3IGKA

Diversity in dna recognition by p53 revealed by crystal structures with hoogsteen base pairs (p53-dna complex 2)
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
200
structure length
197
Chain Sequence
b'SSSVPSQKTYQGSYGFRLGFLHSGTAKSVTCTYSPALNKMFCQLAKTCPVQLWVDSTPPPGTRVRAMAIYKQSQRMTEVVRRCPHHERCSGLAPPQHLIRVEGNLRVEYLDDRNTFRHSVVVPYEPPEVGSDCTTIHYNYMCNSSCMGGMNRSPILTIITLEDSSGNLLGRNSFEVRVCACPGRDRRTEEENLRKKG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular tumor antigen p53
publication title Diversity in DNA recognition by p53 revealed by crystal structures with Hoogsteen base pairs
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 48
structure length 197
sequence length 200
ec nomenclature
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00870 P53 P53 DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.720 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3igkA00
3KZ8A 3WTWA 2J1WA 3WU1A 4HJEA 3VD1A 4AGLA 2BIMA 3QYMA 4AGQA 2AC0A 2PCXA 4GUOA 5KBDA 4IBTA 1KZYA 5AB9A 3IGLA 2IOOA 1H9DA 5AOLA 2MEJB 3WTUA 3KMDA 3WTSA 4IBWA 2J21A 3VD0A 4G82A 1HJBC 2RMNA 2BIOA 5LGYA 1UOLA 2IOIA 4IBYA 4GUQA 1EAQA 1T4WA 2BIQA 2IOMA 2YBGA 5ABAA 1YCSA 3VD2A 1EANA 3WTTA 4LOFA 3ZMEA 3EXLA 2ATAA 2AHIA 1CO1A 2VUKA 3US1A 2ADYA 2WGXA 4L18A 3D05A 4IBZA 1TSRA 2X0UA 2BIPA 3Q05A 2J1YA 4IJTA 3D07A 1GZHC 2J20A 5LAPA 5ECGA 4IBUA 1LJMA 5AOIA 3EXJA 3TS8A 3WTYA 3WTVA 4LOEA 2XWRA 5G4NA 3D0AA 1CMOA 4A63A 2P52A 3IGKA 4AGNA 4AGMA 1HJCA 3US0A 4L0YA 1GZHA 2GEQA 4G83A 1TUPA 4IBVA 3D08A 2OCJA 4IBSA 4XR8C 2J1XA 5AOJA 3D06A 4IBQA 3QYNA 5AOKA 5A7BA 2J6WA 4MZIA 2X0VA 1HU8A 4L0ZA 5BUAA 3Q01A 1E50A 1EAOA 4KVPA 2BINA 5AOMA 4AGOA 4LO9A 4AGPA 2J1ZA 2XWCA 1IO4C 5G4OA 5G4MA 3WTXA 4MZRA 3Q06A 2H1LM 2X0WA 4QO1B 2FEJA 3D09A
chains in the Genus database with same CATH superfamily
3CQFA 4N0YH 3REVB 3WFCL 4ODXB 4TQIA 4UQIM 4BK5C 5F97E 2VERN 5C0IA 4XWOD 3NBNA 1BBDL 2P24A 2R23B 1DFBL 3OKNA 4LVHB 3SGEI 5JHLL 1KMGA 2Y7QA 2Y1AA 3J7HA 1C5DB 3ELAT 5A6IA 3GRGA 4G3YL 4RZCA 2O5YL 2GBVA 5DA0B 3HR6A 2DM4A 2EDTA 3APFA 3GIVB 3BVTA 4NQDA 5DRXA 4BUQA 4D8PB 2K45A 2QEJA 4LNRA 2L0DA 43CAA 4PTUA 3H7LA 2LVCA 2FYYA 1DQDH 5GS1B 5DTFA 2Q87A 2JTDA 2WLJA 2VLKA 4LDCA 2ADIA 4RZKA 4MKMA 4XBMA 2VDKH 1JK8A 1BECA 3A3YB 4WUUE 4UAOB 2VC2B 1J05A 2ILLA 4UT9H 1WK0A 5E9DE 1K85A 5F8RC 1BJ1H 3IEAA 3PWPE 4PHZA 3S3CB 3WTTA 3B83A 5E2TH 4JFSA 2E76C 1DJYA 4J3UA 4X6CE 3UPRB 3INOA 3RVUC 3DIFA 3DX0A 4PV8B 2I24N 4W4OA 4K9JA 4LP5A 2Q76A 4BKLB 4FI7A 4P46A 3G5YB 3WKMH 4HSAC 1AH1A 1Q9OB 1S9KC 1IIIA 5E08L 2V3FA 3VXQB 2HFEA 2FIKB 2HT4D 1EGJA 4M9OA 1Y6KR 1GY1A 1A7NH 1SOKA 1GGBH 3RTLA 1KB3A 2JQZA 4J3OF 2F0CA 4TVPL 3TBWB 5IB3B 2Z93A 1TNMA 2LU4A 1U93A 3ILPB 4TOYH 2F19H 1XSKA 4XBEL 5DMKA 1VZHA 5JDJA 3O6LL 2CE6A 3SCMA 3Q3GB 5ITFB 4UNIA 2VKWA 5DSCB 4FHBD 1YECL 3WYRA 1WITA 1T7VA 3B3IA 2XRAH 4M5ZH 3BYYA 2APVA 4UT6H 2YARA 2VYRE 2R0WL 4GB9A 4NB7A 2XQYK 3AU1A 4XAKE 3PWJB 4N0YL 2W0LA 1GTFA 3FT3A 4BWWA 3JWNC 4IEFA 2EICA 4KY2A 2V5MA 1N0XH 1FV1A 2ZWYA 4M56A 1A3ZA 3I85A 2CBPA 3ZDZB 1BIIB 4H0LC 3VSQA 1XQ4A 5MENE 3M8OH 1JK9A 3BGMA 2H32A 5EUOB 1WUNT 4J4PA 1PQZB 5F9WC 5HDBE 1L7IH 1U91A 2VXQA 4WFFE 4NO3A 3VRJB 4Y5YC 3MA7A 3ZGIA 4MNQB 4X6EB 1QRKA 1B4JH 5C6TH 2VW7A 4XNDA 3KYKL 2VZ3A 2W07B 5DUJA 5C08D 2R2EB 5L4MA 3BP7A 4ZRGA 1A1MB 3P3TA 4JZJB 3WEXB 1R5IB 4WJG3 2WTOA 1OCRB 1ZVSB 3FQXA 3RVTD 4N0UE 4DQOL 2QTEA 3TEWA 3HAEH 3HUJB 4IGBB 1F4XH 1URLA 5D1ZA 2E86A 4A68A 1S7WB 1YY9C 3QG7H 3WKML 2YD9A 1BQRA 3GLAA 4TVPD 4QHUA 1XSOA 1GJWA 2BNQE 1ETZA 3L4TA 5FYJU 4NP4L 1AS7A 1OXYA 2LGNA 4O2FA 3VXSB 2FCBA 3HN3A 2NDFA 1KLFA 4HFWA 2APBA 1EHLH 4JANA 4OI8A 4N0FA 1GGBL 2WGNB 3AVEA 1YNKL 1WC7B 1ZY9A 4AZUA 3JZ7A 1H19A 4JPIA 4GG6A 4CDGC 2Q10A 1TETH 2X4SA 4NKDB 5EOCL 5EZJB 4AYDC 4TOYL 5BZXA 1RIVH 1NDMB 1ZT1A 2F19L 5I74C 3U82B 2QKSA 2FZ3A 1MHHB 2GG1A 3B5TA 3CVHB 3MODH 4CN6A 1E0OB 1JHKH 1LNUB 2N7BA 1YQVL 5DVMA 2P1YA 3LEXB 1WZAA 2QVIA 3MNZA 2X4UB 2VLRA 2CRZA 3V6OE 5KUMA 3FFOA 1H8LA 1I3GH 1XIWA 3WELA 4OLZH 1EH9A 5TE6H 3OJDA 1MDTA 3WFDH 3FQWA 3NG5A 5EZLB 4UT6L 4F7CB 2YAPA 3L6FA 1A4JA 3NEOA 2EEFA 3VU2A 5BOPA 4N28A 1XF2A 1BQHA 2NRDA 2YFOA 1FHNA 3PPEA 3BUBA 3QBTB 1OZTG 2QADB 5E6IB 2OMXA 4OZ4B 3KEHA 3RWHA 1JDAA 4JY5L 4ATTA 4D0DB 2WMPB 4DPAX 2ZXBA 1HHHB 1OTSC 4X6BB 3CV5A 3KPLB 2BSRB 1PKOA 3TZVD 3EBHA 4LSPH 1JPGB 1WCQA 2AXFA 5HHPA 3MROB 4PRHB 2DTML 4WSJA 1Y6MR 4Z3TA 3L4WA 3R06B 5HDOA 2VM4A 4UF7C 4B7IA 4L9LA 5C6TL 1CLCA 3HPLA 3BW9A 5K9JL 2GSGB 4NNYB 4CC4C 2YRPA 4W4NA 2XN9A 1JWUB 3DSNA 2Z7ZA 4WV1B 1PG7X 3APDA 1DVFC 5FFGA 5EC1A 4M6AA 3PWVB 4HWEL 1UZ6F 3Q7JA 4PJ9C 3F7VB 5L2KA 4Z1PA 4IMLA 5CM1A 1W0WB 3G04A 1MFEL 2WUCH 5PAZA 3II3A 1NJ9A 1GGCL 5CN3A 4PGBA 4ZMAT 3GS0A 4QF1B 3W39A 3LVTA 3U2JA 1FVCB 2DYSB 4HAGA 1AGBB 1HHIB 3T8MA 2FWLB 3RWGA 4PRIB 5I26A 5J13B 3FUEA 4KAQH 4PJ8A 2EUXA 3BGAA 5DRWA 3MBXH 1A5FH 2JKLA 2K3HA 3U0PA 3IJYA 3RL2A 3MODL 3MRQB 4N2LA 4OZHF 5DQ9B 5BZWA 3K1DA 3Q13A 1K2DA 1J9SA 5DVNA 4DP9X 2X1QA 3WEOA 3TF7C 2XDHA 4FL4C 4OLZL 5TE6L 5JZ7D 3AXLA 3WFDL 1TEFA 1HXKA 4X8GA 3AU0A 5GGUB 5IHZB 3ULVH 3AAZB 4U6YB 1BFVL 2ERJB 3I6GA 4MDRA 