3IGRA

The crystal structure of ribosomal-protein-s5-alanine acetyltransferase from vibrio fischeri to 2.0a
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
183
structure length
183
Chain Sequence
DVSFEFEHYQVRLIKSSDAVTIANYFMRNRHHLAPWEPKRSHAFFTPEGWKQRLLQLVELHKHNLAFYFVVVDKNEHKIIGTVSYSNITRFPFHAGHVGYSLDSEYQGKGIMRRAVNVTIDWMFKAQNLHRIMAAYIPRNEKSAKVLAALGFVKEGEAKKYLYINGAWEDHILTSKINDDWKP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ribosomal-protein-S5-alanine N-acetyltransferase
publication title The Crystal Structure of Ribosomal-protein-S5-alanine Acetyltransferase from Vibrio fischeri to 2.0A
rcsb
source organism Vibrio fischeri
molecule tags Transferase
total genus 49
structure length 183
sequence length 183
chains with identical sequence B
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13302 Acetyltransf_3 Acetyltransferase (GNAT) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 3igrA00
2RC4A 4AG9A 2VI7A 1WWZA 2ATRA 3FIXA 5KTDA 3OWCA 5GCNA 4IUSA 3EC4A 1WK4A 3EY5A 1XEBA 4UWJA 2FCKA 2ZW7A 2B3VA 3SXNA 3TT2A 2VZZA 2HUZA 4OADA 2ZXVA 2QECA 3QAHA 4H89A 4KLVA 2H5MA 1I1DA 2R98A 2A4NA 4U9YA 4H6ZA 4LUAA 2Z11A 2JDDA 2DXQA 1KUVA 3EO4A 2KCWA 2REFA 2O28A 4CRZB 2VBQA 2FXFA 2VXKA 1OZPA 2D4PA 4H6UA 2Q4YA 1Y7RA 3TOAA 4B5PA 3RYOA 2R7HA 4JJXA 4FD5A 4QVTA 3QB8A 1L0CA 5F46A 2P0WA 4RS2A 2Q7BA 4E8OA 1Y9KA 2NMTA 1SQHA 3DR6A 4R87A 3R96A 4YGOA 5KTAA 2C27A 3DR8A 1J4JA 4KUAA 5DWMA 4L89A 4HKFA 1PU9A 4L8AA 2JEVA 5C88A 1I21A 4U5YA 1MK4A 2Q4VA 3R9GA 3W6XA 3LD2A 4KOWA 2CNTA 3PZJA 1M4DA 1RXTA 2ZW4A 1IYLA 2QMLA 3TE4A 4NSQA 3T90A 1LRZA 3MGDA 1M4GA 3R95A 4KOXA 4XPDB 5FVJA 5KTCA 4B5OA 4F0YA 2PSWA 1QSTA 4NEXA 2WPWA 5DWNA 4OLLA 4QUSA 1B6BA 3F0AA 4Y49B 3TO6A 4ONUA 1IIDA 2OZHA 1S7LA 2P6FA 1S5KA 2ARHA 4HNXB 2B5GB 2R1IA 4BMHA 3V8IA 3D2MA 2ZW6A 2VZYA 1CJWA 1RO5A 4JLYA 4LX9A 1Q2CA 1S7KA 4PK2A 1QSMA 2GANA 1NSLA 2Q04A 2P6EA 2FSRA 2BL1A 1XF8A 2B58A 5HMNA 1Q2YA 3BJ8A 2B4DB 4R9MA 2BSWA 5JQ4A 4FD7A 5F47A 4M3SA 4AVAA 3S6FA 4UBRA 4DNCA 3PGPA 2GIVA 4R3LA 3TOBA 2REEA 4AG7A 1KUXA 3R9FA 1U6MA 3S6KA 2G3TA 4FD4A 4MHDA 4I49A 4KVXA 3G3SA 4KLWA 3IWGA 4KVME 2F5IA 4MY3A 1GHEA 4E2AA 3GY9A 4KOYA 1XIXA 5IX3A 5I0CA 4QB9A 3FRMA 1XE4A 3F5BA 3TO9A 2Z0ZA 2EUIA 4YFJA 2OB0A 4JWPA 4JXQA 2FIWA 3W91A 5C82A 2OH1A 2Y0MA 3W6SA 3BLNA 3K9UA 4NF1A 3FYNA 2OU2A 4U9ZA 5J8FA 4K30A 5EC4A 1IYKA 2B5GA 4ZBGA 1TIQA 2B4BA 1P0HA 1XMTA 1YVKA 4PV6A 2IL4A 3ZZIA 1R57A 3BJ7A 3JUWA 5CNPA 4F6AA 4YRHA 4AB7A 3EFAA 2J8MA 2OZGA 3IGRA 5ISVA 4RI1A 2FT0A 1Z4EA 2B4DA 3NE7A 3GYAA 4KORA 2FIAA 2X7BA 3F8KA 2K5TA 4KZTA 3S6GA 4KOUA 3CXPA 3FNCA 3LODA 2B3UA 1YLEA 1V0CA 4PSXA 1K4JA 2Q0YA 2BUEA 2JDCA 2Z10A 3R1KA 3P2FA 1ON0A 4JD6A 3TO7A 2I79A 2GE3A 3FBUA 2CNMA 3T9YA 3H4QA 3D8PA 4EVYA 4JXRA 1YGHA 4CS0B 1M4IA 4GS4A 5E96A 2EVNA 4M85A 4KOSA 1QSRA 4PSWA 1YX0A 4QBJA 3G8WA 3C26A 1BO4A 2G3AA 4CRYB 1YK3A 3P2HA 5H86A 4MI4A 1N71A 4AVBA 1Q2DA 1MJBA 3ZJ0A 3DSBA 2PR1A 4HNYB 5EBVA 5F49A 4NXYA 2QIRA 3R9EA 3S6HA 1KZFA 4UWIA 1I12A 3VWDA 2BEIA 1Z9UA 3TCVA 1PUAA 3EXNA 1M1DA 3E0KA 4KVOE 1YVOA 3DDDA 4KUBA 1YR0A 3SXOA 3DNSA 4MJ8A 1M44A 2PRBA 4MY0A 3I9SA 1BOBA 2CNSA 4J3GA 4CAWA 1P4NA 3PP9A 3JVNA 1YREA 4MBUA 2PR8A 4X5KA 1Z4RA 3D3SA 3FB3A 4XPKA 1S7NA 4R57A 5F48A 4XNHC 5IV0A 1MJAA 3FXTA 4PK3A 4FD6A 2D4OA 5J8CA 4HNWB 2FS5A 4XPDC 1KUYA 1B87A 3WR7A 3CXQA 2JLMA 3VWEA 1S7FA 1NE9A 4UA3A 2G0BA 1CM0A 2FL4A 4Y49C 2Q44A 2AJ6A 3N7ZA 4KOTA 2VEZA 1IB1E 4IF5A 4AVCA 4KOVA 4B5PB 3TTHA 1Y9WA 2J8NA 2VQYA 4ORFA 1IICA 4XNHB 4CAXA 4XPLA 1MJ9A 3D2PA 3SHPA 5HH1A 1QSOA 4II9A 2PC1A 2PQ8A 2WPXA 4E0AA 4R3KA 2FE7A 3UY5A 2R8VA 3I3GA 5JPHA 2HV2A 2CY2A 1VHSA 2PDOA 1S60A 1FY7A 2HQYA 1QSNA 1UFHA 3KKWA 3GKRA 5IB0A 2AE6A 2J8RA 2I00A 1S3ZA 3B8GA 4CAVA 3CXSA 2ZPAA 2ZW5A 4QC6A 2OZUA 1VKCA 2P6GA 4OAEA 5H84A 1NMTA 3TFYA 4NCZA
chains in the Genus database with same CATH superfamily
