3IGSA

Structure of the salmonella enterica n-acetylmannosamine-6-phosphate 2-epimerase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
230
structure length
230
Chain Sequence
AMSLLEQLDKNIAASGGLIVSCQPVPGSPLDKPEIVAAMALAAEQAGAVAVRIEGIDNLRMTRSLVSVPIIGIIKRDLDESPVRITPFLDDVDALAQAGAAIIAVDGTARQRPVAVEALLARIHHHHLLTMADCSSVDDGLACQRLGADIIGTTMSGYTTPDTPEEPDLPLVKALHDAGCRVIAEGRYNSPALAAEAIRYGAWAVTVGSAITRLEHICGWYNDALKKAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Isomerase
molecule keywords N-acetylmannosamine-6-phosphate 2-epimerase 2
total genus 81
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3igsA00
3NL6A 1DL3A 2GQ9A 1I4NA 3M1ZA 2ISSA 4MPQA 3W76A 1GTHA 3F1QA 3M44A 3BW3A 1WBHA 5AB3A 1ME9A 3NVTA 4AB4A 3WFAA 1VPXA 5AHLA 5U7SA 2JGYA 3BPWA 4PCFA 3FJLA 3DHFA 5CZSA 3TROA 4DO6A 3NQFA 3UY7A 4WX2A 4WUIA 4DF0A 4UTHA 3O1NA 4MZ1A 3GK0A 3MHGA 3S8HA 2YGYA 2E1DA 2V8ZA 1FDYA 3PAJA 4KKXA 1QAPA 3LLDA 1QCWA 3MUXA 4N6EA 4PTNA 1HTIA 1PE1A 2HMCA 3S6DA 3TJXA 3A5VA 3STCA 1KBJA 1QR7A 5HNRA 1LRTA 3LV6A 3G1YA 3BK0A 3C2RA 1W5QA 3CU2A 2NLIA 3PSVA 1ONRA 1MEWA 1FCVA 3TCEA 3DI0A 3TQ0A 2CZDA 2ZDRA 3NQCA 3ZS4A 3W1RA 4PFMA 2X1SA 3N73A 1R2TA 4WQ6A 1ALDA 2GVJA 4LS1A 5LSMA 3LTPA 3FS2A 3GAKA 2HS6A 4M19A 5E93A 3LRLA 5D03A 5I3IA 4OE7A 3BW4A 4ZZ9A 1KM2A 1K3UA 3NL5A 2FB3A 2Y88A 1G4PA 3LM7A 4WXYA 2GVLA 3G1FA 3GNDA 1QDSA 3EWXA 1R2SA 3GKAA 1AK5A 1KM6A 4AAJA 5EBUA 2QAFA 5KMYA 4MZYA 3W7DA 5C55A 3OA3A 2GPTA 3L0NA 3FYOA 4JDYA 5BNKA 2A21A 3M5VA 1GVSA 1KFJA 1U5JA 1PV8A 4KFNA 5G4EA 3TC7A 2EGZA 3HGOA 4OBTA 1EUAA 3OVPA 4JGDA 2A85A 4JYEA 3NM1A 2DJLA 1LZOA 5DCDA 3NQMA 3LCGA 3B0UX 4JNMA 4O13A 2ZA1A 4IWWA 2CLEA 3E02A 4HSNA 4OQVA 1P0KA 2OX1A 1VHCA 3GR7A 2O7SA 5DLCA 4AVFA 1XXXA 1JUEA 2VFEA 3HG4A 3LHTA 4IMCA 3HG2A 4IUOA 4O1DA 1H60A 1Q6QA 1GVRA 2DU2A 2NUWA 5C2XA 2JBMA 3E9AA 3LTYA 3RNDA 4DPPA 2ZBTA 5LNWA 4MY9A 2WJZA 3EKLA 3W1TA 3CLMA 3IVSA 1KFKA 1THFD 4JTEA 4U28A 3W2LA 3EX2A 3BLFA 4L4LA 2VEIA 2X30A 3SGUA 2Y85A 1WDWA 1TIMA 3G1DA 3R5EA 1W0MA 1JRCA 3GAYA 4NQ1A 2E68A 1SO3A 3NPVA 1Z42A 4XWUA 5J5RA 2Z6IA 1CW2A 3W72A 4UTKA 2Y70A 1QOPA 5G2HA 3GIYA 1F76A 4BFAA 3DFQA 1UASA 2E5CA 2FLIA 3A23A 5K9XA 1WOAA 3OHIA 3L66A 3TE9A 4HNVA 1G4SA 4KWWA 1M7OA 1F2JA 3G1VA 4QISA 1XFBA 1PVNA 3N14A 1GT8A 2YCEA 3MBFA 2E6FA 1W3IA 3B8DA 4NUWA 1KM3A 4I7WA 4A22A 1T0OA 3C52A 4UFKA 1YPIA 3CEPA 4O57A 5D2WA 2QEZA 1RV8A 2E09A 5G2WA 4GJ1A 4LY8A 4YL2A 1LLZA 5C5YA 1VJIA 4LOCA 3O06A 3LDVA 1RQBA 1OHLA 3LB0A 3THAA 5K9CA 2TRSA 1QPNA 3KVMA 1A5BA 5C54A 2ZFAA 4ADUA 1UJPA 4UTJA 4ZQOA 1JCNA 5AHFA 4NJHA 2FIQA 4WOQA 4FXRA 3FKRA 2FPVA 3CC1A 4LVFA 5G4WA 3LERA 1VQTA 5LKYA 3B0VC 3W7RA 3MHUA 4Z1AA 3LI1A 1ZAJA 1NAL1 4B5NA 1PCWA 4LUIA 4YWIA 2DZSA 1YADA 2EHHA 1DV7A 1N55A 3S5NA 3S1UA 3UWQA 1RQEA 1L6SA 3QM3A 2BLEA 1J5TA 4HNNA 3W1NA 1TJPA 3NXFA 1HO4A 3PUEA 3DI1A 4AF0B 1TCDA 1S5TA 1VCGA 4QNWA 1F6KA 1TPDA 3VFLA 3WK2A 5AHEA 1FWNA 3LCHA 4IQLA 1VCFA 3U6WA 2YSWA 3GZ3A 4K37A 4I7VA 3D0CA 1TREA 3QYQA 3SI9A 3T78A 1F73A 4WD0A 4NXSA 1YTEA 3AJXA 2ZRUA 4XBSA 3UWWA 1ICSA 3PG9A 3MP3A 3TAOA 2XFWA 4NZJA 4OGZA 3M47A 4N4QA 4XTIA 1UB3A 3GXNA 3MJYA 1C29A 2EAWA 4EWND 1OYCA 2RH9A 1HUVA 1VYPX 4PA8A 3SFKA 4JTFA 2WPBA 4AHPA 4LRTA 5H2ZA 1DORA 1A5AA 2QCLA 3M7WA 2R8WA 4R53A 5K4XA 5KTLA 1VHNA 5EMUA 1B4KA 4Y9AA 5KITA 2J88A 4D2JA 4MJMA 3KVLA 5I3FA 3QQ0A 3IRDA 5CKSA 4AH7A 4AWSA 3KRSA 2J9XA 3W7EA 2P10A 5K4ZA 2P0OA 2VKZG 4ZMGA 5EA9A 4ORIA 3EB2A 5CGQA 2DZWA 3ELFA 3INPA 3W86A 3YPIA 3VCRA 4RZ4A 3EXRA 1B4EA 3I7QA 2QKFA 3W84A 1KM0A 4AWUA 5TBOA 3JRKA 1I2RA 4FF7A 2V5LA 2QF7A 1TQJA 3I7SA 3T40A 1V5XA 3QFEA 1S3HA 2W0UA 1PHQA 1IXOA 1AW1A 4GWEA 3CIWA 2CU0A 2ZRYA 4M6PA 3P80A 4JY8A 4UFJA 2Y7DA 2NX9A 2ISVA 3H55A 1OFDA 4GFSA 3MW7A 1JUBA 3S5ZA 5LNSA 3UXAA 1NF7A 3GXPA 1H1ZA 1YYAA 1GG0A 4JTHA 1TSIA 4K8HA 4FX6M 3QRHA 1H5YA 1LYXA 4C1KA 1K8ZA 2X1RA 3PUDA 3LHYA 3WJYA 4QNEA 5HINA 3HB9A 2PRMA 3EXTA 1WAUA 3KHJA 4TR9A 1OYAA 4PL2A 5I3HA 4LNYA 2QUTA 1EA0A 3EWYA 3W3OA 3QPYA 3G22A 1KTNA 3BLEA 5HUOA 3LI0A 3QF0A 1F6PA 2J6XA 5LNVA 3QC3A 1H61A 1O95A 8TIMA 2BX7A 3IGSA 2WSQA 3QEZA 1TV5A 2C6QA 2ZYFA 2DZVA 5E1QA 3PULA 1KFLA 3UPBA 4DO5A 2E5BA 5F4SA 3LBMA 1H63A 4FEZA 3M41A 2OJPA 5HQEA 4CCEA 4O19A 1SQ7A 3BGJA 5D30A 5LZLA 3W7HA 3OVQA 4S2BA 1LROA 3LHVA 3CHVA 3WJXA 2GQ8A 4H4IA 3LCIA 4R7JA 4C1LA 5FEZA 4EF9A 4NX0A 3T7VA 2V2CA 1JJKA 1GVOA 5D33A 4HNTA 3R8RA 3LOTA 1OVDA 1OG0A 4CCCA 4QSHA 1SO4A 5CPNA 4Z1DA 1BEUA 3W07A 4BF9A 1GYLA 1WBJA 1B3OA 1M5WA 4K38A 5BRBA 4O16A 3CIXA 3NQVA 3I6RA 1UUMA 1H7NA 1H62A 2D73A 2Y63A 1YLVA 1Q6LA 3QJAA 2WNQA 4QAIA 2Y62A 4RXFA 2GJLA 4ZQNA 2E77A 2FPYA 1GZGA 3HG3A 2QDGA 3PB0A 1DJQA 5IM51 1Y0EA 1Z41A 1JVNA 2NXGA 1G7UA 4O8RA 4CNOA 3W88A 3STFA 1PL9A 4HHPA 2FDSA 2NV1A 3P7YA 1MXSA 3E49A 4DF1A 1K8YA 4JX4A 5FI8A 5EPDA 2OT0A 2CLOA 1NSJA 4IMFA 3BGGA 1I2QA 1KM4A 1W54A 2RKXA 3LHWA 5H91A 3W1AA 3BG5A 1OX4A 1SZEA 1TPC1 1IGSA 1XC4A 1ZY9A 1JQVA 1HO1A 3TU9A 2TPSA 4FIRA 4TIMA 2I9EA 3DENA 4JYDA 3NGJA 1W1ZA 4NJIA 2LLEA 2NWSA 2VXNA 3O05A 4HPXA 1OFOA 4HSOA 4BI7A 1EP3A 3TXVA 1GG1A 1QPQA 3VNDA 1DBTA 2ZZ4A 4MOZA 2BWGA 1T96A 1BWKA 1LCOA 2A7PA 3GB6A 