3IGSA

Structure of the salmonella enterica n-acetylmannosamine-6-phosphate 2-epimerase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
230
structure length
230
Chain Sequence
AMSLLEQLDKNIAASGGLIVSCQPVPGSPLDKPEIVAAMALAAEQAGAVAVRIEGIDNLRMTRSLVSVPIIGIIKRDLDESPVRITPFLDDVDALAQAGAAIIAVDGTARQRPVAVEALLARIHHHHLLTMADCSSVDDGLACQRLGADIIGTTMSGYTTPDTPEEPDLPLVKALHDAGCRVIAEGRYNSPALAAEAIRYGAWAVTVGSAITRLEHICGWYNDALKKAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylmannosamine-6-phosphate 2-epimerase 2
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Isomerase
total genus 81
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3igsA00
1SZNA 2ZRUA 3M9YA 3LCXA 2ISWA 2ZDRA 4LS2A 5E93A 5H2ZA 4QAIA 4N6FA 1UUMA 1VYRA 3OHIA 2QCGA 4DF1A 3KRSA 1H5YA 1Z42A 2WSYA 3TXZA 1Q6RA 5D32A 1R46A 1I4NA 4JYFA 4EOUA 2ZRXA 3Q2DA 4IWWA 3MP3A 3PR2A 2B7NA 2B7OA 1KBJA 1DORA 3LHYA 1XBXA 4BI7A 2ZRYA 4RR4A 1XFBA 3JRKA 2C14A 1OF8A 3BGJA 1KTNA 5I3KA 1UCWA 3CQ0A 2Y85A 1GOXA 1EWDA 1MEIA 4MJZA 2YW3A 1TTJA 3W1AA 4GXMA 3FOKA 5MHBA 4I7VA 3DFSA 4IXXA 2C6QA 3E9AA 4CLMA 2Y7FA 1A5BA 5J5DA 5CSRA 1TREA 4LY8A 1GG1A 4JN6A 1JCYA 4FB7A 1FCBA 2HS8A 4IQLA 2WV8A 2WNQA 1DBTA 4NX0A 3HGJA 4JTSA 4O16A 4O57A 2H6RA 1YADA 2Y88A 5K9XA 2Y62A 2NWSA 1FQ0A 3S5OA 3W73A 1DHPA 1KFLA 3USBA 3IVTA 3HOJA 3S5YA 2VELA 3LCLA 3W1XA 2PRLA 5LNUA 4Z0JA 2Z1BA 4DO6A 1L9WA 4CCDA 4PCFA 5J5RA 2J24A 3C2FA 1H1YA 1C9DA 3LLFA 3QEZA 3R12A 4XQ6A 3G24A 4MY8A 2A21A 3GAKA 2G96A 4AAJA 5LGXA 4YXGA 1SFLA 4TX9A 2R14A 1OABA 1H7NA 1WXJA 3M5ZA 2EPHA 3PVFA 4QNEA 1T99A 3W7KA 4IMDA 4MZYA 2VEKA 2GJLA 4BFAA 2CFFA 1TRDA 4IMGA 4IX0A 2A1YA 3QQ0A 4FHAA 5AYZA 1OFDA 1YPFA 2C15A 2E5CA 3PUEA 5EKYA 3C2RA 1GYNA 3FKRA 1XBYA 3W1QA 1FWWA 4UTTC 1IIGA 4O10A 5LNRA 3EXRA 1RV8A 1VCGA 2WNNA 5FESA 1SQ7A 1ML1A 1VC4A 1VYPX 3TCEA 2ZTKA 3HBLA 4J9JA 1PCKA 3QMSA 1WBJA 1OK6A 2AQWA 4QIUA 3FYOA 4O17A 1ZJIA 3UY8A 1H63A 2OZ0A 2VFHA 2C18A 4ZVJA 3PULA 1XXXA 3I65A 1ZCOA 1SZGA 4KFPA 1N55A 5FF3A 4LVBA 3ANYA 1SU5A 3KHJA 1OG0A 3HG5A 5DCEA 3LRLA 1QO2A 4ONVA 2BXVA 1S5TA 2GUUA 3L0GA 4ZQRA 5FEPA 4HPJA 3P82A 4LC8A 4AWSA 2X1SA 4QITA 4GUGA 4WY0B 3SSJA 1FXPA 3L2IA 3E02A 1W5NA 4MJMA 1ICPA 3ZWSA 3TMQA 3QW4B 2ISVA 1FY6A 3TFCA 5FI8A 3V75A 2P0OA 2DZWA 1XKYA 3G3DA 1H7PA 2YFOA 1G7UA 3RMJA 2V82A 1T0OA 1SO5A 3C61A 4JTFA 1LROA 1I2RA 2VKZG 4UTTA 4K6AA 1WX0A 4TR9A 1PE1A 3TW6A 1F7BA 4FNSA 1R47A 4AWTA 1S5VA 1F6KA 3BGGA 1RZMA 4MOZA 2WKJA 1LBLA 4IX2A 4UNLA 1EB3A 5CKSA 3IEBA 3VE9A 1I2OA 5G5IA 3PBWA 1VHCA 4NUWA 1TPVA 3EXSA 4MY1A 4O11A 4O1DA 2YR1A 3I7RA 3VI2A 4DQWA 4NNAA 3GLCA 3UD6A 3HPSA 4Y96A 4NT0A 2A2IA 3PB0A 1QPRA 2QAPA 3N9RA 3LCHA 4MVAA 4WZHA 3HPZA 3SY5A 1Z41A 2TRSA 4LVGA 3W1RA 2OT1A 4NXKA 2H90A 3NQ7A 1K8ZA 2CZ5A 2NV2A 3R8RA 3NQMA 3P61A 3SR7A 2QCNA 2Q8LA 3MI2A 5BNKA 4UXDA 4GUIA 2O7SA 1TV8A 3S1VA 4S1FA 4RJEA 1M6JA 1W56A 3R5EA 3W1NA 4NJHA 1LLZA 4N4PA 3Q58A 4NJIA 1M5WA 4RLIA 4JX4A 