1DVSA 3VFVA 1VEOA 2E27L 3NACL 2AJVH 3TU6A 3FW6A 1BZ9A 3RAJH 4P2AA 5C97A 3CVBA 1I8LA 1MW3A 4FDWA 4FZ8L 5I6XC 4A37A 2QQQA 3H9SD 3MLXH 4JKLA 2VITB 2A5UA 1PYWB 2ZJSL 4J3OD 2WSDA 3HI5H 2YIHA 1ET8A 3NJFA 3DC0A 4AVIA 4FXKA 3QRBA 4LFHG 2DS4A 5T5FH 2P5PA 4MCYB 1WRFA 1YEKH 3CHQA 1GYCA 4OKVA 4FI8A 3US0A 2AV1B 4UM9D 4TPRH 1KGWA 1AKJD 1YYCA 3FPYA 1T03H 2X1XR 5K1VA 4HG4K 5CGYD 3HN5A 1Q0EA 1C1EL 3ZL1A 3UAEA 1V10A 2GT9B 1Q9WA 5IJKA 2FQDA 3DUUB 4HYTB 5JDSA 3TCLA 3GMLA 4D0BA 1KIPB 3SKOA 1IKFH 5E2UH 4GS7C 2ZXGA 4HULB 2EJ1A 5K59F 5KSAB 1LDPH 3LS5L 2Z3FA 5L0QC 4ACPA 3NABH 3MV8D 3OKMB 3P9MB 3X3FL 5JQIB 1I85A 1A5FL 1IO4C 35C8H 2QV2A 4ONFL 2CIKA 3ZLQC 5D7LA 1N0LB 1RIHL 4DZBB 5E7BA 3WEBA 3GS4A 5A6MA 2FEJA 4HSQA 3TJEL 4D9RD 3GSWB 4IHOB 4MZ3A 1YY8B 4KO9A 4U6HB 3SZKC 1SLWA 3B34A 2J43A 4OGZA 2KZBA 3AJ7A 3THML 2C5DC 1E90A 5I6KA 3HFMH 1WAAE 1DVTA 2XQYG 4NYLA 1AG0A 3RWJA 3STZB 1CYXA 4P4RA 4K7PY 3I6LD 4B53A 4M7ZB 2BOLA 4S2SB 5IVXB 3MCLH 1OSZA 2APTA 2WN2A 1JTTA 2F5BL 5BQDA 5D4JA 4JO5A 1MN4A 5GSRB 1HJBC 4WEMB 1F56A 1JPFA 3HN8A 2AS5M 2JB6B 1JV5A 4JREB 1EV2E 9PCYA 5G55A 3CZEA 5A40E 2NY4C 1RZFL 3II1A 1P1ZB 3D3VB 4XNYL 5F3FA 5B1JA 2KUTA 3SO5A 3R8BB 3VD2A 3QUXC 2OLDA 2Q5BA 5T5FL 1YNTA 1QBMH 2P8MB 5TDNA 2Z31B 2CMRL 1GH7A 1U8MA 4JN1H 1DVQA 4JKWA 2VUOA 3T2LA 3MLRH 3RX5A 4ZUWB 5FGBC 1I8KB 2NNFA 3GSXA 4ONOA 4PV9A 1BLIA 2Y5QA 4I18A 4B9CA 5MHSD 4KJPC 1XF4B 3PCYA 5KJRH 4JO2H 2R1YB 2H0EA 5F3BB 5T3XE 2K9UA 4K71B 1G1YA 3NIDF 1GHFH 2F68X 3RVVC 4FI6A 1H8NA 3DVGB 1D5BA 1P1VA 1ZOXA 3GJFK 1S78C 4AVKA 5DQDH 5CJ8A 4CSZA 4YE0A 3DJSA 3W57A 1NKRA 1Q1PA 1MLCA 4XXCC 5J11C 5E2UL 2FLBT 4KKQA 4GAGL 1CB4A 3T0DA 3O9WB 4PJIB 1A22B 3W37A 1ZWIB 1SHSA 3NABL 4F37K 4J5VA 1TU2A 2SODB 4JUSA 3TBSA 4UTAH 3NRFA 5I0WA 3LKSA 35C8L 4Y4FA 1QSVA 1NIBA 1B0RB 3QFJA 1VB9A 2DICA 2ENJA 2MIZA 3CZNA 4V1DA 3UJIL 3BIKA 5FEBA 1JUFA 2H32H 3FBKA 4Z3EA 3AT8A 3QQ9D 1I82A 2HLFC 3RHWK 3GI8H 1QI4A 4TNFA 2OMYB 3ARZA 5CLXA 1TMQA 3AUVA 3HFML 2VXQH 3MRHB 2PCYA 1Z5YD 4BGLA 1G7HB 3HG1A 1VIWA 4AZ8B 4Y2DC 5D5MF 4H88L 4CBZA 3FQNA 2H3NB 2B08A 3KWWB 4X6DA 4KMLB 5DC9B 3T0BA 4OD1L 5L6YH 4WW2C 2FJHA 4NM4H 3GEWB 1TYEB 1E6JL 2WIMA 4ZPVB 2DLTA 3FCSB 3JTSA 5CJBA 3MHZA 3QUYA 2EDFA 5EBLB 3TJHD 2OXHB 3MLYH 2CU9A 1IKNC 3FNKA 1HXMB 5TGBA 4POZC 5GGRY 3LXBA 2GY7B 2AKRB 3FF7A 2FT7A 3G3LA 2FSDA 3KGRA 3LRGA 4I3RL 1L6PA 3PGDB 3SY0B 4BIKA 3G5ZA 4DN4L 5IVNA 1BZ7A 4EE2A 2IAMC 4XODA 2HYMA 4PAZA 1A9EB 4MASA 1I1AA 1S9XB 1FG2A 4OLUL 1JGVH 4U1NA 3GWJA 4QHMA 4GG8A 2ZCKL 4GIPD 4PUBL 4QRBA 1BVKB 2R56H 5CMAB 2HG5A 5DJ6B 5IOPA 1DVXA 2W91A 2NNAA 4RFEB 2G60H 2QLYA 5DQDL 2DWYA 5CS7A 3UCRA 1FGNH 2FB4H 4BCXA 2FT6A 1AO7E 4RIRB 5MP6H 3CH1A 3O2DH 1I8IA 1QX1A 4LF3A 3B2UD 4JFFE 5DZAA 3IXAA 2BW4A 5FOJA 2ZWLT 4BFGA 2FQGA 4BZ2A 2LU5A 1ZK9A 4U3SA 4UTAL 3TPKA 5KS9B 4FNLH 1IM3D 1CGWA 1SUHA 1FFPA 3V6FA 4YL4A 3SDDC 2RH0A 4WUUA 3QIUD 3IFPA 3NIFB 1UWXH 3O6FD 5E4AA 2AJUH 5E9DA 5AQ0A 1EXUA 2DI9A 3HE7B 4QD2E 4XNBA 3O6MH 3PWPA 3H7BA 1JBJA 3B9DA 4H8VA 4N68A 4YC2C 3UYRH 4A2HA 2A9NL 5HYSG 5JA8B 1IGCL 4X6CA 4QRPE 4JFHD 2QSQA 3QIBD 5AALA 1BBJA 4PLKC 1IC4H 4OM1L 1FL6A 3G5VB 2XUWA 4XPGL 3V5KB 3KJ4B 3K6SA 1XGPB 4I3SL 5L6YL 3MU3A 3GKZA 3OLDA 1BP3B 1Q90A 3WKPA 4DPCX 3RPIA 5I30L 2ADGA 2FLRT 3SGEH 1H8OA 1ZLUK 3BH9A 1HIML 4DP5X 3LHPH 2UUDK 2DI7A 3B8YA 3GHEH 4QY8B 5CCGE 5DD0H 2XZQH 5ABDE 1NICA 1T66D 1XCQB 3O9WC 1H15A 4IU3A 2P5WD 2FAUA 4D9RE 3BH8B 4PJAF 2F74B 5CZVH 5I1EH 3H9ZA 4XNUL 1HL4A 3PNWB 1D5XB 2MOQA 4Y5VB 2F54E 1BGXH 1S9VA 1J0ZA 2YKKA 4HJ0D 3HR5B 4IU2A 4WNQA 3EJRA 1KC5L 1PIGA 1NH6A 2VDRB 1NFAA 2DMHA 4E42B 3WU1A 2QQKH 4FQ2H 5E51A 2CZNA 2P8LA 3DPBA 4GKSB 3VFSB 1BXXA 3L54A 2G5UA 4YHML 4K3DH 1NEZA 1O9ZA 4PGCB 3IGLA 3PL6C 3RI5F 2BSBA 5EU4A 4AEEA 5SWQA 3FB6B 5AVUB 1KBGH 1FGNL 2YMOA 1FE8H 4XPFL 4LKXB 5J9PA 2BOCA 3LTVA 1SHWA 2WQWA 1N12A 1ZV2A 4M4PA 4WI3A 1MI5D 3UZEA 4EI6B 4ZXBA 5I1JH 3FTGA 5MENA 4N9GB 5CKAA 3HPJA 2CGRL 1IAIM 3N0AA 3ARED 1XD1A 4JUTA 1V05A 1FL5A 4RGOL 5C6WH 2B9BA 3ZTNH 1HXYA 1FVEB 4YNYB 5DA4A 1SDDA 2NX5E 3WS3B 3KH4A 2H1XA 1G1OA 1NGXB 4AKOA 1SJEB 2WQUA 4P3WA 1CGYA 4R2GB 1KB5B 4LEXH 3SE8L 4HGMA 2OYLA 1T2QL 2YUXA 1NFDB 1MJ7L 3KYMA 4N0UA 5HGDB 5BRZE 1R33A 2W88A 2BIPA 2XVBA 3P4MA 5DJYB 3GMRA 1ACYH 4LSTH 4RRPG 5LAPA 5I9QC 3RJOA 5GJTL 3IDMB 4GSUA 4ISVB 1TJHH 2C3VB 5C0AE 1WGVA 2BNQA 4WUKH 5HHVL 1E8WA 5AW0B 2KMWA 4ZMPA 5ACZA 2FT8A 4HFUL 4IOFD 4TVUA 3KPSA 3VA2C 5TDOA 3F65A 4K4KA 2J4WH 4BDVA 2QQNH 1JFQH 1S7TB 1KFAL 5HI4D 2V5YA 4KK8C 4WHCA 3CGTA 4P5TD 4G5ZH 4IRSA 4EVNA 4HIIB 4K94L 5CXPA 5IVOA 3HHMA 5MEQB 2BX5A 1A1OA 1VF5C 3FOMB 5HJGA 1WP6A 3LNHA 4G6JL 3ROOB 1GMEA 3ZSSA 4XP4H 2EO7A 2NY5C 1AC6A 5BUGA 4Y16C 2DJUA 3C60A 3W81A 1H3XA 1SBSH 4UB0H 4P23D 3ZE2E 3QA3B 1M2VB 2V2WB 1KLUB 1RSYA 4FQ2L 4I9WE 1CD0A 1XR8B 3X13A 4BE6A 5IKCA 1TITA 4EUPA 3WIAA 2FJUB 4JDEB 3KPRE 4NFDA 5FCUH 1IJNA 3QHTC 5HHOE 3BFWA 3EYVB 2WXNA 4XCCL 3RTQA 4P5SA 1KBGL 1SY6A 3WUWA 4ANXA 2OQJA 2NR6C 1CFTB 3KW7A 5C7ZA 3HZVA 4ELME 2KBGA 3HNSL 5HD8C 4PGJA 3UJTL 1WBXA 3LKNA 3T77A 1NFKA 2KT6A 1LO3H 4QRUB 4RESB 2ZAGA 3RILA 4JPKL 1WEJH 4AQOA 3AACA 2XHNA 3O8XC 4O02H 4NJAH 5IJCC 3QFDB 3RX9A 3FO9A 4FXLA 