3NL3A 3M6YA 5C6MA 4MFDA 2A2IA 5LNUA 3KFTA 2V82A 4UFMA 4HT3A 3W75A 3IIZA 3W1QA 3BV4A 2VENA 1A50A 5D2YA 2YYTA 3TFXA 1TPVA 3S5OA 3Q2DA 3M5YA 2OCZA 4GUIA 1LRNA 4UNLA 2VOMA 3TQVA 5TIMA 1MO0A 1LBMA 5FF7A 3TW6A 2RFGA 3QQ1A 3NA8A 4LRSA 3ABSA 1G69A 1VLWA 1Q6OA 1L2UA 1CI1A 3OBKA 3W73A 2ALDA 3MWAA 4DBEA 3QSTA 2Y89A 2F7FA 3UXDA 3HMJG 4ZL1A 3HOJA 1VR6A 4M7TA 1KV8A 5AC8A 2ZZ1A 1EP1A 2XN0A 4QQ3A 1ZAIA 3W87A 3ZFHA 3ZR4A 5CPOA 1ME8A 3M16A 4IX2A 1S5WA 5HR6A 5CZJA 4UTMA 4UTLA 4PC8A 1X7FA 2QCCA 3V1PA 1OFQA 2H3DA 3GDRA 4P61A 2HTMA 4UMBA 4UTTC 1JUKA 4O15A 2R91A 4RLIA 4QJ1A 3HPSA 3W85A 4Z08A 1GPWA 1L9WA 2I1OA 3O8AA 1TQXA 5L9FA 3VI2A 4BWLA 1LORA 1G4TA 1OFAA 3M9YA 2GUUA 2ZRVA 1YDNA 3ATYA 1XUZA 4IXXA 4XZ9A 1OK4A 4GUFA 4X2RA 5D38A 2QCDB 2V5BA 5KZMA 2QCDA 4NT0A 1WX0A 5L6UA 3TAKA 3WK0A 2FB2A 1KLYA 2DZTA 2YFOA 3CQ0A 2QDHA 3KAOA 1FWSA 2CLIA 4LVGA 3W2MA 4O1AA 1SSGA 4ONVA 3JR2A 3IIVA 4UCGA 5FF2A 3IIXA 1EPXA 1EWDA 3KOFA 2OZ0A 1TV7A 3IIOA 1ZCOA 4NJKA 1H7RA 4JIPA 2ZZ3A 4L4MA 3DKJA 2PRHA 4OU1A 3ZWTA 3STEA 4JXCA 3EX1A 1DHPA 1Q6RA 2NXIA 2CLFA 3NPWA 3A5FA 3WK3A 1TO3A 5D05A 2V9DA 2V2HA 4PEKA 4N2YA 4ZQMA 3EX4A 3G0SA 1QFEA 2C19A 2CLMA 3H54A 1NEYA 2X2GA 5F1VA 4UUIA 2OMAA 1CX9A 2WNZA 2HSAA 3P84A 4Y6GA 3RLUA 3G0XA 2BTMA 1A5CA 2W6RA 3W2JA 1ICPA 4WY0A 3MMTA 4RZ6A 1QPRA 2Z0IA 3STGA 5CZ0A 4O53A 3IV3A 3WJSA 4TO8A 1F7BA 1VYRA 2JKEA 2JKAA 5E0KA 3GNNA 4ICNA 4FNRA 4TMBA 3TH6A 1FY6A 4TX9A 3DFPA 2HS8A 3W1LA 2J24A 3GVGA 4Y8FA 2X16A 3QMRA 1T99A 2E6YA 1VC4A 1OX6A 5AC7A 3GLCA 5I3JA 3ABQA 2FQIA 3W2NA 1I8JA 1YTDA 2Y7EA 4PODA 1RQHA 2C18A 1K03A 1SW0A 2QAPA 4A29A 3S1WA 3NDOA 1IXPA 3MYPA 3HGJA 3N9SA 4UFLA 1BTMA 3DBPA 3NG3A 1GQNA 1QPOA 4O4VA 3R12A 3HJZA 4OT7A 3L5MA 2G96A 2GQAA 4P2VA 5FEXA 3CM4A 2V30A 1YXDA 4FNSA 2ZA3A 3UWUA 2V2DA 3SIZA 3W74A 1SZFA 3L5AA 3FIGA 4N9DA 4UXDA 2Z6JA 2ABBA 4K7YA 1XBXA 4IX0A 5CSRA 3QW4B 4M5PA 3RFAA 4O17A 1R47A 2J9YA 3N34A 2C3ZA 1OABA 3TNOA 5K3VA 2R14A 3F03K 4I7UA 2VEKA 1XCFA 2A6NA 4CQ9A 4K6AA 4MY8A 1H50A 2YR1A 3LXCA 3LXBA 4JX6A 1TPB1 3HF3A 3ANYA 3NZ1A 4Q33A 3SJ3A 4EF8A 2ZA2A 4O10A 2EPHA 2ZRWA 2QCFA 3MP4A 1YXCA 4WOZA 1OFBA 4MLRA 1H1YA 2B7OA 3W22A 4AHQA 2QCGA 2A1YA 4TMCA 3W71A 4XUGA 2A5HA 6TIMA 3L65A 2G5WA 1O60A 2RDUA 3IGXA 3G1SA 4N9CA 3OEXA 4NU7A 2XN2A 2FFCA 4O12A 2BZNA 4X3ZA 1FWTA 3C3NA 5AYZA 1O5KA 2UV8G 3W70A 3LX9A 1KBIA 1LDCA 4UC5A 2NZLA 3UWYA 4JTIA 3B03A 1F05A 4M6VA 5KZEA 4J9JA 1EP2A 1C8VA 5D04C 3RLVA 3TFCA 1H7OA 3BO9A 4MVAA 4GUJA 4DELA 1FCBA 1SZGA 3KX6A 3MO7A 3PUOA 4QITA 4ADTA 5F2MA 4LS0A 1TB3A 4ADSA 3NO5A 2C1HA 2B7QA 2ATMA 4EVZA 5HULA 4DBDA 3S42A 3W23A 3RU6A 2VFHA 2ZRZA 5AOUA 2DP3A 2YPIA 3L0GA 3OVRA 2G95A 1GOXA 3SZ8A 2PE4A 1MZHA 2Q3OA 2GOUA 3FYPA 3TX9A 3MYOA 1VCVA 3FFSA 1M7PA 3HBLA 3LHUA 3P81A 5AYYA 5I3GA 1LBFA 1TRIA 4JX5A 2I14A 5HWNA 3C2EA 5EL1A 3NAVA 4CCDA 1G6CA 1NVMA 3Q94A 2C13A 2B0MA 4XBKA 3OG3A 4XKYA 2DORA 1MEIA 1FBAA 4MYAA 3V75A 1SW3A 3DFTA 1HL2A 3NR0A 4IMDA 3JS3A 5DBUA 2WKJA 2CWNA 3GYEA 1JCLA 2Q3RA 3U8GA 3FKKA 3PM6A 4ZQCA 5A5WA 3NZRA 4UMAA 3W7GA 2ABAA 3LCFA 1GTEA 2E6AA 4GUHA 2ZRXA 5AN7A 2X1UA 1TTIA 1VGAA 2DZPA 3THQA 3KVKA 2CLKA 2ZTKA 3P5YA 4XQ6A 5G1TA 1H51A 4OV9A 4HKPA 1YDVA 3UWZA 4DEFA 1OJXA 2E6DA 4Y96A 4O50A 2VFFA 4FNQA 3M0ZA 1K7FA 1MEHA 3MI3A 3W1PA 3BW2A 2BSLA 1AW5A 4RR4A 4RZ5A 1KTCA 5EKYA 1U83A 1ADOA 1DOSA 1I45A 3NQ8A 1ML1A 3TW7A 2P1FA 1I2NA 5FEWA 2VEMA 5LHFA 1OFEA 1VS1A 2C16A 4GNJA 3EWUA 4WJEA 3A22A 4N9BA 3FJ6A 4JYFA 2AAMA 1DKWA 1LOLA 3NEVA 3LGEA 1BWLA 2Y7GA 2H90A 5CPMA 5KINA 2AGKA 2RDTA 3P67A 1OFRA 1RPXA 4JR5A 1QMLA 4LC8A 4S2CA 5EY5A 1FX6A 4BI5A 3R13A 4YMZA 3CB8A 3I65A 4RJEA 4ZQPA 3B04A 1TV8A 3LTSA 3VE7A 1I2OA 1XBZA 4DPQA 1JQXA 1JRBA 4MYXA 1E51A 1W5PA 2YW3A 1FQ0A 1FXQA 2ISWA 2ZZ6A 2IQTA 3G3DA 2V81A 4O14A 1D3GA 3C6CA 1JCJA 4UTWC 5KSWA 1LTDA 5BOOA 4AF0A 1KM1A 4FNUA 4O52A 2A0NA 3PS7A 2G97A 5K9DA 3DZ1A 3UQNA 4TU1A 5AC6A 1EUNA 2A6LA 3NQDA 3TC6A 4NJJA 4N9EA 3G24A 4S1FA 3NQ7A 4RKAA 4GUGA 1PS9A 1P4CA 1XDMA 2WSYA 3O16A 5EYWA 1ZHAA 2CZEA 4CNPA 4PL1A 1X1ZA 3KRUA 5T26A 4A2SA 3G1HA 4QIUA 1PHWA 4M6QA 3O15A 3C61A 4Z1BA 1RVGA 1S5VA 5AFDA 3C0JA 2WOQA 3E0IA 5DBTA 2X1TA 5AHIA 2CFFA 3L2IA 3IVTA 3E96A 3NM3A 3GDKA 4DF2A 1AG1O 3EKZA 3W2KA 4JDBA 4RK8A 3BVJA 1G7VA 5F2GA 3FOKA 3FEMA 1IF2A 2BXVA 1JCXA 5D32A 3UD6A 2YDAA 2C14A 3SGZA 3PBUA 1R2RA 1H7XA 1QO2A 3HGSA 1SO5A 2A4AA 4EOUA 2Z2UA 1WXJA 3TA6A 2PCQA 1LM1A 5CSSA 1K7XA 2WV8A 1LOQA 1SW7A 2NWRA 3LV5A 1VZWA 3NL2A 3C2VA 1K7EA 5LGZA 1F74A 2QCEA 3W7CA 5HWJA 3QH2A 5G2IA 3DFNA 3USBA 4DQWA 1J4EA 4UR7A 5CPLA 3L67A 1A53A 1SPQA 2OT1A 2Y6ZA 1TYGA 1R30A 1O94A 1TJRA 5TQLA 5SWUA 3P74A 4N02A 4UMCA 2C15A 3PWAA 1FUYA 3W7QA 4JTGA 3LHZA 1X6UA 3EWBX 1UUOA 3SECA 5F4WA 3CT7A 1XKYA 3C56A 3S5YA 4NJGA 3W7KA 2EKCA 3G1XA 4O0ZA 2CW6A 5D09A 1HFBA 1SFLA 3LCWA 1TPEA 1ZNNA 5K2ZA 2CLHA 1XBVA 1SFJA 4AMAA 3B05A 1LBLA 1Q3NA 4JTLA 1A5SA 3GDLA 1JCMP 4XKYB 2B4GA 3IVUA 3W6YA 4FXSA 1KFBA 2ZZ5A 1PCKA 4O54A 1QWGA 1IXNA 3M43A 2WSRA 3KVJA 3O63A 4AHOA 3NOEA 4NNAA 4CLMA 4LVBA 3I7RA 4MY1A 2C0AA 3O6DA 3P62A 4MJZA 4KFPA 3CEUA 2QUUA 3TJLA 5KZDA 4BI6A 1D9EA 4Z0JA 1QNVA 4JTSA 2H8XA 4MIMA 4NXKA 