4M6VA 1KM2A 5F4WA 3M0ZA 4PL1A 3N3MA 1VGAA 3ABRA 5CPOA 3FJ6A 4CQ9A 3GZ3A 3LDVA 2RH9A 1LRNA 3LHZA 4NZJA 4UFJA 3L5AA 3LBMA 3W70A 4QNWA 3CU2A 3UWWA 3EKZA 4UFLA 4WJEA 1Z44A 3NQEA 4QM1A 1R2RA 2QCEA 1XCFA 3B0UX 3CT7A 3HIJA 1QNVA 1KW1A 2OJPA 4L4MA 4GRSA 2OT0A 2V2CA 3JR2A 4E0CA 2ZZ4A 4DPQA 4A22A 5K9DA 4FIQA 4YWIA 4O1BA 1TTQA 3OG3A 3UWVA 3LCFA 5U4NA 3I68A 1K7XA 4HT3A 5KINA 2WJZA 5SWUA 2ZBTA 4Z1BA 8TIMA 2QR6A 4YMZA 2Y89A 1TPB1 1K03A 2H8ZA 1OVDA 1W5OA 2QCFA 4AXKA 4FNQA 4IPJA 3N14A 1JCMP 4GFSA 3FS2A 2PC4A 3P8IA 4HHPA 2NLIA 2XN1A 4KWWA 3GDMA 5D2YA 4NJKA 3ZFHA 5I3HA 1ZAHA 3BPWA 2IQTA 3GK0A 2R8WA 3W22A 1JQXA 4Z0SA 3A5FA 4MZ8A 3EX4A 1SO4A 3GIYA 2A7PA 2NZLA 3LI1A 1DL3A 3T78A 3CB8A 3TAKA 1QO5A 2QAFA 2DJXA 1QPNA 3ABSA 6ALDA 3MBFA 4X2RA 5AOUA 1OFBA 4FX8A 3BLEA 3TQKA 5LNVA 3M41A 4UTMA 3W7LA 2CLOA 1OFAA 3WJSA 3TNOA 4FXRA 1FXQA 1ZALA 3DFOA 4JEQA 3P5YA 2RFGA 2D73A 3E0IA 3B4UA 4EWND 2BSLA 5F2LA 3MHFA 4PEKA 5HNRA 5HWNA 3O15A 3A5VA 5HULA 4NNCA 1F6PA 4NZFA 3H55A 5AHMA 3B03A 3W1PA 3SJ3A 4OGZA 5AFDA 3F4NA 2CWNA 3W6YA 2VFFA 3G0UA 4UNKA 3GDTA 1OYCA 2NXGA 4WOZA 4N9CA 3DKJA 1I8JA 3YPIA 1KTBA 2B0MA 3PAJA 4POCA 1K8XA 1YXCA 2ZA3A 5HR7A 3W07A 3UWQA 3TIMA 3IIVA 4BI5A 3HGOA 1KTCA 3GKAA 3IGXA 2O7QA 3RU6A 4HSNA 3MP4A 4HNNA 3TQVA 2C13A 3P62A 2J88A 4O18A 1QDSA 4N9BA 4LVDA 1VRDA 3O1NA 2NUXA 2V30A 1TV7A 4DF2A 2DZTA 4UTHA 3P7YA 3TROA 1NF0A 1YDOA 2Q3RA 2EKCA 3S0CA 2QUTA 2NUYA 5DLCA 2Y7EA 5AHLA 1PHWA 4U4MA 1VYSX 2LLEA 1VZWA 4YCOA 2C3ZA 1TPH1 3F03K 3G1XA 3LOTA 4ZQOA 5HWJA 3T7VA 1O5XA 4DELA 3FIGA 4CQAA 4UMAA 3CEUA 3PF3A 3FKKA 4O4VA 3NXFA 4RKAA 1ALDA 3JS3A 1BKSA 1WAUA 4WQ6A 3TW7A 2YX0A 2ZQ0A 1OFRA 2VXNA 3UY7A 3W9ZA 1HO1A 3VCRA 1LZOA 2JBMA 3S1XA 3W84A 3GR7A 4N02A 3W2KA 3W1TA 3L5MA 5LHEA 1Q45A 1CX9A 4N9DA 4K7VA 1FBAA 3BARA 1LTDA 4N6EA 3NM3A 1L6YA 4XUGA 3OEXA 4O0ZA 2Z6JA 3ATYA 1GZGA 1WOAA 5FEXA 1P5BA 5D2VA 3EEGA 1R2TA 1DQWA 1LORA 1DKWA 1PIIA 1X1OA 2P1FA 5CPLA 4MIMA 1T8XA 2NX3A 2E5DA 4MYAA 3B0PA 2ZCGA 2G97A 1B4KA 2YXGA 5F4XA 3KVJA 1AG1O 4MZ1A 4FXSA 3M7WA 3L5LA 4AF0B 1H62A 2E6AA 2HSAA 3O05A 1PHQA 5DCDA 5C55A 1K7FA 2EF9A 4GUHA 3NL6A 3S6DA 3VFLA 3W1MA 3E96A 1UJPA 2YW4A 3N9SA 2E6DA 3DAQA 2ATMA 2BLEA 1DQXA 3IGUA 4WY0F 2VEIA 1I45A 4R7JA 1F74A 1WBHA 3QYQA 3PBVA 4PL2A 3INPA 3PUOA 2QDHA 5CGQA 3W7JA 4D2JA 2H3DA 4XKYB 3F4WA 4EF9A 1KFJA 3UXDA 1GVRA 3W2NA 3NVTA 1NFBA 4ADTA 1UASA 3O6DA 3KVMA 1VLWA 2ZTJA 3LV6A 1HUVA 1TTIA 2A4AA 4IJBA 5D2TA 1MEWA 3TC7A 3QSRA 3ABQA 2ABAA 4UR8A 3LHTA 2RDWA 1A5SA 2J6XA 5E0KA 2HMCA 1CW2A 3EWZA 1TJRA 5D05A 4RXFA 2Y61A 2BX7A 4W9TA 1J5TA 1AW5A 1LM1A 1U5JA 1GQNA 2FQIA 2CLIA 1S3HA 4UIOA 3B06A 1C8VA 3P67A 2PRMA 5L6UA 5F2IA 1N8FA 1XM3A 2FJKA 5FF0A 5DY2A 3L9CA 4RX0A 4JXCA 1UB3A 1YYAA 1LDCA 4UUIA 4FX6M 3THAA 2PE4A 5KZDA 1P0KA 3TK7A 2QCLA 2QCDB 3I6RA 3W1UA 4K38A 4A2SA 1W31A 4LNYA 2FPTA 2QCCA 2TYSA 3ZWTA 3CC1A 1VH7A 1HO4A 1T96A 4JYEA 4AEOA 2Y7DA 1I2PA 4HNUA 3DKLA 4MUZA 