2RC4A 4P45A 2VI7A 1WWZA 2ATRA 4AG9A 4OC2A 3FIXA 2PVWA 3KASA 5KTDA 2PJ0A 4MFKA 3ISZA 4B11A 1ZO0A 3OWCA 5GCNA 4IUSA 3QNVA 4B14A 3EC4A 1WK4A 3EY5A 1XEBA 4MHNA 1ELMP 4UWJA 5K8OA 4A31A 2FCKA 2ZW7A 2B3VA 3SXNA 1OBRA 3TT2A 2VZZA 4P4EA 2GLFA 5LYLA 3FMCA 2HUZA 2CTBA 3B3VA 1F2OA 3B3WA 2Q43A 2V8DA 2ZXVA 4OADA 4ONWA 1EE3P 2QECA 3GLJA 4CGPA 4P4JA 2IMOA 2AFMA 3IFEA 3FVLA 3QAHA 1Y0RA 4H89A 4KLVA 2H5MA 3K9TA 4UFXA 1I1DA 4OP4A 2R98A 2GREA 3KQZA 4KSFA 4UEEA 3SJGA 3WC6A 2A4NA 4U9YA 4H6ZA 4LUAA 2Z11A 2JDDA 2DXQA 4P4BA 2XEJA 4F9VA 1KUVA 3EO4A 2KCWA 1Z8LA 2REFA 2O28A 4MXUA 4P10A 2VBQA 2FXFA 4YWYA 4CRZB 4F0XA 4F8ZA 2VXKA 1OZPA 5ELYA 3RZAA 4B10A 2D4PA 4H2KA 4H6UA 3B7IA 2GLJA 1Y7RA 1RTQA 2PJ1A 2Q4YA 5LYDA 3TOAA 4C2ZA 4X2TA 1M4LA 4B5PA 4CYOA 3RYOA 2R7HA 3JRUA 4UCNA 3SI1A 4CGMA 4JJXA 4FD5A 4QVTA 3QB8A 2WSAA 1L0CA 2O53A 3PB4X 5F46A 1YSJA 2RB7A 2P0WA 4RS2A 4UEZA 2FVGA 4RN7A 2Q7BA 4E8OA 1YQEA 1Y0YA 1YW4A 1Y9KA 3CPXA 3KGQA 3S9NA 4MCPA 1ZLIA 2NMTA 3CT9A 1SQHA 3DR6A 4R87A 3R96A 4YGOA 5KTAA 2C27A 3NFZA 3DR8A 4EWTA 2C6GA 3KI9A 1J4JA 4KUAA 4NGPA 2ODFA 5DWMA 4L89A 4EFDA 4HKFA 1PU9A 4L8AA 1ELLP 2JEVA 5C88A 4NGNA 5A27A 3LMSA 2ZEDA 3HLPA 4Q38A 2ZOFA 1I21A 2PJ9A 4CAEA 4U5YA 5LYFA 3MRUA 1MK4A 2Q4VA 2YNDA 3R9GA 3LD2A 3W6XA 8CPAA 5A28A 4KOWA 2CNTA 3PZJA 3DGVA 1M4DA 3S9LA 1RXTA 2JBKA 2ZW4A 5LRJA 7CPAA 4PXDA 4P4FA 4UCPA 2BO9A 1IYLA 2QMLA 4C2XA 4NGMA 3TE4A 4NSQA 5G21A 2XEIA 3T90A 1LRZA 3MGDA 1M4GA 3R95A 4KOXA 3BI0A 3NA6A 4CGLA 4XPDB 5FVJA 2AFWA 4A2ZA 5KTCA 4B5OA 5LRGA 4F0YA 2PSWA 1QSTA 4NEXA 2WPWA 5DWNA 4OLLA 2V8HA 4DUKA 4MFQA 4QUSA 1B6BA 5HXDA 1NSAA 3F0AA 4Y49B 3TO6A 4ONUA 3NH5A 1IIDA 2OZHA 1PYTB 1S7LA 2AFOA 1CPXA 2P6FA 1S5KA 2QVPA 2ARHA 4PXCA 4HNXB 3IIBA 2B5GB 3RBUA 3KR4A 2R1IA 3FF3A 4BMHA 3V8IA 2Q7SA 3PFOA 4ZGYB 5K8NA 3D2MA 2Z3PA 2PJBA 2ZW6A 4ZX9A 2VZYA 1CJWA 1RO5A 2DEAA 4JLYA 4Q7AA 1LAPA 3TC8A 4LX9A 4DYOA 5CBMA 1VHEA 1Q2CA 2XEFA 4PQAA 1S7KA 2V8VA 3VARA 4FUUA 3PBBA 1ZG9A 1YMEA 1ZG8A 4MFLA 1QSMA 4PK2A 2DPSA 4MCSA 4P4IA 4CYNA 2GANA 1NSLA 4GM5A 3TX8A 2PJCA 3D66A 2Q04A 2P6EA 3MN8A 2OOTA 1R3NA 2FSRA 2BL1A 1XF8A 4X3RA 2B58A 5HMNA 1Q2YA 4X8IA 3BJ8A 3D7FA 4Q36A 3KZWA 4ZYQA 1TKFA 2B4DB 4R9MA 2Z3LA 1X12A 2BSWA 5JQ4A 2ZENA 4FD7A 2PJ6A 5LYIA 1TF8A 2YNCC 3D7HA 5F47A 4M3SA 4CYQA 4TWEA 4AVAA 3PRTA 3B3SA 4O23A 3FJUA 3S6FA 4UBRA 4DNCA 3PGPA 3V7ZA 2GIVA 2DPTA 4R3LA 4B12A 3TOBA 2REEA 4BBHA 4AG7A 1ZLHA 1KUXA 1F57A 2PJ4A 3PFEA 4K3NA 3R9FA 1U6MA 3S6KA 2G3TA 1IGBA 4ZY1A 1CBXA 4FD4A 4UCMA 3H5ZA 4MHDA 2QYVA 4I49A 4KVXA 1XJOA 3G3SA 3IO1A 4KLWA 3SI0A 3IWGA 4KVME 3RAMA 2F5IA 4MY3A 1GHEA 3WC7A 4E2AA 1Z2LA 3GY9A 2Z3KA 4P6YA 4KOYA 1XIXA 4OC0A 2ZEEA 1YLOA 5IX3A 1DTDA 3PBEA 1Z5RA 3RO0A 5I0CA 2C6CA 4QB9A 4R8FA 4C7HA 3ISXA 3FRMA 3BHXA 1XE4A 3GIUA 5AG6A 5G1ZA 4YU9A 3F5BA 3TO9A 4NGTA 2Z0ZA 2EUIA 2Q4ZA 2Z3OA 4EMEA 2C6PA 4YFJA 1TXRA 3SJEA 2OB0A 1TKHA 5JM6A 1Y7EA 2CXAA 4JWPA 4JXQA 2FIWA 3W91A 3H8GA 5C82A 2PIYA 4R6TA 4F9UA 5HVFA 1Q7LA 1QQ9A 1XFOA 4LQGA 2OH1A 1LFWA 4A32A 3B2YA 4UFVA 4RUHA 2Y0MA 3W6SA 3BLNA 4PXEA 3K9UA 4OC4A 4G1PA 1IY7A 3LACA 4NF1A 4NGRA 3FYNA 2OU2A 2OR4A 4FAIA 4U9ZA 5J8FA 4K30A 5EC4A 1IYKA 2Z3MA 2B5GA 4ZBGA 1TIQA 1F2PA 2B4BA 1P0HA 1XMTA 3KHXA 1YVKA 4MCRA 2PIZA 3KQXA 4OIWA 4PV6A 3RNZA 5D8NA 4A39A 3FEDA 4NFRA 2IL4A 3ZZIA 4P44A 1R57A 5AGEA 3BJ7A 1YW6A 3D68A 2QJ8A 3JUWA 4NJQA 4PXBA 1XMBA 1AMPA 5CNPA 1LCPA 4F6AA 4YRHA 4B6ZA 4IHMA 3IC1A 4A37A 3D67A 3EFAA 4UF4A 2C1CA 2EO8A 3D7GA 4MMOA 4AB7A 2J8MA 2OZGA 3IGRA 3KHZA 5ISVA 4OMEA 2BOAA 4RI1A 4NGSA 3IJ3A 1TF9A 1VHOA 2FT0A 2WYRA 1Z4EA 5EMIA 2B4DA 3JTKA 1JWQA 3NE7A 3CDXA 3GYAA 4KORA 2FIAA 1IU8A 2X7BA 1XBUA 3F8KA 2K5TA 4KZTA 3S6GA 4AXVA 4C2YA 4KOUA 2NYQA 4HPSA 4LQ6A 3CXPA 3HUVA 1X10A 3FNCA 3LODA 3VATA 2B3UA 1LOKA 3QAYA 1YLEA 2CTCA 1V0CA 2PJ7A 4PSXA 1K4JA 4MFJA 1FT7A 2Q0YA 2BUEA 2J9AA 4TNUA 5F09A 2JDCA 2PJ8A 1ARMA 2Z10A 3KL9A 3WT4A 4DJLA 3R1KA 2GFQA 2WUUA 3P2FA 4NJRA 4BD9A 1ON0A 3FX6A 4JD6A 5G22A 4R76A 3TO7A 2I79A 2GE3A 3FBUA 2PJ2A 2CNMA 3T9YA 3H4QA 2PJ5A 3D8PA 1XOVA 4EVYA 4JXRA 1YGHA 5HVGA 5J1QA 1BLLE 2YNCA 4CS0B 3H8EA 2RFHA 1VGYA 1M4IA 2CF4A 2F8HA 4GS4A 5E96A 4ZX8A 2EVNA 4M85A 4KOSA 1KWMA 1QSRA 2EK8A 2YNEA 4PSWA 3WC5A 1YX0A 2V8GA 4ZY0A 4QBJA 3G8WA 3C26A 1BO4A 2G3AA 4CRYB 4P4DA 4A33A 3N5FA 1YK3A 5D29A 4CPAA 3BXMA 1HDUA 3P2HA 5JH9A 5AG4A 5H86A 3NH8A 4MI4A 1N71A 4FWUA 4GXHA 4AVBA 