3IG9A

Small outer capsid protein (soc) of bacteriophage rb69
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
75
structure length
75
Chain Sequence
b'GGYVNIKTFTHPAGEGKEVKGMEVSVPFEIYSNEHRIADAHYQTFPSEKAAYTTVVTDAADWRTKNAAMFTPTPV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Soc small outer capsid protein
publication title Structure of the Small Outer Capsid Protein, Soc: A Clamp for Stabilizing Capsids of T4-like Phages
pubmed doi rcsb
source organism Enterobacteria phage rb69
molecule tags Viral protein
total genus 17
structure length 75
sequence length 75
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-07-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16855 Soc Small outer capsid protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.20 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Outer Surface Protein A; domain 3 3ig9A00
3IG9A 3IGEA
chains in the Genus database with same CATH superfamily
1VQ4E 1RL6A 1VQNE 3CC4E 1P4PA 1W2BE 3IG9A 1YJNE 2ZJQE 1KC8G 5GADG 4IO9E 3CCME 3CCSE 3OW2E 5B3MO 2OTLE 3I55E 3CF5E 1VQ5E 1YITE 1K73G 2OY5O 3G4SE 2AF5A 1Q7YG 3CKGA 3CCLE 3CC2E 1VQ9E 1N8RG 2PI3O 5JVGE 2CQLA 3CCRE 1VQ6E 1M90G 3G6EE 1M1KG 2OTJE 3CC7E 2OY1O 1JJ2E 5GAHG 4IOAE 1YIJE 2FKJA 1S72E 1YI2E 4WCEE 1KQSE 1NJIG 1FJ1E 3CXCE 2OYBO 2ZJRE 5AN9B 3CKFA 5B11O 2OY8A 1KD1G 2OL8O 3AUMO 1YHQE 1Q81G 5B10O 1VQ7E 1VQPE 1Q86G 1OSPO 3J7ZG 5DM7E 3PIOE 1VQME 5B2AO 5MLCH 2I5VO 1QVFE 2OL6O 2HKDA 1VQOE 4WFBE 4UY8G 5H1SI 3CMAE 2QA4E 2OL7A 1K8AG 1VQ8E 3G71E 3CMEE 4IOCE 3CCEE 1YJWE 3CCJE 3CCQE 4WFNE 1YJ9E 1Q82G 1RJLC 2G8CO 4U67E 5HL7E 3CPWE 2FKGA 3I56E 5GAGG 1VQKE 3PIPE 3DLLE 1VQLE 4WFAE 2I5ZO 4WF9E 5DM6E 3CCUE 5GAEG 3EC5A 2QEXE 1QVGE 3CCVE 5JVHE 1K9MG 2OY7A 3IGEA 3CD6E 2ZJPE
chains in the Genus database with same CATH topology
5B10O 1RJLC 2G8CO 2OY1O 1P4PA 3IG9A 2FKGA 1OSPO 5B2AO 5B3MO 2FKJA 2I5ZO 2I5VO 2OL6O 2HKDA 1FJ1E 2OYBO 3EC5A 3CKFA 2OL7A 2OY5O 2OY7A 3IGEA 2AF5A 5B11O 3CKGA 2OY8A 2OL8O 3AUMO 2PI3O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IG9 A;  3IGE A; 
#chains in the Genus database with same CATH topology
 1VQ4 E;  1RL6 A;  1VQN E;  3CC4 E;  1P4P A;  1W2B E;  3IG9 A;  1YJN E;  2ZJQ E;  1KC8 G;  5GAD G;  4IO9 E;  3CCM E;  3CCS E;  3OW2 E;  5B3M O;  2OTL E;  3I55 E;  3CF5 E;  1VQ5 E;  1YIT E;  1K73 G;  2OY5 O;  3G4S E;  2AF5 A;  1Q7Y G;  3CKG A;  3CCL E;  3CC2 E;  1VQ9 E;  1N8R G;  2PI3 O;  5JVG E;  2CQL A;  3CCR E;  1VQ6 E;  1M90 G;  3G6E E;  1M1K G;  2OTJ E;  3CC7 E;  2OY1 O;  1JJ2 E;  5GAH G;  4IOA E;  1YIJ E;  2FKJ A;  1S72 E;  1YI2 E;  4WCE E;  1KQS E;  1NJI G;  1FJ1 E;  3CXC E;  2OYB O;  2ZJR E;  5AN9 B;  3CKF A;  5B11 O;  2OY8 A;  1KD1 G;  2OL8 O;  3AUM O;  1YHQ E;  1Q81 G;  5B10 O;  1VQ7 E;  1VQP E;  1Q86 G;  1OSP O;  3J7Z G;  5DM7 E;  3PIO E;  1VQM E;  5B2A O;  5MLC H;  2I5V O;  1QVF E;  2OL6 O;  2HKD A;  1VQO E;  4WFB E;  4UY8 G;  5H1S I;  3CMA E;  2QA4 E;  2OL7 A;  1K8A G;  1VQ8 E;  3G71 E;  3CME E;  4IOC E;  3CCE E;  1YJW E;  3CCJ E;  3CCQ E;  4WFN E;  1YJ9 E;  1Q82 G;  1RJL C;  2G8C O;  4U67 E;  5HL7 E;  3CPW E;  2FKG A;  3I56 E;  5GAG G;  1VQK E;  3PIP E;  3DLL E;  1VQL E;  4WFA E;  2I5Z O;  4WF9 E;  5DM6 E;  3CCU E;  5GAE G;  3EC5 A;  2QEX E;  1QVG E;  3CCV E;  5JVH E;  1K9M G;  2OY7 A;  3IGE A;  3CD6 E;  2ZJP E; 
#chains in the Genus database with same CATH homology
 5B10 O;  1RJL C;  2G8C O;  2OY1 O;  1P4P A;  3IG9 A;  2FKG A;  1OSP O;  5B2A O;  5B3M O;  2FKJ A;  2I5Z O;  2I5V O;  2OL6 O;  2HKD A;  1FJ1 E;  2OYB O;  3EC5 A;  3CKF A;  2OL7 A;  2OY5 O;  2OY7 A;  3IGE A;  2AF5 A;  5B11 O;  3CKG A;  2OY8 A;  2OL8 O;  3AUM O;  2PI3 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...