1R3IL 4UNTA 4ZFFA 3TLRA 2VZVA 2BRQA 4QT5A 4MNHB 3RDTD 4WFFE 4ODXA 2CJUL 3RL1B 4LSTH 4OM0H 3FQXB 5GRYA 2V2TB 4YDKL 1R5VA 2P46B 3T4AB 2G9HB 5EG6C 4CBPA 4PG2C 1QR1B 1X5ZA 4YE4L 1JZ4A 2BK8A 2A9MH 4XC1H 2R1XA 2R2CA 1B88A 4BZ2L 4NOBA 1D5MB 1IEAB 2RGSA 1G7MB 2K9UA 1BVKA 2GITA 3OR7A 4AH2B 4G7YH 4QRUA 1M71B 4MNGE 1RZ7L 4PJ8C 4JB9H 5EU3B 3KPQB 3U7WL 1AR1C 5GSRA 3GKZA 4P23A 5J11C 4M93B 2M1KA 5IMOA 3RWEA 4NSKB 1SM3H 5DMJB 3KR3L 3M8OH 4HV8B 4K71C 4QXUL 1BHGA 2YN3A 5ADOL 2XFXA 4O2FA 3FB8A 3FL7A 2F53D 3VXMD 3U4AA 1ONQA 2ZJSL 5D96C 2V17L 1YEIL 2J8UB 4X98A 2AJZB 4FABL 2VZ3A 1GHFL 1Q0YL 4HMEA 3T2PA 5I1CH 2FGZA 4CMMB 3V8OA 1MCBA 3MODH 4HT1H 1K6QL 5DSCB 1E4JA 3KWWA 1BD2D 4GQPH 4OGXH 3NA4A 1BEYH 3DO3A 1KYOK 1TZHA 4WW2B 1RZIA 4Z8FH 4P4RB 4GRWE 2WINA 3VXSE 1CIUA 2XZZA 4DKEL 4MHHG 1ZKAA 1KIRA 4KJQC 5KJRH 2RBLA 1P7HL 5FB8B 5GGSA 2B1AH 1M1SA 3QFJB 3OKKB 4Z76B 4UV4H 2EH8L 1MHEB 4KKCC 4PGCA 1A3QA 5IB4A 3V5DB 4FP8H 3MROB 2AERT 4MAYC 4ORZC 4RGNE 3BPNC 1T80A 3S36L 1HHGB 1LO2L 3M45A 4D0BA 2CLVB 1X7QB 2VQ1A 3CD4A 3EJZC 3QJFB 3WIFB 2QHRL 4XNMA 1C5BH 5F9OH 4J3SA 4OIIH 4XVSL 4L8DB 3D69A 5BRZD 4M1DH 4ZXBA 1AJ7H 1OAXH 1P4LA 3GSOA 4HPYL 3SDDB 2COQA 1DBKH 4AENB 5ESVA 1XAUA 2R23A 1VFAB 4XP6H 1LNUA 4JFPA 5DJAB 5HHOE 3WFDL 5T3ZD 3NGBB 1G9MH 2R2HA 1H8SA 2PCPB 4OAWA 3MXWL 3JTTB 5LQBH 3B9KD 2X1XR 3ZKMD 1JPTH 1V3JA 1KLUA 1DR9A 2B20A 1H0DB 2FSEA 4OCXL 3SDXA 4HX1A 4PJ9A 4HWEH 3BUYA 5HYJB 1VFMA 1XCTB 4OI7A 1VFUA 2DJUA 4P2OD 2A83B 3SKOB 3T1FA 1AGCA 1RUKH 5KZCB 3TN0C 2VN4A 2B5IB 1UJ3C 3BZEB 4XTRC 1E27B 2NZ9C 2X4PA 1BX2A 2JLLA 3ALWA 2BNRA 4WWKD 4L8CB 2UY7A 2FHBA 4QY8B 4JHWH 3U0TB 3VGGA 4Z78A 5KSAA 4RAUB 2NTSP 5DLMH 3VFRB 2GTWA 4YXLL 1WTGT 2GHWB 3CDFA 2D31A 2DQTH 4HAGA 1MQKL 3EYFB 