1MJBA 1Q2DA 1LAMA 2EK9A 2V77A 2AFZA 3ZJ0A 3DSBA 2PR1A 2AFXA 4HNYB 2ZEMA 5EBVA 5F49A 4NXYA 5LRKA 2QIRA 3R9EA 2AFSA 1CX8A 3S6HA 6CPAA 3I1UA 4CGOA 1KZFA 2JBJA 4UWIA 2ZEOA 3LWUA 1I12A 5I4MA 3VWDA 1GYTA 2BEIA 1Z9UA 2XEGA 3TCVA 3VH9A 1PUAA 3EXNA 5DS0A 2BCOA 1IOFA 1M1DA 3E0KA 4KVOE 5G20A 1CG2A 1YVOA 4IAVA 3DDDA 2GU2A 3PB6X 3S9MA 5THWA 1IOIA 4MFPA 4CYPA 4ZI6A 4KSAA 2PJAA 3IU1A 4KUBA 1YR0A 3SXOA 3DNSA 3WABA 4R7MA 2POKA 2DF5A 1Z8TA 2ANPA 3IWWA 4M6IA 4MJ8A 1M44A 5IB9A 2Q51A 2ZOGA 2PRBA 4MY0A 3I9SA 1ZG7A 1BOBA 4OC3A 2CNSA 3NE8A 2I3CA 4J3GA 4CAWA 3SI2A 1P4NA 3PP9A 2ZEFA 1DE4C 5BWAB 3JVNA 1YREA 4CAFA 4A95A 1PCAA 3CZXA 4A94A 1Z8WA 1LANA 4MBUA 2YGWA 2PR8A 4X5KA 1Z4RA 3NH4A 2F7VA 3D3SA 3FB3A 4UFWA 4UIBA 4XPKA 1S7NA 3PB9X 4R57A 4C68A 4A38A 1ARLA 1HEEA 3B35A 5F48A 1BPNA 4XNHC 4OKOA 1MJAA 4A30A 5IV0A 3D4UA 3FXTA 4PK3A 4UIAA 4FD6A 2D4OA 2PRQA 2PVVA 4KS9A 5AG5A 4B13A 4MHYA 2EBJA 2FS5A 4HNWB 3T8WA 4M6HA 4XPDC 4Z65A 1KUYA 4CGNA 4IK2A 4OC5A 1B87A 4BINA 2WZNA 1JQGA 2JLMA 3CXQA 1HDQA 4W9YA 3VWEA 3WR7A 1AYEA 4WJBA 3L2NA 1S7FA 3SJFA 1NE9A 4PPZA 4UA3A 2G0BA 1BAVA 1CM0A 2FL4A 2G9DA 3A9LA 3IU2A 4Y49C 2Q44A 4MHZA 2AJ6A 4FBEA 1TKJA 3N7ZA 2IJZA 4KOTA 2VEZA 1IB1E 4IF5A 1H8LA 4NGQA 1FNOA 2ZELA 4AVCA 4KOVA 4B5PB 2ZEHA 3TTHA 1Y9WA 2J8NA 2VQYA 3FH4A 3B3TA 4ORFA 2HC9A 1CP6A 1IICA 4XNHB 1VIXA 2ABZA 5K8MA 4OIDA 1CP7A 5J8CA 4MCQA 4CAXA 4XPLA 1MJ9A 3D2PA 5AG7A 3FECA 3IWEA 3SHPA 5HH1A 2IQ6A 1QSOA 2Z3NA 3SJXA 1AUGA 4JZ0A 4II9A 2ZEPA 5JGFA 2PC1A 2PQ8A 2WPXA 1UWYA 2PE3A 4E0AA 1CPSA 4R3KA 2FE7A 2PCUA 3UY5A 3KR5A 2O4HA 1Z8XA 3CPAA 2R8VA 3I3GA 4KSIA 2HB6A 4WWVA 5JPHA 3IEHA 2HV2A 1QMUA 2PJ3A 3H8FA 3K2KA 4MHPA 1XRYA 3FEEA 2CY2A 1VHSA 2PDOA 1S60A 1FY7A 2VL1A 2ZEGA 2EWBA 4C7IA 2HQYA 1QSNA 4ZY2A 4MFZA 1UFHA 3KKWA 3V38A 3GKRA 5IB0A 2AE6A 3B3CA 3GUXA 3GB0A 2J8RA 3PEIA 3DLJA 2I00A 5HVHA 1S3ZA 3B8GA 4CAVA 3CXSA 3PB8X 4UEFA 2ZPAA 2ZW5A 4QC6A 2OZUA 4JYWA 3PB7X 1VKCA 2P6GA 2CIJA 4OAEA 3D7DA 1R43A 3BI1A 5CPAA 4M6GA 2NSMA 5K8PA 2JEWA 5H84A 1NMTA 4OC1A 1BPMA 2AFUA 1A2ZA 3TFYA 4MRIA 4NCZA
chains in the Genus database with same CATH topology
2RC4A 4AG9A 2VI7A 1WWZA 2ATRA 3FIXA 5KTDA 4MFKA 4B11A 1ZO0A 3OWCA 5GCNA 4IUSA 4B14A 3EC4A 1WK4A 3EY5A 1XEBA 4UWJA 4A31A 2FCKA 2ZW7A 2B3VA 3SXNA 3TT2A 2VZZA 2HUZA 4OADA 2ZXVA 4CGPA 2QECA 3QAHA 4H89A 4KLVA 2H5MA 4UFXA 1I1DA 2R98A 4KSFA 2A4NA 4U9YA 4H6ZA 4LUAA 2Z11A 2JDDA 2DXQA 1KUVA 3EO4A 2KCWA 2REFA 2O28A 4CRZB 2VBQA 2FXFA 4F0XA 2VXKA 1OZPA 4B10A 2D4PA 4H6UA 2Q4YA 1Y7RA 3TOAA 4C2ZA 4B5PA 4CYOA 3RYOA 2R7HA 4UCNA 4CGMA 4JJXA 4FD5A 4QVTA 3QB8A 2WSAA 1L0CA 5F46A 2P0WA 4RS2A 2Q7BA 4E8OA 1Y9KA 2NMTA 1SQHA 3DR6A 4R87A 3R96A 4YGOA 5KTAA 2C27A 3DR8A 1J4JA 4KUAA 5DWMA 4L89A 4HKFA 1PU9A 4L8AA 2JEVA 5C88A 5A27A 4Q38A 4CAEA 1I21A 4U5YA 1MK4A 2Q4VA 2YNDA 3R9GA 3LD2A 3W6XA 5A28A 4KOWA 2CNTA 3PZJA 1M4DA 1RXTA 2ZW4A 4UCPA 1IYLA 2QMLA 4C2XA 3TE4A 4NSQA 5G21A 3T90A 1LRZA 3MGDA 1M4GA 3R95A 4KOXA 4CGLA 4XPDB 5FVJA 4A2ZA 5KTCA 4B5OA 4F0YA 2PSWA 1QSTA 4NEXA 2WPWA 5DWNA 4OLLA 4MFQA 4QUSA 1B6BA 3F0AA 4Y49B 3TO6A 4ONUA 1IIDA 2OZHA 1S7LA 2P6FA 1S5KA 2ARHA 4HNXB 2B5GB 2R1IA 4BMHA 3V8IA 4ZGYB 3D2MA 2Z3PA 2ZW6A 2VZYA 1CJWA 1RO5A 4JLYA 4LX9A 1Q2CA 1S7KA 4PK2A 4MFLA 1QSMA 2DPSA 4CYNA 2GANA 1NSLA 2Q04A 2P6EA 2FSRA 2BL1A 1XF8A 2B58A 5HMNA 1Q2YA 3BJ8A 4Q36A 2B4DB 4R9MA 2Z3LA 2BSWA 5JQ4A 4FD7A 2YNCC 5F47A 4M3SA 4CYQA 4AVAA 3S6FA 4UBRA 4DNCA 3PGPA 2GIVA 2DPTA 4R3LA 4B12A 3TOBA 2REEA 4BBHA 4AG7A 1KUXA 3R9FA 1U6MA 3S6KA 2G3TA 4FD4A 4UCMA 3H5ZA 4MHDA 4I49A 4KVXA 3G3SA 4KLWA 3IWGA 4KVME 2F5IA 4MY3A 1GHEA 4E2AA 3GY9A 2Z3KA 4KOYA 1XIXA 5IX3A 5I0CA 4QB9A 4C7HA 3FRMA 1XE4A 5AG6A 5G1ZA 3F5BA 3TO9A 2Z0ZA 2EUIA 2Z3OA 4YFJA 2OB0A 2CXAA 4JWPA 4JXQA 2FIWA 3W91A 5C82A 2OH1A 4A32A 4UFVA 2Y0MA 3W6SA 3BLNA 3K9UA 4NF1A 3FYNA 2OU2A 4U9ZA 5J8FA 4K30A 5EC4A 1IYKA 2Z3MA 2B5GA 4ZBGA 1TIQA 2B4BA 1P0HA 1XMTA 1YVKA 4PV6A 2IL4A 3ZZIA 1R57A 5AGEA 3BJ7A 3JUWA 5CNPA 4F6AA 4YRHA 4AB7A 3EFAA 2J8MA 2OZGA 3IGRA 5ISVA 4RI1A 2FT0A 1Z4EA 2B4DA 3JTKA 3NE7A 3GYAA 4KORA 2FIAA 2X7BA 3F8KA 2K5TA 4KZTA 3S6GA 4C2YA 4KOUA 3CXPA 3FNCA 3LODA 