4NZFA 2D4FA 1RP9A 5BW7C 2GAZA 3CFEB 3QDAA 1MAMH 3GMMB 4AIOA 5LBVA 1MWAL 1FNGB 2Z4TA 4ZX5A 3L1FA 3NIGF 2ED6A 2J2ZB 2VTFA 3HNTL 4D0CA 4HUNB 1VRSA 1CWVA 3NOIA 1SN5A 3IFLH 2X6CA 4GNKB 4J2QA 4X80H 1LO0H 4OFQA 4F8QA 1CFSA 5J6HA 2D2CC 4NRZA 5IESH 3GHPA 1AGFA 2H3XC 3ASNB 1WT5C 3P4LA 4W6WB 4WUKL 3EO9H 5AZUA 2H0PA 3MRLB 1W8EA 4NN7B 3TC9A 4F2FA 1Y0LB 2X4TA 1X5JA 2N0KA 4PMEA 2OL3L 3VH8B 3NZHL 1ZS8A 3U0TB 3IDIB 3UADA 3O3AA 2QQNL 1IZKA 2P5ED 1JFQL 3QORB 3Q44A 5FYJE 4YSTA 1MJJB 2Z35B 4D3CH 3OWRA 1IBGH 1WTGT 4G5ZL 4RX4A 3SQOL 5JOPE 3X11A 1U3NA 4AJ0A 3SYCA 1CI5A 5DDHB 3CFUA 4WWKB 3WNOA 3D9AL 1Q9LA 1CE1L 2YQ3A 1SEBB 4FCAA 1FI8C 1JXJA 5LCVA 5A2KH 4U6XB 5I8EA 5F7LB 3K6FA 4H0GA 2OTUA 4DPBX 1HYSC 4M62L 3ROLA 1KT2B 5LWYH 3FUHA 1KPRB 4JFHE 4MJ5A 2V5SA 4TQPA 1HS6A 1D5IH 4R2GC 3WIHA 2HT2D 5IIEA 1HILA 4DVBA 4NO0B 3FCGA 3VG0L 4JGMA 5FUOH 5FCUL 4OLXH 5L8JB 2AANA 1LP9E 1NTDA 4FQIL 4L3ED 3CQQA 2YRBA 2A9CA 3DKHA 1EJFA 1AR1C 1IAIH 3LEVL 1KEGL 1ZSDB 5B22A 4OBSA 2GC4C 3V7AG 5EIIG 1HDMB 1E9PB 3GBEA 4L8BB 1GMIA 3PWLA 4MXQD 4OJCA 5BJTB 5KSBB 3RL1B 3UACA 2P5WE 4TQEH 1P4LA 2CGYA 4GAYA 3FFDA 1C5CL 3RGHA 3UC0H 2XVKA 2J71A 3S8GB 5EIVA 5IFJA 1DE4B 1F3DH 2EDBA 2VDNL 4OGYH 2OM5A 3FTVA 3MLWL 3W1ZA 3BQUA 2Y06H 3AM8C 4KWUA 3W82A 1YPZA 4M6OH 3CN3A 3LN5B 1KBBA 5SV4A 4Y4HA 1AS6A 2DYPB 4LRIA 4F58H 1F4YH 4PS4H 5DS8B 1BWWA 3IFLL 2NY3B 4L4TE 1R5WA 3SBPA 4GPVA 3BZDA 3RGVB 2J1WA 5L8KB 2E9IA 4N8VG 1FP5A 4FQCH 1QQDB 2ZOKA 5IESL 5HHMD 4P06A 3OPZH 3ZTEA 5BO1H 3NCYP 4FNPA 1MI5E 4KV5F 1S3RA 5KBDA 3VW3H 1A6WH 3QJHB 3EJUA 4DWHA 1DBMH 2C3HA 5EZIH 4R26H 4GRLC 3L9BA 4L9DA 2CGZA 2CXKA 3KHOA 3OF6A 1C08B 2IPKB 4ZUVA 1EWHA 3OKOB 4D3CL 2H6PB 2YEZB 3QEHA 1NC2A 4JR9H 3DYPA 1CFNA 1ED3A 2FNWA 2D8KA 3MLTB 3MRFB 3PXJA 4YSOA 4ELKB 1X7TA 1FDLH 3CFJA 4BZ2H 1DUYA 4PRDA 2YAOA 3P02A 2L7EA 3V2AR 2VABB 5F7AA 1WAAA 4M1DL 1IAKB 2A6KB 3EDEA 3UEQA 1RUKH 4OLXL 3LNGA 3WGVB 5F9JA 1PFOA 2BRQA 1EERB 2XCMC 3T65A 3PABA 1RQ5A 1XXFC 4JVWA 2B20A 1M05B 1FFOB 3E8UH 3IRPX 4ZFOL 5BMFH 3IMVA 1KIRB 3F2LA 1FNSH 4K2UL 5I1CH 1DJWA 1KCVL 5JHDD 4L1DA 1IM9B 4TQEL 3OVUB 3UBHA 3U6RB 3V4VA 2YEQA 4P2CG 4LLUB 3CSYB 4GW1B 4OGYL 4AL8C 4XTRC 1L9RA 4HUVB 4KTDH 1SOQA 1X5GA 1E2WA 1G1KA 2A77H 3D87B 4OFIA 4ZMLA 2JIXA 1LEGA 4WWKC 4U1JA 5KYUA 2M83A 3N40F 2O6EA 4MA1B 2JKNA 3AZUA 2ZIDA 1JF5A 4YLCA 3MNMA 3RWCB 2ATKA 5K9OA 3L81A 3VWJC 1I7ZA 4QIRA 3L9EA 3S5YA 1XFPA 3QWOA 3MUHL 2WLIB 2BINA 1GSKA 3HZMB 3OQRA 2OXGA 3CWGA 2VDPL 1EVUA 4MMZA 3WIIL 5C86A 4G9DA 4RAUB 3U7AA 2OK0H 5AKTA 2DD8H 4C54A 1D2OA 5IR1A 2I27N 5EZIL 3TZVA 5CAYB 1HTYA 4MLSA 4R26L 4Q89A 5G4MA 3ZE1E 1E5BA 4BD4A 2F61A 4RGNE 3TN0A 4MJ6B 4XCYA 5BVJB 1C9SA 5SV3A 2FJGB 4JCLA 2FWOA 2VWEE 1NFIA 3ZHKA 3GB7B 1RZQA 2XFXA 2NY6C 4GLRI 2I5YH 1WIUA 3EJTA 2YUZA 4YBQD 5ALCH 2B4CC 5T5NF 4F7TA 4Z7NB 3IDYB 4U1KA 3DV6B 4B5EA 4K5LA 5IK3B 3ARSA 2ALWA 4UIKL 4QHNB 1MAJA 1BSIA 1USQA 3DBXB 3EOYG 4QWWC 1X7SA 4Q4IA 5TPWH 2VZUA 4NM8H 4RSVA 4FG6C 3DRTB 3EH1A 4XO4A 5T1LB 3QZWB 4UANA 4QXTB 4WW1A 4HU8A 2QGBA 1P7QD 3MCKB 3JUYA 2D7TH 3L1GA 2FD6H 4B9GA 1MF2L 3ETBJ 3O41A 4BYHA 1RUKL 1RJYB 3ARFD 1NOLA 2GBAA 3TP4A 4WEUD 1RURL 1VFMA 2E7LA 3WJLA 1Q9KB 3TO2B 1A9BB 3N44F 4HXBH 2ZOLB 3E8UL 4F15C 5BMFL 2D7QA 3MRRB 4M3HA 4F2MB 4AQ8C 4FX5A 4Z7VF 4OQTA 2CDFA 1M6OA 3R19A 1OB0A 4YH6A 4AQ1A 1F1DA 4M1GL 4AJYV 2AI0H 5AVRB 4U0RB 5IHWA 2O61B 1CTOA 4AYFB 1CLZH 4NI6A 4MSWA 5FYKU 5B21A 1H3GA 1N3NB 3UMTA 2OJ1A 2I9LB 2GC7C 2A77L 4X42A 3IK2A 1ZXQA 2FH8A 3GMNB 3UYPB 1QZ1A 5G4NA 1VZIA 5I6MA 3BPOB 3ARGC 4JM2B 2O26U 2H1PL 2YC1B 1O6SB 2C9PA 4Z0XB 5IQ9A 4AGNA 5ADOL 1AY1H 3HG4A 4L3EE 5H35B 3MV7B 3F7YB 2HKFH 2WIIA 3TGXA 4LT7A 2VM9A 2X28A 1CBJA 3STLA 1VGKA 4H1LA 2HJLB 5DD6B 5TK2A 5ANME 4YWGH 4OIFA 4LPTA 1X7QB 1WPCA 2WVUA 1AO7A 1S7XA 1XCTB 4JFFA 4WAFA 2PPEA 4YXHH 1LMKA 3GBML 4N8PA 4YDMA 2OMBA 1M7UA 1ZDQA 4YHLL 2FR4B 1B2WH 2GPZA 1XTMA 2P80A 3K6OA 1CI3M 1T1ZA 2I69A 4GAJH 3C9NB 5FLVA 1NAMH 5DEFA 4Y2LA 5ALCL 4G7SB 4L3CA 2E6JA 2EYRB 1ZGLP 2WC7A 5DMGD 5EO0A 4P2QB 2BP8A 1V7MH 4AI7A 3ZBMA 4G7YH 3VD7A 2WN3A 1JZIA 2F08A 1AKJA 4DUXA 2HRHA 3IGAB 1E6OH 1BAFH 4PLOB 3CZGA 3N9GL 4HJGA 1EZUA 4HPYH 2XZCH 3T8XB 1ZHNB 5I1KH 3KPPA 4KOBA 2WWMD 2NY0D 4QRPA 1OAQL 2H1LM 3TWCH 3BZEB 2IDUA 4G6AD 1QNIA 4GXVH 1UJ3A 4ZOAA 4XMPH 4HKBB 4HQQL 1F97A 1EA9C 2AV7B 1XR9B 3IM1A 4R4FL 2IPTH 3OG4B 1QLFB 4X8JB 4ZS6C 2ADFL 5GRYA 4FHJA 3SPIA 2H5UA 3Q48A 4X7SL 2HVJB 2PCFA 1JS4A 2X1PA 3MV8A 3U48A 4B9YA 4QOKB 1M9SA 5L2JB 3QJXA 5EFIA 1ZGLB 3IXTB 5D2LF 2YAHA 3F5WA 1ITCA 2AI0L 3CVIH 3M17A 4WO4D 1FN4B 1JRHI 1K3IA 4JRLA 4E5XG 4L4VE 5E1GA 1WWWX 2MOGA 2Q86B 3RDTA 4MJJA 2HT3C 3CHPA 2ZCLH 2R1XA 3BP6B 2F54A 4N6RB 1J1PH 1XGTA 1OF2B 4CAGA 4E9VA 4BQBA 3QQXA 1RHHB 2BXZA 4MRCA 4P5MB 4D8OA 5T3ZE 2YPVA 3FT4B 5LCVH 1CBVH 1T4KA 3V8OA 1YEWA 5I71B 3DX4A 4ODSL 2FHBA 3VWKC 4YWGL 4IJTA 4N2DA 1CGXA 2NZ9C 3JYCA 3K46A 4FFZH 3WIHH 4BK8A 1FC2D 1Y6NR 3NZ8A 1QLEH 4YDIH 4TTDD 4G1EA 5F7UA 3NSYA 2BSDA 1ICTA 2MTPA 1S9YB 1NGPL 1MIEH 2GITB 1B2WL 1G7QB 1FO0H 1OHQA 4NRYA 5F1NB 3TCXA 2ZXEB 2MHAA 2CO3A 1NAML 3E38A 4JM0A 4OZFG 4PD4K 4Z5RA 1MUJA 4K5MA 2CO1A 3V9FA 4TQHA 4FLRA 5LKNA 2NX5A 2VKXA 2Q3XA 2GYSA 