1F76A 1H7WA 3R89A 1M7PA 4CNPA 2J27A 2A5HA 3QZEA 3OVRA 5LNSA 3N2XA 3KRZA 1A50A 3S42A 3PBUA 3NDOA 2QUUA 4LUIA 4AHPA 4DXVA 1IIHA 3QM3A 5CZJA 3NL2A 4TO8A 2NV1A 3GR8A 1TB3A 3KRUA 1P0NA 3L65A 3OVQA 3W2JA 1KV5A 4PTNA 1NSJA 3GDLA 4JDYA 3MBDA 4Y8FA 3HGSA 2A7RA 1A53A 3FYPA 4QISA 2EAWA 1QOPA 3LGEA 4JR5A 3QC3A 2VEMA 1SO6A 3FA5A 3M6YA 1ZNNA 4WX2A 2W0UA 4DEFA 1Y0EA 1I2QA 3NQ6A 5EY5A 3MJYA 3N19B 3MO7A 3W3OA 4A29A 4H3DA 2RKXA 2X1UA 3KVKA 1SW7A 3NM1A 5D2XA 4WY0A 3PS7A 3GXTA 3M1ZA 4LVFA 1ZAIA 4E2DA 1ZENA 1RD5A 3SGZA 2V2HA 3EWWA 3NQFA 3PC0A 4FO4A 3DGRA 3LLDA 3PUDA 4K36A 2ATSA 1GT8A 4I9AA 3EB2A 1KFEA 1QR7A 1QOQA 3MHUA 1KFKA 1ICSA 3Q94A 2KZHA 3IVUA 3NZ1A 1F2JA 1LYXA 2E77A 3MI6A 4JTLA 5G2WA 5C2XA 4B5NA 3G1SA 4LS0A 1FDJA 5BMWA 1FWTA 4HN4A 2W79A 3CWOX 1SSDA 5FF7A 3DFQA 1EP1A 3NG3A 5I3FA 2EHHA 2VFEA 3CIWA 5LNWA 1W5QA 3EWUA 1H60A 1SPQA 3TH6A 1KBIA 2CLLA 3G8RA 4XBSA 1JULA 5AB3A 2Z0IA 2WSRA 2VENA 5T26A 3L66A 3NQAA 2ZZ2A 3MHGA 5D03A 4E38A 5F4SA 1GPWA 4RK8A 1JRBA 2FPYA 1V5XA 1AW1A 1TSIA 3LCIA 1B4EA 2VC6A 2CLKA 4RCXA 5D2WA 5IM51 3FFSA 3L0KA 1EP2A 3QPZA 3W2UA 3C4UA 3M44A 2TMDA 4OV4A 1X8FA 3O06A 1K3UA 3L0NA 2WQPA 4Z08A 1AW2A 2C16A 4OU1A 1JJKA 1YXDA 4JYDA 4LW7A 2A6NA 1NEYA 1B9BA 2GQAA 3FLUA 3UXAA 4L4LA 3VE7A 3EWBX 3LTPA 3W7QA 1FDZA 5G2IA 3NPVA 3TKFA 3NQ2A 1P4CA 1ZAJA 3PG8A 3DU0A 4M7SA 1Z48A 1A5CA 2J9XA 3G0XA 1IXPA 1IF2A 1XDLA 4JX6A 3LV5A 1VR6A 5D38A 1XBZA 1KM3A 5EBUA 1FWNA 5K4XA 3C2VA 2VFIA 4NJJA 1S5WA 2B7PA 3DBPA 2CLHA 4MLJA 3R2GA 1F05A 1GVQA 3RFAA 4LWWA 1XI3A 5AC7A 5EYWA 3W7MA 5F1UA 3THQA 2FLIA 4WD0A 4DPPA 3UYCA 3ABOA 4O14A 3T40A 3W74A 4YL2A 4U28A 1Q6QA 3PG9A 1HL2A 5LKYA 2GJNA 5K3VA 1GJPA 1PV8A 4O52A 2B7QA 2YPIA 3A9IA 4AMAA 4M5PA 2CZFA 4O13A 1UUOA 3G8EA 3DHDA 1EX5A 3MI3A 4G1KA 3DFTA 2ZFAA 3QPYA 4TU1A 2JGYA 3STGA 3TE9A 4NX5A 1KM5A 1X7FA 3PSWA 3LX9A 3DFNA 4X22A 4K8EA 5EA9A 3W2MA 5DBTA 5AHIA 4ZQMA 3OIXA 1DJNA 2TSYA 4MFEA 1NF7A 1XC4A 2J9YA 4AVFA 4LV4A 1Q6OA 4JTTA 3TAOA 1W5MA 1KLZA 3SW6A 4H6KA 3IRDA 1W3IA 3VKJA 2JKEA 1E51A 2FB3A 4M6QA 1PVNA 5AC8A 3UWUA 1JUEA 4O28A 3STFA 1DV7A 3BVJA 2BTMA 3A24A 5AHNA 4DBEA 2NX1A 4OHQA 3TQ0A 3EX3A 1JCLA 4JTEA 4WOQA 5KMYA 1DOSA 2V81A 3GDRA 1IXNA 1F5ZA 2YSWA 3EX2A 5AHEA 1AK5A 2HTMA 3CM4A 2WSQA 2ZYFA 4P61A 5G2HA 2E1DA 5A8GA 2GVLA 3E49A 4OV9A 3C2EA 4UFMA 4MKNA 4ZQPA 5HWMA 5EMUA 4BWLC 1YLVA 3LRKA 3E12A 4ADUA 4H4IA 1QPOA 3DH7A 1AL7A 1OFQA 1TO3A 4ADSA 2W6RA 3QMTA 4HPXA 1SO3A 1V7YA 2ZZ7A 3DXIA 5BW6A 4FEZA 1TPFA 1SW0A 3TSMA 2NXIA 3NNTA 4WXYA 2ABBA 2I14A 4HKPA 3KFTA 3SFKA 1W54A 3DI1A 2DJLA 1YTKA 3CTLA 1VJIA 3SGUA 4IMFA 1O95A 1HTIA 5EPDA 4NJGA 2JKAA 4LC6A 1JR1A 4AHOA 3LCGA 1G67A 3DFPA 2E6YA 3UNDA 3AO0A 3V1PA 5D37A 2ZZ6A 1PL9A 5G4EA 3RF9A 1TJPA 2G5WA 1GWJA 3B05A 1KFBA 4IXHA 2EGZA 1RQEA 1H50A 3TDFA 3P60A 1SZFA 2OX1A 4LU0A 3ATZA 4UTLA 5DXXA 4M7TA 3SECA 2DZPA 2E5BA 3O6YX 4BR1A 4BWLA 5CPNA 3UPBA 3HMJG 3MYPA 3LRMA 3I7SA 1IXOA 3NL5A 2Q3OA 