2B3UA 1YLEA 1V0CA 4PSXA 1K4JA 4MFJA 2Q0YA 2BUEA 2JDCA 2Z10A 3R1KA 2WUUA 3P2FA 1ON0A 4JD6A 5G22A 3TO7A 2I79A 2GE3A 3FBUA 2CNMA 3T9YA 3H4QA 3D8PA 4EVYA 4JXRA 1YGHA 2YNCA 4CS0B 1M4IA 4GS4A 5E96A 2EVNA 4M85A 4KOSA 1QSRA 2YNEA 4PSWA 1YX0A 4QBJA 3G8WA 3C26A 1BO4A 2G3AA 4CRYB 4A33A 1YK3A 3P2HA 5AG4A 5H86A 4MI4A 1N71A 4AVBA 1Q2DA 1MJBA 3ZJ0A 3DSBA 2PR1A 4HNYB 5EBVA 5F49A 4NXYA 2QIRA 3R9EA 3S6HA 4CGOA 1KZFA 4UWIA 1I12A 3VWDA 2BEIA 1Z9UA 3TCVA 1PUAA 3EXNA 1M1DA 3E0KA 4KVOE 5G20A 1YVOA 3DDDA 4CYPA 4MFPA 4KSAA 3IU1A 4KUBA 1YR0A 3SXOA 3DNSA 4MJ8A 1M44A 2PRBA 4MY0A 3I9SA 1BOBA 2CNSA 4J3GA 4CAWA 1P4NA 3PP9A 5BWAB 3JVNA 1YREA 4CAFA 4A95A 4MBUA 2YGWA 2PR8A 4X5KA 1Z4RA 3D3SA 3FB3A 4UFWA 4XPKA 4C68A 1S7NA 4R57A 5F48A 4XNHC 5IV0A 4A30A 1MJAA 3FXTA 4PK3A 4FD6A 2D4OA 4KS9A 5AG5A 4B13A 5J8CA 4HNWB 2FS5A 4XPDC 1KUYA 4CGNA 1B87A 3WR7A 3CXQA 2JLMA 3VWEA 1S7FA 1NE9A 4UA3A 2G0BA 1CM0A 2FL4A 3IU2A 3A9LA 4Y49C 2Q44A 2AJ6A 3N7ZA 4KOTA 2VEZA 1IB1E 4IF5A 4AVCA 4KOVA 4B5PB 3TTHA 1Y9WA 2J8NA 2VQYA 4ORFA 1IICA 4XNHB 4CAXA 4XPLA 1MJ9A 3D2PA 5AG7A 3IWEA 3SHPA 5HH1A 1QSOA 2Z3NA 4II9A 2PC1A 2PQ8A 2WPXA 4E0AA 4R3KA 2FE7A 3UY5A 2R8VA 3I3GA 5JPHA 2HV2A 2CY2A 1VHSA 2PDOA 1S60A 1FY7A 4C7IA 2HQYA 1QSNA 4MFZA 1UFHA 3KKWA 3GKRA 5IB0A 2AE6A 2J8RA 2I00A 1S3ZA 3B8GA 4CAVA 3CXSA 2ZPAA 2ZW5A 4QC6A 2OZUA 1VKCA 2P6GA 4OAEA 5H84A 1NMTA 3TFYA 4NCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RC4 A;  4AG9 A;  2VI7 A;  1WWZ A;  2ATR A;  3FIX A;  5KTD A;  3OWC A;  5GCN A;  4IUS A;  3EC4 A;  1WK4 A;  3EY5 A;  1XEB A;  4UWJ A;  2FCK A;  2ZW7 A;  2B3V A;  3SXN A;  3TT2 A;  2VZZ A;  2HUZ A;  4OAD A;  2ZXV A;  2QEC A;  3QAH A;  4H89 A;  4KLV A;  2H5M A;  1I1D A;  2R98 A;  2A4N A;  4U9Y A;  4H6Z A;  4LUA A;  2Z11 A;  2JDD A;  2DXQ A;  1KUV A;  3EO4 A;  2KCW A;  2REF A;  2O28 A;  4CRZ B;  2VBQ A;  2FXF A;  2VXK A;  1OZP A;  2D4P A;  4H6U A;  2Q4Y A;  1Y7R A;  3TOA A;  4B5P A;  3RYO A;  2R7H A;  4JJX A;  4FD5 A;  4QVT A;  3QB8 A;  1L0C A;  5F46 A;  2P0W A;  4RS2 A;  2Q7B A;  4E8O A;  1Y9K A;  2NMT A;  1SQH A;  3DR6 A;  4R87 A;  3R96 A;  4YGO A;  5KTA A;  2C27 A;  3DR8 A;  1J4J A;  4KUA A;  5DWM A;  4L89 A;  4HKF A;  1PU9 A;  4L8A A;  2JEV A;  5C88 A;  1I21 A;  4U5Y A;  1MK4 A;  2Q4V A;  3R9G A;  3W6X A;  3LD2 A;  4KOW A;  2CNT A;  3PZJ A;  1M4D A;  1RXT A;  2ZW4 A;  1IYL A;  2QML A;  3TE4 A;  4NSQ A;  3T90 A;  1LRZ A;  3MGD A;  1M4G A;  3R95 A;  4KOX A;  4XPD B;  5FVJ A;  5KTC A;  4B5O A;  4F0Y A;  2PSW A;  1QST A;  4NEX A;  2WPW A;  5DWN A;  4OLL A;  4QUS A;  1B6B A;  3F0A A;  4Y49 B;  3TO6 A;  4ONU A;  1IID A;  2OZH A;  1S7L A;  2P6F A;  1S5K A;  2ARH A;  4HNX B;  2B5G B;  2R1I A;  4BMH A;  3V8I A;  3D2M A;  2ZW6 A;  2VZY A;  1CJW A;  1RO5 A;  4JLY A;  4LX9 A;  1Q2C A;  1S7K A;  4PK2 A;  1QSM A;  2GAN A;  1NSL A;  2Q04 A;  2P6E A;  2FSR A;  2BL1 A;  1XF8 A;  2B58 A;  5HMN A;  1Q2Y A;  3BJ8 A;  2B4D B;  4R9M A;  2BSW A;  5JQ4 A;  4FD7 A;  5F47 A;  4M3S A;  4AVA A;  3S6F A;  4UBR A;  4DNC A;  3PGP A;  2GIV A;  4R3L A;  3TOB A;  2REE A;  4AG7 A;  1KUX A;  3R9F A;  1U6M A;  3S6K A;  2G3T A;  4FD4 A;  4MHD A;  4I49 A;  4KVX A;  3G3S A;  4KLW A;  3IWG A;  4KVM E;  2F5I A;  4MY3 A;  1GHE A;  4E2A A;  3GY9 A;  4KOY A;  1XIX A;  5IX3 A;  5I0C A;  4QB9 A;  3FRM A;  1XE4 A;  3F5B A;  3TO9 A;  2Z0Z A;  2EUI A;  4YFJ A;  2OB0 A;  4JWP A;  4JXQ A;  2FIW A;  3W91 A;  5C82 A;  2OH1 A;  2Y0M A;  3W6S A;  3BLN A;  3K9U A;  4NF1 A;  3FYN A;  2OU2 A;  4U9Z A;  5J8F A;  4K30 A;  5EC4 A;  1IYK A;  2B5G A;  4ZBG A;  1TIQ A;  2B4B A;  1P0H A;  1XMT A;  1YVK A;  4PV6 A;  2IL4 A;  3ZZI A;  1R57 A;  3BJ7 A;  3JUW A;  5CNP A;  4F6A A;  4YRH A;  4AB7 A;  3EFA A;  2J8M A;  2OZG A;  3IGR A;  5ISV A;  4RI1 A;  2FT0 A;  1Z4E A;  2B4D A;  3NE7 A;  3GYA A;  4KOR A;  2FIA A;  2X7B A;  3F8K A;  2K5T A;  4KZT A;  3S6G A;  4KOU A;  3CXP A;  3FNC A;  3LOD A;  2B3U A;  1YLE A;  1V0C A;  4PSX A;  1K4J A;  2Q0Y A;  2BUE A;  2JDC A;  2Z10 A;  3R1K A;  3P2F A;  1ON0 A;  4JD6 A;  3TO7 A;  2I79 A;  2GE3 A;  3FBU A;  2CNM A;  3T9Y A;  