4NNBA 3W7OA 3B06A 4NVTA 3FLUA 3LCXA 3IIPA 3B0PA 1B9BA 2QUVA 3QMSA 3WJWA 2PC4A 4MZ8A 3N3MA 1VRDA 1SO6A 1WYIA 2QJIA 2FJKA 3OIXA 2ATSA 1FCUA 3L9CA 2A7RA 3C2FA 1W5MA 1TMHA 4UFHA 3W7LA 4JEQA 1H7WA 2KZHA 3HG5A 2QCNA 1EWEA 2WQPA 4Q4KA 3PF3A 3W7PA 3W7JA 4LTSA 4UNKA 1O4UA 4FNTA 5K7JA 3NYZA 2WNNA 1KV5A 3HGRA 5ABTA 3F4NA 1H7PA 4DO4A 5MHBA 1R46A 4O0KA 2YZRA 3W7NA 5FF3A 3TXZA 2VELA 5DCBA 2GVGA 5F2LA 3TV8A 3DFSA 4Q32A 3WJZA 5G1YA 1TPWA 4ML9A 3BG3A 5LGXA 4LS2A 3O6CA 3QZEA 4XTDA 3G8RA 3LRMA 2FPTA 1KM5A 1JULA 4HN4A 1NF0A 2W79A 1TTPA 4LV9A 4RX0A 2PURA 4RXGA 3MHFA 4JS3A 3G8EA 2B7PA 1L6WA 3PB2A 1OF8A 3HPXA 5BMXA 1YXYA 1FWRA 1SR9A 5D2VA 4LVAA 2H8ZA 2QJHA 3TR2A 4AEOA 4JTKA 3QMTA 4A3UA 4MFEA 1AMKA 1EB3A 3PR2A 4MUZA 1X8FA 1XI3A 3DAQA 6ALDA 1J2WA 5DXYA 2VFIA 2B7NA 3L21A 4YCOA 3P61A 3EXSA 1ZFJA 3G1AA 3TUUA 4MKNA 4G1KA 4HPJA 1OF6A 1P1XA 4NX5A 2Y61A 5FF4A 3CWNA 3IEBA 1YDOA 1SUXA 3N2MA 1XUUA 4A21A 7TIMA 4UFIA 2XN1A 3W9ZA 3QPZA 3P60A 3KXQA 2NUYA 5DCEA 1LLWA 4N4PA 5DXXA 3RK8A 3R2GA 3LRKA 3LXAA 4R33A 4W9TA 4K39A 5GVJA 1W8SA 1DQWA 1SSDA 5F2IA 2ZZ7A 2YW4A 3S0CA 4O11A 3UWVA 1TPFA 1Q45A 3EWZA 3S9YA 3ATZA 2NUXA 4IGHA 4IMGA 4LUJA 2WO5A 3P82A 4LV4A 1MSSA 3VKJA 4YXGA 4YCPA 1P0NA 4GRSA 4CQ8A 1GEQA 4AWTA 1YPFA 1QO5A 3M5XA 1V7YA 4O1BA 4K7VA 3Q37A 4IXHA 2DJXA 3W1UA 5DY2A 3SW6A 2CLLA 5DN1A 4QM1A 3PVFA 1T8XA 3NQAA 1FCQA 1K02A 2R94A 1XM3A 5AYXA 1EEPA 3PBWA 4JIQA 2QJGA 3GKFA 1WV2A 3P5ZA 3NNTA 4NZFA 1OFPA 1PIIA 3EWWA 5FF0A 1P5BA 4GBUA 3UZ5A 4CNNA 3TDFA 3QW3A 5BMWA 3UNDA 3CWOX 3A9IA 3BG9A 4FB7A 3O07A 5IBXA 3AO0A 3HPZA 4JN6A 1AW2A 3GR8A 3P8JA 4Z1CA 4OHQA 3ZWSA 4GC4A 1OX4B 1L6YA 1W5NA 1N7KA 5DY3A 4JTJA 1X1OA 1I2PA 5DELA 1EX5A 4MLJA 5CZTA 1IIGA 4FX8A 2Q8ZA 5A8GA 5FEPA 4RCXA 1OX5A 4GE8A 3L0KA 3DU0A 4FX7A 3L5LA 3EEGA 4FHAA 1W37A 3NPXA 3M5ZA 4BK9A 1TTQA 3W7MA 3GXTA 3U2OA 3W83A 3ABRA 2QCMA 3FA5A 4NNCA 4UTIA 4HIBA 1G67A 1HG3A 2EF9A 4BWLC 3NPUA 2VEPA 3MBDA 3LLFA 3GDMA 4O28A 4UR8A 3UZJA 1KTBA 5G5IA 1ZENA 4JTTA 4DXVA 2ZTJA 1N8FA 4IPJA 5IBXC 2QCHA 1FDJA 3TSBA 4AXKA 1SU5A 3MI6A 3N2XA 4Z0SA 4KWVA 1KLZA 2J9ZA 4UTTA 5LNRA 5F4XA 4RV8A 4X22A 1AL8A 1ZAHA 1LRQA 2NX3A 4WXZA 3P8IA 4H6KA 4PH6A 3W7IA 2F84A 3G18A 1GJPA 1KFEA 4E2DA 3BARA 1W3NA 1W31A 3T44A 2Z1BA 4K36A 3S1VA 3PC0A 3S1XA 4UTUA 1W3TA 1NFBA 2A7NA 1FDZA 1XBYA 3C8FA 1JCYA 1DJNA 4ORMA 3PG8A 2TMDA 1K8XA 4JICA 2E5DA 2VFDA 2DZUA 1RR2A 4GXMA 2CZFA 4LU0A 3LCLA 2ZCGA 4KFOA 4H3DA 3UPWA 4WY0F 4WY0B 3I68A 5HUPA 5D37A 1TPH1 3GDTA 3TQKA 3TSDA 2TSYA 3CTLA 5J5DA 2Y7FA 2YFNA 3TMLA 5HMSA 3TK7A 5BW6A 1Z48A 3UY8A 1M6JA 1GVQA 3PBVA 4X9SA 3PBYA 4LT9A 5LHEA 3W1XA 3W1MA 4POCA 1ME7A 3Q58A 3TKFA 4LC6A 2NX1A 3B4UA 1YTKA 3C4UA 4BR1A 3G3MA 4I9AA 2GJNA 1KW1A 3PY2A 1LOSA 3G0UA 3DGRA 1O5XA 4JY9A 3DXIA 3EX6A 1G4EA 1DQXA 4OV4A 3SY5A 1WOBA 3N19B 1W5OA 3RMJA 4FO4A 3TSMA 4UTWA 3H53A 5U4NA 2JGQA 1UCWA 1FXPA 4A2RA 4E0CA 3L68A 4K8EA 1VYSX 3SR7A 1RZMA 1OYBA 2VC6A 3CPRA 3T4CA 3GX9A 3DH7A 1Z44A 4LWWA 4UIOA 1WQ5A 2JK2A 3MI2A 2CZ5A 1ICQA 5HR7A 5I3KA 5F1UA 5CG7A 2H3BA 5AHMA 3KRZA 3ABOA 2ZZ2A 3T55A 3BLIA 4WZHA 2Q8LA 1TRDA 1IIHA 4IPIA 5HWMA 2RHGA 4JD4A 3NQ2A 1FWWA 4YLWA 3HQ1A 1GVFA 3K30A 3UYCA 1F5ZA 4O1CA 1ZJIA 1WA3A 2JKPA 5AHNA 1OK6A 3F4WA 1VLIA 2FTPA 4Y90A 3NQEA 1XL9A 3DFOA 1C9DA 1AL7A 4FIQA 3RF9A 4E38A 3C2OA 4E2BA 4M7SA 2AQWA 4IOTA 1ZALA 1XDLA 3DKLA 5D2TA 4R34A 3O6YX 1BKSA 2TYSA 3A24A 3NQ6A 1GYNA 4N6FA 1RD5A 2V0TA 1TTJA 1QOQA 2RDWA 3VE9A 3PSWA 2J27A 2PRLA 3MP5A 3IGUA 2VFGA 4OWGA 1EIXA 3DHDA 3A21A 3E12A 4O4WA 3TIMA 3EX3A 1DVJA 2NV2A 3HIJA 3LBCA 4IJBA 4LW7A 3R89A 1SZNA 3SSJA 2ZQ0A 1IXQA 2NXHA 3NQGA 1KFCA 4LVDA 1KA9F 4ZVJA 4IMEA 2O7QA 5D02A 1W56A 1B57A 5FESA 1D3HA 5HJLA 3QSRA 2DZXA 5D2XA 3W2UA 2YYUA 2H6RA 4ALDA 4FNPA 1JR1A 2QR6A 3WK1A 4ZQRA 4HNUA 2YXGA 1GWJA 4U4MA 4EIVA 4O18A 1UBSA 3HO8A 2YX0A 1LP6A 3N9RA 1TPUA 4CQAA 1VH7A 3TMQA 4JTUA
chains in the Genus database with same CATH superfamily
3NL6A 4KWUA 3VOJA 2OWCA 4ZOCA 3M1ZA 5JH1A 3W76A 2Z1KA 4DJFA 3UU0A 4F2UA 5GJNA 1ME9A 3VIJA 2VTFA 1GORA 3S6TA 4PCFA 3FJLA 3DHFA 5CZSA 3TROA 4DO6A 3UY7A 1ECEA 4WUIA 4UTHA 4MZ1A 5JVLA 3GK0A 3S8HA 5FJPA 2E7FA 2E1DA 2V8ZA 1QAPA 2HVMA 1QCWA 4N6EA 2G50A 4J3ZA 5LA1A 3S6DA 3A5VA 3FAWA 1MW3A 1XRFA 2Z1VA 5EMKA 4JIHA 4YVXA 1ISXA 3NYDA 2VC9A 3CU2A 3VCCA 2NLIA 1F3XA 1HZYA 1ONRA 2VNCA 1IZJA 3TCEA 2W27A 4ECLA 2D3LA 3AIRA 1TUFA 4LCQA 3LY0A 1CXHA 4M3PA 2ZDRA 2X0YA 4DBSA 1US3A 3FVMA 3ZT5A 3W81A 5LSMA 2HS6A 4M19A 3RPDA 2IMRA 4J5NA 2JIWA 3MCMA 3E6EA 4DUWA 3H26A 3N9KA 2GVLA 3G1FA 3EWXA 5A6SA 1R2SA 3GKAA 1OB0A 5KMYA 2XGBA 4IG2A 3W7DA 5I2UA 2GPTA 4JDYA 2IPWA 1QHPA 4RPPA 3H4XA 4Q6XA 1QNOA 5G4EA 2NQ5A 3TC7A 2NT1A 2HQAA 4EANA 5KETA 3MWCA 1EUAA 2XZ9A 3NM1A 3WELA 1A5KC 4C6KA 4W5ZA 3P0XA 1TKKA 4IIBA 4O13A 1XW8A 2ZA1A 1S3TC 3E02A 2GJPA 1F3WA 2O7SA 1TZ9A 5DLCA 4DJDA 3EDDA 1OC7A 2VGIA 4OKDA 2REQB 5ECUA 1DWJM 5EMMA 2PP3A 2VFEA 2XM1A 1AUSL 1GZJA 3LHTA 4O1DA 3AALA 1Q6QA 1GVRA 2NUWA 5C2XA 4R3UA 2ZBTA 4IIDA 3GW0A 2OYMA 2WJZA 1THFD 4JTEA 3TZNA 1QW8A 3BLFA 1VBGA 2VEIA 2X30A 4NG3A 2Y85A 2AKZA 1JNEA 2DSUA 1W0MA 1HNYA 3GAYA 3WF1A 4NQ1A 3F4VA 1CW2A 1NWUA 4LNCA 