3Q2CA 5GS2H 1TCRA 4XGZA 4BQBA 3EYFA 3ZKND 5IIEA 1H3VA 2DLFL 3X13A 5IHLB 3IGAB 1A6WL 3GMPB 3OGCA 2XKUA 3QIUD 4OZIA 5J13B 2E6PA 4G6JH 1H3XA 4MNGB 2XACC 1P5VA 2BHZA 2Y25A 1NKOA 2VO5A 3CNKA 5E24E 5F7KC 4JM2B 1X5HA 1JN6B 2OTUA 4NO5A 2HYMA 4XT1C 2BVPA 3BPLB 1ZVHA 2ITDB 5LAXB 5EPMB 2A74A 2C3VB 4JPVH 3CFDB 5IB3A 2AKRA 4IIQC 1G7LA 2VR9A 3BD3A 4AMKH 3KNBB 4XAWH 3WL9B 3QCUL 3UJIH 5F9WB 1S9XB 3UDWA 4QXTA 4U1GB 4OV5B 5BS0B 1FIGH 3WCYA 3IRPX 1JGLH 1DUZA 1IGFL 3KPRB 4UIMB 4AEIL 1YNKH 5KTEH 2B2XH 4QCIB 3BO8A 1H8OA 1IL1B 3KJ4B 3SBWA 1UXWA 2Z31C 5GS3A 3LN9A 4O9HL 1HDMA 1I9IH 3RNKB 2GITB 3OR7B 4CW1A 2FL5B 1PYWB 2GJJA 4RRPG 2BMKA 3QJHB 1YQVL 1AE6H 5CSGA 3T4YA 2EO9A 3MOQA 1JV5B 3WE6A 4NUJA 4JFZL 4IJ3B 3O6FA 1ZTXH 2R1YA 2MPAL 2DQDH 5GRUH 3VWKD 3GI9H 4M5YH 4OGAC 35C8H 4XP1L 4ODVH 3E6HA 1WBZB 4MHHI 3I9GL 5J13C 5I1IH 4WI6A 4WW2A 2IGFL 4OZHF 1QP1A 1ZSDB 1KEML 5E5MB 4HJGB 4JFHD 4KPHH 2V2XB 1C1EH 5IW6A 4G7VH 1GOHA 5I8EA 3OB8A 1UG9A 2VXUL 2C3WA 3TO2B 4AL8L 5I0DA 5C0BD 2FBOJ 4L9LA 4Z7VB 5D7IA 2R29H 4A2LA 3FFCE 4JY4B 4PJBE 5E2VH 3MA9H 2PW2B 5GJSL 3QXUA 4UQ3A 2ID5A 2AP2A 1CGUA 4WNQB 1N8ZA 4FMKA 4OJFL 3JSSA 4YHNA 2VJXA 1FFOB 1U92B 5DK3A 3DXAE 2MHAB 4WDIA 2DQGH 2ZPKH 5DYOA 3O11B 4KKLC 5I6XB 1RURH 4MWFA 1JGVH 1EJOH 1AXSB 3H7LA 3BPLC 5IEKA 3ULVC 2DQEH 4O2EA 3QIUB 2DKSA 1DQML 4S1RH 1E4XI 4QOKE 1T5XB 3IKCA 5HGHA 2AJXH 3C8DA 4JM2D 1EEZB 2MSPA 1Q9KA 2Z35A 2Y5TB 3R1GL 1LO0L 4KZEL 4N0YH 4HF5H 1XCTA 3QDGE 3QEQE 2D7MA 1O5DT 3F65A 1J1OL 1KG0A 2E27L 4PRPE 3QDJA 3QAZC 2XQYG 3UYPA 5D1XB 1NC2B 4NZRH 1QSEA 2Q8BL 2I26N 2JJVA 2AJ3A 4HIHA 4EZMA 1T1YA 4U1MA 4XI5C 1F58H 5T5FL 4CRPA 3T1FB 1A6PA 3ARQA 4Z7UE 3K1DA 5IHUL 1WCBB 4PJBA 3QFJE 3ARFD 4TSBL 3SDYL 1SEQH 1TNNA 2IANA 5A16A 1UJTA 