3H4Q A;  3D8P A;  4EVY A;  4JXR A;  1YGH A;  4CS0 B;  1M4I A;  4GS4 A;  5E96 A;  2EVN A;  4M85 A;  4KOS A;  1QSR A;  4PSW A;  1YX0 A;  4QBJ A;  3G8W A;  3C26 A;  1BO4 A;  2G3A A;  4CRY B;  1YK3 A;  3P2H A;  5H86 A;  4MI4 A;  1N71 A;  4AVB A;  1Q2D A;  1MJB A;  3ZJ0 A;  3DSB A;  2PR1 A;  4HNY B;  5EBV A;  5F49 A;  4NXY A;  2QIR A;  3R9E A;  3S6H A;  1KZF A;  4UWI A;  1I12 A;  3VWD A;  2BEI A;  1Z9U A;  3TCV A;  1PUA A;  3EXN A;  1M1D A;  3E0K A;  4KVO E;  1YVO A;  3DDD A;  4KUB A;  1YR0 A;  3SXO A;  3DNS A;  4MJ8 A;  1M44 A;  2PRB A;  4MY0 A;  3I9S A;  1BOB A;  2CNS A;  4J3G A;  4CAW A;  1P4N A;  3PP9 A;  3JVN A;  1YRE A;  4MBU A;  2PR8 A;  4X5K A;  1Z4R A;  3D3S A;  3FB3 A;  4XPK A;  1S7N A;  4R57 A;  5F48 A;  4XNH C;  5IV0 A;  1MJA A;  3FXT A;  4PK3 A;  4FD6 A;  2D4O A;  5J8C A;  4HNW B;  2FS5 A;  4XPD C;  1KUY A;  1B87 A;  3WR7 A;  3CXQ A;  2JLM A;  3VWE A;  1S7F A;  1NE9 A;  4UA3 A;  2G0B A;  1CM0 A;  2FL4 A;  4Y49 C;  2Q44 A;  2AJ6 A;  3N7Z A;  4KOT A;  2VEZ A;  1IB1 E;  4IF5 A;  4AVC A;  4KOV A;  4B5P B;  3TTH A;  1Y9W A;  2J8N A;  2VQY A;  4ORF A;  1IIC A;  4XNH B;  4CAX A;  4XPL A;  1MJ9 A;  3D2P A;  3SHP A;  5HH1 A;  1QSO A;  4II9 A;  2PC1 A;  2PQ8 A;  2WPX A;  4E0A A;  4R3K A;  2FE7 A;  3UY5 A;  2R8V A;  3I3G A;  5JPH A;  2HV2 A;  2CY2 A;  1VHS A;  2PDO A;  1S60 A;  1FY7 A;  2HQY A;  1QSN A;  1UFH A;  3KKW A;  3GKR A;  5IB0 A;  2AE6 A;  2J8R A;  2I00 A;  1S3Z A;  3B8G A;  4CAV A;  3CXS A;  2ZPA A;  2ZW5 A;  4QC6 A;  2OZU A;  1VKC A;  2P6G A;  4OAE A;  5H84 A;  1NMT A;  3TFY A;  4NCZ A; 
#chains in the Genus database with same CATH topology
 2RC4 A;  4P45 A;  2VI7 A;  1WWZ A;  2ATR A;  4AG9 A;  4OC2 A;  3FIX A;  2PVW A;  3KAS A;  5KTD A;  2PJ0 A;  4MFK A;  3ISZ A;  4B11 A;  1ZO0 A;  3OWC A;  5GCN A;  4IUS A;  3QNV A;  4B14 A;  3EC4 A;  1WK4 A;  3EY5 A;  1XEB A;  4MHN A;  1ELM P;  4UWJ A;  5K8O A;  4A31 A;  2FCK A;  2ZW7 A;  2B3V A;  3SXN A;  1OBR A;  3TT2 A;  2VZZ A;  4P4E A;  2GLF A;  5LYL A;  3FMC A;  2HUZ A;  2CTB A;  3B3V A;  1F2O A;  3B3W A;  2Q43 A;  2V8D A;  2ZXV A;  4OAD A;  4ONW A;  1EE3 P;  2QEC A;  3GLJ A;  4CGP A;  4P4J A;  2IMO A;  2AFM A;  3IFE A;  3FVL A;  3QAH A;  1Y0R A;  4H89 A;  4KLV A;  2H5M A;  3K9T A;  4UFX A;  1I1D A;  4OP4 A;  2R98 A;  2GRE A;  3KQZ A;  4KSF A;  4UEE A;  3SJG A;  3WC6 A;  2A4N A;  4U9Y A;  4H6Z A;  4LUA A;  2Z11 A;  2JDD A;  2DXQ A;  4P4B A;  2XEJ A;  4F9V A;  1KUV A;  3EO4 A;  2KCW A;  1Z8L A;  2REF A;  2O28 A;  4MXU A;  4P10 A;  2VBQ A;  2FXF A;  4YWY A;  4CRZ B;  4F0X A;  4F8Z A;  2VXK A;  1OZP A;  5ELY A;  3RZA A;  4B10 A;  2D4P A;  4H2K A;  4H6U A;  3B7I A;  2GLJ A;  1Y7R A;  1RTQ A;  2PJ1 A;  2Q4Y A;  5LYD A;  3TOA A;  4C2Z A;  4X2T A;  1M4L A;  4B5P A;  4CYO A;  3RYO A;  2R7H A;  3JRU A;  4UCN A;  3SI1 A;  4CGM A;  4JJX A;  4FD5 A;  4QVT A;  3QB8 A;  2WSA A;  1L0C A;  2O53 A;  3PB4 X;  5F46 A;  1YSJ A;  2RB7 A;  2P0W A;  4RS2 A;  4UEZ A;  2FVG A;  4RN7 A;  2Q7B A;  4E8O A;  1YQE A;  1Y0Y A;  1YW4 A;  1Y9K A;  3CPX A;  3KGQ A;  3S9N A;  4MCP A;  1ZLI A;  2NMT A;  3CT9 A;  1SQH A;  3DR6 A;  4R87 A;  3R96 A;  4YGO A;  5KTA A;  2C27 A;  3NFZ A;  3DR8 A;  4EWT A;  2C6G A;  3KI9 A;  1J4J A;  4KUA A;  4NGP A;  2ODF A;  5DWM A;  4L89 A;  4EFD A;  4HKF A;  1PU9 A;  4L8A A;  1ELL P;  2JEV A;  5C88 A;  4NGN A;  5A27 A;  3LMS A;  2ZED A;  3HLP A;  4Q38 A;  2ZOF A;  1I21 A;  2PJ9 A;  4CAE A;  4U5Y A;  5LYF A;  3MRU A;  1MK4 A;  2Q4V A;  2YND A;  3R9G A;  3LD2 A;  3W6X A;  8CPA A;  5A28 A;  4KOW A;  2CNT A;  3PZJ A;  3DGV A;  1M4D A;  3S9L A;  1RXT A;  2JBK A;  2ZW4 A;  5LRJ A;  7CPA A;  4PXD A;  4P4F A;  4UCP A;  2BO9 A;  1IYL A;  2QML A;  4C2X A;  4NGM A;  3TE4 A;  4NSQ A;  5G21 A;  2XEI A;  3T90 A;  1LRZ A;  3MGD A;  1M4G A;  3R95 A;  4KOX A;  3BI0 A;  3NA6 A;  4CGL A;  4XPD B;  5FVJ A;  2AFW A;  4A2Z A;  5KTC A;  4B5O A;  5LRG A;  4F0Y A;  2PSW A;  1QST A;  4NEX A;  2WPW A;  5DWN A;  4OLL A;  2V8H A;  4DUK A;  4MFQ A;  4QUS A;  1B6B A;  5HXD A;  1NSA A;  3F0A A;  4Y49 B;  3TO6 A;  4ONU