1BWKA 2DU2A 1WDWA 1H51A 2CLEA 1KA9F 1A5AA 3G0SA 2OMAA 1GEQA 4RV8A 4YCPA 3C52A 4JS3A 5U7SA 4C1LA 4TMBA 1MXSA 1SR9A 4QQ3A 1EP3A 3W7CA 3T44A 1OF6A 4AH7A 2V5LA 5LSMA 3G1YA 3STCA 2YYTA 1YXYA 4PODA 4S2CA 1OK4A 1QPQA 5CPMA 4O19A 4JIPA 3IIZA 2YZRA 5HINA 3DENA 3BO9A 3R13A 4NXSA 3BG5A 1H7OA 2V2DA 3G1FA 4UTKA 3C8FA 1JUKA 3NPUA 4IMEA 1XUZA 5AYYA 3W2LA 4AF0A 1JQVA 1H1ZA 5TQLA 1LLWA 2A85A 1DJQA 3G22A 2DP3A 1N7KA 5I3IA 5G1TA 3TJXA 3NZRA 3W1LA 1FCQA 4OQVA 3B0VC 2B4GA 4HSOA 4KFNA 3W7EA 1KV8A 1OX4B 2WOQA 1TMHA 1B57A 2X2GA 4JTJA 4MFDA 2UV8G 2ZZ5A 1UBSA 1NVMA 1TPWA 1HFBA 2WNZA 1JCNA 2ZRWA 3LERA 1M7OA 4WUIA 3N34A 4RZ6A 3GAYA 5C6MA 4LT9A 5KSWA 3UPWA 5LZLA 3UWZA 3MMTA 3C56A 2P10A 4XKYA 2RDUA 2J9ZA 3W23A 1B3OA 1VS1A 1ME7A 3QH2A 1O60A 4OWGA 4A21A 2A0NA 1H61A 2E6FA 4A3UA 1C29A 5IBXC 1TTPA 2FPVA 4XTDA 3O07A 4EIVA 3T4CA 3S5NA 4UTJA 2QCHA 4JTIA 3ZS4A 3CWNA 4XWUA 4FNPA 3IVSA 2E09A 1L6WA 4BI6A 3CHVA 3GX9A 1THFD 4IMCA 4YLWA 2Z6IA 3W7IA 3RK8A 3RLUA 4UMBA 1H7XA 4M19A 3W7RA 3ELFA 4FF7A 2X1RA 3BG3A 4K8HA 1GTHA 1NAL1 1TPUA 4XTIA 3QMRA 3TXVA 3NPWA 1D3GA 3BK0A 1K8YA 4GUFA 3NQCA 1PCWA 1WQ5A 4GNJA 3STEA 1TIMA 5CZSA 1TQXA 3NYZA 1EWEA 3MWAA 1ADOA 1KM6A 4K37A 4O50A 4LTSA 1CI1A 2FTPA 3GVGA 4JICA 4JY8A 3G1VA 4JTKA 5DCBA 2QCDA 1L2UA 3P81A 1OFEA 2TPSA 1SFJA 4Q32A 5KITA 1LBFA 2X30A 3W87A 5A5WA 1W37A 4PH6A 4DO4A 2AAMA 3HG3A 3NO5A 5DXYA 4TMCA 2GQ9A 3M47A 5IBXA 3W7DA 4FIRA 4UFIA 1VCVA 1O5KA 1GVOA 1ZHAA 1R30A 4GWEA 5K7JA 3EXTA 1LOSA 5TBOA 3RNDA 2VFGA 1W3NA 1G4PA 1QAPA 3PBYA 3IIXA 3WK1A 3OVPA 4LS1A 3SI9A 4P2VA 4ZL1A 4O8RA 1D9EA 1ZFJA 2QCMA 4Y90A 3EX6A 3LHVA 3TUUA 4ZQNA 3NQGA 3S1UA 5CZTA 3W85A 3W7OA 2GVGA 1YDNA 1TPC1 3NA8A 4A2RA 3G1DA 4BF9A 4CNOA 1EEPA 1O4UA 3PB2A 3W75A 3S8HA 3G1AA 3EX1A 4JX5A 3PM6A 5DY3A 1LRQA 1XDMA 3HB9A 3PY2A 1G7VA 4LVAA 4GC4A 5D09A 4XZ9A 2V9DA 5AC6A 3A22A 4CQ8A 4LRTA 5F2GA 1Q6LA 3HGRA 3KOFA 3B8DA 1K7EA 5C5YA 4Q4KA 2C1HA 5HQEA 5D02A 7TIMA 1LRTA 4FX7A 3LBCA 3HO8A 4Z1AA 1AMKA 3ZR4A 3IV3A 4LUJA 2VFDA 1J4EA 1LOQA 4O15A 3KVLA 2QKFA 3C3NA 3P74A 3I7QA 1X6UA 1I2NA 1JRCA 4ALDA 5AN7A 2F7FA 2C0AA 4KKXA 1AL8A 5F2MA 3LXAA 1W5PA 4AHQA 2CZDA 4ICNA 4IGHA 1LOLA 4PFMA 1RR2A 1KM4A 1TQJA 3TX9A 4OT7A 1QMLA 2BWGA 2PRHA 1RQBA 2CW6A 1FUYA 4O1CA 1FX6A 2A6LA 3A21A 4JTGA 3W7HA 2DORA 3LXCA 3VNDA 3BG9A 3MUXA 2QJHA 1D3HA 1FCUA 4BK9A 2Y6ZA 1MZHA 5LHFA 1IGSA 4I7WA 5FF2A 3P84A 5KZMA 1GG0A 1GVFA 2YGYA 4UTIA 5K4ZA 2CLMA 2FDSA 3QF0A 4HNVA 2R94A 1EIXA 3TSDA 3M5XA 3W83A 5I3JA 2DZXA 3IGSA 3HF3A 1R2SA 2Y70A 1VPXA 1WV2A 3W88A 1H7RA 3GNDA 4KFOA 2A7NA 3IIPA 3TU9A 2NWRA 3OBKA 4ZMGA 5E1QA 3GDKA 2ZRZA 3QFEA 1G4EA 3LHUA 4R34A 3TFXA 2FB2A 2OCZA 3NL3A 4E2BA 1EPXA 4OBTA 5GVJA 3FEMA 2XN0A 3OA3A 3UZJA 5DELA 5DN1A 4FNTA 5F1VA 3DHFA 4MYXA 3G1HA 3Q37A 2ZZ1A 4OE7A 4WXZA 3WJYA 1BTMA 5CG7A 1P1XA 3GB6A 3TJLA 1J2WA 4IUOA 4JDBA 1TYGA 1OJXA 1OX5A 2DZSA 3LTSA 3O6CA 1YTDA 4CNNA 3M16A 3P5ZA 3NAVA 4JD4A 2QUVA 