2O6DA 1JPEA 2VDQB 4JQIA 1E6OL 5ICUA 1XGYH 3BZFA 1LO5B 4HPYL 4OUUA 3R8QA 2OMWB 5BRZA 5JIHA 3Q2VA 3FXIC 5BXFB 3U0WH 2C1PA 3GRWL 4GXVL 1NA8A 1JNHB 2XN0A 4P4KC 5C0AA 1T5WB 4XVJL 1EEZB 2IH1A 1OTTD 2J7LA 2NSQA 5B3JF 3GD1C 1DLFH 3AFLA 1PU0A 3FRPA 5AB2A 5C7XH 1RUPL 5LNEA 1DP0A 5ESAB 2B1HH 2WNGA 3Q5OA 2WINB 1TZIB 3NFPB 2HVKB 4NQSB 3X12B 1MJUH 4Y7MA 3BKCH 1KWKA 4ZAKD 3MRDA 4I13B 4PWHA 3CZJA 2MOVA 3ILEA 1M1XB 5KZCD 1OD9A 2LABA 4XNMB 2ZCLL 4APQB 3HC4H 5KANI 2VDOL 1U92A 4HKXA 4MNGB 1J1PL 2ZONA 5C07E 1XF3B 5D7IB 3FC8A 5JQHC 5I17A 4JQVC 1JPTH 1KIUA 5EU6E 2VR9A 3WS6A 3LV3A 1Y18A 1HEZB 1NBVH 1U3HD 3OMAB 3O3EA 3MGOB 2MNUA 2Q6WB 3IE9A 2BFGA 4UQ3A 1T0NA 3KPRA 3MOBH 2R0KH 1DUZB 1MFNA 1U8CA 2BMKB 2H47C 3L3OA 3JVGC 5HHOA 1CBVL 3QHZH 1P7KA 1O75A 1NL0H 1JZ6A 4ZMXA 4ZX3A 5IHUH 4XN4A 3EJZD 3ZSTA 5EBMA 1L9MA 5C0BD 4WU7B 1UD3A 1QLEL 3O0RH 2CWRA 4PW9A 1MVFA 4AH2B 5FDYA 1MIEL 1KN2L 1FO0L 1OLLA 2R2BA 3GXTA 4FA6A 2W8CA 3B7TA 3BZ4B 2WW8A 3HMXA 4OZHA 4YHOH 3MRNB 4F20A 5GSVA 4X6FA 5MERA 4WGWB 4ONGH 2QZQA 4CU8A 4Y1SA 2EXWD 3GTNA 4WK2B 4MMYA 3S3PA 4ODBD 3VO0A 3TFKD 1IJ9A 2WZ0A 1DJSA 4NZDA 4C56D 4KK6D 1KPVA 2JE8A 1NBZA 1BEYH 1J8RA 1XGYL 3E8VA 3A6BL 4CADA 3V4VH 2LR4A 5KBPA 2W94A 3QNFA 5DRNA 4XMUA 4LOVA 4Q9CA 1M7IA 1XTLA 2DTSA 4P99A 4CC0A 4XMXA 2AQ1A 4J1UB 4CW1A 3QWQB 3L5XH 3LD8B 1FAKT 5GGTA 5B4MC 2B7DT 4JRYD 5EEWA 3K5SA 1KGXA 5FK9A 1OK8A 1DLFL 1ZMYA 3EFDL 4GEIA 5E5MA 5F9OH 3ZHFA 1GZPB 3SKMA 3ZR5A 5F7WC 2BHZA 3HBZA 1OCWL 2EILB 3JWOH 1WBZB 5T3XH 3KWUA 4EZJA 4YFLF 1GS7A 2BSEA 4JHUA 3H54A 1TKWA 2KH2B 1X5AA 3ARBB 2PP7A 3BKCL 3QXDA 2VDLB 4LGRB 4R3SB 5D7KE 4YBHA 1KJVB 3DWTA 3QIUA 2K3TA 1QACA 3CLEH 5D96B 4XP1H 4HMCA 3TNMB 4DW2H 3HC4L 2Y5TB 3FN0H 3QIWD 4BZYA 4B9KC 4MWFB 4XPBL 4GEJA 4H26B 4K8RC 1JYXA 1JPTL 4RAUA 1SQ2N 3QIBA 4EIUA 3MFFA 1BYOA 2X70B 1NBVL 5J1AA 3CJJA 1FWXA 3D25A 1CF1A 4XCNB 5FO8A 4OCSH 5AD0A 3H2QA 3FPXA 1TT6A 3FKUS 1L9PA 3LN9A 1WS7A 1BDYA 4LCWB 1IGJA 3S7GA 4MZ2A 4CVXB 1PSKL 4XCEA 3TBTB 3O81A 1J1XH 3OZ9L 5KSVB 1NMCB 4FHKA 3FSVA 3KYOA 2EDYA 3NEEA 3NK4A 4Q8BA 4IYKA 4NC1C 1UA7A 3SO3C 1G6VK 1HX0A 4R4BA 1RK0A 3GBNL 5EORL 5D6DC 4FNTA 2P5WA 3GSOB 3B9AA 5JLZA 4YHOL 4A66A 1VGEL 3M46A 3VSTA 3RZCA 4HCRH 5CD5C 4MAUH 2B15A 1KDJA 4ODTH 4EIZC 3WKNA 4N2KA 2FIRT 2CNYA 2NLJA 3DA0A 3F00A 4N86A 3VXMB 4OQTH 3SYOA 1A21A 2DMKA 3CNKA 2XTJD 2CXGA 1OTUD 2H4EA 4NUQA 2JCCB 2Y2TA 2R7EA 3D85A 5AW4B 3MX0B 4FD0A 4JDVA 4L4TA 3HZ3A 4PBDA 1NLBH 2JJWA 1CD1B 4HWBA 4H20H 4I5BA 4JY6A 1IE5A 1P5UC 2JH2A 1BMWA 1DBAL 1Q0XH 2MRYA 1M6UA 4NQCD 1MI5A 5I16A 1BWMA 5HGBA 5CJOL 2CBQA 3P0YL 1L9NA 2QBWA 1A6ZA 3KR3H 3DV4B 3NJVA 4N26A 4URKA 2ICWJ 1KXQE 3JWOL 4I2XE 3PGFH 3AREA 1BD2B 2J3SA 3QEQE 1AXSB 2VR3A 1CDGA 3EHBD 3EYOB 4S1DD 5DEZA 2HPOA 5EMYA 2QQLL 4N2EA 3ZKXB 1UH3A 1T83C 3V4PH 5A2FA 4IRJD 3FU0A 3EOBA 4H1LH 1KYUA 3KE0A 3CLEL 1OT2A 2YUWA 3HC3L 4DW2L 1I9EA 2IAND 3I02A 4KXAA 5F1IA 4MDIB 1UFUA 2G2NA 1Z3RA 3L17A 2LOEA 4PJFB 3QXUA 1NGZA 1ES0B 5GZOC 3QZLA 4M43L 1NANI 2PW1B 2R9HD 3WMSA 4JRXB 4LEOA 1XAUA 2WXQA 2J1XA 1RZKH 3UAFA 4CVUA 2ADJB 4TL4A 5D1XD 3KPMB 5GS3A 1BFSA 3VXTB 2EAEA 2VE6B 2ICCA 2YZ8A 4R0LA 3PJSB 3LD8C 2ZUUA 3DMMC 3GFUA 2NTFB 3BQVA 1U3ZA 3S8WA 5HHNB 3FZUD 1YEDB 4P5TA 4UIMA 3RU8L 3AWGA 2E4FA 5B1BB 4FYQA 3TO4C 2ZSVB 2VLJE 4NGHH 5EN2B 1WHOA 4QRQA 2OX5B 1H9VA 3RNKA 2DMCA 3FMGH 4OB5H 4MAUL 1NGQL 4ODTL 3D48R 1YEIH 1IGIL 3GSUB 2ED8A 2A4EA 1URIA 4Z7QE 3KXFD 1ZLEA 3MBEA 3SGJA 2HUHA 2Y07H 4GKNB 3V0IA 2D73A 1KGUA 3WHE1 3L3HA 4GUOA 5KW9L 1ID5I 3QXTA 5D5MA 1BQ5A 5KVGE 5ENWA 5F71A 2A3TA 4ICWA 5SWSB 2WBJB 1YEGH 4GYBA 1OF0A 1MCFA 1WWBX 4PP1C 2Z91B 3K91A 3FQ4A 3KMDA 5FA4B 3PQYD 5E99H 4U4BA 3UERA 4PJGE 3WBDA 4F7KA 3VFRB 2NQCA 3PHQA 1TZOA 3PGFL 2IO5A 2V3EA 3EYFB 4HH8A 4HIPA 3EYSL 4TUKH 4WJ5B 1TJXA 5D6CA 2J88L 1NMCC 4OV5B 3LRLA 1A02N 2A2QT 3IU3A 3Q9PA 4BJLA 2B0SL 3LSOA 5CP7B 5DLLA 1J8HB 4XH2A 4AEFA 4DFHA 1G7LA 3GUTB 3U25A 5CBAB 2P8PA 3LKQB 4P2OD 1C12B 1T0MB 1MY5A 2CO7B 2OV0A 1GAFL 1IC7H 4HJJL 1OGSA 3HLKA 4FTVD 4JFOB 3P0VH 4NHCH 4XGZB 1E3FA 1KTJA 3EGXA 3SB3A 2X4QA 2YRLA 5LGJB 5DUMH 5JW5A 1LJMA 1MFAL 1RZKL 2WYZA 3NP3A 4Q6KA 4YUEH 3WTVA 1PGRB 4LHUB 4PJ7E 2AEQH 2HFTA 2NY1D 4JN2B 4HS3A 4JQIH 4EI5B 5IY5B 1PLGH 4LKCA 4PWKA 3LMJH 4ABVA 4P2RD 4ELMF 3BP5A 3X1FA 4UTBH 2HFGH 1W8NA 3AQZA 4FKEA 2DQCL 2NW2B 1JZ2A 4ATWA 4AMKL 1HN1A 2W81C 3CE1A 4LASH 5A2LH 4UNVA 2YAEA 2VR5A 3MNDA 3FHQA 1YO4A 3NJNA 5AOJA 1I7RB 3ZKXC 4AENA 3F6LA 4QCIB 1YEIL 3DURB 2UYLB 5FECA 2GUOB 3QC5X 2YMXL 1YNLH 3JUZA 4GLRH 1IARB 2L3BA 4MZIA 3PWUB 3KLHC 4Z7OE 1K8DA 5DO2D 4W6XB 5D8JL 1EZLA 5C0GB 2Y07L 5GS0H 4LLVB 3PP3K 1M71B 2WAHA 3AY2A 1A4AA 2V2XB 4NN5C 1I9RH 4Y4KB 2UZYA 3K81A 4L3EA 1YEGL 2OW6A 1IEHA 4XPHH 1QTPA 3OB0K 4U0QB 4Y19D 3BAXA 3IBOA 4AXWA 2YA1A 4MXVE 4WLCA 2QFPA 2Y7NA 3GSNA 2GABA 2PXYD 4YBLB 4YO0A 5ANMA 5GGSY 1GIGL 4X7EC 4M8RA 1MWAA 3GLZA 4TUKL 3BPNB 4V33A 3UROR 1SEQL 4YLQT 2UWEE 3NSCA 5I23A 1SMOA 1CDCA 1NWOA 2PCXA 2QVKA 1WFNA 1ZLDA 3ABGA 1OSPL 1JMZA 2ZZUT 5GGQH 3ZDZF 3E6HB 1P4IH 5FKAB 5EUOF 4DZ8B 1V3LA 3K7UA 3T6ZA 4PREA 3DXAB 5TH2A 3V0EA 5IROA 4CMMB 2XTJE 1T20B 1JI2A 4PRNB 1CFQA 2J21A 1OAXL 2OCCB 2OP4H 5A2CA 12E8H 