A;  3NH5 A;  1IID A;  2OZH A;  1PYT B;  1S7L A;  2AFO A;  1CPX A;  2P6F A;  1S5K A;  2QVP A;  2ARH A;  4PXC A;  4HNX B;  3IIB A;  2B5G B;  3RBU A;  3KR4 A;  2R1I A;  3FF3 A;  4BMH A;  3V8I A;  2Q7S A;  3PFO A;  4ZGY B;  5K8N A;  3D2M A;  2Z3P A;  2PJB A;  2ZW6 A;  4ZX9 A;  2VZY A;  1CJW A;  1RO5 A;  2DEA A;  4JLY A;  4Q7A A;  1LAP A;  3TC8 A;  4LX9 A;  4DYO A;  5CBM A;  1VHE A;  1Q2C A;  2XEF A;  4PQA A;  1S7K A;  2V8V A;  3VAR A;  4FUU A;  3PBB A;  1ZG9 A;  1YME A;  1ZG8 A;  4MFL A;  1QSM A;  4PK2 A;  2DPS A;  4MCS A;  4P4I A;  4CYN A;  2GAN A;  1NSL A;  4GM5 A;  3TX8 A;  2PJC A;  3D66 A;  2Q04 A;  2P6E A;  3MN8 A;  2OOT A;  1R3N A;  2FSR A;  2BL1 A;  1XF8 A;  4X3R A;  2B58 A;  5HMN A;  1Q2Y A;  4X8I A;  3BJ8 A;  3D7F A;  4Q36 A;  3KZW A;  4ZYQ A;  1TKF A;  2B4D B;  4R9M A;  2Z3L A;  1X12 A;  2BSW A;  5JQ4 A;  2ZEN A;  4FD7 A;  2PJ6 A;  5LYI A;  1TF8 A;  2YNC C;  3D7H A;  5F47 A;  4M3S A;  4CYQ A;  4TWE A;  4AVA A;  3PRT A;  3B3S A;  4O23 A;  3FJU A;  3S6F A;  4UBR A;  4DNC A;  3PGP A;  3V7Z A;  2GIV A;  2DPT A;  4R3L A;  4B12 A;  3TOB A;  2REE A;  4BBH A;  4AG7 A;  1ZLH A;  1KUX A;  1F57 A;  2PJ4 A;  3PFE A;  4K3N A;  3R9F A;  1U6M A;  3S6K A;  2G3T A;  1IGB A;  4ZY1 A;  1CBX A;  4FD4 A;  4UCM A;  3H5Z A;  4MHD A;  2QYV A;  4I49 A;  4KVX A;  1XJO A;  3G3S A;  3IO1 A;  4KLW A;  3SI0 A;  3IWG A;  4KVM E;  3RAM A;  2F5I A;  4MY3 A;  1GHE A;  3WC7 A;  4E2A A;  1Z2L A;  3GY9 A;  2Z3K A;  4P6Y A;  4KOY A;  1XIX A;  4OC0 A;  2ZEE A;  1YLO A;  5IX3 A;  1DTD A;  3PBE A;  1Z5R A;  3RO0 A;  5I0C A;  2C6C A;  4QB9 A;  4R8F A;  4C7H A;  3ISX A;  3FRM A;  3BHX A;  1XE4 A;  3GIU A;  5AG6 A;  5G1Z A;  4YU9 A;  3F5B A;  3TO9 A;  4NGT A;  2Z0Z A;  2EUI A;  2Q4Z A;  2Z3O A;  4EME A;  2C6P A;  4YFJ A;  1TXR A;  3SJE A;  2OB0 A;  1TKH A;  5JM6 A;  1Y7E A;  2CXA A;  4JWP A;  4JXQ A;  2FIW A;  3W91 A;  3H8G A;  5C82 A;  2PIY A;  4R6T A;  4F9U A;  5HVF A;  1Q7L A;  1QQ9 A;  1XFO A;  4LQG A;  2OH1 A;  1LFW A;  4A32 A;  3B2Y A;  4UFV A;  4RUH A;  2Y0M A;  3W6S A;  3BLN A;  4PXE A;  3K9U A;  4OC4 A;  4G1P A;  1IY7 A;  3LAC A;  4NF1 A;  4NGR A;  3FYN A;  2OU2 A;  2OR4 A;  4FAI A;  4U9Z A;  5J8F A;  4K30 A;  5EC4 A;  1IYK A;  2Z3M A;  2B5G A;  4ZBG A;  1TIQ A;  1F2P A;  2B4B A;  1P0H A;  1XMT A;  3KHX A;  1YVK A;  4MCR A;  2PIZ A;  3KQX A;  4OIW A;  4PV6 A;  3RNZ A;  5D8N A;  4A39 A;  3FED A;  4NFR A;  2IL4 A;  3ZZI A;  4P44 A;  1R57 A;  5AGE A;  3BJ7 A;  1YW6 A;  3D68 A;  2QJ8 A;  3JUW A;  4NJQ A;  4PXB A;  1XMB A;  1AMP A;  5CNP A;  1LCP A;  4F6A A;  4YRH A;  4B6Z A;  4IHM A;  3IC1 A;  4A37 A;  3D67 A;  3EFA A;  4UF4 A;  2C1C A;  2EO8 A;  3D7G A;  4MMO A;  4AB7 A;  2J8M A;  2OZG A;  3IGR A;  3KHZ A;  5ISV A;  4OME A;  2BOA A;  4RI1 A;  4NGS A;  3IJ3 A;  1TF9 A;  1VHO A;  2FT0 A;  2WYR A;  1Z4E A;  5EMI A;  2B4D A;  3JTK A;  1JWQ A;  3NE7 A;  3CDX A;  3GYA A;  4KOR A;  2FIA A;  1IU8 A;  2X7B A;  1XBU A;  3F8K A;  2K5T A;  4KZT A;  3S6G A;  4AXV A;  4C2Y A;  4KOU A;  2NYQ A;  4HPS A;  4LQ6 A;  3CXP A;  3HUV A;  1X10 A;  3FNC A;  3LOD A;  3VAT A;  2B3U A;  1LOK A;  3QAY A;  1YLE A;  2CTC A;  1V0C A;  2PJ7 A;  4PSX A;  1K4J A;  4MFJ A;  1FT7 A;  2Q0Y A;  2BUE A;  2J9A A;  4TNU A;  5F09 A;  2JDC A;  2PJ8 A;  1ARM A;  2Z10 A;  3KL9 A;  3WT4 A;  4DJL A;  3R1K A;  2GFQ A;  2WUU A;  3P2F A;  4NJR A;  4BD9 A;  1ON0 A;  3FX6 A;  4JD6 A;  5G22 A;  4R76 A;  3TO7 A;  2I79 A;  2GE3 A;  3FBU A;  2PJ2 A;  2CNM A;  3T9Y A;  3H4Q A;  2PJ5 A;  3D8P A;  1XOV A;  4EVY A;  4JXR A;  1YGH A;  5HVG A;  5J1Q A;  1BLL E;  2YNC A;  4CS0 B;  3H8E A;  2RFH A;  1VGY A;  1M4I A;  2CF4 A;  2F8H A;  4GS4 A;  5E96 A;  4ZX8 A;  2EVN A;  4M85 A;  4KOS A;  1KWM A;  1QSR A;  2EK8 A;  2YNE A;  4PSW A;  3WC5 A;  1YX0 A;  2V8G A;  4ZY0 A;  4QBJ A;  3G8W A;  3C26 A;  1BO4 A;  2G3A A;  4CRY B;  4P4D A;  4A33 A;  3N5F A;  1YK3 A;  5D29 A;  4CPA A;  3BXM A;  1HDU A;  3P2H A;  5JH9 A;  5AG4 A;  5H86 A;  3NH8 A;  4MI4 A;  1N71 A;  4FWU A;  4GXH A;  4AVB A;  1MJB A;  1Q2D A;  1LAM A;  2EK9 A;  2V77 A;  