4BFAA 3GHUA 1TZZA 3OHIA 3L66A 4IIHA 3VKCA 4CD6A 1NELA 1M7OA 3WF0A 3TN3A 4C7GA 1C91A 1PVNA 2CIPA 3H6OA 4S3JA 3MBFA 4NUWA 1KM3A 3OTRA 4QGCA 4PUKA 1YPIA 3VKDA 1UR4A 2BDQA 5D2WA 2QEZA 3I3BA 4G8TA 4YJ5A 1K4HA 1US0A 4AEEA 1REQA 1LLZA 1G0CA 3LDVA 5IOBA 4B9ZA 1QPNA 4GIEA 4GJJA 4QG8A 5C54A 4ADUA 3L4XA 4FXRA 2FPVA 3CC1A 5G4WA 3LERA 3W7RA 3LI1A 1ZAJA 4A8IA 4W84A 1PCWA 1VFTA 4LUIA 4Y9NA 2EHHA 1RD6A 2YCLB 1KBKA 3NXFA 4AF0B 3UGRA 1TCDA 1VCGA 1L8PA 1F6KA 4ROPA 2FZBA 2VUYA 5FAJA 1VCFA 1E1CB 3VM5A 4U2YA 3GZ3A 4K37A 3D0CA 3S6OA 3SI9A 5B7ZA 1B30A 1XF0A 3WQGA 1QPKA 3PFRA 1YTEA 2IUZA 2IPJA 3UWWA 4IMAA 4OGZA 2UWFA 3M47A 4XTIA 2PEVA 3HZ3A 1XPGA 1W1IE 1Q66A 2RH9A 3EWDA 3NIYA 3WF4A 4GZ7A 2WPBA 3U7BA 4WLCA 2QCLA 2R8WA 4ZXLA 4MWAD 2J88A 4GO9A 4F40A 1UQZA 1K6AA 4AWSA 1WP6A 2J9XA 2P10A 5K4ZA 2P0OA 2VYOA 4ORIA 3EB2A 2OTDA 3W86A 4J3UA 1ZJHA 3HQNA 2JF7A 2Y5EA 3W84A 5MKGA 1KM0A 3GYCA 1XYLA 1QASA 1UKOA 4FXJA 2V5LA 6REQB 1TA3A 3T40A 2X09A 1V5XA 3QFEA 1W8GA 4HA4A 1AMYA 2W0UA 4E2OA 4TQTA 4GWEA 5DANA 1E0TA 3ITXA 1PUDA 3WBWA 5E9XA 5AVHA 1QNRA 3H55A 1OFDA 1JUBA 3TNBA 4DAFA 3EMZA 2FZ9A 4FX6M 2PPGA 1H5YA 1LYXA 2QPXA 2X1RA 3VIKA 5CJ5A 2Y8VA 2PDNA 1KB3A 5HINA 1JF5A 3K46A 3TOPA 4Q4MA 3HB9A 2PRMA 1TELA 3WQDA 3ZLHA 4TR9A 1OYAA 4HNCA 2G3FA 5I3HA 1IT7A 2IKJA 3G22A 2V67A 1KTNA 4GVFA 1F6PA 3T07A 5LNVA 1ZU8A 3RAOA 2C6QA 3KDNA 3NEHA 3PJTA 2YL5A 4XG1A 1KWGA 4AG0A 1NH6A 5E1QA 3WL1A 4DO5A 2E5BA 2PF8A 1UKQA 1H63A 4FEZA 3LK6A 3M41A 4CCEA 4F66A 3BGJA 4HJWA 5LZLA 4WVXA 1E70M 4AIBA 4AW7A 3NZPA 2GQ8A 4XD3A 4GNVA 2FZNA 3LLXA 4R27A 3T7VA 2DVXA 1OVDA 4QSHA 5A3HA 4XD4A 4Z1DA 1BEUA 4BF9A 1XGDA 3T2OA 3BXWA 1H62A 2Y63A 1LF1A 4DM1A 2OZ8A 3GTXA 1OCJA 2WNQA 4QAIA 4RXFA 5D8WA 2FPYA 1AD4A 1J0JA 3HG3A 4GHRA 4GISA 4UQAA 2QDGA 2NVAA 3NVDA 4JL1A 1Y0EA 1Z41A 2ZE0A 3F5JA 4O8RA 4CNOA 1Q6GA 2PTYA 4PYSA 3ZR6A 2B31A 4AY7A 3WDJA 4DF1A 1K8YA 4B90A 6XIMA 4WJXA 3BJSA 1ZUAX 3EOEA 4IUGA 4IMFA 1V4YA 3EB4A 3PNZA 3WF3A 4TUFA 5A69A 5H91A 4BZYA 3U4AA 4UCFA 4YNGA 1OX4A 3SSZA 1TPC1 1ZP4A 1IR1A 1JQVA 2NVCA 2TPSA 4FIRA 3ONCA 1NQ6A 2I9EA 3DENA 3NGJA 1W1ZA 2A3CA 4NJIA 2ZX9A 2IXUA 2YB4A 3O05A 4HPXA 4L6DA 3V35A 4XO6A 4BI7A 1GG1A 1C8YA 3VNDA 1DBTA 4MOZA 2BWGA 3H7VA 2BHZA 1YRRA 4AD0A 2A7PA 2IQDA 3LU2A 3NL3A 4AIOA 4ZTXA 2AL2B 1BYBA 3IS4A 1KRCC 3RILA 4TX6A 3W75A 3IIZA 5HBFA 1ZJAA 1UH3A 1DWHM 3VINA 2YYTA 4FLOA 2FVMA 4X61A 1PKNA 4M1RA 1TPVA 1R9XA 4OFCA 3S5OA 4EXBA 1LRNA 5TIMA 1MO0A 2D24A 4NP7A 4ZB0A 2RFGA 1OINA 3ABSA 1G69A 3MWAA 5BYWA 3F2CA 2VM8A 4LALA 2F6XA 3HMJG 4M7TA 1KV8A 2XN0A 1UBPC 3VIOA 5FJRA 5CPOA 1ME8A 1EF2A 2UZ9A 5HR6A 3B4YA 5AZ0A 1J0IA 1RBAA 1X7FA 2YLLA 1F4AA 2ANUA 3GDRA 4UMBA 3SADA 4O15A 2R91A 4RLIA 1WZAA 2FVLA 3TTYA 3O8AA 2OG9A 1LORA 2YIHA 4ZGYA 3RM9A 4UOQA 2BOEX 3ATYA 1HJXA 4D6FA 1OK4A 5D38A 2QCDB 1K9FA 3DHPA 3CV6A 1B3YA 5I78A 5L6UA 2FB2A 1FWEC 1BVWA 3II1A 1GVEA 2YFOA 3BANA 1PKMA 1W1TA 5D9PA 1EO5A 2CCRA 1NDZA 4JPGA 1KXTA 3VU2A 1EPXA 3ERPA 1OZQA 2HWGA 4NJKA 1K1DA 1XYFA 3DKJA 2PRHA 2V3FA 3EX1A 1DHPA 3N11A 4PMDA 2CLFA 3NPWA 3ZLFA 4FPSA 3KHDA 2V9DA 2V2HA 3CUZA 4PEKA 1M68A 4LYPA 1OQFA 4A3QA 3G0SA 2C19A 2VP8A 3KDOA 2YDRA 2ZWYA 2J66A 4HA0A 2GWGA 2WNZA 4UOJA 4Y6GA 3VABA 1ICPA 1JGMA 4RZ6A 4C6FA 4TOQA 1EXPA 1QPRA 3RG6A 1LWIA 2VZTA 3WJSA 1BWVA 1F7BA 3CH9A 4UTFA 1IGWA 1A49A 4JQ4A 1V3MA 3W4RA 3BLOA 3N1AA 3PZOA 1G94A 4QRNA 5JH2A 3A4AA 3GVGA 4LYQA 2REQA 3ZVHB 3R8HA 3AC0A 1T99A 3NSNA 2GDVA 5AC7A 3V4BA 3T0TA 1RQHA 3BCJA 3VD9A 2OKTA 3KEHA 3D6NA 3N9SA 1BTMA 3DBPA 3NG3A 1QXLA 4FZIA 3H2EA 3RU8X 4H19A 4AD3A 2YDQA 3HJZA 2X05A 2PTDA 4OT7A 5FEXA 2V30A 4FNSA 1C90A 3SIZA 3W74A 1SZFA 1XISA 5ABFA 3GWQA 3FGCB 2Z6JA 3U4FA 1IEWA 1V6TA 3EOSA 2F2HA 1P7TB 1XG4A 1EDGA 3B8IA 4M5PA 1XWYA 2J9YA 4FOJA 2C3ZA 3TNOA 1HJQA 1CGTA 4I7UA 4MY8A 1H50A 3HF3A 4J4KA 2ZA2A 4O10A 4AZGA 3TR9A 2EPHA 1Q7ZA 2QCFA 4WOZA 4QDPA 2POZA 3UG4A 2A1YA 3CUXA 3KCOA 1CB7B 1XIFA 2A5HA 2RDUA 3NQBA 4N9CA 2PTXA 5GJPA 5A2AA 2FFCA 3C3NA 3R79A 4WF7A 3W70A 1GQLA 3VIPA 1KBIA 4UC5A 3UWYA 5CC5A 5D04C 1BXBA 4GUJA 2D3NA 1FCBA 4FOUA 4N0RA 3MU7A 2OWXA 1XQKA 2B7QA 4EVZA 4KERA 4LAUA 2C79A 3OVRA 1XIDA 1MUMA 5CC7A 4DJFC 1M41A 4JEJA 1E6QM 1NDWA 4HCHA 5FIPA 1VCVA 1UOZA 3QV9A 1ODZA 4H01A 5AYYA 1IHIA 5I3GA 4JX5A 3TYDA 2I14A 3C2EA 1UMLA 3NAVA 1NVMA 4G9PA 1ESWA 1IEQA 2QGYA 5JXQA 3KP0A 1YIXA 1Q13A 4P7NA 1GOWA 3CV2A 1EQPA 4AIUA 5A8PA 1HL2A 4NKCA 5DBUA 2WKJA 2CWNA 1MZRA 2Q3RA 1P6CA 1XIBA 3BCFA 2XM2A 3NZRA 3KLLA 3OZOA 4S3EA 4LGXA 2X1UA 3UG3A 4JBRA 2CLKA 1WB0A 5G4HC 3HFTA 5G1TA 4OV9A 2ACRA 4HKPA 3KCJA 4RDYA 3TP4A 1DJIA 3PZIA 2E9LA 1O66A 4O50A 2VFFA 1E1EA 2QMJA 3SRFA 4EPDC 1X6LA 1AW5A 1UOKA 4RR4A 1QI0A 1DHKA 1UC5A 1M01A 1X1NA 2FHCA 3VNLA 1DYSA 1ML1A 2P1FA 2E67A 1OBAA 5TAOA 4ASTA 4DHGA 5LHFA 4H2CA 1AZ2A 1POKA 5C9WA 3THDA 2BY0A 4B15A 1E4IA 4GNJA 3A22A 3T42A 4JYFA 4JQ2A 1J0KA 2AAMA 3M0HA 1DKWA 3NEVA 3QKEA 3N2CA 4XAYA 5KINA 3P67A 3MTWA 4MB1A 4JR5A 4W4QA 1NU5A 1XC6A 2Z00A 1RJRA 1JDCA 4YMZA 4RJEA 3GFYA 3B04A 3GM8A 3LTSA 3E0WA 1IT8A 3WNMA 4D6IA 5AECA 1E51A 1QW9A 1W5PA 3EDJA 5LA2A 3G3DA 2CERA 3VKAA 1RH9A 2ZX7A 1LLOA 4UTWC 4IH3A 1Z3NA 4UNIA 