3IGRA

The crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
183
structure length
183
Chain Sequence
DVSFEFEHYQVRLIKSSDAVTIANYFMRNRHHLAPWEPKRSHAFFTPEGWKQRLLQLVELHKHNLAFYFVVVDKNEHKIIGTVSYSNITRFPFHAGHVGYSLDSEYQGKGIMRRAVNVTIDWMFKAQNLHRIMAAYIPRNEKSAKVLAALGFVKEGEAKKYLYINGAWEDHILTSKINDDWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal-protein-S5-alanine N-acetyltransferase
publication title The Crystal Structure of Ribosomal-protein-S5-alanine Acetyltransferase from Vibrio fischeri to 2.0A
rcsb
source organism Vibrio fischeri
molecule tags Transferase
total genus 49
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3igrA00
2P6FA 5FVJA 2B58A 4MI4A 2CNSA 4R9MA 5CNPA 1N71A 1MK4A 3TT2A 1L0CA 4KUBA 4AVBA 2Q04A 3P2FA 1XIXA 4LX9A 3DDDA 1LRZA 2D4OA 2Z10A 3VWEA 2OU2A 3QB8A 4CAWA 1I12A 2PSWA 1M1DA 1Y9WA 2VBQA 4B5PB 2FXFA 1TIQA 2K5TA 5JPHA 2EUIA 1CJWA 4UBRA 2PRBA 4QUSA 3R95A 3FNCA 3NE7A 4OADA 2Q4VA 3BJ8A 4NCZA 2CNTA 3BLNA 3LD2A 1YK3A 2ZW6A 4JJXA 1S7NA 3LODA 2FS5A 3D2MA 3GYAA 3T9YA 3DNSA 2FT0A 2HUZA 2JEVA 2P6EA 4KOYA 2ZXVA 4E2AA 4J3GA 1YVKA 5KTCA 3TOAA 1VHSA 2JDDA 3D3SA 3DSBA 3TCVA 1NSLA 2B4DB 2PR1A 3VWDA 4H6ZA 3C26A 3TE4A 5GCNA 4UWJA 2Q0YA 4XPLA 5IV0A 1OZPA 2I00A 3JUWA 3QAHA 4JLYA 3CXQA 2PC1A 3W6SA 3KKWA 2P0WA 5IB0A 2VQYA 4FD5A 5J8CA 5JQ4A 2OZUA 3F5BA 1BO4A 4UA3A 1M4IA 4F6AA 1GHEA 2JDCA 3WR7A 4OLLA 4RS2A 2P6GA 4CRYB 2Q7BA 4R3KA 4M85A 3TFYA 3R9EA 4QVTA 4QBJA 2Q4YA 2B3UA 4HNWB 3N7ZA 2OH1A 4MBUA 2ATRA 1XMTA 4KOUA 5ISVA 1RO5A 3IGRA 4JD6A 3R9GA 3JVNA 4PV6A 3ZJ0A 3ZZIA 4KVOE 2GANA 3F0AA 4U9YA 4YRHA 4B5PA 2QECA 4EVYA 2PR8A 3PGPA 4I49A 2VXKA 1I1DA 3R9FA 1WWZA 2DXQA 4R87A 3R1KA 2B5GB 2OB0A 4AG7A 1Y7RA 2Y0MA 4YFJA 4KVXA 1PUAA 2Z11A 3TO6A 4YGOA 3I3GA 4KUAA 2R7HA 4QC6A 4JXRA 2I79A 4LUAA 4PSWA 1J4JA 2HV2A 5F48A 1QSRA 2FSRA 2Z0ZA 1KUVA 2OZHA 4KVME 3TO7A 3S6GA 1FY7A 1YX0A 2ARHA 1Y9KA 4PSXA 4R57A 1IB1E 4KOSA 1M4GA 3FYNA 3S6KA 3SXOA 2B4DA 2ZW7A 1S3ZA 1IIDA 2ZW5A 4AVCA 4F0YA 2FCKA 3E0KA 2AJ6A 1WK4A 3IWGA 1YGHA 2OZGA 1KUXA 4AG9A 2VI7A 1UFHA 4RI1A 4XPDB 3K9UA 1NMTA 2C27A 1S5KA 3TTHA 5DWNA 4KLVA 2CY2A 3RYOA 3PZJA 2EVNA 1QSNA 3DR6A 2R8VA 5EC4A 4FD6A 3EC4A 1U6MA 3S6HA 1ON0A 4KZTA 1S7FA 4UWIA 4CAXA 3FRMA 1VKCA 5EBVA 2A4NA 2G3TA 2WPWA 2PQ8A 2J8NA 2PDOA 4KLWA 4MY0A 1I21A 4NXYA 3EY5A 4L89A 2QIRA 2BSWA 4NEXA 4II9A 2AE6A 3UY5A 4CAVA 3G8WA 1P4NA 2F5IA 2REEA 4JWPA 4KOVA 1YVOA 4XNHB 3SXNA 3V8IA 4KOWA 4FD7A 3GKRA 5H86A 3I9SA 3FXTA 5C88A 2B5GA 5HH1A 1M4DA 1Z4RA 4PK3A 1M44A 1XEBA 4MJ8A 1KUYA 2X7BA 4AB7A 1K4JA 1B87A 4NSQA 2Q44A 2BEIA 1IICA 5HMNA 4ORFA 1IYLA 1NE9A 4KOTA 2ZPAA 1SQHA 3FB3A 4IUSA 2KCWA 2R98A 4PK2A 1P0HA 3EO4A 3FIXA 5C82A 4NF1A 3PP9A 3TO9A 4XNHC 2O28A 4AVAA 4H6UA 4U5YA 4XPKA 3T90A 5J8FA 1CM0A 5DWMA 4FD4A 1MJAA 3GY9A 3BJ7A 1XE4A 4ZBGA 3TOBA 2D4PA 4JXQA 2J8MA 3EFAA 3FBUA 4KOXA 2J8RA 3G3SA 2JLMA 2G0BA 2GE3A 3P2HA 5F47A 2NMTA 2FIAA 4U9ZA 2QMLA 3H4QA 3EXNA 4BMHA 5E96A 1BOBA 2H5MA 5I0CA 4KORA 3F8KA 4HNYB 4H89A 4MHDA 2HQYA 4Y49B 4IF5A 2REFA 4MY3A 3CXSA 5F46A 2ZW4A 2WPXA 1Z9UA 2VZZA 2IL4A 3OWCA 2FL4A 3MGDA 5H84A 4CS0B 4CRZB 1PU9A 1S7KA 2G3AA 3W91A 1Q2CA 4L8AA 5KTAA 1Z4EA 5F49A 1QSTA 1KZFA 1S7LA 5IX3A 4K30A 3CXPA 4R3LA 1XF8A 4DNCA 2VEZA 2FIWA 4XPDC 3R96A 1YR0A 2VZYA 4Y49C 1MJ9A 1V0CA 3DR8A 2B4BA 3D2PA 2CNMA 2FE7A 2RC4A 2BUEA 3S6FA 3SHPA 2BL1A 4GS4A 4OAEA 1Q2YA 4ONUA 1QSMA 1MJBA 2R1IA 2GIVA 1YREA 4X5KA 1YLEA 4B5OA 4E0AA 3D8PA 3B8GA 2B3VA 4M3SA 1R57A 1QSOA 1B6BA 4E8OA 1Q2DA 1RXTA 5KTDA 1S60A 1IYKA 4HNXB 4QB9A 3W6XA 4HKFA
chains in the Genus database with same CATH superfamily