1NBYA 2DMBA 2DQJH 2IOIA 3FTWA 3H3BC 3IRCA 4ZFGH 4WTZG 2OSLB 1T4WA 3SOTA 2PN5A 3V52H 1KG0A 2BOBB 3HUJF 1FH2A 1S7RB 2N01B 3L3JB 4KMTH 4BA0A 1FLTX 3MJ9L 3LKOB 1GYUA 1PLGL 2Y1ZA 3IF1A 3QHFH 1T2JA 1IZJA 3ELQA 3RFZB 5CZXC 1JZDC 4UTBL 1XZ0A 1INQB 2HFGL 1BHGA 1O7SA 1ZTMA 5GGTH 2WXOA 1YMHA 4HK0B 4HLEA 4I0CC 1OW0C 1D9KB 3NGBB 4FN0A 2R8SH 4G8IA 4HZLA 1LXMA 3NA4A 4L4VA 3O4OC 3QDMB 2R29A 3U4EA 2Z9TA 2G3ZA 3QNZA 3WJMB 1DQQB 5IEKA 2UY6A 4TLUA 5MEOB 2AEWA 4UINL 3L3KA 2NSXA 2YUVA 5FYJH 3CTTA 4Y1AD 2ZD0A 4KZDH 3HE6B 2FEDD 5GIRA 1JERA 1L5GA 3GZQA 4R7VA 4PJ5D 1PEZA 4LHQB 3NCEB 4QTFA 1AKPA 3SBQA 5SWZE 5E8EB 4XVUC 2MQGA 2LLGA 3L9RA 3ALPA 5ESVB 3TBVB 3UBXG 2RAMA 1K8IB 2VC2L 4P8QA 4KO6A 4X98A 4XWOC 4R7LA 2BP0A 2KZWA 2HVBA 1GPOL 4K9EC 4AQEA 1JZGA 3HS0C 3QNYB 2YZ1A 5GGQL 1WA0X 1P4IL 2Q7YA 3IMUA 1HHGA 4XB3A 3V7AE 1NC4D 1RZ8B 1UKSA 1TO5A 4KQ0A 2CCVA 4PJXE 1H5BC 4M00A 3JWDC 2EE2A 2EDJA 2PW2A 2XZAH 3S96B 3NQIA 3L5WB 4NCDA 3DNKA 1WBYB 3MREB 3Q2LA 5E2JA 2J6EA 12E8L 3G6JB 2X10A 3ISYA 5DGQA 2WYHA 1D5MA 3MKGA 4LSSL 4OI9A 2FATL 2WZPD 3L1OL 3PQYE 4R7NB 1SGKA 1UZ8B 2X4NB 2FBJL 3TVMD 2YLHA 5HGHA 1G9MH 3C5ZB 1E8XA 3CVHH 3F85A 5DRZB 4YR6A 1IUZA 5MEPB 4N0CD 1J9TA 1OANA 2VDKB 5LG6A 3IJ9A 4AC4A 1U58A 4KKLD 3IGFA 1ZVYA 1GC1H 2X6BA 2WTPA 4X7CC 4CVWA 1LVEA 3G6DH 1OZUA 1I9IL 3BPNC 3WJJC 2BVQB 2R8SL 5FOBB 3IVKA 1NUGA 3M1BA 2BY2A 2E7CA 1EZVX 4XN2A 1VDGA 2ZAHA 3A21A 4C4KT 1Z3GH 4PGDA 5C0JA 4OZIE 1KENH 4HUKB 4Y8AA 3AY4A 5C07A 1P7QA 3WN6A 1TJGH 1XWVA 2VR4A 5I1IL 5FLUA 5EU6A 2QSVA 2HA1A 5DUBA 1UCTA 4TRPH 1KJ3H 3V0DA 3V95A 5JW4Q 3ARFA 4Z7WE 4QT5A 3B7SA 2J1YA 3ZRCC 1G5AA 2IADA 1C5BL 5D71H 1MCHA 3TIEB 5D1QB 4BK5A 3FO1B 3WN5C 2EDLA 4MJ2A 2DJ4A 1WHPA 2XQYA 5FA3B 2DQIH 4G8EB 2NY7H 2WAQA 4MQSB 4O58H 2X4RA 5DJCB 1LE9A 4OT1L 5CEXA 5A16A 3MNWA 5M95B 2WB1A 3QVAA 1OTSD 1GZHA 4AV4A 1A6UL 5D7SL 2CUIA 1EHNA 1UCBL 2A6IB 3TV8A 4KDTC 4F57H 4M61A 5IMMA 1UXSB 4B9JA 4U7KA 1MOEA 1N67A 1AD0A 2WLLB 1JRHL 3GZOA 3QUZA 4KJQD 3V8CA 2KQMA 3B6SB 1UH4A 2X1WL 5FYLE 2G9HA 3OHXC 3ZL2A 2CO6B 1AE6H 2PYEE 5BUAA 5F88B 2V7NA 4X5XB 3D39E 4LVOC 3RVTC 1OM3H 4DESA 2C9XA 4PJEE 3DX9B 1IGYA 1NCJA 1QR4A 3DX6A 3CVHL 3BHBA 2MSPA 1KOAA 1JYNA 3H2PA 4HS8H 3LPPA 5G5DB 5HYJE 1KXTB 2GCYB 1KELH 3SE4C 4U1LA 2ENQA 5IG7B 3W11D 1H3PH 4AMWA 3C6LB 3E9TA 3FTYA 4JJ5B 3G6DL 2XQ0A 2EYTA 3O3BA 5FWQA 3MACH 1INEL 2E9BA 4M5YH 3UTTD 5FUCC 1V7NH 4GAAA 3LCYA 3UAJD 3ZUCA 4HX1B 4B5ZA 5F8QC 3K4AA 2WHVA 5I8KH 4UDTA 1TJGL 5KVDE 5I1AA 3ORJA 4MNQD 3S36H 5JPNA 4TRPL 5D93C 3NUKA 2CPCA 2EH8H 2ZNWA 4IKNA 4ZFFA 1N5YH 2VXVH 5D71L 4MD5A 1ZKAA 3J8F7 5F9DC 2BIQA 3C6SA 1KEML 3ZDWA 3QUKA 3PWNB 4HU2A 2N0MA 3EYQD 4IGBD 3LKPB 1RI8A 1CXLA 1T04B 1E4WH 4KTGA 5JR1H 5K9KB 2AJYH 1GZQA 3Q5TA 3T3PE 3EXLA 4O58L 5IVXF 3GBDA 3L13A 3VXSD 3T0XA 1P0SE 4TLKA 4LP8A 5EOCJ 4Y5XB 3REWA 5I5IA 3KPOB 4PTTA 2ARJQ 2CLZB 3V10A 4WKZA 5AB0A 4AEHH 1O9WA 1HQRB 1PTZA 2ZUXA 3BKYH 3CSBA 3Q2WA 2Z1KA 1TO4A 5I1LA 5BQ7B 3RWDB 1FYTB 5DZVA 2EVJA 1FNFA 4BXSV 5BS0B 3VXNA 1AI1L 4Y1AE 5GGSA 5IB4B 5HI3D 1I8UA 1QW9A 5KYYB 3KYAA 1M1SA 1SMAA 3CUPB 4TLTA 4PW4A 1BXVA 1NBCA 4ODWB 1NGYA 4UYPA 4G42A 1Z9PA 1KV3A 3MOQA 4ZUUB 2YXWA 4GXUN 4IMKA 3RUGE 1YJDH 4H25B 3FSZA 3T4YA 5KTEL 1R9FA 3D06A 3F12B 3QI9A 5ISZB 2CJUH 3QYNA 1N5AB 5J4MA 1CR9H 5INCA 4I2XA 1KXQA 4LIQE 4P9MH 2QADD 5D9SB 2A1WL 5T1MA 3QEQA 2QVMA 4Q97A 1H3PL 3BWAB 5F9AC 1EEYB 1X3DA 1D5RA 5GRVL 2X3AA 2Q2EB 2V9UA 3DARA 3QNXB 4PJIF 3I9IA 3GSNH 4CC1A 3S3BB 5JNYA 4Q9RL 1U8JB 1WYJA 1T22A 1RSFA 3KNBA 1K6QL 5ID0A 1WUZA 3K5RA 1NIEA 2VXTH 1AHKA 3CSFA 4NWTL 4PRHD 3TV3L 4UQBA 3K71A 3IDNB 3BAYA 3S36L 3W0WE 5LLIC 2WLMA 3CDYA 1TIUA 5AW9B 1T2XA 3NPSB 1MRDH 3IDXH 3QQDA 1RKRA 3VJ6A 1G9EA 5E94B 4QRTA 4J3TA 1N5YL 1F90H 1AJ7H 5JZ7C 1SMDA 1NINA 1Z9MA 2BIMA 3GMPA 2G5BB 1QSFE 3HLAB 3U4BH 3O45A 5AZEL 5HYSA 3HW7A 5JR1L 2AJYL 4WHTA 2XTSA 4XC1L 4I3GA 5AZ2H 1BYPA 3IKCA 4GSQA 1LEIA 2BERA 1EBAA 3ZDYE 2YQGA 5DJAB 4M02A 1E4KC 4JHBA 4BFJA 2WD0A 2VLJA 3V0AC 4LLQB 1ZLWK 2IIJA 3CFKB 5LGYA 5KG9B 2GIMA 2SEBB 2EYSB 3QUXD 4PLNC 5FIEA 4PRID 4J3OC 1E43A 1GTNA 3ISRA 1R3IH 1HCZA 4JNXA 4OLYL 4U1SA 1KNOB 2YXVA 1TZHA 1U95A 4OGAD 2F9BT 2IGTA 1KJMA 2R0LH 5IBTH 1UQSA 5C0CB 1WE5A 2IWGA 4A67A 5B8CC 3WIFB 3H0TB 4EKXA 3OXSA 4Q2ZA 3APMA 2WGXA 2Z8SA 3ASWA 4KJPD 2OMZB 1I3RB 1MNUH 3E9UA 5CBEA 3S4SG 1IMHC 3GM0A 5PCYA 3FFCE 5DQJA 1OGAD 4Q6IA 2V3DA 1HH6A 3GYRA 4FXGB 1F4HA 2AGJL 4L05A 3V6BR 5C0BA 3BDYL 4J27A 2ZPKL 4DEWA 5JXAL 4PJGA 1HZHL 1CR9L 4JW3A 3TF4A 3RWEB 1UM4H 2AEPL 1VADB 3FUNA 5T3ZH 4P59L 4C55A 1QRND 3E0GA 4NPKA 1ZT7A 3ZTJG 5KYWA 2P49B 4XMTA 4MAYA 1GOHA 5IV2A 4QRRD 4DKEL 5KS9F 3AG3B 2VXTL 2XWTA 4KRPB 4OJDH 1HNGA 2EIBA 4H8WH 2BVUA 3NIFF 2HLFD 1MRDL 4QJ3B 5JYLA 3U2SA 2H8PB 2JXMA 3NVQA 5DYOA 4XNAA 1J5CA 3NCFB 1MHCB 4PJ7A 4ZD3H 4PYHA 5GGVH 5A6LA 4PBVC 3U4BL 5TQ0H 3D18A 5C0IB 5CWSB 4AGPA 2P24B 1EX0A 3OKNB 2LHAA 2Y7QB 4HOMA 3ZL4L 4RRPA 1AFVH 1JGDA 3L2LA 2OTWA 4LOUC 3UIYA 3UTTE 2W65A 3CN0A 5DRXB 1HEHC 4NQDB 3WMQA 3B2MA 2HXAA 5DFTA 4LNRB 3S48A 43CAB 4PTUB 4YGVA 2JF1A 2FYYB 5DTFB 3OAYK 2O5NA 5KSAD 2XJLA 2VLKB 2ADIB 1JK8B 3V9CA 3BD4A 1BVLB 4EAEA 3SDXE 2R0LL 4FP8H 3HI1A 3PDDA 