4DK3A 1RIUL 3VI4E 3VXSD 1WBXA 5DRWA 2N1KA 3QDAA 4GW4B 3WXVH 2YC1A 3VWJA 1LP9F 3OPZL 2H32B 5I1AB 3RWGB 2R23B 4YH6A 1HQRB 4PTTB 3HMXL 5ALBL 3NH7H 3VWKB 5BVPL 1P4IH 3K4DA 1XIWB 1QFUH 2OJEB 2YK1L 4LNRB 1Q9LA 4G8GA 1DBAH 5JW5B 1I7TB 1NUGA 4C56E 5DD3H 3PL6C 4TNVK 4U3HA 3TNMA 1FPTL 4KTYA 3D85D 5ITFA 5HHOD 3ZDYE 1A6UH 1NSNH 1BQLH 5LBSH 4M43L 1J1PL 3P11H 4AQ1B 5KSAC 4ONFL 5T1DL 1R5WB 3EO1B 5KS9E 1UWXH 4XNQB 3W11C 4OD3L 4XVJH 4JFYA 12E8H 2XWTA 3GBML 1RQ5A 4Z7WF 5ICZB 1N0LA 5DK2A 3IJHA 1TPXC 3TV3L 1MNUH 4GRWH 3P4NA 3RA7H 1IEBA 3VG9B 1DQJA 5IBTL 1S9YA 5L0QC 4ZFOB 3QUXC 1YJDH 3ZE0F 2YMXL 4M1GH 1GGTA 1HOCA 4EI6B 1T21B 1MFNA 3ZDXF 3HFML 3OKOA 4X9BA 3SDDD 2AJYH 1JVKA 4ODTH 1XF2A 2CIIA 2XG5A 4EKXA 5IMLB 3GFUA 5HGAB 1IGIH 2B4CL 1NAMB 2FJHB 4GKSB 2Q7YA 1HCVA 1NGXB 4I2XA 4ESKA 3MLWH 3QNXB 3L1OH 3NIDF 4NKDB 1U2HA 4YHKH 4RFNB 1RULH 3ILQD 3AY4C 3EYUL 3FO2B 4QO1A 5GGRA 1V8HA 2NW2A 3Q48A 2GJZA 3VJ6A 1URLA 5J1SC 4Q74A 5D1QB 5C6WH 4FXKA 1JZ5A 2HJLA 2C4FT 2VC2H 3PGFH 6FABL 3ESVF 5ERWA 2BOBA 3KPSA 5AUMA 3ARFB 5HHQA 2XN9A 4EI5D 1AHWB 5DMKB 4HMDA 4TULL 2RFXA 1AD9B 1HXYB 3AM8C 4QRQB 5K93A 1R3HB 1P4LB 2ADGA 4UT6H 1HK6A 4Y8AA 1E28B 3RL2A 5IFHH 3NMEA 5GS0H 2Y6SD 5DURD 5TE7L 3PF2A 3VA2C 2ZCKL 4UTBH 3TGXA 4GW1B 1FAKT 5KANG 4XMPL 2CDEA 4JJ5A 3LV3A 1CFVL 3LMJL 4DKFH 4NN6C 5EO1A 3H9SD 2UV3A 3WIIH 4RZCB 4OD1H 1FGVH 2VXTL 2ZCHH 3RWCB 3L95A 3RVXD 2OQJA 2XTJD 4D0BB 5ISZD 3D85A 2X9WA 2OTPA 3GZKA 2YPLB 3IDGA 1IAIH 3LH2L 4Y88A 3IRZA 1NH6A 1RUAH 2O5ZL 3QEQD 3W39B 5TDNA 1D5IH 1IFHL 1OARH 2X1QA 2H26A 2PUQT 3QSKB 4FG6C 4KHTH 5T1LA 3OAYK 4PRDA 3O45A 3CFEA 5EUOB 5DJXA 1N7ML 5FYKL 4HAFA 2MQ3A 1F4WL 3J8F7 2QADC 2VABB 3C5ZC 4RRPA 2MTPA 1HH9B 2WANA 3VI3F 3WHXB 4KRNA 3X11B 1BWWA 4N8VG 