2P6FA 5AG5A 3SI1A 5FVJA 2CXAA 1VHOA 2B58A 2BOAA 2CTBA 4MI4A 2CNSA 2V8DA 4B6ZA 4R9MA 4MHZA 2EWBA 5CNPA 1HEEA 3TX8A 1N71A 1IOIA 1MK4A 4MCRA 4Q38A 3TT2A 1L0CA 2ANPA 4KUBA 4OC5A 4A2ZA 4A37A 4AVBA 1A2ZA 4MCPA 3A9LA 3KR5A 2Q04A 2AFXA 1X10A 2XEIA 1CP6A 2Z3KA 3P2FA 4MFQA 4ZYQA 1IU8A 4JYWA 1XIXA 4LX9A 3B3VA 3DDDA 2GREA 1Y0RA 1LRZA 1BPMA 2D4OA 2PJ0A 1IOFA 2Z10A 3VWEA 4UCNA 2OU2A 2DPSA 3QB8A 4LQGA 5G22A 3LMSA 1I12A 4UCMA 4CAWA 5F09A 2PSWA 4ZY1A 3KI9A 1M1DA 3WABA 1Y9WA 5LRGA 2VBQA 4PXBA 4B5PB 2FXFA 4PXEA 1ELLP 1XJOA 5K8OA 1TIQA 2K5TA 5JPHA 2PVWA 2EUIA 1CJWA 4MFJA 4UBRA 4NGRA 2PRBA 4QUSA 3R95A 3FNCA 3NE7A 4PQAA 3VARA 1VHEA 3N5FA 4P4FA 4OADA 2Z3PA 2Q4VA 3BJ8A 4NCZA 2CNTA 2JBJA 4C7IA 3B2YA 2WYRA 1KWMA 2ZEPA 3BLNA 3FEDA 2ZOGA 3LD2A 1YK3A 3FX6A 2YGWA 1TF9A 2ZW6A 1R43A 4JJXA 4NGSA 1TF8A 5LYIA 1S7NA 3CPXA 3B3CA 3KHXA 3LODA 4UFWA 2FS5A 3D7HA 5HVGA 2DEAA 1AUGA 5AGEA 3IO1A 3NA6A 5A28A 3D2MA 3H5ZA 3GYAA 3T9YA 3DNSA 2GFQA 3D7GA 2FT0A 2HUZA 2JEVA 2P6EA 3K9TA 4NGNA 4KOYA 2ZXVA 4P6YA 2IJZA 5HVHA 3DGVA 4E2AA 4J3GA 2AFWA 5JM6A 1YVKA 5KTCA 3IC1A 3TOAA 5HXDA 1AYEA 1VHSA 2JDDA 3D3SA 3DSBA 3TCVA 1NSLA 3WC6A 2B4DB 3SI0A 2PR1A 2Q51A 3HLPA 1OBRA 4FAIA 3VWDA 4H6ZA 3C26A 4P4DA 3TE4A 5GCNA 4UWJA 1LCPA 1TXRA 2Q0YA 4XPLA 3KL9A 5IV0A 1OZPA 4ZI6A 2I00A 3GIUA 4NFRA 3JUWA 3QAHA 5LYFA 4JLYA 3CXQA 4UEFA 2PC1A 5DS0A 4A95A 3W6SA 4RUHA 3KKWA 3FH4A 4F9VA 4EMEA 2PJBA 5J1QA 2P0WA 5IB0A 2F7VA 2VQYA 1BLLE 4FD5A 5J8CA 2F8HA 2Z3LA 5JQ4A 2C1CA 2I3CA 2OZUA 3F5BA 1BO4A 3FVLA 1XFOA 3BI1A 4UA3A 4C7HA 5JGFA 3S9NA 1M4IA 2PJAA 4P44A 4F6AA 2V77A 3JTKA 3GLJA 4X8IA 1FT7A 4IAVA 1GHEA 2JDCA 3WR7A 4K3NA 4OLLA 4RS2A 2P6GA 3BXMA 3NH8A 4CRYB 2Q7BA 4R3KA 4M85A 1JQGA 3IWEA 3NFZA 4P10A 2ODFA 3PBEA 4MMOA 4A31A 1Z8LA 4KS9A 2AFMA 4FBEA 3R9EA 3TFYA 4QVTA 4QBJA 1CP7A 2Q4YA 2B3UA 1ZG8A 3GB0A 4HNWB 3N7ZA 1Z8WA 4UEZA 5K8NA 3IJ3A 2OH1A 3B3TA 4MBUA 4AXVA 5I4MA 2ATRA 1XMTA 3KR4A 4KOUA 4NGMA 4CGMA 2PJ2A 5ISVA 4MXUA 2XEGA 3CT9A 2PJ1A 1RO5A 2Q43A 2ZEDA 2Q4ZA 3IGRA 3JVNA 2CIJA 3KZWA 4JD6A 4KSIA 4PV6A 2Z3NA 1VGYA 4KVOE 5G20A 2GANA 3F0AA 3ZJ0A 3ZZIA 3LACA 4U9YA 2RB7A 5BWAB 4A32A 5CPAA 4YRHA 4B5PA 2JEWA 3L2NA 2QECA 4MFKA 4UF4A 4EVYA 2PR8A 4GXHA 3PGPA 4I49A 2VXKA 2Z3OA 3MN8A 1I1DA 3R9FA 3V7ZA 1WWZA 2DXQA 3D7FA 3HUVA 4R87A 4M6IA 3S9MA 5IB9A 3R9GA 3R1KA 4C2YA 2PCUA 2B5GB 2PJ7A 2OB0A 4AG7A 2PJ9A 1Y7RA 1ZG9A 3RBUA 4OP4A 2Y0MA 4YFJA 4UCPA 4ZY0A 3B7IA 2PJCA 3LWUA 4KVXA 1ZLHA 1PUAA 2Z11A 5ELYA 3TO6A 4YGOA 3RAMA 3I3GA 3IU2A 4KUAA 5AG4A 5LYLA 2R7HA 4CPAA 4QC6A 4CAFA 3WC5A 1F2OA 2DF5A 4JXRA 2I79A 2O53A 4LUAA 2CTCA 4PSWA 3RO0A 2ZEOA 1J4JA 2HV2A 3KGQA 5F48A 4ONWA 1QSRA 2FSRA 2Z0ZA 1KUVA 2OZHA 4KVME 2POKA 1HDUA 4X2TA 2OOTA 3TO7A 3S6GA 1FY7A 1YX0A 1YW4A 2ARHA 1Y9KA 4PSXA 4R57A 1IB1E 2Q7SA 2QYVA 1M4GA 3D66A 4KOSA 3FYNA 5LRJA 4A94A 4Q36A 3S6KA 4F0XA 3SXOA 2B4DA 2ZW7A 4DYOA 1S3ZA 1IIDA 2ZW5A 4HPSA 4AVCA 2FCKA 4P4JA 4F0YA 1LFWA 3E0KA 4P4BA 4A39A 2C6CA 3VH9A 2AJ6A 2WSAA 4F8ZA 2EBJA 4Q7AA 1PYTB 1WK4A 3IWGA 1AMPA 1YMEA 1LAPA 1YGHA 2AFSA 3NE8A 5LYDA 1Z8XA 2OZGA 1TKHA 4MHYA 1KUXA 3IIBA 3PRTA 4EWTA 1LANA 2VI7A 4AG9A 1UFHA 4RI1A 1X12A 3NH5A 1QQ9A 4XPDB 3K9UA 1NMTA 2C27A 2NYQA 1S5KA 4B10A 4FWUA 3TTHA 5DWNA 4CAEA 3D4UA 4KLVA 2CY2A 2CF4A 3RYOA 2YNCC 3FJUA 2ZEGA 3PZJA 2EVNA 1QSNA 3B3WA 3DR6A 4OKOA 2R8VA 4TWEA 5EC4A 2C6PA 1IGBA 4FD6A 3SJGA 4EFDA 5JH9A 1VIXA 2AFZA 1DTDA 3I1UA 3EC4A 4RN7A 1U6MA 3IWWA 3S6HA 1ON0A 1XRYA 1S7FA 4KZTA 4UWIA 4CAXA 4OC3A 3FRMA 4MFPA 1VKCA 1FNOA 2PE3A 4IK2A 1CBXA 5EBVA 2A4NA 1YSJA 2G3TA 4A33A 2WPWA 2PQ8A 3T8WA 4MFLA 2J8NA 1LAMA 2PDOA 4KLWA 4PXDA 4WWVA 5D8NA 4MY0A 1I21A 3BI0A 4NXYA 3WC7A 3CZXA 3EY5A 1Z2LA 2WZNA 4KSFA 3SJXA 4CGNA 1Z8TA 1HDQA 4L89A 2QIRA 2BSWA 4NEXA 4C2XA 4MHPA 1EE3P 2ZOFA 3D67A 3TC8A 4R76A 4II9A 3PFEA 2AE6A 3UY5A 2HB6A 4CAVA 3G8WA 3IU1A 1P4NA 4W9YA 3FMCA 3JRUA 1ELMP 4OC2A 2F5IA 2REEA 4OC1A 4JWPA 4KOVA 1YVOA 3IFEA 4R6TA 4XNHB 1ZO0A 3SXNA 3V8IA 4YWYA 2YNDA 4FD7A 3GKRA 2WUUA 3PBBA 4KOWA 4BD9A 5H86A 3I9SA 3FXTA 4IHMA 5C88A 2V8VA 2XEJA 2B5GA 2XEFA 5HH1A 4UIAA 1M4DA 1Z4RA 4PK3A 3SI2A 3ISZA 1M44A 3SJEA 1XEBA 1RTQA 2IMOA 3K2KA 4MJ8A 4P45A 3H8GA 4MHNA 4Z65A 3DLJA 1XOVA 1KUYA 1ZG7A 5AG7A 2X7BA 5HVFA 2Z3MA 4AB7A 3SJFA 3RZAA 1K4JA 4KSAA 1B87A 4NSQA 4X3RA 2Q44A 2YNEA 4OIWA 2BEIA 4PXCA 1IICA 5HMNA 3QNVA 4ORFA 1IYLA 1NE9A 4KOTA 4NJQA 1TKJA 2ZPAA 2AFOA 1SQHA 2YNCA 3FB3A 4IUSA 3RNZA 3FEEA 1Z5RA 2KCWA 2PJ8A 2R98A 4MCSA 4OC0A 1CPXA 4PK2A 1P0HA 4DUKA 3EO4A 3FIXA 4CYPA 5CBMA 1LOKA 3D7DA 1YLOA 5C82A 4NF1A 5AG6A 1CG2A 3PP9A 3TO9A 4XNHC 2O28A 2ZELA 4FUUA 4AVAA 