5IBTL 5T1KD 1J05B 1TCMA 3Q6GL 4KX7A 4N8UA 5KVMC 3DBSA 1E3ZA 1YRKA 3L4ZA 5DURB 1MNUL 3DIFB 4BZ1A 2Q76B 4P46B 2D7NA 3DDGA 3P4OA 4HGWA 1YHPA 2HFEB 1FZKB 1QFWM 3OQ3B 3ZUNC 3RY6A 1AANA 3GJFA 2FX8H 4HV8A 2UWEA 4PJCE 1ETA1 3RB5A 1NKGA 4EDWH 3GGWA 1QSZA 3Q8FA 4TMPA 2Z93B 3U9PH 1DANU 3GTVA 4XZUA 1U93B 2FBRA 4KTEH 5KAQF 4GW4A 2DKSA 1O5PA 1VERA 1ODAA 3D3VD 4OCRH 3H53A 5DMKB 1EDHA 8CGTA 1MG3C 2H3KA 4JE4B 3SCMB 2HMIC 2P48B 2Z31D 4MMXA 1W16A 3JV4A 2HLAA 1FVDA 3B3IB 3QISA 4I87A 3AT0A 4ODHL 4HPOL 5I75B 4KVCH 4ICXA 4Z95H 1NFDF 3A67L 1TYRA 3AU1B 5GGVL 1XMWA 4PLKD 1NCCH 4G11A 2XG5A 2R2CA 1BW8A 3QWNA 3FU7A 2FQFA 3FT3B 1F13A 4GQ9L 2KLRA 2F18A 3JVFC 4MKTA 4IEFB 3OTTA 2VAJA 5JUEH 1U8LA 5D7JA 1XF1A 3MUGA 5IMLA 1FV1B 2A9ML 5F7EH 4BKTC 1AFVL 2ZYSA 5HYFA 1I3VA 3N43B 4YZFF 3ABZA 3JV5A 1KJ2A 4XNQA 1JK9B 2HN7A 1KGJA 2BC4A 2H32B 3BGMB 5DLMH 4MS8D 1KY6A 1QSEE 2NNCA 2NZ1A 3LH2H 4Z3FA 1U42A 1U91B 2I60H 2JQAA 3F8UB 3O9WD 4IKJA 4NO3B 3MA7B 4A04A 2CK2A 3NESA 3BUTA 4FP8L 4P9HH 4JKKA 3BP7B 1I9JH 2DQUL 4PVBA 2JLPA 1E42A 1SHXA 3FQXB 1T5XA 4RDBA 2UVEA 5D1ZB 1UYWL 4XCFL 4LRNL 3VXUB 2ZKHL 3TXAA 2FK9A 3RIAK 3P2BA 4I0PB 4HUWA 2FX9H 4LLYA 3MJ8A 4QHUB 5SWZA 1ETZB 3PL6D 2PETA 3RWIA 3I6KA 4O2FB 5E9NA 2FGZA 4HIHA 1KLFB 4HFWB 1UUNA 3GHBH 3HS9A 4JANB 5A2IH 2ICEA 1HWHB 1KB5H 3FAWA 4C4KO 2P7TA 4MCMA 5CJXC 5JIIA 4JPIB 4ALAH 2KPNA 3FTZA 4GG6B 3U7YL 2X4SB 3GS7A 4KTEL 5EIIA 1ZT1B 2V8MA 2B1AH 3L3GB 1T1WA 4PJXA 2FZ3B 3LIUA 3LN4A 2ITDA 4Z3JA 1VZGA 3GXIA 3D0VA 5I0XA 5F0LB 4JKMA 3MNZB 2VLRB 5D72H 1E9QA 2HJKA 4NCC2 2EC9T 5EF2A 1XIWB 2A9AA 3OJDB 4RRPM 4U1GB 3FQWB 1OGAE 2WQXA 1CO1A 4DGVH 3L6FB 1A4JB 1LO4L 1ZJBA 3A0OA 3PQYA 4Z95L 1ET7A 1Z0NA 2P42B 3HB3B 3D4GA 5GJSH 3UO8B 3ZDXE 1XF2B 1NCCL 1HYRC 4MYPA 1BZDA 1BQHB 1MIMH 1JTOA 2NYZA 4W4OC 1GY2A 2OMXB 4H8PA 1MW2A 5JUEL 4JFQA 2MKLC 5EDXA 3RWHB 4AYSA 4ZNEE 2O5ZL 4TQ8A 1QRNE 4N8VA 4ETYA 3NJMA 5JPMA 2D0FA 1YEFL 3HIZA 3RNQA 2LTQB 4PRAA 5DLML 4ECNA 2VDRL 1IVTA 1A6TA 5J0BA 2AXFB 3LH2L 5HHPB 1OAJA 1OP3K 4FA8A 2W92A 3UH8A 3Q1SH 1GCYA 4KJYA 4L9LB 4OZIA 2COQA 3HPLB 4P9HL 3BW9B 2AXJA 2OJZH 3JTTA 2EDDA 1I9JL 2XN9B 3ABLB 1MJ8H 3DSNB 1OQXA 1QR1A 2P44B 4FFYL 4Z7WA 2DPKA 3KJ6H 2CCLA 2COVD 4HJ0C 5EF0A 2F5AL 3EKCA 3HE7D 4GO6B 1BJ8A 1GRWA 4AC2A 1D6VH 4NZTH 1QFWH 3PV6A 5IBUG 5L2KB 4IMLB 3WY3A 3G04B 1HU8A 5CEZD 3QULA 5FHBH 1YEEL 2MH4A 4J3XA 3RB7A 1NJ9B 1E28A 2B9AA 4PGBB 1G5GA 4OJFL 4RNRA 3W39B 3GHBL 4PRPE 4ODUA 2WXIA 1MEXL 2YBRA 1KB5L 1ZD6A 1UENA 2XWCA 4OD3L 4X9FA 1NOAA 1WV7T 1MPAH 2JI1A 4TNVK 5FHAL 3LRHA 5F96H 2D03L 5HD8D 3RWGB 3SDCC 1GYWA 5F1SA 3X17A 4ALAL 3BWUF 4UNUA 3MRGA 3FQRA 5K93A 4PJ8B 5KSBF 1WO2A 2YHGA 3Q8BA 1BZOA 3M07A 5DRWB 4Z3GA 2B1AL 3U0PB 3IJYB 1SDAB 2ZWKA 3FUJA 4IBLT 4LSRL 4Q56A 3K8MA 1J12A 1R3KA 3RL2B 4HJEA 5BZWB 2RIKA 3T3ME 1K2DB 5D72L 1RZ7L 2NYYD 3WFEL 1MVUA 5TJWK 3NCWA 4DN3H 2PYEA 3AXLB 2FO4A 3BUYA 3CU1A 3LZLA 5D70L 2V37A 4HJIA 5I28A 4A2GA 5FGCE 4E41D 2FYVA 1FHGA 1JAEA 2G3XA 4LSQH 3MBWA 2YLKA 3D39A 5DD3L 5FO9A 3EYUH 4BFOA 3I6GB 4PJEA 1E27A 2R4SH 3VFVB 1MIML 1II4E 1BZ9B 2ZNXA 4NP9A 4I0PC 2VCOA 4HAKA 4L23A 4E36A 3B9EA 2AJ3B 5BRQA 3P54A 3VGAC 5HYJA 4JB9L 5KVGH 1RPUA 1PS3A 2YPKA 4KVNL 2WO3B 1UASA 3VXPA 4X7FC 5IQNA 1T1YA 2H45A 1UKTA 5EOQH 3D69B 2FO1A 1SPDA 5CJQL 4FXKB 1UGNA 3EDDA 1FH5H 3EOTH 4HF5H 4PGZA 2JKSA 4CSSA 4J2XA 2AITA 4MBRA 1YQ2A 1UATA 4HWUA 5B1AB 2Y2YA 5TQ2L 3ZT6A 4PN6A 3WXVH 1T3FA 3PGCA 4R2GD 3BAIA 3MGAA 2IC2A 4CRPA 4CMHB 2DQGL 1LO2L 3BGFC 4EBQL 1ACCA 3D8MA 3D2UA 4P23C 2IALA 1HOEA 2JB5L 3LZOA 5MI0C 2QGEA 2NUTA 1Q9WB 1I7TB 3ZOAA 1AR1D 4HW6A 4LL1A 3TCLB 3GMLB 3UJJH 1XBDA 3LNIA 4D0BB 3SKOB 3HI6L 5GRUL 2JJTA 1MPAL 4K5PA 2J1KA 4KUZL 1AQMA 2EACA 5ECGA 1MCBA 5I0VA 5IFAL 3CX2A 1NZRA 2RTTA 3V79C 1E65A 3QCTH 2CIKB 1B3JA 4OZGE 5D7LB 1HZLA 4Y1AA 2GTWA 3DI3B 3H8NA 2ZCZA 4A2FA 3P3SA 1MCWM 1U8IB 4M8UA 4ZQTA 3TURA 3VSVA 2OMTA 4AY0A 3T0EC 1NQBA 3ZKSD 3OAUL 1YAZA 4LSQL 2JNZA 3UTQA 5E2WH 3QRGH 4P4RB 3UZQA 4ZMYA 3LZPA 3KS0H 3RUGA 1PZBA 1OSZB 5CJ5A 3X3GH 2JELL 4AYEC 4O02B 4XE0A 2JKRM 5EG6C 3VVWA 3V6ZA 2GFBA 2OYMA 1JPFB 4K94C 4GRLD 3X1BA 1JV5B 5C09B 1M7DA 3UTPD 1FRGH 4BZ1H 5CLZA 4O2CA 4PFEA 3FU8A 4DP2X 4TTGA 1N8OE 4Y5YA 4IIQB 2XV3A 4MQ7A 1JHLL 2W60A 3EOTL 3RZWA 1YNTB 1JXDA 5TDNB 3S88H 1U8MB 5F44A 3U83A 3ZGHA 3GJFH 4Z7NF 1ADQA 2FJSA 5HYQA 4NRXA 3W0WA 3ZKQD 4AG4H 2W9EL 1JXFA 3GSXB 4PV9B 4I18B 3IJHA 3L5JA 2ARJA 4KRNA 3FHEA 5DK3A 4AUUA 3I6SA 1HCVA 4KROB 5DJDA 1QSFA 5F2FA 4FQHA 5DUPH 4XVSL 4IBZA 1EHKB 1D5BB 2ED7A 1YG9A 5A7EA 1WD8A 3NCJH 3MN8A 4P3CH 2E8YA 4S0HA 1MLCB 2OR8A 5CSGA 4N2BA 3AS3A 2RBLA 1SYSA 4NHUA 1PX8A 4R4NC 1FIGL 3SE9H 3GIVA 1CL7I 4TNWF 3TBBA 1X5YA 4O2EA 1TU2B 1Q0YH 2ZG1A 4MXQC 3TBSB 1DO6A 3WDIA 2HRPH 1NDGB 3LKSB 4Y4FB 3QCTL 4XTRD 4B60A 3FQ1A 4OD2B 2XTLA 3QFJB 4JO3L 4FXKC 2WP3T 4V1DB 4GI8A 1KJ2H 4NSKA 2DWDA 2FECI 3BIKB 3N5AA 1YEHH 1JUFB 4R8WH 4DGYH 1FFQA 4WWKD 2XV2A 5EU3A 4E5XA 3ESMA 4ZOBA 4GT0A 3QR2A 5DU7A 4E9YA 1AHWA 4J7RA 3L7EA 4ZUTA 2OZ4A 5CEZE 5EO9A 3HG1B 4ONHA 3VWJD 4JM2F 3FFCA 3JT0A 5E2WL 4LCCC 5JW4M 4CU6A 3FQNB 4X6DB 2FH6A 1MW1A 4NO0D 2FJHB 4W6YB 1UOVA 1W9XA 5FKPA 4H44C 3E2HC 5FYKH 4G8GD 1K9TA 1JXKA 3JTSB 3QUYB 3CFBA 4XMLH 2QV4A 1J86A 2VZOA 2PTVA 5C0RH 4BKSC 5TGBB 2XVGA 4OTXL 3ZYIA 3GUFA 3SBWA 4N5EC 3G5ZB 1BZ7B 1IEAA 5D55A 4ZO9A 4QWWD 2XV6B 5SX4I 3VDCA 3WHXA 3VA6A 1I1AB 1DVFA 2X89D 4FG6D 1FG2B 4BCYA 4PJ9A 2IQ9H 1F45A 2OZNA 4WZ9A 4U1NB 5FM5M 3DGGA 3MRPB 4MCZA 4QHMB 4GG8B 4ZFQA 4HVBA 5FS5A 2QPDB 4ABQA 1IVLA 1H8SA 3MXVH 2HG5B 5IOPB 4ESKA 2HRGA 2NY3D 2WM0A 2E56A 2NNAB 5I6NA 3H9YA 1F86A 4HUUA 3RGVD 3NJJA 1HWWA 4WIQA 3WFZA 4JG1H 1T21A 2E7BA 4X8CA 3VYPA 3CH1B 4M9PA 1I8IB 3MCYA 4LF3B 5I8CA 2G5RA 3IXAB 3UTTA 3EJYC 3FT9A 3NAAL 5AYUH 4W81A 1KCBA 5EUOA 1G7JA 3J07A 3IPFA 1RJZA 4ZS7L 2HRPL 1AGEA 1P9MC 1IX2A 5D4QA 5DC4B 5F21B 3N3EA 5HVHB 3UABA 4IIQC 4JO4L 4G6MH 4M6MH 2MPAH 3D05A 1MQKH 4JG0L 3V6FB 4OF6A 3SDXA 4WUUB 1TSRA 1IC5L 5F70A 3E6FA 4JKNA 4R8WL 4Z18A 5E9DB 4OM0L 1EXUB 3PWPB 1IBBA 3H7BB 1ZVSA 2Y6TE 4BK4A 3ARGD 3VI3E 2X3CA 2UUDH 2XN2A 4JFZH 4X6CB 4YAQA 2WLNA 1BBJB 3K6SB 1FL6B 2K6WA 1EMTH 3M86A 4NBZB 1FL3A 3V4UL 4YHZH 1OAKH 3DHJA 5AUMA 3MYJA 3RPIB 2ADGB 4F3FA 1SN0A 2E6QA 3PUUA 4TV3A 5FYKL 2H7WA 3TA3C 3BH9B 2ZF8A 4PJCA 3R7QA 5CCKL 5DK0A 1ZXKA 3GMOA 4KXZI 5EZJA 1H15B 4IU3B 4PY8I 1U8KA 1IM9D 1FNHA 2Y24A 1PJWA 2NSMA 1KGCE 4PB9L 3LEXA 3RPBA 1S9VB 4WNQB 3H9HA 4IU2B 3FONA 1D3CA 1WF5A 4F2EA 1NLDH 5F0PB 1I53A 3KPQA 5I6PA 1Q4NX 4AGOA 2LFEA 3BP4A 3NFSL 1PD1A 4N3TA 1KCKA 4PI0A 2QPUA 4UMGA 3GSRA 5JORA 2A4ZA 2PPAA 1LILA 2P8LB 2PO6C 3DPBB 4XNXH 5FYLH 3TH4T 5I5RA 1NEZB 3N40P 4HHAA 1RPKA 2HJFA 3MRKA 5EU4B 1S3KL 2HWZL 2Z8VC 5IMOA 3T3PF 5SWQB 3T6QC 4JHWH 4L2YA 4NLAA 1URZA 3BDBA 4YDJA 5J9PB 2BOCB 4ZS6D 1RU9L 3S34H 4ZXBB 5J3HD 2Y7MA 1JF6A 1J18A 3QYMA 2IBBA 2EDXA 3FTGB 4LBEA 4NT6A 5MENB 1XT5A 4JKPH 4HJUA 3HPJB 2E3VA 3L4CA 1QSEA 1CDJA 4F5CE 2AJZA 3HMWL 3NDYE 5HDBB 4GIAA 1EK3A 1HXYB 2YKLH 3B7UX 3WKYA 4G6ML 1NCAL 1NCTA 1SDDB 3IJSB 2HT3D 3B2VH 1A7PH 3K80A 4O4YH 4WI7A 1EIBA 4XNZB 3ZVVA 5ICXB 3CK0H 4MD0A 2VISA 4DOHE 3CCHA 3N55A 3KYMB 3E80A 3EUUA 4N0UB 5D7IF 2I07A 1I1AC 4XO8A 4D9LL 1EO8H 2WTRB 3ECVA 3GMRB 3MRJA 3DSFH 3Q8CA 5IOKA 3OL2A 1S46A 3MLVH 2WZ6A 3D4ZA 2BNQB 1OAKL 5ACZB 2M2DA 3BSZL 5F7NC 1BZEA 4LEBA 5IB1A 3KPSB 5TDOB 5CSBA 4X4XA 2X1OA 4BDVB 1N7MH 2BFVH 2CRMA 3WG7B 1J8SA 3QUXA 3WO4C 4G43A 4CA4A 4MXWH 1DL7H 2WY3B 3SDYH 4M8QA 3P77A 1J10A 4EVNB 4KH9A 1PX3A 2IQAA 4LPVA 2VSDA 4HBCH 3MZTA 2NXZB 4R6UA 5FGBA 5IP4A 1AZBA 2AAVA 1T89A 3U1PA 4AGMA 1CDUA 1JGUH 5HVHC 3C60B 1HJCA 2WXKA 3AG2B 4YK4B 2E74C 1NLDL 5F3HA 4TSAH 1E7UA 4XC3H 1DBKH 3OKKA 2J5WA 2VJ0A 1SRDA 4UQ9A 4ZYKA 1OGAA 1FUNA 4LAQH 3NA9L 5IKCB 5GGUA 1UD8A 3X13B 4KZEH 3KL5A 4EUPB 2OFQA 1CGSH 4XNXL 4OLEA 4UV7H 5AW6B 4JM2D 4BUGA 2WJ7A 3KL0A 3BZ5A 2WWMC 2NY0C 4XXCA 2XQBH 4G6AC 3RTQB 4JHWL 1FQ9C 1VKXA 3MV7D 3WUWB 4ZNEA 1EDYA 3UTSE 1QRNA 2OQJB 2XA8L 3N44B 3S34L 1UWYA 4NQVA 5L9DH 3HZVB 4HLZG 5JO5A 1PD0A 2OI9B 4JKPL 3OC5A 3OLIA 2MNWA 1QATA 1HI6A 1WBXB 3LKNB 2CUAA 2NW3A 3T77B 3T6WA 3WL9A 4QRRA 2BJML 2BZCA 4G80B 3CDCA 5HGGS 1PKQE 3FB8A 3MC0A 3LH8A 4LIQH 3FO9B 3K6NA 4WO4C 4WWNA 4YN3A 3VUAA 4TLSA 2GAZB 5B3SB 3IMRA 1FZMA 2BZ7A 3CVCA 1F6AA 3F05A 4P2QD 5EBWA 3WHE0 3VD1A 4Y2DA 3GC3A 4D0CB 15C8H 3SQRA 2Y7SA 3QO1A 2DBJA 4EN3A 3QDJE 1CFSB 3DSFL 3L16A 1K4CA 4NRZB 5J6HB 4WW2A 3MLVL 4RWYL 4JLRA 3S37H 1ADQH 2XXFA 2AF2A 1AGFB 4IJ3B 2XZZA 1TTCA 3S36X 1LEKA 1H3UA 1H6UA 5AVVB 1BQSA 2X4TB 2XWDA 3SYAA 2RHEA 4PRPA 4JDTL 5DHMC 2VDQL 2JI2A 5GXBB 5KEZA 5IF0A 4JVUA 3QPXL 4X50A 1IKNA 4JPWL 5FGRA 3SDYL 2ITEA 5TE4H 3E3QC 4TTDC 3X11B 4QOKD 4WI0B 5T1KA 2IAMA 2IDFA 4L8CA 4FFVD 4F7PA 2Q3ZA 1RHFA 4W9IC 2VMCA 1Q9LB 2O5XH 2Y7LA 1FCGA 1ORSA 3GPEA 4W9LC 5I8EB 2GJ6E 4TXVB 5DJ2A 2OTUB 4LARH 4XC3L 3D7PA 3ROLB 4J3BA 1TQTA 1VFAA 4MJ5B 4UV4H 3FO0H 4XNZC 4LCYB 4CNIA 4WU5A 1BMZA 2JCCF 4DVBB 2WKOA 5IIEB 3KPTA 3CD4A 4ODVH 1TVHA 2VDLH 3IDUA 4ZODA 2GI7A 3L48A 1CE6A 1WAPA 4DP1X 2DQEH 2QPFA 1SXNA 4HZ1A 5I66A 2JKJA 5H4ZA 3VGBA 2OZ4H 1LQSR 5L9DL 3PWLB 3SGDH 1WZ1H 5EWIH 1CPUA 3F64A 4OLVH 5LGKA 1NCHA 1G9NH 3HFFA 4GAYB 3FFDB 4WQOA 1RVFL 1RD6A 3SDDA 5IFJB 1W80A 2DZEA 3UMNA 1NIAA 3HG3A 4ZAKC 3TYGL 2WLYA 3K3QA 1LK3H 3BQUB 4YXLH 4MA8H 4IRZA 1WIPA 1ILUA 4A6YA 4B95C 4LNVA 4Y4HB 1AD9A 4M03A 4PJFF 2CAKA 3C60C 3V6OC 3KBEA 2VLRE 1R5WB 3ARYA 1UC6A 5I8OH 2GK0A 3ZHLA 4GSXA 1U3HC 2ZOKB 3S37L 1XGUA 2PTTA 1N70A 3U9UB 4OZFH 4AX3A 2R1WA 2AQPA 4J3OG 1B9KA 4ORZC 4X4ME 1VPOH 4PS8A 4NLHA 4RMQA 3KLKA 3HAEG 1N9PA 5FUZL 3RTQC 4BFIA 5DEGA 1XB8A 3EJZC 2YGPA 3BD5A 4ZUVB 3WXWH 2YD4A 1BPLB 2F53D 3VQMA 4B9ZA 3DJZA 1A4KA 3QEHB 1NC2B 5KJ7E 3K6DA 4DERA 3O0LA 3L5HA 1CFNB 1ED3B 2Q7AA 3INUL 5E4IA 3VXRE 4DAGL 5I73B 2QHRL 2O5XL 3FCBA 2BSCA 2K4AA 2ZWSA 1MFDH 4KHXL 3CFJB 4LARL 1DUYB 2EXWC 4PRDB 2XU9A 4ZT1A 3QJFA 4ZX6A 2P28B 3TFKC 2AK1H 3FO0L 4PB0H 1U4EA 3DTUB 1KTDA 4ODVL 4JO1L 2VDLL 3PL6A 2CM5A 1C7TA 3FTSA 4AZ8A 3MR9A 2E75C 5F9JB 3T65B 1V5JA 4WTQA 3UEZA 3PABB 4L48A 1S7SA 4F8PA 1J0HA 1O0VA 3U4AA 4RFOL 4JFPA 2UV3A 5DT1L 2OR9L 4ANUA 3FCSA 4KX9A 4OLVL 2XFGB 2WP3O 1CFMA 3V4VB 4R84A 4PSPA 2YA0A 4Z77A 3R1GH 3QYCA 5EIQA 1A2YA 2ZCHH 5LN4A 4WK4B 1LK3L 3WY4A 5KVEL 3NJKA 4MA8L 4GRWE 5DS1A 5AENA 4BSVA 1FAIH 4HIXL 2W9DH 1MCKA 2EIEA 1LEGB 2JIXB 3EADA 4U1JB 4EOWL 5GZOD 5KYUB 2GW5A 