5KZEA 5HR6A 5I3GA 1HG3A 3HG2A 3NEVA 1EUAA 3CIXA 3LCWA 4UR7A 2BZNA 5LGZA 3BLFA 4R53A 5FEWA 2X1TA 3WFAA 3LI0A 1DVJA 4XBKA 4UFHA 3UQNA 1F73A 1G4TA 1SZEA 3BV4A 3W71A 4O4WA 1ME8A 2Y63A 3BW4A 4GUJA 3NGJA 1RVGA 2GVJA 4LRSA 1LBMA 4DO5A 3U2OA 3HPXA 3LB0A 4NVTA 1RPXA 2VOMA 5G4WA 5HUOA 3C0JA 1W8SA 4EVZA 4PC8A 5AYXA 1OFOA 3EWXA 4HNTA 2GQ8A 1PS9A 3D0CA 4DF0A 3G18A 1OFPA 3WJZA 2QJGA 3CLMA 3W7GA 1EUNA 2QEZA 4IPIA 2R91A 4AB4A 1LCOA 3S5ZA 1VLIA 3GNNA 4MPQA 2I1OA 3LTYA 3GXPA 3FJLA 1OHLA 4NU7A 1XL9A 2VEPA 3P80A 1ICQA 4HIBA 3L21A 4M6PA 3QRHA 2ZRVA 3TV8A 4I7UA 4O12A 4FNRA 3TR2A 3TSBA 1JCJA 1OX6A 3L67A 4N2YA 3MP5A 2JGQA 1SW3A 2PURA 5H91A 3UWYA 3MW7A 1SSGA 5HUPA 3W7PA 1VQTA 4EF8A 4R33A 3N73A 3M5VA 5CZ0A 3F1QA 4JTHA 1GVSA 3CEPA 3GXNA 5D30A 3PWAA 5AHFA 3GKFA 1K02A 3QSTA 1JUBA 3NR0A 4X9SA 3B04A 1ME9A 2FFCA 5CSSA 2JK2A 3MYOA 1TPDA 4O53A 4GJ1A 4GBUA 4NNBA 3PSVA 3L68A 4S2BA 1U83A 3LHWA 4Y9AA 1GTEA 4UFKA 4O0KA 3EKLA 3QQ1A 5D04C 1LP6A 1IXQA 1W0MA 2CU0A 2YFNA 4JNMA 1WYIA 1VHNA 2GOUA 6TIMA 2H8XA 2X16A 1W3TA 3H54A 3EWYA 3NOEA 1KM1A 3TA6A 2V8ZA 3TC6A 1JVNA 3DI0A 4K39A 5FF4A 2ZA2A 2C19A 3BLIA 2Y7GA 2CLFA 3WJWA 3S1WA 1FWRA 1YTEA 5ABTA 3KXQA 5D33A 3U6WA 5TIMA 2CZEA 3QJAA 4CCEA 3DZ1A 2E68A 4PA8A 4UTUA 1YDVA 1GYLA 1O94A 3N2MA 3O63A 4CCCA 2HS6A 4DBDA 3C6CA 3W86A 4C1KA 4LOCA 2QDGA 3WK3A 4RZ4A 1QCWA 4RXGA 5BRBA 3SIZA 3WK2A 2PCQA 3BW3A 5HJLA 3U8GA 3W76A 3M43A 1XUUA 2NXHA 1YPIA 3NPXA 3SZ8A 1WA3A 1X1ZA 1KLYA 3UZ5A 2JKPA 1XBVA 4UTWC 3W72A 1KFCA 3NQDA 3WK0A 3CPRA 1WOBA 3WJXA 2Z2UA 4UCGA 2QJIA 4ORIA 1L6SA 1JCXA 4MY9A 5G1YA 1ZY9A 1QWGA 3NQ8A 4ZZ9A 1W1ZA 2YDAA 5DBUA 4AWUA 1G4SA 2Q8ZA 3HJZA 5FEZA 1KM0A 4K7YA 4JGDA 1ONRA 4FNUA 2I9EA 2RDTA 4Z1DA 2RHGA 2WPBA 2DZUA 2ZA1A 5BMXA 2QF7A 3M5YA 4QSHA 2YCEA 5L9FA 3P8JA 2WO5A 1OYBA 3BW2A 1TV5A 2ZZ3A 4N9EA 2G95A 4ZQCA 4JTUA 3RLVA 3T55A 3O16A 3KX6A 5K9CA 4O54A 4ORMA 3HQ1A 1OYAA 2V5BA 4NQ1A 5HMSA 2F84A 3LXBA 4TIMA 5BOOA 3K30A 3C2OA 1OX4A 5KTLA 1Q3NA 3NQVA 2H3BA 4RZ5A 1TCDA 2YYUA 3AJXA 4KWVA 4UTWA 3QW3A 2GPTA 4N4QA 2DZVA 2V0TA 1FDYA 4JY9A 4X3ZA 3O8AA 2XFWA 1G69A 1QFEA 1TRIA 1FWSA 2ISSA 3LM7A 4JIQA 1MSSA 5EL1A 3W7NA 3TMLA 1SUXA 1MO0A 3IIOA 4Y6GA 4LV9A 3G3MA 5K2ZA 1RQHA 4O1AA 1VCFA 5C54A 1BEUA 3S9YA 4UMCA 3A23A 4GE8A 4Q33A 2XN2A 2AGKA 4IOTA 4ML9A 3H53A 2NUWA 2NX9A 4UC5A 3KAOA 3GYEA 1BWLA 4Z1CA 4QJ1A 1EA0A 1MEHA 2ALDA 4MLRA 1G6CA 2FIQA 3HG4A 1FCVA 1TPEA
chains in the Genus database with same CATH superfamily
4DJFA 1SZNA 2ZRUA 4CD5A 3C0LA 1MXGA 5I23A 4QAIA 5HNTA 2QCGA 4ROQA 3ZLGA 3MDWA 1Q6RA 5D32A 4CN4A 4JYFA 2ZRXA 3PAOA 4GX8A 2D0GA 1Z7AA 1XBXA 4BI7A 1T6MA 1XFBA 4Q8QA 3O3RA 1XSIA 5E09A 3ITXA 3N6QA 1C92A 3TYZA 4M56A 1JZ2A 5I3KA 3LD5A 3UXKA 3DFSA 1LT8A 2C6QA 3GW0A 3TEVA 3BH4A 5J5DA 1ADSA 1QHOA 3B9EA 1TREA 1FRBA 4OFCA 3BCJA 1ZJAA 3N13A 2HS8A 4IQLA 1KCXA 1US0A 4O16A 1YADA 3UCCA 2Y88A 1FQ0A 3W25A 3W73A 1DHPA 3WF1A 3USBA 3FX4A 3S5YA 3RDKA 1EO7A 