4BKNA 5BOOA 1FWIC 4AF0A 1DJYA 1KM1A 2A0NA 3PS7A 4Q3MA 2Z25A 3UQNA 5AC6A 1EUNA 3VZZA 1OIMA 2Z2AA 3TC6A 3DG7A 1JD7A 3AS2A 4G1NA 1TR9A 4S1FA 3NQ7A 4AMCA 2ACQA 4GUGA 2Q71A 4DN1A 4JTRA 3I4KA 1UPMB 5DEZA 5EYWA 1SJCA 5J8LA 4PL1A 5T26A 4A2SA 4QIUA 3O15A 1H3GA 3D3FA 3B9AA 4L6OA 1NTHA 4WDTA 3ZZ1A 2CFFA 2FZ8A 4DBUA 3IVTA 3NM3A 1AG1O 4KW2A 3BVJA 3HV9A 2DDXA 2OEMA 4PUUA 2XTKA 1WKDA 3LGGA 5D32A 4JTCA 4R9OA 1R2RA 4PB3A 1QO2A 3SQMA 4GBDA 2A4AA 4EOUA 1J93A 1Z6KA 3UERA 2A3HA 1L8NA 4JIIX 1K7XA 4F0KA 2WV8A 1KKOA 1VZWA 1EJ7L 3UZYA 3C2VA 2EG7A 5FJTA 2QCEA 4KBXA 3RPMA 3W7CA 2BOGX 5G2IA 4B5VA 4DO7A 3USBA 3AICA 3GUGA 4IIGA 4ROQA 2DT3A 3VGEA 2OT1A 2DIEA 1TYGA 1N8WA 3POCA 5TQLA 2O92A 3BE7A 4N02A 1GKPA 1RA0A 1XCWA 2VURA 3LHZA 3EWBX 3SECA 5F4WA 3C56A 1EA9C 4I8YA 2EKCA 3OHMB 1TPEA 4QHRA 4AU0A 2DH3A 4PUDA 4AMAA 4PUMA 1KXHA 1LBLA 3EZ4A 3GDLA 3IVUA 4YPJA 3ZIZA 2ZZ5A 3MUIA 5CLTA 3TTOA 1LUCB 3E0LA 2DSVA 2VDIA 2WK2A 4XZLX 4CLMA 1E5JA 1FVPA 4M51A 2Q01A 1RALA 2C0AA 3O6DA 1RJQA 1HJWA 4GO8A 1D3CA 3D46A 1KCLA 2VR2A 4JHZA 4KFPA 1JGIA 2QUUA 3TJLA 1J2BA 1AQ0A 2VCCA 3CUIA 4JTSA 3WUEA 2ZXDA 3M0YA 4MIMA 4W8LA 3LCXA 3MC5A 1UKPA 2PS2A 3PWGA 4LY4A 1JD9A 5HATA 4H7ZA 3N3MA 1E0WA 1OIFA 1SO6A 5A6LA 1K9TA 4NYUA 2ZXAA 3B9DA 4TX8A 1GOIA 4NI8A 3OIXA 2ATSA 3FJNA 1MUWA 2D0HA 3KS5A 1TMHA 4UFHA 4JEQA 1H7WA 2KZHA 3CHEA 1EWEA 1W1PA 3PF3A 1Q6CA 3VNYA 3LGDA 4OBRA 3C8NA 2NQHA 2GUBA 3K4WA 1ZS2A 3NYZA 1JG9A 5ABTA 1H7PA 2Z24A 3LSCA 5EFFA 2FH6A 4NZCA 4ACZB 5FF3A 2VELA 4CKQA 2GVGA 4UQEA 4LAZA 1RCQA 3WJZA 4Q8NA 2C0HA 2D22A 1CPUA 2VGFA 4FLSA 1JDAA 3J7HA 4L9YA 4LS2A 2UBPC 3QZEA 4XTDA 3G8RA 1KM5A 2PGWA 1JULA 4HN4A 4PTVA 3SJNA 2VDHA 2B7PA 1NOFA 1L6WA 1OGSA 1XIGA 3PB2A 1YXYA 3DUGA 3AIVA 3ID7A 2OOFA 3W28A 1CGVA 3KBMA 2H8ZA 4AEOA 4A3UA 3WLJA 3DAQA 3AS3A 4UBPC 1MYRA 1J2WA 4AQLA 4YTSA 5DXYA 2B7NA 2GJXA 1W2PA 2GQ3A 4A4AA 4L9XA 3G1AA 1J9YA 2G4FA 4G1KA 4HPJA 5JMUA 1OF6A 2Z7KA 3DYMA 5FF4A 5HQMA 3IEBA 2J7CA 4KGLA 1XUUA 2HE5A 1CXLA 2XN1A 3B8VA 4V28A 3E2SA 2PU0A 2WMIB 1LWJA 4O1EA 1HVXA 5DXXA 1H0GA 2DT1A 1RBLA 1BFNA 2WM1A 4K1WA 4WKAA 3MCNA 4K39A 3GS6A 3NJ3A 4J35A 1XLJA 9CGTA 3CQJA 5EU9A 1SR0A 4WDXA 1CGUA 3W37A 2D2GA 3G6MA 3MMWA 4L80A 1EEXA 4YVVA 2UY2A 1M7XA 4CD7A 4PSRA 4YXGA 4YCPA 1XYAA 3VZYA 4CQ8A 1GEQA 1E1FA 4AWTA 1YPFA 1PEZA 5DMYA 4PGLA 3SW6A 3RCNA 4FOKA 1MNZA 3E2VA 1BQGA 1A4MA 8A3HA 1K02A 2R94A 1XM3A 2W9MA 1O1ZA 2HCVA 1EEPA 3KWSA 4JTAA 4IJRA 1M65A 2XDFA 1HKIA 1RAKA 4KT2A 3TWAA 3TYAA 2OSYA 1DWFM 5F7UA 1RVKA 1SM9A 3QW3A 5M1TA 3A9IA 4MKSA 3PNUA 2PDXA 5EMYA 5IBXA 4AISA 4MNLA 4NZ4A 3P8JA 3TLLA 1W5NA 3OPSA 1EJUC 1V0LA 3AMDA 5H8MA 4FX8A 4TVUA 3GNOA 4D6JA 3EOUA 4DNHA 3E5BA 1V6UA 4M56A 4PCPA 3L0KA 3OGSA 3ZVIA 1OCQA 2HNHA 4FHAA 1W37A 2DV0A 3H2MA 4BK9A 1NOUA 4PBFA 3W83A 3KP1A 1XLMA 3MDUA 2QV4A 1HG3A 5DO8A 4AX7A 1W3JA 4BWLC 2VEPA 3LLFA 3U2CA 2ZTJA 5IBXC 1FDJA 3TSBA 1KLZA 2J9ZA 1UWIA 1LRQA 4A35A 1MW1A 2V69A 1KFEA 1W31A 3T44A 1MMFA 2HXTA 3S1XA 1UD3A 1CGXA 2A7NA 4S3CA 1B3ZA 3MO4A 1DTUA 3C8FA 1JCYA 1SVDA 3WFLA 5I0DA 3AIBA 3PG8A 3UETA 5FJOA 4LU0A 3AROA 3H2OA 3CPUA 4A3YA 4JFTA 4WY0B 3SUWA 1OG6A 3T1GA 2HE8A 2O9PA 4GIAA 2TSYA 5C0QA 4RE2A 1K8CA 4TVDA 4ERAA 2ZIDA 5HMSA 4C6JA 3PZUA 1GVQA 1NJJA 1JL8A 4PMRA 3WQFA 1E6XM 3WDIA 4QQUA 4POCA 4J3WA 5C8BB 3L4YA 3TKFA 4LC6A 2NX1A 1GGOA 1YTKA 3TEVA 4BR1A 1CT5A 5D9NA 4H9YA 2AOSA 1OSEA 3RIKA 3EX6A 1DQXA 1AJZA 2GJRA 3M6DA 3GC4A 3H53A 2JGQA 1FXPA 4A2RA 4K8EA 1CECA 2E40A 2INZA 2VC6A 5AYBA 1KXQA 3RX2A 3GRIA 3ZJ7A 1Z44A 1WQ5A 1VBUA 7REQB 2CZ5A 2J25A 5I3KA 5F1UA 1Z32X 2H3BA 4GACA 3KRZA 3P14A 3KLKA 1E3ZA 1TRDA 3IJIA 1IIHA 2J7HA 1GYMA 4ZTYA 3VILA 3GXIA 3SY1A 4ICMA 5LIKX 5IDZA 3GTIA 1F5ZA 4KESA 3HPAA 4FI4A 4HHLA 3V0TA 5CXPA 5AHNA 1OK6A 4W7VA 4J2PA 1VLIA 1EQCA 3QV7A 1XL9A 1P6BA 3NWRA 4E38A 3DBNA 4E2BA 4M7SA 2AQWA 1CXFA 4IOTA 2NW0A 2FTYA 1BKSA 1SJBA 1OC6A 1XGZA 1RD5A 1K9DA 1Q2SA 2PRLA 3H4GA 4OWGA 4HP5A 3S2LA 3ZQ9A 3ITOA 1OZMA 1GOOA 1XP3A 3H23A 4IJBA 3R89A 5XIAA 1SZNA 1R85A 1ZGDA 2NXHA 4ZVJA 1CXKA 3OP2A 1ZBCA 2O7QA 5D02A 2YL8A 3MKVA 3AU6A 1B57A 5FESA 3QSRA 1C8QA 2VX4A 4L9ZA 1ONWA 2QW5A 3LZ3A 1QTWA 1JR1A 4CN4A 4QEEA 1OADA 1WDPA 4QG9A 2FZMA 2EG6A 4QCFA 3MUAA 3M0KA 3QHOA 2NV9A 1TPUA 4C1NB 1IEIA 1DL3A 2PDMA 5C7HA 1I4NA 5ABGA 4DI9A 4PMUA 1GTHA 5A8QA 1E71M 1WBHA 4AB4A 1DE5A 1WKEA 1VPXA 5U7SA 1U33A 3JZUA 2HVNA 3ES7A 3TONA 2VWTA 4G5DA 1WXYA 1GQIA 1P1MA 1XR2A 4XV0A 4MB5A 1K70A 4PUJA 1FDYA 4KKXA 3EA3A 1M1BA 1W9UA 4HPGA 5MKGB 3UR8A 2ZX6A 3VPLA 2RUSA 2MNRA 2HMCA 5G1MA 3STCA 1KBJA 1QR7A 2HV5A 3WMBA 2EPMX 2NQ9A 2PTZA 3TN4A 3IJ7A 4MGGA 4H9ZA 2PBOA 2QT3A 3C2RA 1VB9A 4HD5A 4J1OA 1W5QA 3OGVA 4AD4A 3NZGA 1KR1A 4KS0A 3PSVA 4CQBA 1MEWA 1MXDA 1NWTA 1J79A 3WQ5A 1FCVA 4QS6A 4M81A 3VD7A 2QUMA 1Y8BA 4XSMA 3A3WA 3LQGA 4GYPA 3TQ0A 1XLGA 4PFMA 4WRHA 5DX7A 3N73A 1R2TA 1FFRA 1ALDA 2GVJA 4LS1A 1WNOA 3IGHX 1E0VA 3UGVA 5E93A 3LRLA 5E9AA 1KM2A 3NL5A 4PUWA 3HQOA 5EB8A 1UMYA 1G4PA 5A6JA 3AYVA 4BA0A 4DYJA 2CBUA 3T0DA 2ISDA 2MANA 3CH0A 1XS2A 1GONA 3QGKC 1KM6A 4RW3A 4S39A 4AAJA 3RM4A 1H09A 4MB4A 3CK5A 3WMSA 3QGVA 3FYOA 2IKHA 2IPGA 5M17A 4F0MA 4ZCWA 4MNJA 3M5VA 