3QIWC 1MVYA 4WNSA 5EC2B 5C2BL 2ATKB 2EDKA 5K9OB 3VFOA 4G72B 1I7ZB 2VQ1A 3P3YA 3QWOB 4NUMA 4WI4A 2ETWA 4DKAA 3S3DB 2FQEA 2TSAA 2OXGB 2VW4A 4MMZB 4WTZA 4G9DB 4ABWA 3BPLB 2ZX9A 4E0RA 1BF5A 5IR1B 1G7MA 3TZVB 2PUQT 2OA9A 4BSJA 1DYZA 4MB5A 3TN0B 3K72A 4XCYB 3O4LE 2FWOB 4WFGD 3I9GH 4L5FE 3MV9E 1EBPA 1IE4A 1NFIB 1P6AB 3TO4D 5E0QA 1CS6A 2XFXB 2VM3A 4OUOA 2BK8A 4F7TB 3ARBD 4U1KB 4Y16A 3GI9L 4LDOB 5IB2B 4UBDD 1X5IA 3IETA 2OPCA 2MQCA 4TSBL 3BO8A 3MUZ1 5SX5K 1A7RL 2A83A 1TZ8A 1KCLA 3WCYA 3BQUC 1YZZA 1TTUA 5J7CC 4TN9A 4FMVA 4PB0L 2C4FU 5IFHH 4K3EH 3O41B 1SJVA 6TAAA 4OV6F 4ZTEA 1W6WA 1N18A 3L2NA 4PP1D 3JXAA 2CDGA 4PJHE 4ZJ9A 2NR6A 1XGPA 2MEJB 3T2NL 3DX8A 2NXYB 3MLSH 4LCWD 1UWXK 1O7DC 2FHCA 2IEPA 4WEBL 5H94A 4DP7X 4Y2OA 1ZHLA 3N04A 1GOGA 3IPEA 3VFUA 5GISH 4JG5A 2CDFB 2Z7UA 3KDMA 1M6OB 3LPWA 4IDJL 2CBMA 1OPGL 4A7GF 1PEWA 3O8XA 4AQ1B 1PL3A 3UBXA 3KGSA 4BFEA 4IBYA 5ANHA 3HG0A 2IFFL 3DGDA 5BW7A 5ALBL 4P49A 4UTCA 3ZQXA 4MSWB 2J8UE 4XMZA 2VLLA 3FT1A 5J1TC 1FAIL 2CBTA 3NFNA 1BAGA 1WFMA 2RALA 4E41A 3VXMD 3SKJL 1UVQA 1IEBA 1X9UA 1YMME 4OSUH 5IQ9B 1DN2A 1ZTXL 4GKSA 2WIIB 4UDUA 3V4PB 1L7TH 3BFQG 1QD0A 1VGKB 3STLB 4H1LB 1P7BA 2R4RL 4OCWH 4PJDE 4XB8A 5D1XC 4MDJA 2APFA 5A43C 2YK1L 4NBYB 1BZ8A 1F42A 1AO7B 1S7XB 4ES9A 4EI6A 1V55B 2NCMA 4JFFB 4FFYA 2CBOA 2TSBA 1TLKA 5TFSH 4CGUB 3FZUC 5TF0A 1BD2D 2ZYIA 3OZLA 1T1ZB 1WIOA 4KI5F 4XAWH 5DEFB 1MCOL 4IBSA 5EO0B 2DQFA 2BP8B 3WEMA 3KLHD 4FEMA 4EXPX 1SJEA 3H55A 1AKJB 3P4NA 2FBOJ 2X4PB 5DWPA 3KLDA 4MA7L 4HJGB 3EJSA 3VI3A 3ARRA 1EPFA 2RCSH 3KPPB 4A1RA 4QRPB 4EMZA 4K3EL 4ZW6A 4LSUL 5DJYA 1UJ3B 3GDCA 2QZ5A 3IDMA 3JWOC 2WJ5A 4K23H 4ZMOA 4JRXD 8FABA 4XXDA 4U6TA 1AG6A 4M93B 4Z7UE 1SZNA 2VZSA 2YN3A 3HRZC 3VD4A 1TENA 3DHMA 3DHPA 2PCFB 2F53E 3MV8B 5D1ZI 3T4AC 1S7TA 5EFIB 1L9OA 1SBBA 5JIDA 3F5WB 3QAQA 3CVDA 3M17B 3ASOB 1EAPA 2DIBA 2P9RA 2WXLA 4HIIA 1MCQA 1CL7L 2ROXA 4JFDE 3AM8A 4NNXA 3ULUF 1A7QL 3RDTB 3T0VA 2F15A 5LQBH 3PHOB 2R1XB 4B27A 5GRXG 3QDGD 2F54B 3MDJA 2Q8AH 1XGTB 4CVZA 5KVFE 4RA0C 1QUNA 4RMVA 2GJRA 1AGCA 1FSKB 2M26A 4P2OC 3WENA 1MSPA 4E9RA 1UM5H 2V2WA 3G6JF 1KYDA 1OAUH 3QZMA 2JJSC 2BIOA 3RI5K 4XVTH 4JFED 1SVZA 2RB8A 1T4KB 1L7TL 3NK3A 2KYIA 2XKSA 1ERNA 3EYVA 2GTQA 3HG1E 2WBJD 5SWSD 1AQKH 3BPCA 4G7RB 2ZUWA 4GRLA 1Z9NA 3TH3T 3J2PA 4FG2A 5AOZA 2NY1C 1GCFA 1CFTA 5IJVA 1DJXA 3NZ8B 3SD2A 2IMMA 4G1EB 3P11H 4DUWA 1JZ3A 1Q1JH 4ZTOL 4F5CA 3S6CA 4NRYB 4PSRA 4OBRA 2MHAB 3FU6A 2XI9A 3PU7A 2Z6FA 4ORGA 1MUJB 1QA9A 2ITCA 3AXIA 4KXZH 2BDNH 2NX5B 4JY4A 1J8HD 5JW3H 4AUYA 4KI1A 4X0NA 1J1OH 1SLVA 1LM8V 1B2YA 1SXCA 1A4BA 2MKWA 3BZFB 4MTMA 4ZQKA 5FW6A 4G8FA 5IUSA 4OFYA 4OUUB 1CD9B 2J2ZA 5BRZB 2O1AA 4JAMA 4ZUSA 2BP3A 1MFUA 4EO5A 5HTSA 2A99A 4XB7A 3ML8A 2C1PB 2ZAIA 4X4YA 3ULUH 2VL5B 3OKLA 3D08A 5C0AB 4U1MA 1J48A 4YHYC 4A6YH 4XVUD 4LHUD 2PWFA 1HESA 4K3HA 2VXUH 3FRPB 5DMIH 4FABH 4Z3HA 2YD3A 3V0WH 4EI5D 3HHRB 3FCTA 2J6WA 4TKWA 2X05A 4XP9L 2PXYC 4KXDA 2VDMH 4X99B 1MDAA 5CN1A 3TM6A 1FPTH 3MRDB 3QUMA 3T6XA 1UACL 4OCYL 1JTPA 2FEEL 5D2NC 2WVSA 2WXGA 1U92B 4AT6A 4HKXB 2R69H 1NCUA 2P4AB 5TTRA 1RZKC 3H3PH 5I17B 3C2AH 1X44A 5I1HH 1KIUB 1EO7A 2RACA 3IMWA 4LCUA 3C5JA 3VWJA 3ZE2B 3LV3B 1Y18B 1HL8A 3O3EB 4GMTL 1QFUH 1QO3A 1L9QA 1CICB 4UQ3B 5I6OA 1PF3A 1L3NA 1T0NB 1U6AL 3KPRB 4XVTL 5J6GA 1Y07A 1BQKA 1U8CB 3L3OB 3EH5B 5HHOB 4H40A 4ADIA 1P7KB 5EULV 1UJ3C 3F01A 4G8GA 5BZDA 1QBBA 1FA4A 3MRIA 3SJVE 4OIIH 1TLMA 3EH3B 3UTSA 4MHHI 5EBMB 5IHBA 1T7WA 4NDMA 4L8BA 4M93C 1ZLSL 25C8H 4ELMB 4EJ1C 3P11L 1T80A 3BN9C 5TE7H 2R2BB 4JJHA 3AABA 4FRWA 3EG9A 3K2MC 4WENB 4U05A 4X6FB 5GSVB 2KPWA 2XWXA 1S7QA 3FT2A 1PKQA 4G7QB 1NM4A 2X89A 3DX1A 4ZW7A 1N6UA 4MMYB 3O6KL 1KPVB 2D3NA 3DXAD 1NBZB 1J1OL 3IN2A 3ZJAA 1UA3A 3HJ0A 4KU1A 2EIJB 1OOWA 4LMQE 3NCMA 4FMFA 3D34A 4GKZA 5DRNB 2A74C 5DS8A 1AVAA 2Y1YA 4N8CL 3FF8A 1M7IB 3RVXC 4L8SC 3BVWA 3QDJA 4CW1B 3WNPA 4FQXB 3ULUL 5IQ7H 1UT2A 3NH7L 2WXFA 3PREA 4UUJA 2FEDC 3BXNA 3V9EA 1FFTB 5FK9B 3UBFA 1CQKA 4PBXA 2VXUL 4QXWA 5E5MB 1OGTA 3Q5YA 4NKIH 4PJBE 2DQHH 3SKMB 2VMJA 3UX9B 4FABL 5FX3A 4KKBC 4M7LH 4LPXA 3VRLF 5KYNA 1DQMH 1TKWB 4DO6A 3GSQB 3QXDB 5C0NC 1KBVA 1FPTL 2C9RA 4NQEE 2OSXA 4RFNB 3TEXA 3ZKND 3QIUB 4KI5D 3FOLA 4X83A 1D9KD 3SDAC 3VI4E 1DQDL 1YN7A 2GJ6A 5CLWA 3ARGA 3H3PL 4QYOA 3C2AL 3QDMD 1I31A 2VDKL 4QTHA 5L4IA 4EZLA 2XKUA 1Q94A 3QIBB 3QE5A 1MLBA 1L6XA 2ENSA 5J1AB 2RGSA 4UT9L 3D25B 2NY5H 1DBJH 5AD0B 5FO8B 2ZP9A 3BT2H 1T6BX 1B0WA 1IGJB 1LP9B 2XICA 3HE6D 5E2TL 2EDQA 4XCEB 4Z0BH 5KYXB 2VNCA 3GM8A 5CIPA 3S2AA 1IC1A 1P2CA 1TPXB 4XO5A 3RX8A 4XBGA 4ABUA 1PZ5A 4OIIL 3TVMC 3JV6A 3S4SA 1OAZH 3KYOB 1R46A 1YN6A 5DHVA 1DDHB 25C8L 3IS1X 1JD7A 2AEOA 4NC0B 4N0CC 4RSYA 4R4BB 1RK0B 3NRPA 2P5WB 5DC0A 2G0KA 3S3JA 3KPSE 5DF0A 3TCTA 5JLZB 1KCSH 1A7NL 4KKLC 4LPCA 4LVHC 3RZCB 1RK7A 4JK0D 2I32A 1BQLH 1QWHA 3QDGE 5I6LA 1THAA 2BSSB 2NLJB 1JMXA 1JN6A 2X53A 2AQRA 2CRIA 4KK9D 5E6SB 3CFDA 1E4XH 1E7VA 1IAOA 3CN1A 1KBKA 2AXHA 5GS1C 3T1FA 4JFEE 2R7EB 3D85B 4L4TB 4JDVB 1NUDA 5DZ9A 3FBQA 4G9FE 5LNGA 4I5BB 3AGWA 2X09A 4DKDC 1FNEA 3KW8A 4HBQA 5CHNA 4UAOC 2BNRE 2XRAL 1SOXA 4M5ZL 4AMXA 4I1RA 1CICC 5HDQH 1MI5B 5I16B 5HGBB 3MOAH 3ZN6A 4X4MA