2GJZB 4NN5B 3QEQA 5IMKA 2PXYC 1LEIA 3H7BA 2IMMA 4IMLA 3L5WB 4P2RE 3V0WH 4MJIE 1S7RB 4U1KB 4YBLC 2FEEI 4C56B 3B2VH 3GSWB 4JZOA 5I1EL 1X5GA 1Q94A 5AG8A 3F8UB 4BFBD 5LGJA 3CLEL 5EDXA 5I75C 4X99A 1OSZB 3ULSB 4HV8A 4PGDB 2FHFA 3CH1A 3N06B 1G7IB 4KQ4H 2Z31A 4BFEA 1F6AB 5FYKD 4ISVA 5I1GH 2A1WH 4KHXH 3BE1L 2X9YA 3D25B 2JB5H 2XY2A 5EIIB 4OFYD 2KL6A 3PJSA 3QQ3B 5I76B 1QQDB 1ADQH 1TJGL 4S11A 3QIBD 5CEYB 1WK0A 4ZFFB 1FE8L 2YRPA 4KU1A 3L3DB 4K3EH 1U3JA 2NY1C 1FNGA 2BJML 1T2QH 3HC0A 3HI6H 3KLAB 2AEQH 4JFFA 4Y19B 1A6TA 3QP3A 3OKNA 3I6GB 1G7HA 1DL7H 2JIXA 3C6LB 4CW1B 3CDYA 4GUPB 4RAVA 4UV7H 4XPAH 3BDBA 1I3GH 1B2WL 3UPRA 4PG9A 1NGZB 2X41A 5C0JA 4MJ2A 4NQTA 1Q0XH 2W0PA 1CQYA 3MRLB 3WXWH 5I19L 2EEBA 4RFNC 4F58H 1PZUB 1KV3A 2DD8H 2NY6C 2APFA 1WFOA 4XC3H 4AM0B 4KXZH 5DO2C 3KYKH 3WLWD 1ZT7B 3MRHB 2FGWL 5I1AA 5DJ6A 5M94B 5DJ2A 3DPBA 3MLTA 2HMID 5E8EA 1TVBA 4PRBA 3GSNL 4X6CA 3OX8B 1C12A 3QIWC 3RU8H 3IXAB 4MCYB 1KCVH 3VXRA 5FGBA 4LNRA 4WW1A 3BEWB 2VDLH 5EIIA 1G7LB 1QPXA 3MRGA 1BAFH 4MDJB 5DJCA 1IQDA 3MLRH 4JRXE 4UDUB 4XB8A 1RJCA 4JG1L 2GUOB 3O6LH 1I8KA 2CRYA 5A1AA 1I8MA 4OGYL 2MCPL 3ULVL 3U48A 2OL3L 2HRPH 1K3IA 3HPJB 3VU2A 5E8NA 3DHJA 4PB0L 4OLZH 3REVB 1T1ZB 2I60L 1MWAH 1YYLL 2EYTA 3SKJL 2BSRA 4K9EC 2O5YL 3LPGA 1J8KA 1D5BA 4XHQA 2BNUB 1SEBB 2FO4A 5F96H 4CUCA 4HC1A 2YSSA 2VQUA 4ENED 2C4XA 5JQHC 3TCXA 3SCMD 3VXUA 2CDGB 2R9HD 3QXTA 3RUGE 1YC8A 1CU4H 1IEBB 1D3CA 5B22A 4WFGE 2FO1A 5F7DA 5CD3A 5EC2B 3MPCA 3A6BH 3SE4A 2XI9A 4GBXC 2AK4A 1REIA 4WO4D 5AYUH 4J23A 5F6HI 2D7TH 2AABH 1CVRA 4PRHD 2H2PC 2OL3A 1QO3A 3L7FB 3IETA 4P2RB 3KPPB 4A6YL 3FONB 3ORJA 3QUXB 2ERJC 1OSPL 3OAUL 1NCTA 3QQ9D 5EZJA 4FFVD 1F4YH 1X3DA 4PRBB 2XWBB 4F9PC 1HHHA 4KK5D 4M4PA 3WFBL 1AO7B 5HPMA 4DAGH 