3AIWA 3R8GA 5LNUA 2Z1BA 2G3NA 1GZ1A 1L8PA 4CCDA 2IPWA 1OWQA 2E8YA 4PTWA 5J5RA 4IIGA 4L1WA 1H1YA 1C9DA 2GGJA 3WN6A 2CKSA 4L56A 3E2VA 4XQ6A 4D6CA 2A21A 5LGXA 1FWBC 2FHFA 4AVNA 3VIGA 4C6NA 1T99A 3W7KA 1BQGA 2P88A 3IJ9A 2DT1A 4R7OA 5AZ0A 2PTWA 5ABGA 3TA9A 3QQ0A 4MM1A 2PZNA 2RGLA 5AYZA 1XLBA 3BAYA 2BGSA 4NHVA 2E5CA 4JL1A 2ISFA 4JNYA 3WF3A 1GYNA 1QI0A 3W1QA 6A3HA 2VX7A 1FWWA 4UTTC 1ZZMA 4H01A 4FSAA 1RV8A 3BAIA 4BF7A 1SQ7A 1DJXA 1Q2SA 4B4HA 3AOFA 1BYAA 4J9JA 3L4ZA 3QMSA 4QIUA 1ITCA 1H63A 2VFHA 1DWFM 3D3AA 3MQTA 1N55A 5FF3A 3T8LA 1OG0A 3TN3A 5I6SA 4Q4RA 3MSRA 1EJUC 4U5IA 4DHGA 3LZ3A 1G94A 3L0GA 5FEPA 4HPJA 2VZUA 4LC8A 4AWSA 2Z26A 4JKLA 1FHUA 4GFIA 3E02A 3BSHA 7A3HA 2WSKA 3TZNA 1V6VA 3A4AA 5FI8A 2Y1HA 3G3DA 2D23A 4GACA 3SN0A 3THCA 2X0YA 4GH1A 1SO5A 3C61A 2R1MA 2OWXA 3ISIX 3HFYA 5BRQA 4HVXA 2C1IA 1WX0A 4TR9A 3AXKA 1PE1A 1AQ0A 1TX0A 1TR9A 5C7VA 3N12A 2BG5A 3BMVA 1LBLA 1BFNA 1EB3A 3QR1A 3TC3A 2DZBA 3W53A 1A3XA 2R1LA 3WH5A 2DVTA 2J74A 2YR1A 3IWPA 2QJJA 3AZSA 1YDYA 3VI2A 1Y5XA 4NNAA 4X60A 1ZTVA 1K9FA 2HRWA 3DEQA 4NT0A 4FZIA 3GU1A 1QPRA 4KCTA 1E6ZA 5AVNA 4G2DA 2GSHA 3F7JA 3SY5A 1Q4NX 3CZLA 4LVGA 3W1RA 4V1YA 2CZ5A 2XM1A 2XWDA 4AIOA 4YPJA 3NQMA 5FL1A 4FF5A 3SR7A 3VGGA 3E3HA 5AECA 6PTDA 2BY3A 2VHLA 1TV8A 3H6OA 3PZNA 1BSIA 1R86A 4XAFA 3W1NA 4XO7A 3Q58A 2EQDA 5A8QA 5JXQA 4JX4A 5BYWA 4M6VA 1VFSA 4NI8A 2G3IA 1JXKA 3BQ5A 2OU4A 3GZ3A 1LWJA 4MDOA 4QJ4B 3LHZA 4UFJA 4OKDA 1KCLA 1UQZA 1U1UA 3ARSA 3EKZA 4UFLA 1W1VA 4QM1A 4Z2LA 4EPEC 3CT7A 4PUNA 1Y8BA 1KW1A 2OT0A 2J7HA 2V2CA 4E0CA 2ZZ4A 4DPQA 4A22A 2D24A 2ZX8A 4M51A 3ARWA 4CQBA 3E2RA 1UP3A 3LCFA 4AG0A 2WJZA 3HM7A 2FZNA 2RAGA 4AW7A 5TF0A 1K03A 2H8ZA 3QYSA 2R6OA 1W5OA 1FH8A 3FS2A 1VFMA 2EBNA 4EE9A 1R9ZA 4AC1X 4HHPA 2XN1A 2BP1A 4KWWA 3I6EA 5XIMA 1OGBA 1WZKA 3WNPA 4QXIA 1OT1A 1MUWA 2ANUA 3ZFHA 4V33A 7ODCA 2D22A 1ZAHA 4P7LA 4GKTA 3GK0A 1XLCA 4Z0SA 5CPTA 4MZ8A 5BXPA 2J75A 2WC7A 2HK0A 1CB7B 4A6GA 2A7PA 3N4FA 2NZLA 2OGJA 1C3FA 5E0CA 4HHLA 4V1XA 3GH7A 3ABSA 3VOJA 1S1PA 3V7PA 3ARXA 3U2CA 2Q09A 4PMUA 4H9ZA 3MUCA 3WJSA 3BLKA 3B9DA 1TG7A 2PTDA 1V6UA 4JEQA 1U5HA 4E6MA 3GNRA 2RFGA 1UZDA 3E0IA 3CASA 3AYTA 5HNRA 5HWNA 3O15A 4Z42C 4V2XA 4GI6A 4EAYA 4NZFA 3SJ3A 4OGZA 1OC6A 1GVEA 3PNZA 2PGRA 5AFDA 3VU2A 3F4NA 3GHSA 4QTGA 2EJ1A 2VFFA 1HKMA 3GDTA 3N1AA 2NXGA 1LG2A 3U5YA 3DKJA 4QJ5B 3YPIA 2XSXA 1BYBA 4AFYA 3PAJA 4POCA 1YXCA 2XIQA 3RR1A 3WEOA 5HR7A 3W07A 1NFPA 1NH6A 3MP4A 4HNNA 3RM8A 3EDDA 1V6YA 4GI9A 3P62A 2W91A 2EPKX 4A05A 4QSFA 4ZB5A 3FK4A 3MS8A 4GX9A 3GH5A 3P7YA 1EX1A 1E1CA 1SJAA 2EKCA 4JHMA 3NSXA 1VB9A 2QUTA 1JDCA 4RW5A 3FGCA 1JZ5A 5MKGA 4PFHA 4BF5A 3F03K 4GKLA 4GZ7A 3MJMA 5HWJA 3FIGA 1DTUA 2HROA 1DXFA 1ALDA 4C6MA 4WQ6A 2YX0A 5C9UA 2V3GA 3EWDA 4C7FA 1FFRA 2VURA 1GEHA 2VCAA 3L5MA 1Q45A 2C91A 5E6YA 3E0WA 3BARA 4WRHA 4M1BA 3NM3A 3OEXA 1RD6A 2Z6JA 1IEQA 1WOAA 3LM3A 1ECEA 1DQWA 1LORA 1X1OA 1PIIA 4MIMA 2PU1A 4M0XA 3W28A 