4H6UA 4B11A 3PEIA 4JZ0A 4U5YA 1ARMA 4XPKA 4ZX8A 3T90A 1XBUA 5J8FA 1CM0A 1XMBA 4CGPA 2G9DA 4FD4A 1MJAA 5DWMA 3GY9A 5THWA 3BJ7A 1XE4A 4ZBGA 3GUXA 4C2ZA 3TOBA 4CYQA 4CGOA 2D4PA 3PB7X 3QAYA 4JXQA 1NSAA 2J8MA 2PJ3A 4UFXA 3KQZA 1F2PA 3EFAA 2GLFA 3FBUA 5K8MA 2PJ6A 4KOXA 2FVGA 4BBHA 2J8RA 3G3SA 8CPAA 4G1PA 2JLMA 2PRQA 4C68A 2ABZA 2G0BA 2GE3A 5EMIA 1IY7A 3P2HA 5F47A 2NMTA 2ZENA 2FIAA 2J9AA 3FF3A 4GM5A 4U9ZA 4ZY2A 2QMLA 3H4QA 2RFHA 4UIBA 3PB8X 3EXNA 2DPTA 4ZGYB 3PFOA 4M6HA 4BMHA 2HC9A 4WJBA 4B12A 5E96A 2PJ4A 3KASA 1BOBA 1CPSA 1UWYA 2H5MA 4KORA 5I0CA 3F8KA 4MFZA 4HNYB 5G1ZA 4TNUA 4M6GA 4H89A 2V8HA 4MHDA 5G21A 4NJRA 4R8FA 3NH4A 4O23A 2HQYA 3MRUA 4UEEA 4IF5A 4Y49B 5K8PA 2V8GA 3CDXA 3KHZA 2OR4A 2REFA 4MY3A 2BCOA 3CXSA 5F46A 2QVPA 4MCQA 2ZW4A 2WPXA 1Z9UA 2VZZA 2IL4A 4B14A 3B35A 7CPAA 3OWCA 5A27A 1PCAA 2FL4A 1BPNA 1ARLA 3MGDA 1YQEA 5H84A 1R3NA 4CS0B 3D68A 3IEHA 4CRZB 1PU9A 1S7KA 2G3AA 2PVVA 3ISXA 3W91A 1Q2CA 1ZLIA 2GU2A 1F57A 4L8AA 4UFVA 3H8EA 5KTAA 1Z4EA 4NGTA 6CPAA 1Y7EA 1CX8A 5F49A 1QSTA 1KZFA 1S7LA 5IX3A 5LRKA 4CGLA 4F9UA 4CYNA 4K30A 2ZEEA 3KQXA 3CXPA 3B3SA 4R3LA 3V38A 4BINA 4P4EA 4LQ6A 1XF8A 4H2KA 4B13A 4OIDA 4DNCA 2VEZA 2FIWA 4XPDC 3R96A 3VATA 1YR0A 2VZYA 2ZEFA 4Y49C 1MJ9A 3PB4X 1V0CA 3DR8A 4A38A 2B4BA 3D2PA 3PB9X 4P4IA 2CNMA 2FE7A 1Q7LA 2RC4A 2BUEA 4MRIA 3S6FA 3BHXA 3SHPA 2EK8A 1DE4C 3WT4A 2AFUA 2ZEMA 4A30A 3H8FA 2BL1A 4GS4A 1GYTA 1JWQA 2PJ5A 1BAVA 4OAEA 1Q2YA 4ONUA 2C6GA 1QSMA 2JBKA 1MJBA 2O4HA 1M4LA 1Y0YA 2R1IA 4NGPA 2GIVA 4ZX9A 2PIZA 4DJLA 1YREA 2EK9A 4X5KA 3W6XA 3PB6X 1YLEA 3CPAA 2QJ8A 4PPZA 2ZEHA 2GLJA 4B5OA 4OMEA 5D29A 4E0AA 3D8PA 3FECA 3B8GA 2B3VA 4NGQA 4OC4A 2VL1A 2PIYA 4M3SA 1R57A 1QSOA 2NSMA 1YW6A 1B6BA 2EO8A 2IQ6A 4E8OA 1Q2DA 1RXTA 5KTDA 4YU9A 1S60A 1IYKA 3S9LA 1H8LA 2BO9A 4R7MA 4HNXB 4QB9A 1TKFA 4CYOA 1QMUA 4HKFA
chains in the Genus database with same CATH topology
2P6FA 5AG5A 5FVJA 2CXAA 2B58A 4MI4A 2CNSA 4R9MA 5CNPA 1N71A 1MK4A 4Q38A 3TT2A 1L0CA 4KUBA 4A2ZA 4AVBA 3A9LA 2Q04A 2Z3KA 3P2FA 4MFQA 1XIXA 4LX9A 3DDDA 1LRZA 2D4OA 2Z10A 3VWEA 4UCNA 2OU2A 2DPSA 3QB8A 4CAWA 5G22A 1I12A 4UCMA 2PSWA 1M1DA 1Y9WA 2VBQA 4B5PB 2FXFA 1TIQA 2K5TA 5JPHA 2EUIA 1CJWA 4MFJA 4UBRA 2PRBA 4QUSA 3R95A 3FNCA 3NE7A 4OADA 2Z3PA 2Q4VA 3BJ8A 4NCZA 2CNTA 4C7IA 3BLNA 3LD2A 1YK3A 2YGWA 2ZW6A 4JJXA 1S7NA 3LODA 4UFWA 2FS5A 5A28A 5AGEA 3D2MA 3H5ZA 3GYAA 3T9YA 3DNSA 2FT0A 2HUZA 2JEVA 2P6EA 4KOYA 2ZXVA 4E2AA 4J3GA 1YVKA 5KTCA 3TOAA 1VHSA 2JDDA 3D3SA 3DSBA 3TCVA 1NSLA 2B4DB 2PR1A 3VWDA 4H6ZA 3C26A 3TE4A 5GCNA 4UWJA 2Q0YA 4XPLA 5IV0A 1OZPA 2I00A 3JUWA 3QAHA 4JLYA 3CXQA 4A95A 2PC1A 3W6SA 3KKWA 2P0WA 5IB0A 2VQYA 4FD5A 5J8CA 2Z3LA 5JQ4A 2OZUA 3F5BA 1BO4A 4C7HA 4UA3A 1M4IA 4F6AA 3JTKA 1GHEA 2JDCA 3WR7A 4OLLA 4RS2A 2P6GA 4CRYB 2Q7BA 4R3KA 4M85A 3IWEA 4A31A 4KS9A 3TFYA 3R9EA 4QVTA 4QBJA 2Q4YA 2B3UA 4HNWB 3N7ZA 2OH1A 4MBUA 2ATRA 1XMTA 4KOUA 4CGMA 5ISVA 1RO5A 3IGRA 4JD6A 3R9GA 3JVNA 4PV6A 3ZJ0A 5G20A 2Z3NA 3ZZIA 4KVOE 2GANA 3F0AA 4U9YA 5BWAB 4A32A 4YRHA 4B5PA 2QECA 4MFKA 4EVYA 2PR8A 3PGPA 4I49A 2VXKA 2Z3OA 1I1DA 3R9FA 1WWZA 2DXQA 4R87A 3R1KA 4C2YA 2B5GB 2OB0A 4AG7A 1Y7RA 2Y0MA 4YFJA 4UCPA 4KVXA 1PUAA 2Z11A 3TO6A 4YGOA 3I3GA 3IU2A 4KUAA 5AG4A 2R7HA 4QC6A 4CAFA 4JXRA 2I79A 4LUAA 4PSWA 1J4JA 2HV2A 5F48A 1QSRA 2FSRA 2Z0ZA 1KUVA 2OZHA 4KVME 3TO7A 3S6GA 1FY7A 1YX0A 2ARHA 1Y9KA 4PSXA 4R57A 1IB1E 4KOSA 1M4GA 4F0XA 3FYNA 4Q36A 3S6KA 3SXOA 2B4DA 2ZW7A 1S3ZA 1IIDA 2ZW5A 4AVCA 4F0YA 2FCKA 3E0KA 2AJ6A 2WSAA 1WK4A 3IWGA 1YGHA 2OZGA 1KUXA 4AG9A 2VI7A 1UFHA 4RI1A 4XPDB 3K9UA 1NMTA 2C27A 1S5KA 4B10A 3TTHA 5DWNA 4CAEA 4KLVA 2CY2A 3RYOA 2YNCC 3PZJA 2EVNA 1QSNA 3DR6A 2R8VA 5EC4A 4FD6A 3EC4A 1U6MA 3S6HA 1ON0A 4KZTA 1S7FA 4UWIA 4CAXA 3FRMA 4MFPA 1VKCA 5EBVA 2A4NA 2G3TA 4A33A 2WPWA 2PQ8A 4MFLA 2J8NA 2PDOA 4KLWA 4MY0A 1I21A 4NXYA 3EY5A 4KSFA 4CGNA 4L89A 2QIRA 2BSWA 4NEXA 4C2XA 4II9A 2AE6A 3UY5A 4CAVA 3G8WA 3IU1A 1P4NA 2F5IA 2REEA 4JWPA 4KOVA 1YVOA 4XNHB 1ZO0A 3SXNA 3V8IA 2YNDA 4FD7A 3GKRA 2WUUA 4KOWA 5H86A 3I9SA 3FXTA 5C88A 2B5GA 5HH1A 1M4DA 1Z4RA 4PK3A 1M44A 