1ITXA 4KFNA 1KFJA 1GOMA 3QGAC 1EYWA 4Y7EA 3PPCA 4C5ZA 5DCDA 3CQKA 2GDQA 3LCGA 3S47A 2OELA 2CLEA 5DMLA 1P0KA 4I3GA 1HVQA 3TN6A 1FWBC 4X60A 4AVFA 5DFAA 3HG4A 2GOKA 1CTNA 3GVWA 4AY1A 2DU2A 5FL1A 3RNDA 4L1XA 1XJBA 4MY9A 3W1TA 3CLMA 4UQCA 1EXBA 3S46A 2QUNA 3W2LA 1WDRA 1FHVA 3SGUA 3PBMA 4S23A 3R5EA 4DWSB 1JRCA 1WDDA 3IJ6A 3NPVA 4JFSA 4XWUA 1IE7C 2Z6IA 3OJGA 1AZ1A 4PB5A 5G2HA 4ILSA 1F76A 1UH4A 1PTAA 1M7JA 3N3TA 1CB2A 3TE9A 3HMCA 4H9TA 1G4SA 4X9YA 1F2JA 5HJYA 3N14A 2X8RA 1FHLA 4HYWA 3AWOA 2E6FA 1W3IA 2OWWA 4MUPA 3B8DA 3W6LA 1H2JA 1C7TA 1EBGA 4I7WA 4UFKA 5EBAA 3CEPA 1VF8A 1UWRA 4LB4A 1VFSA 4GJ1A 3ZR5A 2OXNA 4JNYA 4LOCA 3MSYA 3R43A 3O06A 4GZIA 4AC7C 1RQBA 1OHLA 3FV9A 3LB0A 3THAA 3KVMA 2VGBA 1TJ2A 1VFMA 4UTJA 2PWUA 4NJHA 2CHNA 2XPKA 3VVGA 5AC5A 1W1VA 2OSWA 4IIEA 4P8XA 3CAVA 4QLLA 2BHYA 2DZSA 4LUTB 4G2DA 1DV7A 3S5NA 3UWQA 5TNVA 2WMHA 1G1YA 3QM3A 1L6SA 4HNNA 4JQAA 1HO4A 3PUEA 5A6BA 1AQHA 1V51A 1GCYA 1I0DA 1S1PA 1TPDA 2BXZA 3WK2A 5AHEA 1FWNA 4WR3A 3FJ4A 5ABFB 3QYQA 3T78A 2C91A 1F73A 1D7KA 3WQPA 3KTSA 2ZRUA 3APYA 4GI8A 1ICSA 3AHVA 4XVDA 3TAOA 4NZJA 1SYTA 1WO2A 2EXOA 3WY1A 4XAPA 3GFXA 3GH7A 1ELSA 3ALGA 3MJYA 3WLQA 4EWND 1HUVA 3GQYA 4PA8A 3SFKA 4JTFA 4DJDC 1MXGA 3UJ2A 4ZSUA 3VDHA 2AQOA 1JDFA 1A5AA 1BLIA 3CL7A 3M7WA 3APTA 3RDKA 3UA4A 4R53A 1IWAA 5K4XA 3UG5A 4R7WA 4L61A 3G2GA 1B4KA 4GIYA 4Y9AA 2Z1XA 4D2JA 4MJMA 3BLKA 3Q65A 3KBVA 4DBWA 5CKSA 4H6EA 4AH7A 3W7EA 5ABHA 2OZ3A 5EA9A 5CGQA 2DZWA 3ELFA 1YBQB 3VCRA 4GGBA 4KPLA 3URNA 4FALA 1B4EA 5DT7A 3ABZA 4RNFA 3JRKA 4I6KA 2YCIX 4FF7A 2QF7A 4A3RA 1JZ8A 1GJUA 2PUZA 1SJAA 4NRSA 3VNKA 2PLMA 4ES4A 5I02A 1XIHA 1IXOA 1TJ1A 1AW1A 3BAWA 3CIWA 4H9MA 3GXFA 4JY8A 4GFSA 4HYVA 1Q63A 3PK7A 3GXPA 4K8HA 3E0FA 4C1KA 3QV8A 3EPOA 3WJYA 4QNEA 3EXTA 3KHJA 4PTXA 4PL2A 2QUTA 4LH8A 4H00A 1UYQA 1QJWA 4AY8A 3L2LA 3BLEA 1XQLA 3LI0A 3ZVHA 5MF5A 1VBRA 1FH8A 2Z27A 3IGSA 2WSQA 1R8LA 4JZ5A 4AYGA 1UA3A 3LPGA 3PULA 3VDAA 1V03A 2WANA 4HA1A 4E3TA 2FTWA 3ALFA 3U57A 3LHVA 3IPWA 4H4IA 4JKKA 4HTYA 4EKJA 4ZO6A 4C1LA 4EF9A 3TJ4A 3VZXA 3BQ6A 2V2CA 1GVOA 1JIBA 1PDYA 4HNTA 1XLBA 4QLKA 2XWEA 1WBJA 1M5WA 4K38A 5BRBA 2ZUTA 3ENLA 3CIXA 3NQVA 4E4FA 3I6RA 1EO7A 2OB3A 1Q6LA 4GIRA 3FHAA 5CCZA 1T41A 2GJLA 4ZQNA 3WN6A 2E77A 2YA1A 1PZ2A 4R85A 3PB0A 5IM51 4NAFB 1TX0A 1V3KA 3ZSSA 1JVNA 1G7UA 4WDWA 3IJDA 4R9XA 2GSHA 3LPOA 1A3XA 4GY1A 2H9AA 1S46A 3PJXA 4JX4A 1MFUA 1NSJA 1SMDA 1KM4A 3GC5A 1QNPA 2VCAA 1W54A 4PTDA 2WBGA 4F4RA 2J79A 1NDYA 4IF2A 1XC4A 1UROA 1ZY9A 3TU9A 4DB7A 4TIMA 3OBEA 4JYDA 3CMJA 3WCZA 3S9IA 2LLEA 2VXNA 2QDEA 1VJZA 5BXRA 2XH7A 1OFOA 1B5TA 4HSOA 2VR4A 4S3GA 3L12A 3GHTA 3CPGA 4HHHA 2BMBA 4BF5A 4FK9A 5LNUA 1DJZA 2V82A 1JYXA 4HT3A 3S83A 3KTCA 3BV4A 2VENA 1A50A 1EJXC 2ACSA 3TFXA 1X7IA 3SCPA 4XZWA 3ITVA 3VGBA 2ZXQA 2VOMA 3TQVA 1U5HA 1LBMA 1VFLA 3BLPX 5FF7A 4I5XA 4HPHA 4H8HA 3NA8A 3EAUA 2YKKA 1Q6OA 1NWRA 2GUYA 3OBKA 3W73A 3R1ZA 2PDYA 3EDEA 4XD5A 5HQLA 4U31A 3AMLA 5FAGA 4FP1A 1J6OA 2HXUA 5AC8A 1QHOA 3BICA 4XVEA 3ZR4A 3M16A 5AYIA 4F3HA 4PC8A 1NARA 1X39A 1ZB5A 3KUMA 3WLRA 3PZGA 1XD0A 2PB1A 3V1PA 2W92A 2HTMA 3TZFA 1A5OC 4PMYA 3DC0A 1WDQA 4LYRA 1BGGA 2F9RA 3W85A 4JNZA 1GPWA 1TQXA 2VDGA 3BDKA 2PMQA 3VI2A 1XLLA 4IP4A 1G4TA 1OFAA 2OLSA 3JZEA 1KCXA 4PTMA 2Y1HA 3VOHA 5KZMA 4NT0A 3ARRA 4EAYA 5HPCA 3TAKA 3FVDA 4K68A 3REQA 2DZTA 2GDUA 3OZPA 2QDHA 2CLIA 4C7FA 2W67A 4LPCA 4YTUA 1K4GA 3LS9A 4XIAA 2ON3A 4ONVA 1HX0A 3IIXA 5FF2A 2OZ0A 1DJGA 1TV7A 3UWEA 1ZCOA 5E0FA 2AAAA 4HU4A 3LPFA 4JIPA 4L4MA 2EQDA 4LCRA 3S5SA 1RA5A 4JXCA 3A5FA 3WK3A 3R0KA 1TO3A 3AUOA 4IM4A 4ZQMA 3UVAA 1IV8A 3AU2A 5E09A 2CLMA 3OB8A 5JUVA 3H54A 1J11A 4PMVA 2YA2A 5C9UA 4Q4PA 3P84A 2W63A 4L7ZA 2DVTA 3AMGA 3G0XA 3RLUA 3WLNA 2W6RA 1A5CA 3MY9A 3W2JA 4WY0A 3MMTA 3A4XA 3P93A 4ZB5A 4ENLA 5CZ0A 3IV3A 4IGMA 4EPEC 2JKEA 5A8MA 4XO7A 2QHAA 4ICNA 4FNRA 4UR9A 3MSGA 4M1BA 4GVIA 4TX9A 1Q65A 3DFPA 3QN3A 3W1LA 3N6JA 2J24A 4V27A 2HBVA 4Q4QA 4Y8FA 4GH3A 3CZLA 1A5MC 4HHMA 2FQIA 4CUCA 1YTDA 3DESA 2Y7EA 1Q7MA 1L6GA 2QPUA 4A29A 2QAPA 4GQBA 5TD4A 3HGJA 1T7LA 4PBGA 5HDRA 2ZUVA 5I03A 2BY1A 4DJEC 3PJUA 4WK9A 4F79A 2G96A 2GQAA 2VRQA 1FHUA 1ZP3A 2FYMA 4MMWA 3UWUA 2V2DA 4C91A 3U5YA 3B97A 3L5AA 1LL7A 2JALA 2AMGA 2NT0A 3UZZA 4N9DA 3W0KA 3ONBA 2CKRA 1PAMA 4IX0A 5CSRA 3FK4A 2KX9A 3RFAA 1R47A 3RX4A 4DRSA 5A6AA 4DYKA 1TWDA 1V6YA 2HJPA 2R14A 3AZRA 3F5KA 1XCFA 2YBUA 2A6NA 2IKGA 3LXBA 4JX6A 3COTA 4Q33A 3OZYA 3SJ3A 1R0MA 2Z1WA 4MJ4A 3MP4A 1P6WA 1YXCA 1JZ5A 5ENLA 4MLRA 1N82A 4B5WA 4N42A 1E9YB 2B7OA 2QXWA 2OPJA 3UJFA 4AHQA 4QE1A 3W71A 1QWKA 1BHGA 4KEUA 2PD5A 3BWWA 1BYCA 3AHZA 4OUIA 2WMJA 1E9ZB 1JFXA 3OEXA 4O12A 2BZNA 2ZADA 2FFIA 5HAOA 3WFZA 1KKRA 4MJ2A 1UZ1A 2UV8G 4V1XA 5IFTA 4B5SA 4M6VA 1CGWA 4QBXA 1XLAA 4S38A 1HT6A 3MO7A 3PUOA 2Z26A 5F2MA 2VUNA 4DBDA 2VFHA 2YCJA 2ZRZA 4UQ9A 3GSMA 5AOUA 3OIHA 2G8ZA 2WAGA 2R9RA 2YPIA 3L0GA 4ATLA 1UWSA 3FYPA 3TX9A 1RPKA 4NASA 3CHDA 1M7PA 3ITTA 4K8GA 3LHUA 3P81A 3SN1A 3STPA 5BRPA 1LBFA 2DUZA 1TRIA 3L7RA 5EL1A 4GLEA 1RP9A 3SFWA 4XBKA 1E3XA 3THCA 4JHOA 1V3JA 3OG3A 1MEIA 3BZJA 4GI4A 3UR5A 2WPGA 3V75A 3M0VA 4B5XA 3JS3A 1XPYA 3FX4A 1JCLA 