4IUGA 2EPLX 1RCOB 2HSAA 3O05A 2XFRA 1PHQA 4PB3A 5DCDA 1BQCA 5C55A 3S9IA 4GUHA 3N4AA 1UKSA 3PWIA 3VFLA 3T08A 4KMQA 3PJTA 3IUIA 4HHHA 2BLEA 1E9YB 3NDYA 4K2SA 3WMSA 1I45A 2QPSA 3UBPC 4PCNA 1F74A 2FMNA 1WBHA 3QYQA 3INPA 3W7JA 2QDHA 1CGVA 4GYPA 4B9YA 1XQKA 3W2NA 3NVTA 3BWWA 4QQUA 5TD4A 4OBRA 2ZTJA 4M1RA 2A4AA 1D7KA 4I5XA 4IG2B 3QSRA 2ABAA 5TNVA 4C6IA 1QNRA 4KRTA 3S2LA 3H4WA 4JFWA 2VR5A 2J4GA 1LM1A 1U5JA 4LUSA 5A6TC 4OUIA 4GOAA 2DQXA 2CLIA 1S3HA 4W8BA 4C6EA 3WQPA 1XM3A 6REQA 1I1XA 4PTVA 2PDUA 3E6EA 4H2CA 4H2HA 2XU2A 1EKOA 1B30A 1UB3A 1YYAA 4HZMA 2ODOA 3THAA 3VTRA 1WKFA 1A49A 3KTXA 1HVXA 5DF0A 2QCCA 2QJNA 2ZX6A 3GRIA 1KQZA 1VH7A 3BSGA 3V5OA 1T96A 1EYWA 4JYEA 1S2AA 3EA2A 4G7EB 1I2PA 1TUFA 4HNUA 1Q8JA 1F76A 1H7WA 4C6FA 3GW3A 1E1FA 4LEQA 5LNSA 2G4JA 4M81A 2V63A 3LK6A 3NDOA 1BSLA 4LUIA 3UYIA 3MKKA 1VBRA 3NZQA 1DWIM 4GBDA 5CJNA 4Q3MA 3OVQA 3GC5A 1KV5A 4PTNA 4D6IA 4ZOAA 3W29A 3MBDA 2PLJA 2PDQA 4ICMA 3OHMB 2INFA 3QC3A 2R1PA 4DNHA 3FA5A 2YB1A 3LPPA 4PE8A 2KX9A 1U33A 4DNMA 4OZOA 1Y0EA 3NQ6A 3PBMA 3O0KA 4Q7BA 5EY5A 4E8DA 3P93A 5B80A 3RYSA 1ZL1A 2X1UA 3AZTA 3VO0A 1O6IA 3NM1A 1EZWA 2R24A 3PS7A 5A1AA 3J7HA 3CYJA 4PN2A 4GVIA 4S3KA 1ZENA 3NQFA 4CNTA 2PEVA 3LLDA 4K36A 1GT8A 1TELA 3VC6A 1CT5A 1MRAA 1EF3A 3CIVA 3MHUA 1UR4A 3Q94A 2PD9A 3R0KA 1TZZA 2GUBA 4JTLA 5H8PA 4GLEA 2VT0A 4LS0A 1FDJA 4HN4A 3GFYA 4W5UA 2AQOA 1A5NC 2EHHA 3CIWA 3IJIA 4MWAA 1V4YA 1WP6A 4XBSA 3T4WA 2D0HA 3HN3A 4GNKB 1BYCA 4FXJA 4MG4A 1S2VA 3NQAA 5D03A 4I9TA 3CAQA 4E38A 5F4SA 2Y5SA 1PKMA 3ANVA 2YCLA 4E4PA 2HPMA 2Z27A 1UR8A 1KRCC 3MTWA 2ONEA 4RCXA 3W2UA 4Y9PA 3C4UA 1V0KA 4HP5A 4OV4A 1ZBVA 3W37A 3L0NA 4K8GA 3N15A 3E2SA 3W00A 2PZ0A 1UD3A 1MYRA 2PDFA 5LIUX 4JYDA 4LW7A 5I0DA 1KCZA 4XZBA 2DVUA 1T41A 4FOKA 4EACA 2IQ0A 4L4LA 1YMYA 3EWBX 3W7QA 5G2IA 2DIJA 1S2UA 4ZFMA 4C6JA 3PG8A 2J7BA 4M29A 1IEXA 1E73M 3WLPA 3VGEA 4TV6A 3LV5A 1VR6A 2WCGA 1RLDA 1LQAA 1Q7MA 4YHGA 5EBUA 1KCKA 1RPKA 3M0LA 1L2QA 4EAMA 3R2GA 4ATLA 5H8MA 5GQBA 3W6MA 4LWWA 1LQ0A 5AC7A 4HSHA 5EYWA 3W7MA 4RDVA 2DT2A 2FLIA 4DAFA 4KIRA 2OEKA 3T40A 4B5SA 3W74A 1FWDC 3GM8A 3LMYA 2CIPA 3SCUA 7ENLA 2BDQA 4IIHA 5ABFB 3IANA 2CZFA 1UW9A 3DHDA 1OM0A 3WBEA 3QPYA 4TU1A 4NASA 3IJ7A 1H4PA 4UOJA 5GNYA 3DFNA 3W2MA 5AHIA 3W02A 3FSUA 5FA5A 2F8QA 4HK6A 2J9YA 4Q7NA 2FYMA 1Q6OA 4JTTA 3SW6A 4H6KA 3IRDA 1W3IA 1E51A 2P5NA 1PVNA 5I5RA 1W32A 2WC3A 2FTYA 4JIHA 4O28A 3BVJA 5EFFA 4UB9A 1R9XA 3A24A 3QKZA 2GK1B 2NX1A 3TQ0A 2O56A 3EX3A 1JCLA 1YW1A 2CKRA 4WOQA 1UWRA 2P50A 5AHEA 1F5ZA 4F2UA 1AK5A 2PC8A 1BHGA 3CM4A 2ZYFA 4P61A 2BVYA 1UKQA 1EJWC 1WCGA 3R8HA 4UFMA 1NELA 4MKNA 4DYEA 4D1IA 4ZQPA 1NTHA 3A64A 2X09A 3UJ2A 5EMUA 4BWLC 2WW5A 1UYQA 1Y7VA 4OJYA 3E5BA 2VD9A 3QMTA 4HPXA 3BTNA 3EEZA 3DXIA 1H1NA 3APGA 1XYBA 2BHZA 1NQ6A 4FEZA 1SW0A 2VX5A 3DECA 3TSMA 2XVKA 4FLQA 1EGMA 1J8VA 2I14A 4HKPA 3QZ6A 1HIZA 4C6PA 4DWSA 3H70A 4WDUA 3H24A 4MKVA 3EOLA 1MFUA 3OYXA 1X38A 5EPDA 