1XEBA 4MJ8A 1KUYA 5AG7A 2X7BA 2Z3MA 4AB7A 1K4JA 4KSAA 1B87A 4NSQA 2Q44A 2YNEA 2BEIA 1IICA 5HMNA 4ORFA 1IYLA 1NE9A 4KOTA 2ZPAA 2YNCA 1SQHA 3FB3A 4IUSA 2KCWA 2R98A 4PK2A 1P0HA 3EO4A 3FIXA 4CYPA 5C82A 4NF1A 5AG6A 3PP9A 3TO9A 4XNHC 2O28A 4AVAA 4H6UA 4B11A 4U5YA 4XPKA 3T90A 5J8FA 1CM0A 4CGPA 5DWMA 4FD4A 1MJAA 3GY9A 3BJ7A 1XE4A 4ZBGA 4C2ZA 3TOBA 4CYQA 4CGOA 2D4PA 4JXQA 2J8MA 4UFXA 3EFAA 3FBUA 4KOXA 4BBHA 2J8RA 3G3SA 2JLMA 4C68A 2G0BA 2GE3A 3P2HA 5F47A 2NMTA 2FIAA 4U9ZA 2QMLA 3H4QA 3EXNA 2DPTA 4ZGYB 4BMHA 4B12A 5E96A 1BOBA 2H5MA 5I0CA 4KORA 3F8KA 4MFZA 4HNYB 5G1ZA 4H89A 4MHDA 5G21A 2HQYA 4Y49B 4IF5A 2REFA 4MY3A 3CXSA 5F46A 2ZW4A 2WPXA 1Z9UA 2VZZA 2IL4A 4B14A 3OWCA 5A27A 2FL4A 3MGDA 5H84A 4CS0B 4CRZB 1PU9A 1S7KA 2G3AA 3W91A 1Q2CA 4L8AA 4UFVA 5KTAA 1Z4EA 5F49A 1QSTA 1KZFA 1S7LA 5IX3A 4CGLA 4CYNA 4K30A 3CXPA 4R3LA 1XF8A 4B13A 4DNCA 2VEZA 2FIWA 4XPDC 3R96A 1YR0A 2VZYA 4Y49C 1MJ9A 1V0CA 3DR8A 2B4BA 3D2PA 2CNMA 2FE7A 2RC4A 2BUEA 3S6FA 3SHPA 4A30A 2BL1A 4GS4A 4OAEA 1Q2YA 4ONUA 1QSMA 1MJBA 2R1IA 2GIVA 1YREA 4X5KA 1YLEA 4B5OA 4E0AA 3D8PA 3B8GA 2B3VA 4M3SA 1R57A 1QSOA 1B6BA 4E8OA 1Q2DA 1RXTA 5KTDA 1S60A 1IYKA 4HNXB 4QB9A 4CYOA 3W6XA 4HKFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P6F A;  5FVJ A;  2B58 A;  4MI4 A;  2CNS A;  4R9M A;  5CNP A;  1N71 A;  1MK4 A;  3TT2 A;  1L0C A;  4KUB A;  4AVB A;  2Q04 A;  3P2F A;  1XIX A;  4LX9 A;  3DDD A;  1LRZ A;  2D4O A;  2Z10 A;  3VWE A;  2OU2 A;  3QB8 A;  4CAW A;  1I12 A;  2PSW A;  1M1D A;  1Y9W A;  2VBQ A;  4B5P B;  2FXF A;  1TIQ A;  2K5T A;  5JPH A;  2EUI A;  1CJW A;  4UBR A;  2PRB A;  4QUS A;  3R95 A;  3FNC A;  3NE7 A;  4OAD A;  2Q4V A;  3BJ8 A;  4NCZ A;  2CNT A;  3BLN A;  3LD2 A;  1YK3 A;  2ZW6 A;  4JJX A;  1S7N A;  3LOD A;  2FS5 A;  3D2M A;  3GYA A;  3T9Y A;  3DNS A;  2FT0 A;  2HUZ A;  2JEV A;  2P6E A;  4KOY A;  2ZXV A;  4E2A A;  4J3G A;  1YVK A;  5KTC A;  3TOA A;  1VHS A;  2JDD A;  3D3S A;  3DSB A;  3TCV A;  1NSL A;  2B4D B;  2PR1 A;  3VWD A;  4H6Z A;  3C26 A;  3TE4 A;  5GCN A;  4UWJ A;  2Q0Y A;  4XPL A;  5IV0 A;  1OZP A;  2I00 A;  3JUW A;  3QAH A;  4JLY A;  3CXQ A;  2PC1 A;  3W6S A;  3KKW A;  2P0W A;  5IB0 A;  2VQY A;  4FD5 A;  5J8C A;  5JQ4 A;  2OZU A;  3F5B A;  1BO4 A;  4UA3 A;  1M4I A;  4F6A A;  1GHE A;  2JDC A;  3WR7 A;  4OLL A;  4RS2 A;  2P6G A;  4CRY B;  2Q7B A;  4R3K A;  4M85 A;  3TFY A;  3R9E A;  4QVT A;  4QBJ A;  2Q4Y A;  2B3U A;  4HNW B;  3N7Z A;  2OH1 A;  4MBU A;  2ATR A;  1XMT A;  4KOU A;  5ISV A;  1RO5 A;  3IGR A;  4JD6 A;  3R9G A;  3JVN A;  4PV6 A;  3ZJ0 A;  3ZZI A;  4KVO E;  2GAN A;  3F0A A;  4U9Y A;  4YRH A;  4B5P A;  2QEC A;  4EVY A;  2PR8 A;  3PGP A;  4I49 A;  2VXK A;  1I1D A;  3R9F A;  1WWZ A;  2DXQ A;  4R87 A;  3R1K A;  2B5G B;  2OB0 A;  4AG7 A;  1Y7R A;  2Y0M A;  4YFJ A;  4KVX A;  1PUA A;  2Z11 A;  3TO6 A;  4YGO A;  3I3G A;  4KUA A;  2R7H A;  4QC6 A;  4JXR A;  2I79 A;  4LUA A;  4PSW A;  1J4J A;  2HV2 A;  5F48 A;  1QSR A;  2FSR A;  2Z0Z A;  1KUV A;  2OZH A;  4KVM E;  3TO7 A;  3S6G A;  1FY7 A;  1YX0 A;  2ARH A;  1Y9K A;  4PSX A;  4R57 A;  1IB1 E;  4KOS A;  1M4G A;  3FYN A;  3S6K A;  3SXO A;  2B4D A;  2ZW7 A;  1S3Z A;  1IID A;  2ZW5 A;  4AVC A;  4F0Y A;  2FCK A;  3E0K A;  2AJ6 A;  1WK4 A;  3IWG A;  1YGH A;  2OZG A;  1KUX A;  4AG9 A;  2VI7 A;  1UFH A;  4RI1 A;  4XPD B;  3K9U A;  1NMT A;  2C27 A;  1S5K A;  3TTH A;  5DWN A;  4KLV A;  2CY2 A;  3RYO A;  3PZJ A;  2EVN A;  1QSN A;  3DR6 A;  2R8V A;  5EC4 A;  4FD6 A;  3EC4 A;  1U6M A;  3S6H A;  1ON0 A;  4KZT A;  1S7F A;  4UWI A;  4CAX A;  3FRM A;  1VKC A;  5EBV A;  2A4N A;  2G3T A;  2WPW A;  2PQ8 A;  2J8N A;  2PDO A;  4KLW A;  4MY0 A;  1I21 A;  4NXY A;  3EY5 A;  4L89 A;  2QIR A;  2BSW A;  4NEX A;  4II9 A;  2AE6 A;  3UY5 A;  4CAV A;  3G8W A;  1P4N A;  2F5I A;  2REE A;  4JWP A;  4KOV A;  1YVO A;  4XNH B;  3SXN A;  3V8I A;  4KOW A;  4FD7 A;  3GKR A;  5H86 A;  3I9S A;  3FXT A;  5C88 A;  2B5G A;  5HH1 A;  1M4D A;  1Z4R A;  4PK3 A;  1M44 A;  1XEB A;  4MJ8 A;  1KUY A;  2X7B A;  4AB7 A;  1K4J A;  1B87 A;  4NSQ A;  2Q44 A;  2BEI A;  1IIC A;  5HMN A;  4ORF A;  1IYL A;  1NE9 A;  4KOT A;  2ZPA A;  1SQH A;  3FB3 A;  4IUS A;  2KCW A;  2R98 A;  4PK2 A;  1P0H A;  3EO4 A;  3FIX A;  5C82 A;  4NF1 A;  3PP9 A;  3TO9 A;  4XNH C;  2O28 A;  4AVA A;  4H6U A;  4U5Y A;  4XPK A;  3T90 A;  5J8F A;  1CM0 A;  5DWM A;  4FD4 A;  1MJA A;  3GY9 A;  3BJ7 A;  1XE4 A;  4ZBG A;  3TOB A;  2D4P A;  4JXQ A;  2J8M A;  3EFA A;  3FBU A;  4KOX A;  2J8R A;  3G3S A;  2JLM A;  2G0B A;  2GE3 A;  3P2H A;  5F47 A;  2NMT A;  2FIA A;  4U9Z A;  2QML A;  3H4Q A;  3EXN A;  4BMH A;  5E96 A;  1BOB A;  2H5M A;  5I0C A;  4KOR A;  3F8K A;  4HNY B;  4H89 A;  4MHD A;  2HQY A;  4Y49 B;  4IF5 A;  2REF A;  4MY3 A;  3CXS A;  5F46 A;  2ZW4 A;  2WPX A;  1Z9U A;  2VZZ A;  2IL4 A;  3OWC A;  2FL4 A;  3MGD A;  5H84 A;  4CS0 B;  4CRZ B;  1PU9 A;  1S7K A;  2G3A A;  3W91 A;  1Q2C A;  4L8A A;  5KTA A;  1Z4E A;  5F49 A;  1QST A;  1KZF A;  1S7L A;  5IX3 A;  4K30 A;  3CXP A;  4R3L A;  1XF8 A;  4DNC A;  2VEZ A;  2FIW A;  4XPD C;  3R96 A;  1YR0 A;  2VZY A;  4Y49 C;  1MJ9 A;  1V0C A;  3DR8 A;  2B4B A;  3D2P A;  2CNM A;  2FE7 A;  2RC4 A;  2BUE A;  3S6F A;  3SHP A;  2BL1 A;  4GS4 A;  4OAE A;  1Q2Y A;  4ONU A;  1QSM A;  1MJB A;  2R1I A;  2GIV A;  1YRE A;  4X5K A;  1YLE A;  4B5O A;  4E0A A;  3D8P A;  3B8G A;  2B3V A;  4M3S A;  1R57 A;  1QSO A;  1B6B A;  4E8O A;  1Q2D A;  1RXT A;  5KTD A;  1S60 A;  1IYK A;  4HNX B;  4QB9 A;  3W6X A;  4HKF A; 
#chains in the Genus database with same CATH topology
 2P6F A;  5AG5 A;  3SI1 A;  5FVJ A;  2CXA A;  1VHO A;  2B58 A;  2BOA A;  2CTB A;  4MI4 A;  2CNS A;  2V8D A;  4B6Z A;  4R9M A;  4MHZ A;  2EWB A;  5CNP A;  1HEE A;  3TX8 A;  1N71 A;  1IOI A;  1MK4 A;  4MCR A;  4Q38 A;  3TT2 A;  1L0C A;  2ANP A;  4KUB A;  4OC5 A;  4A2Z A;  4A37 A;  4AVB A;  1A2Z A;  4MCP A;  3A9L A;  3KR5 A;  2Q04 A;  2AFX A;  1X10 A;  2XEI A;  1CP6 A;  2Z3K A;  3P2F A;  4MFQ A;  4ZYQ A;  1IU8 A;  4JYW A;  1XIX A;  4LX9 A;  3B3V A;  3DDD A;  2GRE A;  1Y0R A;  1LRZ A;  1BPM A;  2D4O A;  2PJ0 A;  1IOF A;  2Z10 A;  3VWE A;  4UCN A;  2OU2 A;  2DPS A;  3QB8 A;  4LQG A;  5G22 A;  3LMS A;  1I12 A;  4UCM A;  4CAW A;  5F09 A;  2PSW A;  4ZY1 A;  3KI9 A;  1M1D A;  3WAB A;  1Y9W A;  5LRG A;  2VBQ A;  4PXB A;  4B5P B;  2FXF A;  4PXE A;  1ELL P;  1XJO A;  5K8O A;  1TIQ A;  2K5T A;  5JPH A;  2PVW A;  2EUI A;  1CJW A;  4MFJ A;  4UBR A;  4NGR A;  2PRB A;  4QUS A;  3R95 A;  3FNC A;  3NE7 A;  4PQA A;  3VAR A;  1VHE A;  3N5F A;  4P4F A;  4OAD A;  2Z3P A;  2Q4V A;  3BJ8 A;  4NCZ A;  2CNT A;  2JBJ A;  4C7I A;  3B2Y A;  2WYR A;  1KWM A;  2ZEP A;  3BLN A;  3FED A;  2ZOG A;  3LD2 A;  1YK3 A;  3FX6 A;  2YGW A;  1TF9 A;  2ZW6 A;  1R43 A;  4JJX A;  4NGS A;  1TF8 A;  5LYI A;  1S7N A;  3CPX A;  3B3C A;  3KHX A;  3LOD A;  4UFW A;  2FS5 A;  3D7H A;  5HVG A;  2DEA A;  1AUG A;  5AGE A;  3IO1 A;  3NA6 A;  5A28 A;  3D2M A;  3H5Z A;  3GYA A;  3T9Y A;  3DNS A;  2GFQ A;  3D7G A;  2FT0 A;  2HUZ A;  2JEV A;  2P6E A;  3K9T A;  4NGN A;  4KOY A;  2ZXV A;  4P6Y A;  2IJZ A;  5HVH A;  3DGV A;  4E2A A;  4J3G A;  2AFW A;  5JM6 A;  1YVK A;  5KTC A;  3IC1 A;  3TOA A;  5HXD A;  1AYE A;  1VHS A;  2JDD A;  3D3S A;  3DSB A;  3TCV A;  1NSL A;  3WC6 A;  2B4D B;  3SI0 A;  2PR1 A;  2Q51 A;  3HLP A;  1OBR A;  4FAI A;  3VWD A;  4H6Z A;  3C26 A;  4P4D A;  3TE4 A;  5GCN A;  4UWJ A;  1LCP A;  1TXR A;  2Q0Y A;  4XPL A;  3KL9 A;  5IV0 A;  1OZP A;  4ZI6 A;  2I00 A;  3GIU A;  4NFR A;  3JUW A;  3QAH A;  5LYF A;  4JLY A;  3CXQ A;  4UEF A;  2PC1 A;  5DS0 A;  4A95 A;  3W6S A;  4RUH A;  3KKW A;  3FH4 A;  4F9V A;  4EME A;  2PJB A;  5J1Q A;  2P0W A;  5IB0 A;  2F7V A;  2VQY A;  1BLL E;  4FD5 A;  5J8C A;  2F8H A;  2Z3L A;  5JQ4 A;  2C1C A;  2I3C A;  2OZU A;  3F5B A;  1BO4 A;  3FVL A;  1XFO A;  3BI1 A;  4UA3 A;  4C7H A;  5JGF A;  3S9N A;  1M4I A;  2PJA A;  4P44 A;  4F6A A;  2V77 A;  3JTK A;  3GLJ A;  4X8I A;  1FT7 A;  4IAV A;  1GHE A;  2JDC A;  3WR7 A;  4K3N A;  4OLL A;  4RS2 A;  2P6G A;  3BXM A;  3NH8 A;  4CRY B;  2Q7B A;  4R3K A;  4M85 A;  1JQG A;  