2AFZ A;  3ZJ0 A;  3DSB A;  2PR1 A;  2AFX A;  4HNY B;  2ZEM A;  5EBV A;  5F49 A;  4NXY A;  5LRK A;  2QIR A;  3R9E A;  2AFS A;  1CX8 A;  3S6H A;  6CPA A;  3I1U A;  4CGO A;  1KZF A;  2JBJ A;  4UWI A;  2ZEO A;  3LWU A;  1I12 A;  5I4M A;  3VWD A;  1GYT A;  2BEI A;  1Z9U A;  2XEG A;  3TCV A;  3VH9 A;  1PUA A;  3EXN A;  5DS0 A;  2BCO A;  1IOF A;  1M1D A;  3E0K A;  4KVO E;  5G20 A;  1CG2 A;  1YVO A;  4IAV A;  3DDD A;  2GU2 A;  3PB6 X;  3S9M A;  5THW A;  1IOI A;  4MFP A;  4CYP A;  4ZI6 A;  4KSA A;  2PJA A;  3IU1 A;  4KUB A;  1YR0 A;  3SXO A;  3DNS A;  3WAB A;  4R7M A;  2POK A;  2DF5 A;  1Z8T A;  2ANP A;  3IWW A;  4M6I A;  4MJ8 A;  1M44 A;  5IB9 A;  2Q51 A;  2ZOG A;  2PRB A;  4MY0 A;  3I9S A;  1ZG7 A;  1BOB A;  4OC3 A;  2CNS A;  3NE8 A;  2I3C A;  4J3G A;  4CAW A;  3SI2 A;  1P4N A;  3PP9 A;  2ZEF A;  1DE4 C;  5BWA B;  3JVN A;  1YRE A;  4CAF A;  4A95 A;  1PCA A;  3CZX A;  4A94 A;  1Z8W A;  1LAN A;  4MBU A;  2YGW A;  2PR8 A;  4X5K A;  1Z4R A;  3NH4 A;  2F7V A;  3D3S A;  3FB3 A;  4UFW A;  4UIB A;  4XPK A;  1S7N A;  3PB9 X;  4R57 A;  4C68 A;  4A38 A;  1ARL A;  1HEE A;  3B35 A;  5F48 A;  1BPN A;  4XNH C;  4OKO A;  1MJA A;  4A30 A;  5IV0 A;  3D4U A;  3FXT A;  4PK3 A;  4UIA A;  4FD6 A;  2D4O A;  2PRQ A;  2PVV A;  4KS9 A;  5AG5 A;  4B13 A;  4MHY A;  2EBJ A;  2FS5 A;  4HNW B;  3T8W A;  4M6H A;  4XPD C;  4Z65 A;  1KUY A;  4CGN A;  4IK2 A;  4OC5 A;  1B87 A;  4BIN A;  2WZN A;  1JQG A;  2JLM A;  3CXQ A;  1HDQ A;  4W9Y A;  3VWE A;  3WR7 A;  1AYE A;  4WJB A;  3L2N A;  1S7F A;  3SJF A;  1NE9 A;  4PPZ A;  4UA3 A;  2G0B A;  1BAV A;  1CM0 A;  2FL4 A;  2G9D A;  3A9L A;  3IU2 A;  4Y49 C;  2Q44 A;  4MHZ A;  2AJ6 A;  4FBE A;  1TKJ A;  3N7Z A;  2IJZ A;  4KOT A;  2VEZ A;  1IB1 E;  4IF5 A;  1H8L A;  4NGQ A;  1FNO A;  2ZEL A;  4AVC A;  4KOV A;  4B5P B;  2ZEH A;  3TTH A;  1Y9W A;  2J8N A;  2VQY A;  3FH4 A;  3B3T A;  4ORF A;  2HC9 A;  1CP6 A;  1IIC A;  4XNH B;  1VIX A;  2ABZ A;  5K8M A;  4OID A;  1CP7 A;  5J8C A;  4MCQ A;  4CAX A;  4XPL A;  1MJ9 A;  3D2P A;  5AG7 A;  3FEC A;  3IWE A;  3SHP A;  5HH1 A;  2IQ6 A;  1QSO A;  2Z3N A;  3SJX A;  1AUG A;  4JZ0 A;  4II9 A;  2ZEP A;  5JGF A;  2PC1 A;  2PQ8 A;  2WPX A;  1UWY A;  2PE3 A;  4E0A A;  1CPS A;  4R3K A;  2FE7 A;  2PCU A;  3UY5 A;  3KR5 A;  2O4H A;  1Z8X A;  3CPA A;  2R8V A;  3I3G A;  4KSI A;  2HB6 A;  4WWV A;  5JPH A;  3IEH A;  2HV2 A;  1QMU A;  2PJ3 A;  3H8F A;  3K2K A;  4MHP A;  1XRY A;  3FEE A;  2CY2 A;  1VHS A;  2PDO A;  1S60 A;  1FY7 A;  2VL1 A;  2ZEG A;  2EWB A;  4C7I A;  2HQY A;  1QSN A;  4ZY2 A;  4MFZ A;  1UFH A;  3KKW A;  3V38 A;  3GKR A;  5IB0 A;  2AE6 A;  3B3C A;  3GUX A;  3GB0 A;  2J8R A;  3PEI A;  3DLJ A;  2I00 A;  5HVH A;  1S3Z A;  3B8G A;  4CAV A;  3CXS A;  3PB8 X;  4UEF A;  2ZPA A;  2ZW5 A;  4QC6 A;  2OZU A;  4JYW A;  3PB7 X;  1VKC A;  2P6G A;  2CIJ A;  4OAE A;  3D7D A;  1R43 A;  3BI1 A;  5CPA A;  4M6G A;  2NSM A;  5K8P A;  2JEW A;  5H84 A;  1NMT A;  4OC1 A;  1BPM A;  2AFU A;  1A2Z A;  3TFY A;  4MRI A;  4NCZ A; 
#chains in the Genus database with same CATH homology
 2RC4 A;  4AG9 A;  2VI7 A;  1WWZ A;  2ATR A;  3FIX A;  5KTD A;  4MFK A;  4B11 A;  1ZO0 A;  3OWC A;  5GCN A;  4IUS A;  4B14 A;  3EC4 A;  1WK4 A;  3EY5 A;  1XEB A;  4UWJ A;  4A31 A;  2FCK A;  2ZW7 A;  2B3V A;  3SXN A;  3TT2 A;  2VZZ A;  2HUZ A;  4OAD A;  2ZXV A;  4CGP A;  2QEC A;  3QAH A;  4H89 A;  4KLV A;  2H5M A;  4UFX A;  1I1D A;  2R98 A;  4KSF A;  2A4N A;  4U9Y A;  4H6Z A;  4LUA A;  2Z11 A;  2JDD A;  2DXQ A;  1KUV A;  3EO4 A;  2KCW A;  2REF A;  2O28 A;  4CRZ B;  2VBQ A;  2FXF A;  4F0X A;  2VXK A;  1OZP A;  4B10 A;  2D4P A;  4H6U A;  2Q4Y A;  1Y7R A;  3TOA A;  4C2Z A;  4B5P A;  4CYO A;  3RYO A;  2R7H A;  4UCN A;  4CGM A;  4JJX A;  4FD5 A;  4QVT A;  3QB8 A;  2WSA A;  1L0C A;  5F46 A;  2P0W A;  4RS2 A;  2Q7B A;  4E8O A;  1Y9K A;  2NMT A;  1SQH A;  3DR6 A;  4R87 A;  3R96 A;  4YGO A;  5KTA A;  2C27 A;  3DR8 A;  1J4J A;  4KUA A;  5DWM A;  4L89 A;  4HKF A;  1PU9 A;  4L8A A;  2JEV A;  5C88 A;  5A27 A;  4Q38 A;  4CAE A;  1I21 A;  4U5Y A;  1MK4 A;  