1BBDL 4L29A 4XCEB 4O58H 3MREB 4XVTL 1P4BL 2F54A 1H8NA 4NDMA 3AU1B 3F7PC 5BQ7B 1J87A 2J7LA 4YQXH 1I7RA 1IARB 2B0SL 2JB6A 2ZOLA 1JNNH 5I30L 1MHCA 1HI6A 3MRMA 4KAQL 2BERA 3OB0K 1RUML 1N8ZB 3P3YA 1MWAB 2ADFH 1MCLA 4GKZB 4PRNA 1JPST 1WFUA 2ARJB 4BFGA 4FQXD 4PTTA 15C8H 5F93C 4P23C 3CC5B 5CMAA 2M2DA 1RZGB 3MJ6A 4GW1A 2IBBA 2F9BT 4UU9B 4B50A 5IJVA 3WSQL 3O6ML 4P5MB 3SE3A 1A9EB 3KXFA 1HSBA 3BJ91 4M6MH 4C54A 1OGAA 3HRZB 3LKNA 4QRPE 3MJ8B 4M8QA 4IDLA 1CZ8L 5FHAL 1IZJA 3TH4T 4KUZL 2J8UF 3I85A 4GOSA 2DL2A 4K9EL 3SGDI 3GB7A 4JVWA 5DSCA 2KDGA 4F8QA 3OWEA 1OAKL 2VLKD 1WBZA 5I75B 1NFDF 5E08H 3LD8C 3BQUD 4WI8A 2YPLA 1EFXA 3IDGB 4Y4KB 4XPHL 2VLMD 3K8MA 1JFQH 4IRSC 1QFWI 1R5IA 2VH5H 5INDB 3KNBA 4U4BA 5IVZB 4LCCA 5JORA 2Q87A 4HUWA 2JELH 2DKUA 4PS4L 3X14A 4I5BA 4JDZA 4FQHA 4U1IB 3NABH 4HW6A 1OD9A 3U79A 3SQOH 1YY9C 3ARFC 4Z0XA 3ARPA 3MFFA 2D0GA 4GBXB 4JZJA 3RZWA 3LQAC 5E1AA 5BRZE 2FX9L 1MRCH 1U6AL 3QA3A 1AXSA 4YEEA 5IEKB 4U6VL 4PRIA 2B5IC 4OLUL 1Q72H 2HFTA 1XGQA 1M6OB 3C2AL 1PX4A 3EJZD 4LQFH 2DBLH 3L3IB 1YEFH 5ENWB 3D5OF 4Q6IC 2VLRA 2Q8AH 5C0CD 3EFFB 3H9SB 3IAQA 1EXUA 3NN8B 4G8GE 4LARH 1UM6H 2VLLA 3MRNA 1I85C 5HYEA 1UYWL 3NCFB 4ZOCA 3VJ6B 3AS1A 3TNMB 4Q9QL 1J8HB 1FO0H 3SQBA 1A7NL 5I8CB 2BOCB 3MV9A 3B8SA 4P5TA 4ZNEE 2V7NA 1L4IA 5DMIL 3RI5F 3WKNA 2DWDB 4KKAC 3U7YL 3T0WA 3EKCA 1KTKE 1N0XH 2J88H 4ODHL 4PLJC 3MNZA 4OCLC 1AGBB 1AI1H 1YMMD 4N5ED 4ELME 1CG9B 1S7VB 5C6PB 4Z7VF 4Z7QE 1AKJD 5T1KA 4KUCD 2EKSB 3F7QA 3WJJA 4WHDA 1KPUA 1S5HA 4EN3B 5FHBH 4Y5VA 2PO6A 2YPLE 4MAYB 2DOCA 5EO9B 4HIEA 3MACL 1FFNA 1QSEE 1FZMB 3JWOL 2XN9B 4ALAH 3VD3A 1T1XB 1LDPH 4MWFB 1M7IB 1QHPA 1PD6A 4O51A 1NLBL 1TQBB 5C9JA 4S1SL 4LPUA 2J2ZA 2ED8A 2GI7A 1FFRA 3D69B 3I50H 3PWNB 3ZZ1A 1F4XL