3IWE A;  3NFZ A;  4P10 A;  2ODF A;  3PBE A;  4MMO A;  4A31 A;  1Z8L A;  4KS9 A;  2AFM A;  4FBE A;  3R9E A;  3TFY A;  4QVT A;  4QBJ A;  1CP7 A;  2Q4Y A;  2B3U A;  1ZG8 A;  3GB0 A;  4HNW B;  3N7Z A;  1Z8W A;  4UEZ A;  5K8N A;  3IJ3 A;  2OH1 A;  3B3T A;  4MBU A;  4AXV A;  5I4M A;  2ATR A;  1XMT A;  3KR4 A;  4KOU A;  4NGM A;  4CGM A;  2PJ2 A;  5ISV A;  4MXU A;  2XEG A;  3CT9 A;  2PJ1 A;  1RO5 A;  2Q43 A;  2ZED A;  2Q4Z A;  3IGR A;  3JVN A;  2CIJ A;  3KZW A;  4JD6 A;  4KSI A;  4PV6 A;  2Z3N A;  1VGY A;  4KVO E;  5G20 A;  2GAN A;  3F0A A;  3ZJ0 A;  3ZZI A;  3LAC A;  4U9Y A;  2RB7 A;  5BWA B;  4A32 A;  5CPA A;  4YRH A;  4B5P A;  2JEW A;  3L2N A;  2QEC A;  4MFK A;  4UF4 A;  4EVY A;  2PR8 A;  4GXH A;  3PGP A;  4I49 A;  2VXK A;  2Z3O A;  3MN8 A;  1I1D A;  3R9F A;  3V7Z A;  1WWZ A;  2DXQ A;  3D7F A;  3HUV A;  4R87 A;  4M6I A;  3S9M A;  5IB9 A;  3R9G A;  3R1K A;  4C2Y A;  2PCU A;  2B5G B;  2PJ7 A;  2OB0 A;  4AG7 A;  2PJ9 A;  1Y7R A;  1ZG9 A;  3RBU A;  4OP4 A;  2Y0M A;  4YFJ A;  4UCP A;  4ZY0 A;  3B7I A;  2PJC A;  3LWU A;  4KVX A;  1ZLH A;  1PUA A;  2Z11 A;  5ELY A;  3TO6 A;  4YGO A;  3RAM A;  3I3G A;  3IU2 A;  4KUA A;  5AG4 A;  5LYL A;  2R7H A;  4CPA A;  4QC6 A;  4CAF A;  3WC5 A;  1F2O A;  2DF5 A;  4JXR A;  2I79 A;  2O53 A;  4LUA A;  2CTC A;  4PSW A;  3RO0 A;  2ZEO A;  1J4J A;  2HV2 A;  3KGQ A;  5F48 A;  4ONW A;  1QSR A;  2FSR A;  2Z0Z A;  1KUV A;  2OZH A;  4KVM E;  2POK A;  1HDU A;  4X2T A;  2OOT A;  3TO7 A;  3S6G A;  1FY7 A;  1YX0 A;  1YW4 A;  2ARH A;  1Y9K A;  4PSX A;  4R57 A;  1IB1 E;  2Q7S A;  2QYV A;  1M4G A;  3D66 A;  4KOS A;  3FYN A;  5LRJ A;  4A94 A;  4Q36 A;  3S6K A;  4F0X A;  3SXO A;  2B4D A;  2ZW7 A;  4DYO A;  1S3Z A;  1IID A;  2ZW5 A;  4HPS A;  4AVC A;  2FCK A;  4P4J A;  4F0Y A;  1LFW A;  3E0K A;  4P4B A;  4A39 A;  2C6C A;  3VH9 A;  2AJ6 A;  2WSA A;  4F8Z A;  2EBJ A;  4Q7A A;  1PYT B;  1WK4 A;  3IWG A;  1AMP A;  1YME A;  1LAP A;  1YGH A;  2AFS A;  3NE8 A;  5LYD A;  1Z8X A;  2OZG A;  1TKH A;  4MHY A;  1KUX A;  3IIB A;  3PRT A;  4EWT A;  1LAN A;  2VI7 A;  4AG9 A;  1UFH A;  4RI1 A;  1X12 A;  3NH5 A;  1QQ9 A;  4XPD B;  3K9U A;  1NMT A;  2C27 A;  2NYQ A;  1S5K A;  4B10 A;  4FWU A;  3TTH A;  5DWN A;  4CAE A;  3D4U A;  4KLV A;  2CY2 A;  2CF4 A;  3RYO A;  2YNC C;  3FJU A;  2ZEG A;  3PZJ A;  2EVN A;  1QSN A;  3B3W A;  3DR6 A;  4OKO A;  2R8V A;  4TWE A;  5EC4 A;  2C6P A;  1IGB A;  4FD6 A;  3SJG A;  4EFD A;  5JH9 A;  1VIX A;  2AFZ A;  1DTD A;  3I1U A;  3EC4 A;  4RN7 A;  1U6M A;  3IWW A;  3S6H A;  1ON0 A;  1XRY A;  1S7F A;  4KZT A;  4UWI A;  4CAX A;  4OC3 A;  3FRM A;  4MFP A;  1VKC A;  1FNO A;  2PE3 A;  4IK2 A;  1CBX A;  5EBV A;  2A4N A;  1YSJ A;  2G3T A;  4A33 A;  2WPW A;  2PQ8 A;  3T8W A;  4MFL A;  2J8N A;  1LAM A;  2PDO A;  4KLW A;  4PXD A;  4WWV A;  5D8N A;  4MY0 A;  1I21 A;  3BI0 A;  4NXY A;  3WC7 A;  3CZX A;  3EY5 A;  1Z2L A;  2WZN A;  4KSF A;  3SJX A;  4CGN A;  1Z8T A;  1HDQ A;  4L89 A;  2QIR A;  2BSW A;  4NEX A;  4C2X A;  4MHP A;  1EE3 P;  2ZOF A;  3D67 A;  3TC8 A;  4R76 A;  4II9 A;  3PFE A;  2AE6 A;  3UY5 A;  2HB6 A;  4CAV A;  3G8W A;  3IU1 A;  1P4N A;  4W9Y A;  3FMC A;  3JRU A;  1ELM P;  4OC2 A;  2F5I A;  2REE A;  4OC1 A;  4JWP A;  4KOV A;  1YVO A;  3IFE A;  4R6T A;  4XNH B;  1ZO0 A;  3SXN A;  3V8I A;  4YWY A;  2YND A;  4FD7 A;  3GKR A;  2WUU A;  3PBB A;  4KOW A;  4BD9 A;  5H86 A;  3I9S A;  3FXT A;  4IHM A;  5C88 A;  2V8V A;  2XEJ A;  2B5G A;  2XEF A;  5HH1 A;  4UIA A;  1M4D A;  1Z4R A;  4PK3 A;  3SI2 A;  3ISZ A;  1M44 A;  3SJE A;  1XEB A;  1RTQ A;  2IMO A;  3K2K A;  4MJ8 A;  4P45 A;  3H8G A;  4MHN A;  4Z65 A;  3DLJ A;  1XOV A;  1KUY A;  1ZG7 A;  5AG7 A;  2X7B A;  5HVF A;  2Z3M A;  4AB7 A;  3SJF A;  3RZA A;  1K4J A;  4KSA A;  1B87 A;  4NSQ A;  4X3R A;  2Q44 A;  2YNE A;  4OIW A;  2BEI A;  4PXC A;  1IIC A;  5HMN A;  3QNV A;  4ORF A;  1IYL A;  1NE9 A;  4KOT A;  4NJQ A;  1TKJ A;  2ZPA A;  2AFO A;  1SQH A;  2YNC A;  3FB3 A;  4IUS A;  3RNZ A;  3FEE A;  1Z5R A;  2KCW A;  2PJ8 A;  2R98 A;  4MCS A;  4OC0 