The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
17
|
sequence length |
75
|
structure length |
75
|
Chain Sequence |
GGYVNIKTFTHPAGEGKEVKGMEVSVPFEIYSNEHRIADAHYQTFPSEKAAYTTVVTDAADWRTKNAAMFTPTPV
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Viral protein
|
molecule keywords |
Soc small outer capsid protein
|
publication title |
Structure of the Small Outer Capsid Protein, Soc: A Clamp for Stabilizing Capsids of T4-like Phages
pubmed doi rcsb |
source organism |
Enterobacteria phage rb69
|
total genus |
17
|
structure length |
75
|
sequence length |
75
|
chains with identical sequence |
B, C, D
|
ec nomenclature | |
pdb deposition date | 2009-07-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF16855 | Soc | Small outer capsid protein |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Alpha Beta | Alpha-Beta Complex | Outer Surface Protein A; domain 3 | Outer Surface Protein A; domain 3 |
#chains in the Genus database with same CATH superfamily 3IG9 A; 3IGE A; #chains in the Genus database with same CATH topology 1VQ6 E; 3PIP E; 3CKG A; 1S72 E; 1KC8 G; 1VQN E; 2QEX E; 3CCE E; 3CKF A; 5B11 O; 1YHQ E; 1KQS E; 1RL6 A; 2PI3 O; 1VQ9 E; 3J7Z G; 3CCR E; 3CC2 E; 1YIT E; 2AF5 A; 1VQK E; 2OTJ E; 4IO9 E; 3G6E E; 3CCL E; 5JVG E; 2I5Z O; 1VQO E; 3OW2 E; 1VQ8 E; 1VQ4 E; 2OL8 O; 1Q81 G; 3I56 E; 3CME E; 1YJN E; 3CCM E; 2OY5 O; 3CCS E; 1QVF E; 4IOA E; 2OTL E; 3CXC E; 3IG9 A; 1Q82 G; 1QVG E; 3CC4 E; 1P4P A; 3CPW E; 1M90 G; 1K9M G; 1OSP O; 3CCJ E; 2ZJP E; 1YJ9 E; 1YJW E; 3EC5 A; 4U67 E; 2OL7 A; 1N8R G; 5GAE G; 5DM7 E; 2ZJR E; 3DLL E; 1RJL C; 5B3M O; 3CCQ E; 3CD6 E; 2I5V O; 3CCV E; 4UY8 G; 1W2B E; 5DM6 E; 1YIJ E; 1VQP E; 4WFN E; 4WF9 E; 1VQM E; 5B10 O; 2HKD A; 5JVH E; 1K8A G; 2OL6 O; 1KD1 G; 2QA4 E; 3G4S E; 5GAH G; 3AUM O; 5GAD G; 3PIO E; 1Q7Y G; 1M1K G; 5GAG G; 1YI2 E; 1Q86 G; 5AN9 B; 5B2A O; 2FKG A; 2OY8 A; 3CC7 E; 3G71 E; 4WCE E; 5HL7 E; 2CQL A; 1FJ1 E; 2FKJ A; 4IOC E; 3CCU E; 2OYB O; 3CMA E; 1NJI G; 2G8C O; 1K73 G; 3I55 E; 1VQL E; 1JJ2 E; 2OY7 A; 4WFB E; 5H1S I; 5MLC H; 2ZJQ E; 1VQ7 E; 3CF5 E; 2OY1 O; 1VQ5 E; 3IGE A; 4WFA E; #chains in the Genus database with same CATH homology 3CKG A; 1RJL C; 5B3M O; 2I5V O; 3CKF A; 5B11 O; 2FKG A; 5B2A O; 2OY8 A; 2OY5 O; 2PI3 O; 1FJ1 E; 2FKJ A; 5B10 O; 2HKD A; 2OL6 O; 2AF5 A; 2OYB O; 2G8C O; 3IG9 A; 2OY7 A; 1P4P A; 1OSP O; 3AUM O; 2I5Z O; 3EC5 A; 2OY1 O; 2OL7 A; 3IGE A; 2OL8 O;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...