3FKKA 3PM6A 2O0TA 2PFHA 1UD2A 2PDUA 2BGQA 4MPKA 1E4NA 3WLMA 3UR7A 1GTEA 2BASA 4GUHA 2XWDA 4W85A 2DZPA 1BF2A 3BLDA 3SCNA 1ZQ5A 1H51A 2GVEA 2RAGA 2CETA 4D72A 1Y7VA 4R88A 2E6DA 3VGGA 4FNQA 3M0ZA 2JIEA 2R1PA 1MEHA 3BMXA 2CBJA 3MI3A 2HK0A 3BW2A 4DZAA 4RZ5A 1KTCA 1U83A 1ADOA 1DOSA 1I45A 4F0LA 3VOGA 4DWSC 4IFRA 1K9EA 2BG5A 3HV8A 1YNQA 2HK1A 3DX5A 4NAEB 4REQA 4CU7A 4ZFCA 4Z2IA 2F6KA 3KBNA 2VEMA 1XSKA 4HN8A 4H9UA 1OFEA 3WLLA 2MUCA 2XGZA 4UQDA 1IWBA 4WJEA 1X96A 4A8RA 3H7RA 3WMCA 4AIEA 4AZCB 3MDWA 3LGEA 1GVYA 3FSUA 1XG3A 3F4CA 1GK8A 2AGKA 4HVXA 3GIQA 3OBAA 1OFRA 4TV6A 3ZT7A 4Q7NA 1RPXA 1FX6A 1E55A 5I5RA 3I65A 2V5KA 4HK7A 4JTDA 1I2OA 4DPQA 3LMZA 2J6VA 2PC8A 2JE8A 1FQ0A 4A05A 3C5QA 2V81A 2X42A 3LSBA 3K13A 3SY8A 3C6CA 2UY3A 1LTDA 3BLLA 2V5JA 4RNHA 4X63A 3MSRA 1WPCA 2A6LA 2P53A 3WSUA 3FSTA 4N9EA 4AYSA 4C6MA 4DWSD 1PS9A 3OYXA 2WSYA 1WUEA 1ZHAA 2CZEA 4V33A 4CNPA 3KRUA 3T8LA 4ZBCA 3BTNA 3BGAA 4CVWA 1PHWA 2XVKA 1XGEA 2DIKA 2W61A 2Z1SA 5AFDA 4DNMA 3D3AA 2WOQA 3HA1A 1RSCA 1UC4A 5DBTA 5H8PA 3L2IA 4LUSB 5CGTA 5LIWX 3GDKA 3W2KA 2O56A 4RK8A 1R87A 3BV7A 1JYVA 5F2GA 2YCLA 4HCLA 4EX4A 2WZTA 5FA5A 3LQLA 5FOOA 3FEMA 4XAGA 3BAIA 3OVGA 3N25A 1EPVA 3UD6A 2YDAA 2VD8A 3SGZA 3PBUA 2PDQA 3GVRA 2WHJA 4IP5A 3TA6A 3AMKA 4HZMA 1VRXA 1LM1A 5CSSA 1LOQA 2NWRA 3LEPA 4PCNA 3ITCA 1CLXA 3NL2A 4F48A 3RR4A 5DT5A 2YCKX 3ZYZA 2W5FA 4MKVA 1H0IA 2Y6ZA 4C65A 5SWUA 3P74A 1ZBWA 2YB1A 1E9LA 4IGSA 2PDHA 3PWAA 4GGHA 1X6UA 1XKYA 1VBJA 3S5YA 1TR1A 4XZBA 3GVQA 3G1XA 3K1DA 1ZNNA 4HMNA 1V08A 2CLHA 3CT2A 4UZUA 5A6TC 1Q3NA 1PDZA 4YYCA 4AXNA 5A6BD 1G5AA 1Y65A 4AHOA 2XVGA 3SAZA 3PP7A 4LVBA 1TA3B 1EF3A 2VCBA 3CZEA 2PBGA 1JPDX 1F61A 1VPYA 2EPOA 5KZDA 3AQUA 4QR6A 4Z0JA 3WH8A 4ML4A 4NNBA 3B06A 4NVTA 1J5SA 1NY1A 3B0PA 3CO4A 3IANA 2QUVA 3QMSA 3WJWA 4QROA 4CNUA 4D8LA 2OO6A 4BQ2A 1OD0A 1RJPA 1RXOB 3V0SA 3AYSA 2FJKA 2W66A 4DLMA 2FGZA 1FCUA 3C2FA 5BOEA 1W5MA 2DPEA 4D6GA 1I75A 2UY5A 4IP7A 3T2PA 4K1GA 2WQPA 4Q4KA 3W7PA 1P0DA 1F8IA 4NZ1A 3E3HA 2WNNA 5D9OA 3F4NA 4ACZA 4DO4A 3BMVA 3BJFA 2VZUA 4IG2B 3TXZA 1E1CA 3TV8A 4Q32A 4LAKA 1DIKA 5H6HA 3M0XA 4ML9A 3T6CA 3O6CA 2DZAA 2FPTA 5HMFA 2F6UA 3PPFA 3F5LA 1TTPA 4RXGA 4JS3A 2HBXA 4CQDA 1V3HA 4AFYA 1F8MA 1DQUA 5I00A 3VD5A 1S1RA 3QTGA 3QY8A 1SR9A 4LVAA 3TR2A 4M82A 4JTKA 4JIEA 1AMKA 4DJFD 4FA3A 3IV8A 4Q8QA 3EGJA 5ABEA 1TZ7A 3N4EA 3L21A 3ZMRA 4PBEA 3C3UA 5FJJA 3TUUA 1JI1A 1NIUA 1S2UA 2WCSA 5FCZA 3CWNA 2ZUUA 2CITA 3PN8A 4H8VA 3HFYA 3NFUA 5CG0A 4GQQA 4PEEA 3QPZA 4AZ5A 4KEMA 2GLKA 4P8WA 4ZA0A 5CSUA 3I6EA 1CIUA 5GVJA 1W8SA 3PZMA 1QI2A 1U2YA 2IPFA 4NRRA 1UR0A 1HIZA 3TN5A 3UWVA 1TPFA 1KRMA 3M0JA 2NUXA 4PMJA 1OEPA 4IMGA 3IJQA 1VFHA 3VKJA 4QE4A 2VR5A 4GRSA 1SFTA 1ENUA 3M5XA 4K7VA 1E5NA 2DJXA 5DY2A 5DN1A 2CLLA 4QM1A 1ITUA 3ARUA 4J7RA 3PVFA 1QT1A 3UBPC 3EMCA 1FCQA 1O6IA 3LUTA 4LX4A 4IFOA 3UXIA 4CNSA 1E6PA 4JIQA 3QVQA 3A64A 1ZL1A 3P5ZA 3EWWA 4OOUA 3OW1A 5AY7A 1Q4NX 1P5BA 1R3RA 3ZT6A 1HL8A 1W9XA 1U1UA 2WXDM 3UNDA 1POJA 3AHXA 3UG8A 4LFYA 4P7LA 3R58A 3VX1A 3HPZA 4JN6A 3GR8A 3AIWA 2R1KA 2XUCA 2AMXA 4OHQA 4S3BA 3ZWSA 3IJ9A 1IEVA 1EGZA 3MUCA 3VOIA 4JTJA 1JXJA 2PU1A 1E0XA 1FRBA 1IIGA 5FEPA 4PRTA 1V93A 3APGA 1UZHA 2PDFA 4H6QA 5KZ6A 1FA2A 3NPXA 3A9BA 3H2NA 3VNZA 3T8QA 2EEXA 3FA5A 2Y4SA 4M24A 3GHSA 2GK1A 3RJYA 1DE6A 4I9JA 3MBDA 3GDMA 4O28A 1D2KA 5IFPA 4JTTA 4DXVA 4ZE5A 4IPJA 4EXQA 2QCHA 4AXKA 2Y5JA 3RGTA 3R25A 3QXBA 3BSMA 3S4TA 4KWVA 9RUBA 4UTTA 4X0NA 3VIGA 5BRQA 1ZAHA 4DX3A 5BCAA 2X7VA 3W7IA 4DIAA 4YYFA 2O4MA 1JZ2A 1GJPA 4B4HA 2AGTA 1NFBA 4S3DA 3LNPA 3RN6A 1FDZA 1XBYA 4D9PA 4P7OA 2R1NA 5C9XA 5JBDA 1TMLA 1DJNA 3E74A 1FKWA 4ORMA 1WKFA 2E5DA 2NVDA 2VFDA 3NURA 2CZFA 2BVTA 2GSEA 4KFOA 1YPXA 1HF6A 1X38A 3UPWA 1HL9A 1TPH1 3GDTA 3TQKA 1H1NA 3CTLA 2J75A 5J5DA 4B3ZA 2Y7FA 2YFNA 2NQZA 5BW6A 1PWLA 4KETA 1M6JA 1QK2A 3P2VA 2QNEA 2PLJA 1S2AA 4AZBA 5CPTA 4OBSA 1EX1A 3C4UA 3NTYA 1ZJBA 4I9AA 3W29A 1XRSA 1KW1A 4H2HA 1LOSA 3G0UA 4G6CA 3DXIA 3SUSA 3TTQA 3XINA 3IAQA 1R3SA 4OV4A 3SY5A 3N19B 3N2TA 3TSMA 5CPSA 3U2ZA 4E0CA 3L68A 3CWHA 1VYSX 1CLVA 3LBOA 3PTMA 4GPNA 2INFA 3CPRA 4PB4A 3T4CA 3DC8A 3DH7A 3PJWA 1ADSA 2BB0A 3MI2A 1ICQA 2WVUA 4GMEA 4HSHA 5H1WA 3UXLA 5CG7A 5AHMA 1W2VA 5CPQA 4OOZA 2Q8LA 3PFMA 1JEZA 1KO0A 2QS8A 3MV01 1AQFA 4HCDA 2RHGA 4URIA 3K5XA 1B3WA 3NQ2A 1FWWA 3HQ1A 3UYCA 1D8WA 2PZNA 2QF8A 3CNYA 1XFCA 1A47A 1WA3A 1QNQA 2OLAA 4U2ZA 4Y90A 2PODA 3VXGA 4A8NA 4GC3A 4DJEA 1XV8A 4AVOA 3DKLA 3FHQA 4D1JA 4LEQA 3MKKA 1GYNA 3AIUA 3U3HA 3WG6A 2WMIA 1QOQA 4JTQA 5E0CA 5C7VA 2G3NA 1B0IA 3N4FA 1A0DA 1ZBKA 4Q6JA 4O4WA 3OOQA 1KGUA 3IARA 3AMCA 2DQWA 3DIPA 3OODA 1QK0A 3SSJA 3VCNA 4QLJA 2ZQ0A 1IXQA 1VJSA 1GOKA 4IMEA 4LAMA 1OT1A 2X1IA 3CUGA 1D3HA 4U10A 2DZXA 5IHRA 3EKGA 4H04A 2VX6A 3NDYA 2H6RA 3VDGA 1QI4A 1V6VA 4BQ4A 2QR6A 2NQJA 4HB7A 1BAGA 5FJIA 3VNMA 3W82A 4CQAA 1VH7A 3EEZA 1AJ2A 4NAFA 4JTUA 3PZTA 1X98A 2FMNA 1H41A 5A6KA 4W8AA 2ISSA 5AB3A 3WQOA 2DUAA 3WFAA 3NGFA 5GQBA 3T2QA 2EPNA 5RUBA 2PDPA 4ZOBA 4L6HA 3QLDA 4PUNA 4WX2A 4DF0A 3O1NA 3MHGA 3PAJA 2G4JA 1P7TA 3CQIA 4E6MA 2W3ZA 2VVSA 3TJXA 5M5DA 3NSXA 5HNRA 3LV6A 3G1YA 1UG6A 3H24A 4NYYA 1FHDA 