A;  1CPX A;  4PK2 A;  1P0H A;  4DUK A;  3EO4 A;  3FIX A;  4CYP A;  5CBM A;  1LOK A;  3D7D A;  1YLO A;  5C82 A;  4NF1 A;  5AG6 A;  1CG2 A;  3PP9 A;  3TO9 A;  4XNH C;  2O28 A;  2ZEL A;  4FUU A;  4AVA A;  4H6U A;  4B11 A;  3PEI A;  4JZ0 A;  4U5Y A;  1ARM A;  4XPK A;  4ZX8 A;  3T90 A;  1XBU A;  5J8F A;  1CM0 A;  1XMB A;  4CGP A;  2G9D A;  4FD4 A;  1MJA A;  5DWM A;  3GY9 A;  5THW A;  3BJ7 A;  1XE4 A;  4ZBG A;  3GUX A;  4C2Z A;  3TOB A;  4CYQ A;  4CGO A;  2D4P A;  3PB7 X;  3QAY A;  4JXQ A;  1NSA A;  2J8M A;  2PJ3 A;  4UFX A;  3KQZ A;  1F2P A;  3EFA A;  2GLF A;  3FBU A;  5K8M A;  2PJ6 A;  4KOX A;  2FVG A;  4BBH A;  2J8R A;  3G3S A;  8CPA A;  4G1P A;  2JLM A;  2PRQ A;  4C68 A;  2ABZ A;  2G0B A;  2GE3 A;  5EMI A;  1IY7 A;  3P2H A;  5F47 A;  2NMT A;  2ZEN A;  2FIA A;  2J9A A;  3FF3 A;  4GM5 A;  4U9Z A;  4ZY2 A;  2QML A;  3H4Q A;  2RFH A;  4UIB A;  3PB8 X;  3EXN A;  2DPT A;  4ZGY B;  3PFO A;  4M6H A;  4BMH A;  2HC9 A;  4WJB A;  4B12 A;  5E96 A;  2PJ4 A;  3KAS A;  1BOB A;  1CPS A;  1UWY A;  2H5M A;  4KOR A;  5I0C A;  3F8K A;  4MFZ A;  4HNY B;  5G1Z A;  4TNU A;  4M6G A;  4H89 A;  2V8H A;  4MHD A;  5G21 A;  4NJR A;  4R8F A;  3NH4 A;  4O23 A;  2HQY A;  3MRU A;  4UEE A;  4IF5 A;  4Y49 B;  5K8P A;  2V8G A;  3CDX A;  3KHZ A;  2OR4 A;  2REF A;  4MY3 A;  2BCO A;  3CXS A;  5F46 A;  2QVP A;  4MCQ A;  2ZW4 A;  2WPX A;  1Z9U A;  2VZZ A;  2IL4 A;  4B14 A;  3B35 A;  7CPA A;  3OWC A;  5A27 A;  1PCA A;  2FL4 A;  1BPN A;  1ARL A;  3MGD A;  1YQE A;  5H84 A;  1R3N A;  4CS0 B;  3D68 A;  3IEH A;  4CRZ B;  1PU9 A;  1S7K A;  2G3A A;  2PVV A;  3ISX A;  3W91 A;  1Q2C A;  1ZLI A;  2GU2 A;  1F57 A;  4L8A A;  4UFV A;  3H8E A;  5KTA A;  1Z4E A;  4NGT A;  6CPA A;  1Y7E A;  1CX8 A;  5F49 A;  1QST A;  1KZF A;  1S7L A;  5IX3 A;  5LRK A;  4CGL A;  4F9U A;  4CYN A;  4K30 A;  2ZEE A;  3KQX A;  3CXP A;  3B3S A;  4R3L A;  3V38 A;  4BIN A;  4P4E A;  4LQ6 A;  1XF8 A;  4H2K A;  4B13 A;  4OID A;  4DNC A;  2VEZ A;  2FIW A;  4XPD C;  3R96 A;  3VAT A;  1YR0 A;  2VZY A;  2ZEF A;  4Y49 C;  1MJ9 A;  3PB4 X;  1V0C A;  3DR8 A;  4A38 A;  2B4B A;  3D2P A;  3PB9 X;  4P4I A;  2CNM A;  2FE7 A;  1Q7L A;  2RC4 A;  2BUE A;  4MRI A;  3S6F A;  3BHX A;  3SHP A;  2EK8 A;  1DE4 C;  3WT4 A;  2AFU A;  2ZEM A;  4A30 A;  3H8F A;  2BL1 A;  4GS4 A;  1GYT A;  1JWQ A;  2PJ5 A;  1BAV A;  4OAE A;  1Q2Y A;  4ONU A;  2C6G A;  1QSM A;  2JBK A;  1MJB A;  2O4H A;  1M4L A;  1Y0Y A;  2R1I A;  4NGP A;  2GIV A;  4ZX9 A;  2PIZ A;  4DJL A;  1YRE A;  2EK9 A;  4X5K A;  3W6X A;  3PB6 X;  1YLE A;  3CPA A;  2QJ8 A;  4PPZ A;  2ZEH A;  2GLJ A;  4B5O A;  4OME A;  5D29 A;  4E0A A;  3D8P A;  3FEC A;  3B8G A;  2B3V A;  4NGQ A;  4OC4 A;  2VL1 A;  2PIY A;  4M3S A;  1R57 A;  1QSO A;  2NSM A;  1YW6 A;  1B6B A;  2EO8 A;  2IQ6 A;  4E8O A;  1Q2D A;  1RXT A;  5KTD A;  4YU9 A;  1S60 A;  1IYK A;  3S9L A;  1H8L A;  2BO9 A;  4R7M A;  4HNX B;  4QB9 A;  1TKF A;  4CYO A;  1QMU A;  4HKF A; 
#chains in the Genus database with same CATH homology
 2P6F A;  5AG5 A;  5FVJ A;  2CXA A;  2B58 A;  4MI4 A;  2CNS A;  4R9M A;  5CNP A;  1N71 A;  1MK4 A;  4Q38 A;  3TT2 A;  1L0C A;  4KUB A;  4A2Z A;  4AVB A;  3A9L A;  2Q04 A;  2Z3K A;  3P2F A;  4MFQ A;  1XIX A;  4LX9 A;  3DDD A;  1LRZ A;  2D4O A;  2Z10 A;  3VWE A;  4UCN A;  2OU2 A;  2DPS A;  3QB8 A;  4CAW A;  5G22 A;  1I12 A;  4UCM A;  2PSW A;  1M1D A;  1Y9W A;  2VBQ A;  4B5P B;  2FXF A;  1TIQ A;  2K5T A;  5JPH A;  2EUI A;  1CJW A;  4MFJ A;  4UBR A;  2PRB A;  4QUS A;  3R95 A;  3FNC A;  3NE7 A;  4OAD A;  2Z3P A;  2Q4V A;  3BJ8 A;  4NCZ A;  2CNT A;  4C7I A;  3BLN A;  3LD2 A;  1YK3 A;  2YGW A;  2ZW6 A;  4JJX A;  1S7N A;  3LOD A;  4UFW A;  2FS5 A;  5A28 A;  5AGE A;  3D2M A;  3H5Z A;  3GYA A;  3T9Y A;  3DNS A;  2FT0 A;  2HUZ A;  2JEV A;  2P6E A;  4KOY A;  2ZXV A;  4E2A A;  4J3G A;  1YVK A;  5KTC A;  3TOA A;  1VHS A;  2JDD A;  3D3S A;  3DSB A;  3TCV A;  1NSL A;  2B4D B;  2PR1 A;  3VWD A;  4H6Z A;  3C26 A;  3TE4 A;  5GCN A;  4UWJ A;  2Q0Y A;  4XPL A;  5IV0 A;  1OZP A;  2I00 A;  3JUW A;  