2Q4V A;  2YND A;  3R9G A;  3LD2 A;  3W6X A;  5A28 A;  4KOW A;  2CNT A;  3PZJ A;  1M4D A;  1RXT A;  2ZW4 A;  4UCP A;  1IYL A;  2QML A;  4C2X A;  3TE4 A;  4NSQ A;  5G21 A;  3T90 A;  1LRZ A;  3MGD A;  1M4G A;  3R95 A;  4KOX A;  4CGL A;  4XPD B;  5FVJ A;  4A2Z A;  5KTC A;  4B5O A;  4F0Y A;  2PSW A;  1QST A;  4NEX A;  2WPW A;  5DWN A;  4OLL A;  4MFQ A;  4QUS A;  1B6B A;  3F0A A;  4Y49 B;  3TO6 A;  4ONU A;  1IID A;  2OZH A;  1S7L A;  2P6F A;  1S5K A;  2ARH A;  4HNX B;  2B5G B;  2R1I A;  4BMH A;  3V8I A;  4ZGY B;  3D2M A;  2Z3P A;  2ZW6 A;  2VZY A;  1CJW A;  1RO5 A;  4JLY A;  4LX9 A;  1Q2C A;  1S7K A;  4PK2 A;  4MFL A;  1QSM A;  2DPS A;  4CYN A;  2GAN A;  1NSL A;  2Q04 A;  2P6E A;  2FSR A;  2BL1 A;  1XF8 A;  2B58 A;  5HMN A;  1Q2Y A;  3BJ8 A;  4Q36 A;  2B4D B;  4R9M A;  2Z3L A;  2BSW A;  5JQ4 A;  4FD7 A;  2YNC C;  5F47 A;  4M3S A;  4CYQ A;  4AVA A;  3S6F A;  4UBR A;  4DNC A;  3PGP A;  2GIV A;  2DPT A;  4R3L A;  4B12 A;  3TOB A;  2REE A;  4BBH A;  4AG7 A;  1KUX A;  3R9F A;  1U6M A;  3S6K A;  2G3T A;  4FD4 A;  4UCM A;  3H5Z A;  4MHD A;  4I49 A;  4KVX A;  3G3S A;  4KLW A;  3IWG A;  4KVM E;  2F5I A;  4MY3 A;  1GHE A;  4E2A A;  3GY9 A;  2Z3K A;  4KOY A;  1XIX A;  5IX3 A;  5I0C A;  4QB9 A;  4C7H A;  3FRM A;  1XE4 A;  5AG6 A;  5G1Z A;  3F5B A;  3TO9 A;  2Z0Z A;  2EUI A;  2Z3O A;  4YFJ A;  2OB0 A;  2CXA A;  4JWP A;  4JXQ A;  2FIW A;  3W91 A;  5C82 A;  2OH1 A;  4A32 A;  4UFV A;  2Y0M A;  3W6S A;  3BLN A;  3K9U A;  4NF1 A;  3FYN A;  2OU2 A;  4U9Z A;  5J8F A;  4K30 A;  5EC4 A;  1IYK A;  2Z3M A;  2B5G A;  4ZBG A;  1TIQ A;  2B4B A;  1P0H A;  1XMT A;  1YVK A;  4PV6 A;  2IL4 A;  3ZZI A;  1R57 A;  5AGE A;  3BJ7 A;  3JUW A;  5CNP A;  4F6A A;  4YRH A;  4AB7 A;  3EFA A;  2J8M A;  2OZG A;  3IGR A;  5ISV A;  4RI1 A;  2FT0 A;  1Z4E A;  2B4D A;  3JTK A;  3NE7 A;  3GYA A;  4KOR A;  2FIA A;  2X7B A;  3F8K A;  2K5T A;  4KZT A;  3S6G A;  4C2Y A;  4KOU A;  3CXP A;  3FNC A;  3LOD A;  2B3U A;  1YLE A;  1V0C A;  4PSX A;  1K4J A;  4MFJ A;  2Q0Y A;  2BUE A;  2JDC A;  2Z10 A;  3R1K A;  2WUU A;  3P2F A;  1ON0 A;  4JD6 A;  5G22 A;  3TO7 A;  2I79 A;  2GE3 A;  3FBU A;  2CNM A;  3T9Y A;  3H4Q A;  3D8P A;  4EVY A;  4JXR A;  1YGH A;  2YNC A;  4CS0 B;  1M4I A;  4GS4 A;  5E96 A;  2EVN A;  4M85 A;  4KOS A;  1QSR A;  2YNE A;  4PSW A;  1YX0 A;  4QBJ A;  3G8W A;  3C26 A;  1BO4 A;  2G3A A;  4CRY B;  4A33 A;  1YK3 A;  3P2H A;  5AG4 A;  5H86 A;  4MI4 A;  1N71 A;  4AVB A;  1Q2D A;  1MJB A;  3ZJ0 A;  3DSB A;  2PR1 A;  4HNY B;  5EBV A;  5F49 A;  4NXY A;  2QIR A;  3R9E A;  3S6H A;  4CGO A;  1KZF A;  4UWI A;  1I12 A;  3VWD A;  2BEI A;  1Z9U A;  3TCV A;  1PUA A;  3EXN A;  1M1D A;  3E0K A;  4KVO E;  5G20 A;  1YVO A;  3DDD A;  4CYP A;  4MFP A;  4KSA A;  3IU1 A;  4KUB A;  1YR0 A;  3SXO A;  3DNS A;  4MJ8 A;  1M44 A;  2PRB A;  4MY0 A;  3I9S A;  1BOB A;  2CNS A;  4J3G A;  4CAW A;  1P4N A;  3PP9 A;  5BWA B;  3JVN A;  1YRE A;  4CAF A;  4A95 A;  4MBU A;  2YGW A;  2PR8 A;  4X5K A;  1Z4R A;  3D3S A;  3FB3 A;  4UFW A;  4XPK A;  4C68 A;  1S7N A;  4R57 A;  5F48 A;  4XNH C;  5IV0 A;  4A30 A;  1MJA A;  3FXT A;  4PK3 A;  4FD6 A;  2D4O A;  4KS9 A;  5AG5 A;  4B13 A;  5J8C A;  4HNW B;  2FS5 A;  4XPD C;  1KUY A;  4CGN A;  1B87 A;  3WR7 A;  3CXQ A;  2JLM A;  3VWE A;  1S7F A;  1NE9 A;  4UA3 A;  2G0B A;  1CM0 A;  2FL4 A;  3IU2 A;  3A9L A;  4Y49 C;  2Q44 A;  2AJ6 A;  3N7Z A;  4KOT A;  2VEZ A;  1IB1 E;  4IF5 A;  4AVC A;  4KOV A;  4B5P B;  3TTH A;  1Y9W A;  2J8N A;  2VQY A;  4ORF A;  1IIC A;  4XNH B;  4CAX A;  4XPL A;  1MJ9 A;  3D2P A;  5AG7 A;  3IWE A;  3SHP A;  5HH1 A;  1QSO A;  2Z3N A;  4II9 A;  2PC1 A;  2PQ8 A;  2WPX A;  4E0A A;  4R3K A;  2FE7 A;  3UY5 A;  2R8V A;  3I3G A;  5JPH A;  2HV2 A;  2CY2 A;  1VHS A;  2PDO A;  1S60 A;  1FY7 A;  4C7I A;  2HQY A;  1QSN A;  4MFZ A;  1UFH A;  3KKW A;  3GKR A;  5IB0 A;  2AE6 A;  2J8R A;  2I00 A;  1S3Z A;  3B8G A;  4CAV A;  3CXS A;  2ZPA A;  2ZW5 A;  4QC6 A;  2OZU A;  1VKC A;  2P6G A;  4OAE A;  5H84 A;  1NMT A;  3TFY A;  4NCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...