1Z8AA 3FXGA 4IQEA 1IYXA 4MB3A 4Y9MA 2J74A 3B8TA 4IGNA 2BS9A 3VK5A 1FFQA 3W1RA 3TOYA 1UW9A 1EJRC 3LTPA 3GAKA 1A3WA 4ZE4A 2V3EA 4IFKB 3N04A 5D03A 4OE7A 3BW4A 4ZZ9A 1K3UA 3CAWA 4C6OA 4AEFA 2X7WA 5A2CA 2ZWZA 2WC4A 6REQA 4JN8A 3WLHA 3TVAA 3GNDA 1QDSA 3O3RA 4W89A 1O68A 2WW5A 4YTRA 1EGVA 1RUSA 3OA3A 3L0NA 4MNMA 4OTKA 2A21A 1A4LA 3IUHA 1GVSA 4ZEPA 4G7FA 1MQRA 2ZX8A 1CXEA 3HGOA 4OBTA 1DWAM 1JZ3A 2A85A 2BOFX 2DJLA 1LZOA 3WNPA 2X0SA 3JUGA 3B0UX 4JNMA 4WHBA 4PMOA 1R5YA 4HSNA 4OQVA 2OX1A 1S2VA 3GR7A 5AKQA 2PI6A 1C92A 4TV5A 5XIMA 3KOYA 2BODX 1RLCL 1XXXA 2XHYA 1JUEA 6XIAA 1MRAA 4IMCA 5EMLA 4LBUA 1H60A 3VYLA 3LTYA 1C7SA 5I7GA 5LNWA 5C70A 5FSDC 3IVSA 1VFOA 5REQB 3EX2A 4CCZA 4L4LA 1O12A 2D2JA 2E25A 4U5IA 3W00A 3G1DA 4W93A 2XIIA 2Z2BA 3WH7A 1YDYA 4X2PA 2PDCA 1SO3A 3CMFA 5J5RA 1ONXA 3W72A 5C2GA 3AS1A 3ANVA 2FLIA 3A23A 5K9XA 4QDMA 4KWWA 4F9JA 3G1VA 4QISA 4KQNA 3SRDA 1XFBA 2F61A 2L5HA 1ITCA 2YCEA 4L5ZA 3WDRA 3VD3A 3LD5A 1YNYA 3SUVA 3RM8A 4O57A 1KD0A 3UJSA 4HA3A 2E09A 4LY8A 4YL2A 2PGFA 1HKVA 1J6PA 1JPMA 5K9CA 5FD0A 3CS2A 5FACA 3OA5A 3PZNA 1UUQA 2ZFAA 1UJPA 4P5UA 2XFRA 1JCNA 5AHFA 3GE7A 2FIQA 4WOQA 3FKRA 4LVFA 4JFWA 5LKYA 3GU1A 3MHUA 3UJRA 4Z1AA 4B5NA 1NAL1 3NSMA 1GQJA 3P3BA 2Q02A 4YWIA 4Q7IA 1N55A 1LUCA 3S1UA 1VBHA 2WCGA 4EPKA 2BLEA 3FAXA 1TJPA 2GWNA 4DUVA 3DI1A 3IJLA 1XLIA 1EZ2A 3VTRA 3RITA 4MG4A 3THUA 3CUHA 3VFLA 1X6NA 4WDUA 3BMWA 3M4HA 3U6WA 2WHKA 1TREA 2NQLA 3NO1A 1JI2A 1PTDA 3AHYA 2R24A 2QIWA 4WD0A 2VJXA 4NXSA 3SB0A 3B8WA 3AJXA 1TE1A 3K2GA 4XBSA 3PG9A 1VFFA 4A8LA 4N4QA 1T8QA 1P43A 2ZXBA 1UB3A 2XINA 2P3ZA 3O6AA 2EAWA 1FWJC 1OYCA 1MDRA 3WL0A 4PULA 3H2FA 1BD0A 4AHPA 4LRTA 1DORA 2FH8A 5KTLA 3W02A 5EGRA 1VHNA 5EMUA 1LT7A 3VNJA 5KITA 1LWHA 5HNTA 3KVLA 1HGWA 3KRSA 1GOQA 3GNRA 1CLKA 3INPA 4QS5A 3M0MA 3YPIA 3EXRA 4GNKB 3I7QA 3W53A 4W87A 4AWUA 2Z4GA 4MDOA 1I2RA 3AIEA 5CAHA 3BAJA 3UCCA 4IJCA 7XIMA 3S9ZA 2BVWA 1EOKA 2CU0A 2ZRYA 1P0BA 4F0SA 1FWGC 4PN2A 3P80A 4UFJA 4B92A 4TVCA 2NX9A 2ISVA 3WMLA 3WLKX 1N8IA 1B1YA 1NF7A 4MHBA 2WZEA 3P0WA 2E8YA 1GG0A 4JTHA 2VZVA 1GKQA 3N2OA 3QRHA 3W26A 3RCMA 1K8ZA 4UOZA 3PUDA 4KMQA 1EHAA 4H6RA 2QGHA 2E3ZA 4JQ1A 3GW3A 2ASHA 3RLGA 3A3XA 1WAUA 3QY6A 4WSJA 1QOXA 3B40A 3ZOAA 4RZBA 4LNYA 1EA0A 3EWYA 3QPYA 4M6UA 5BZAA 5HUOA 1UP0A 2J6XA 1H61A 1O95A 8TIMA 4JFVA 3QEZA 3H2CA 7CGTA 3WD3A 3GG0A 2ZYFA 2WMFA 1US2A 2WNWA 3QQWA 4LUSA 1XHGA 3CZGA 5HMDA 3BUVA 2IW0A 1KFLA 3UPBA 4UWMA 2I56A 5F4SA 2ZC1A 3LBMA 5HQEA 5BU6A 1NP2A 2PGRA 3W7HA 1XKJA 3SCUA 4QTGA 1LROA 3CHVA 4H83A 3LCIA 1OD8A 3PBGA 4NX0A 1KGWA 1BQCA 2CHOA 2YA0A 1RCXB 4XB3A 3LOTA 3R8RA 4CCCA 3WD0A 1SO4A 3AAMA 2W91A 5CPNA 2J7DA 3NCOA 4C5YA 3PTKA 3FEQA 4C90A 2HVOA 3MQTA 4O16A 4KRZA 3WZ0E 5TF0A 3ECQA 1C8XA 1UR9A 1YLVA 2BGSA 3QJAA 3UZXA 2Y62A 8CGTA 4YTQA 3V18A 1DJQA 3IWPA 1REQB 4Z2GA 2NXGA 3RHGA 1EDQA 3DDMA 3SUTA 2XIBA 3MPGA 3W88A 4HHPA 2H9AB 2FDSA 5LA0A 3I10A 1BPLB 1R7OA 1MQQA 4Z2HA 4XKMA 1MXSA 3E49A 2GFTA 2ZKMX 1WKYA 4YTTA 2OT0A 2CPUA 3B8UA 3BGGA 3KL3A 3EMQA 3NUKA 2R1LA 4PFHA 3BOFA 2RKXA 5DF0A 1SGJA 3BQ5A 3W1AA 1ODUA 4RDZA 3FGCA 1SZEA 4LCSA 1IGSA 1EDTA 3UEQA 7A3HA 4RW5A 2OEJA 3GBEA 2NWSA 1VD6A 3O0FA 4CN1A 1MVYA 4F8XA 1QI5A 1EP3A 1MQPA 3TXVA 1QPQA 1PB0A 1I1XA 4NIRA 1BWKA 1LCOA 3GB6A 4MWAC 3WBXA 3VNIA 5JBFA 3M6YA 4AZ6A 4MFDA 5ECVA 2QZRA 4ZOAA 4UFMA 1WCGA 1V0NA 1YMYA 2WZMA 2B81A 5D2YA 3GHRA 3NOYA 1UD4A 1KRBC 1B9ZA 3M5YA 1ECQA 2EO7A 4UNLA 3WD4A 1JPHA 3GTFA 1DXEA 2E8ZA 4QG6A 4CD5A 2XJ7A 3ANUA 3QQ1A 4LYKA 4DM2A 1UD5A 1OT2A 1L2UA 2AKMA 1CI1A 4DBEA 2Y89A 1V6WA 1H4PA 3MUZ1 2F7FA 3UXDA 4S3FA 2ZZ1A 4M0XA 4QQ3A 3W87A 4DXXA 4IX2A 1JFHA 4UTLA 2HISA 4ERIA 4Q8UA 3QZ6A 1OFQA 2J77A 3O2LA 3VD4A 4P61A 3URAA 4UTTC 1S38A 5FJUA 3H7UA 4W5UA 2Y8UA 3HPSA 5C9ZA 4Z08A 3UZWA 4NHVA 5L9FA 4MAZA 5FL0A 2YJQA 4A3HA 3M9YA 2HRWA 3QZAA 1E6RA 2ZRVA 3RCYA 1YDNA 2Y0FA 4Q8VA 4I5RA 4IXXA 4XZ9A 4X2RA 4O0QA 4REQB 2V5BA 2XH2A 3F4DA 4GA8A 1DP0A 3WK0A 3C0QA 2RDXA 2XVLA 1K6WA 3W25A 2WKLA 3WQVA 1Q6DA 4PTWA 1W9DM 2CKSA 1EWDA 1XSIA 3GG7A 2J7EA 1NP0A 1W3LA 5M03A 2ZZ3A 2WHMA 4IPLA 4OU1A 3STEA 1CXIA 2NXIA 3CL6A 4KRUA 1PTGA 5DRCA 2GSJA 2PAJA 3SO7A 5D05A 2DW7A 4N2YA 5IHSA 4MSSA 3EX4A 1VAHA 1QFEA 4Y9PA 3T0BA 2P5NA 1NEYA 2X2GA 1XRTA 5T8GA 2Q6ZA 5F1VA 1QUMA 2UY4A 2OMAA 1CX9A 4RUBA 2HSAA 2V5DA 1XIJA 1AVAA 1GEHA 1J18A 5E5CA 1NOWA 4HZ7A 4W7UA 1Y5WA 3SQSA 3GXMA 3HJEA 4O53A 4GZJA 4TO8A 2XIOA 1A5LC 3GNNA 4RDVA 1FY6A 3K8KA 2HS8A 1GPFA 3HTWA 4PSPA 2WYSA 2WLZA 2E6YA 2XFFA 4GCXA 3DYOA 3GLCA 3QR1A 5I3JA 2CXGA 1UKTA 3WBYA 3VDCA 1I8JA 4GABA 5D9MA 4PODA 2C18A 4QFUA 1TWWA 3BJTA 1SW0A 3NDOA 1IXPA 1WZMA 3MYPA 4XISA 5GNXA 3A3HA 2WKGA 3BAYA 1HP5A 5REQA 5CBIA 1O5RA 4P2VA 1XINA 3CM4A 3L4ZA 2IS7A 3U7VA 1H11A 5XINA 2ZA3A 3ES8A 3RLHA 3FIGA 5IDIA 2C1GA 1XD1A 1EH9A 4D6DA 4QE5A 4K7YA 1XBXA 3AUJA 3QW4B 3VIFA 1R3VA 4C6QA 4L4PA 3N34A 3GG1A 1W3KA 5K3VA 2VEKA 4M80A 2G3JA 4K6AA 4CQ9A 1HJSA 2YR1A 2WBKA 5FKYA 3LXCA 1TPB1 4EF8A 2I5QA 4I6VA 2ZRWA 4BQ3A 2A3AA 3C2YA 1EZWA 4XK2A 4B3KA 5BU9A 1UR3M 3WUFA 5BXTA 3W01A 3SRHA 3W22A 2PDBA 4TMCA 4CEUC 5DMNA 4XUGA 1F3TA 3UW6A 2GK1B 4DI8A 3L65A 3Q45A 4WJ8A 3IGXA