3QAH A;  4JLY A;  3CXQ A;  4A95 A;  2PC1 A;  3W6S A;  3KKW A;  2P0W A;  5IB0 A;  2VQY A;  4FD5 A;  5J8C A;  2Z3L A;  5JQ4 A;  2OZU A;  3F5B A;  1BO4 A;  4C7H A;  4UA3 A;  1M4I A;  4F6A A;  3JTK A;  1GHE A;  2JDC A;  3WR7 A;  4OLL A;  4RS2 A;  2P6G A;  4CRY B;  2Q7B A;  4R3K A;  4M85 A;  3IWE A;  4A31 A;  4KS9 A;  3TFY A;  3R9E A;  4QVT A;  4QBJ A;  2Q4Y A;  2B3U A;  4HNW B;  3N7Z A;  2OH1 A;  4MBU A;  2ATR A;  1XMT A;  4KOU A;  4CGM A;  5ISV A;  1RO5 A;  3IGR A;  4JD6 A;  3R9G A;  3JVN A;  4PV6 A;  3ZJ0 A;  5G20 A;  2Z3N A;  3ZZI A;  4KVO E;  2GAN A;  3F0A A;  4U9Y A;  5BWA B;  4A32 A;  4YRH A;  4B5P A;  2QEC A;  4MFK A;  4EVY A;  2PR8 A;  3PGP A;  4I49 A;  2VXK A;  2Z3O A;  1I1D A;  3R9F A;  1WWZ A;  2DXQ A;  4R87 A;  3R1K A;  4C2Y A;  2B5G B;  2OB0 A;  4AG7 A;  1Y7R A;  2Y0M A;  4YFJ A;  4UCP A;  4KVX A;  1PUA A;  2Z11 A;  3TO6 A;  4YGO A;  3I3G A;  3IU2 A;  4KUA A;  5AG4 A;  2R7H A;  4QC6 A;  4CAF A;  4JXR A;  2I79 A;  4LUA A;  4PSW A;  1J4J A;  2HV2 A;  5F48 A;  1QSR A;  2FSR A;  2Z0Z A;  1KUV A;  2OZH A;  4KVM E;  3TO7 A;  3S6G A;  1FY7 A;  1YX0 A;  2ARH A;  1Y9K A;  4PSX A;  4R57 A;  1IB1 E;  4KOS A;  1M4G A;  4F0X A;  3FYN A;  4Q36 A;  3S6K A;  3SXO A;  2B4D A;  2ZW7 A;  1S3Z A;  1IID A;  2ZW5 A;  4AVC A;  4F0Y A;  2FCK A;  3E0K A;  2AJ6 A;  2WSA A;  1WK4 A;  3IWG A;  1YGH A;  2OZG A;  1KUX A;  4AG9 A;  2VI7 A;  1UFH A;  4RI1 A;  4XPD B;  3K9U A;  1NMT A;  2C27 A;  1S5K A;  4B10 A;  3TTH A;  5DWN A;  4CAE A;  4KLV A;  2CY2 A;  3RYO A;  2YNC C;  3PZJ A;  2EVN A;  1QSN A;  3DR6 A;  2R8V A;  5EC4 A;  4FD6 A;  3EC4 A;  1U6M A;  3S6H A;  1ON0 A;  4KZT A;  1S7F A;  4UWI A;  4CAX A;  3FRM A;  4MFP A;  1VKC A;  5EBV A;  2A4N A;  2G3T A;  4A33 A;  2WPW A;  2PQ8 A;  4MFL A;  2J8N A;  2PDO A;  4KLW A;  4MY0 A;  1I21 A;  4NXY A;  3EY5 A;  4KSF A;  4CGN A;  4L89 A;  2QIR A;  2BSW A;  4NEX A;  4C2X A;  4II9 A;  2AE6 A;  3UY5 A;  4CAV A;  3G8W A;  3IU1 A;  1P4N A;  2F5I A;  2REE A;  4JWP A;  4KOV A;  1YVO A;  4XNH B;  1ZO0 A;  3SXN A;  3V8I A;  2YND A;  4FD7 A;  3GKR A;  2WUU A;  4KOW A;  5H86 A;  3I9S A;  3FXT A;  5C88 A;  2B5G A;  5HH1 A;  1M4D A;  1Z4R A;  4PK3 A;  1M44 A;  1XEB A;  4MJ8 A;  1KUY A;  5AG7 A;  2X7B A;  2Z3M A;  4AB7 A;  1K4J A;  4KSA A;  1B87 A;  4NSQ A;  2Q44 A;  2YNE A;  2BEI A;  1IIC A;  5HMN A;  4ORF A;  1IYL A;  1NE9 A;  4KOT A;  2ZPA A;  2YNC A;  1SQH A;  3FB3 A;  4IUS A;  2KCW A;  2R98 A;  4PK2 A;  1P0H A;  3EO4 A;  3FIX A;  4CYP A;  5C82 A;  4NF1 A;  5AG6 A;  3PP9 A;  3TO9 A;  4XNH C;  2O28 A;  4AVA A;  4H6U A;  4B11 A;  4U5Y A;  4XPK A;  3T90 A;  5J8F A;  1CM0 A;  4CGP A;  5DWM A;  4FD4 A;  1MJA A;  3GY9 A;  3BJ7 A;  1XE4 A;  4ZBG A;  4C2Z A;  3TOB A;  4CYQ A;  4CGO A;  2D4P A;  4JXQ A;  2J8M A;  4UFX A;  3EFA A;  3FBU A;  4KOX A;  4BBH A;  2J8R A;  3G3S A;  2JLM A;  4C68 A;  2G0B A;  2GE3 A;  3P2H A;  5F47 A;  2NMT A;  2FIA A;  4U9Z A;  2QML A;  3H4Q A;  3EXN A;  2DPT A;  4ZGY B;  4BMH A;  4B12 A;  5E96 A;  1BOB A;  2H5M A;  5I0C A;  4KOR A;  3F8K A;  4MFZ A;  4HNY B;  5G1Z A;  4H89 A;  4MHD A;  5G21 A;  2HQY A;  4Y49 B;  4IF5 A;  2REF A;  4MY3 A;  3CXS A;  5F46 A;  2ZW4 A;  2WPX A;  1Z9U A;  2VZZ A;  2IL4 A;  4B14 A;  3OWC A;  5A27 A;  2FL4 A;  3MGD A;  5H84 A;  4CS0 B;  4CRZ B;  1PU9 A;  1S7K A;  2G3A A;  3W91 A;  1Q2C A;  4L8A A;  4UFV A;  5KTA A;  1Z4E A;  5F49 A;  1QST A;  1KZF A;  1S7L A;  5IX3 A;  4CGL A;  4CYN A;  4K30 A;  3CXP A;  4R3L A;  1XF8 A;  4B13 A;  4DNC A;  2VEZ A;  2FIW A;  4XPD C;  3R96 A;  1YR0 A;  2VZY A;  4Y49 C;  1MJ9 A;  1V0C A;  3DR8 A;  2B4B A;  3D2P A;  2CNM A;  2FE7 A;  2RC4 A;  2BUE A;  3S6F A;  3SHP A;  4A30 A;  2BL1 A;  4GS4 A;  4OAE A;  1Q2Y A;  4ONU A;  1QSM A;  1MJB A;  2R1I A;  2GIV A;  1YRE A;  4X5K A;  1YLE A;  4B5O A;  4E0A A;  3D8P A;  3B8G A;  2B3V A;  4M3S A;  1R57 A;  1QSO A;  1B6B A;  4E8O A;  1Q2D A;  1RXT A;  5KTD A;  1S60 A;  1IYK A;  4HNX B;  4QB9 A;  4CYO A;  3W6X A;  4HKF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...