3OLIA 1F3TA 4LC6A 2YL9A 1ZPTA 2FZ8A 1VBJA 3V1PA 2IPJA 2GGGA 5D37A 2W67A 1GWJA 1KFBA 3RILA 1RQEA 3WG6A 3KCLA 4US6A 1PO9A 3TDFA 1SZFA 4M7TA 4UCFA 3TTSA 2DZPA 3SAZA 4ZTYA 1V51A 3O6YX 1BXBA 5CPNA 4GGHA 5GJNA 3MYPA 3LRMA 5BOFA 3I7SA 3QVQA 1IXOA 2DU2A 3WELA 4IFOA 2CLEA 4EXQA 1KA9F 1XLGA 1V3JA 2OMAA 4LUTA 3CZ8A 4IFRA 3VFCA 3OZYA 3GC2A 3C52A 1J9YA 3ZMRA 2PWHA 4C1LA 4TMBA 1MXSA 3GQYA 2WVUA 1SR9A 4QQ3A 1EP3A 4PRRA 2JF6A 5LSMA 1X6LA 3STCA 4WSKA 3NZGA 2A3AA 5FAGA 4PODA 4S2CA 4IH3A 1OK4A 4D8AA 4MTVA 1QPQA 4DJDA 1A0CA 1J0YA 1TWWA 3WQ5A 3L4YA 1RHCA 2CBVA 3O7UA 2Z28A 3DENA 3M0IA 1E9LA 4LQ1A 1JUKA 4I9MA 1UD6A 5AYYA 4DIAA 3ZIZA 1ZU8A 1JIBA 2DP3A 5I3IA 3TJXA 3AWOA 3AXHA 3W1LA 1FCQA 5IFPA 2B4GA 4HSOA 4QEEA 2YIHA 3CMFA 1C8YA 3V18A 1XH2A 4JTJA 1HZYA 3BJFA 3ARYA 3B0XA 1NVMA 3ZO9A 1JCNA 2D0FA 4KGLA 1M7OA 3WL0A 4WGXA 2PSNA 1XINA 1ZBKA 1FKWA 3U3HA 3UCQA 2PTYA 4XKYA 2J9ZA 3WLIA 4O1FA 1VS1A 3QH2A 2ZUVA 2Q6ZA 4LALA 1VFTA 1R9YA 2A0NA 4WCJA 3PJUA 3GUGA 4GY1A 4A3UA 4JHZA 3NZPA 1UWUA 5IBXC 2FPVA 4H1ZA 1XP3A 2D2GA 2WZHA 4HBKA 4HPHA 4UTJA 1LLOA 3KTSA 1XSJA 1UMYA 1VFUA 2X2YA 3GX9A 2XGIA 2EXOA 4UMBA 1H7XA 1BVWA 5AC5A 4JIEA 4K8HA 2GL5A 3WNKA 3OQEA 4NAFA 5ABEA 1NAL1 1TPUA 1UWSA 3QMRA 2IXUA 3BK0A 4GUFA 1FP8A 2WKGA 1HP5A 2V5KA 5IXEA 2WBKA 1PCWA 4GNJA 1TQXA 3TTOA 3MWAA 5ECVA 4MHBA 1H2JA 1JI2A 1NOFA 4EXAA 4JICA 4JY8A 4LBRA 2FVLA 3P81A 4OIFA 1OFEA 4Q32A 1XRSA 3DIPA 1EC8A 3W87A 1W37A 5AC4A 2AAMA 2PGFA 3HG3A 1OGGA 1XICA 3W7DA 4AZIA 1GVOA 1B9ZA 1E9ZB 1GKPA 2QIWA 4QCEA 3EXTA 1ENUA 3K2GA 1TA3A 5D9OA 3CV1A 3G1RA 5CC5A 1G4PA 1QAPA 3SUUA 4LS1A 1EHNA 1HX0A 1D9EA 1ZFJA 3LHVA 3SM0A 2J8GA 1PDYA 4D6DA 1HJXA 3CUZA 4FLOA 3NQGA 4LCRA 2IS7A 1ISXA 4A2RA 3G1DA 4BF9A 5A94A 4CNOA 1DWGM 1JPHA 1SZRA 5FJUA 4US5A 4J3UA 4UTFA 3PM6A 5HQMA 5DX7A 1G7VA 4OBSA 4GC4A 4MB1A 2XIOA 2V9DA 3N2BA 2UY3A 3V0UA 4CQDA 5AC6A 1IT7A 3W24A 2BV9A 3WNNA 2GDUA 4Q4KA 2JIWA 4CQCA 4J3ZA 3CV7A 2O4MA 5GNXA 3UCDA 3LBCA 2VFDA 4ZR8A 1IR1A 1LOQA 3GFXA 4O15A 4NKCA 1E6RA 4LAOA 2XFFA 3AHZA 4O8AA 5FACA 2J79A 4FLSA 4KWSA 4KKXA 4TVCA 3F5JA 4NZCA 2AKMA 4PMDA 2CZDA 1XH1A 3ICJA 3JW7A 3W4RA 4EWJA 5CBBA 1XLFA 4DVOA 3RX3A 1QNOA 5FSDC 1RQBA 4O1CA 1XIFA 3BUVA 5CC3A 5LXEA 4RW3A 2CBIA 4BQ5A 3QLDA 3KP0A 2WBGA 2DORA 3CUXA 3LXCA 1XIIA 3VNDA 2NVDA 4Y2WA 4XZHA 1D3HA 4BK9A 2PLCA 1MZHA 5A6AA 3F5LA 1MMFA 2D2JA 4HZ8A 5I07A 4I90A 4C6LA 3Q67A 3B8SA 2CLMA 3TSDA 2W62A 5I3JA 3AXXA 1R2SA 3SQLA 2O55A 1OG6A 1P0BA 3W88A 1H7RA 1AJ0A 1OD0A 5DEZA 1X96A 4H9VA 4QLLA 4KQNA 2FB2A 3BURA 3NUKA 4CKQA 5DELA 3NOYA 2DSUA 2GJPA 4MYXA 4D1JA 4OE7A 1BTMA 3OVGA 3CT2A 2VL4A 1WNOA 1P1XA 3UR2A 3WD2A 2HZGA 1SJCA 1TYGA 3OGRA 3HZ3A 3KTCA 1SJDA 2DZSA 1UZ4A 3K4WA 3WMBA 1CGXA 3NAVA 3OGSA 3R6IA 3TP4A 1NFGA 1UHVA 3NEVA 3LCWA 1K4HA 3BLFA 5DANA 5FEWA 5E9XA 3REQA 1E5JA 1SFTA 3RCNA 2GVJA 2G41A 4DO5A 3HPXA 4L80A 1JYVA 4LAKA 4HNTA 1PS9A 4F0MA 5T9BG 2OZ3A 4HPGA 4HTYA 3CGTA 2BXZA 4IPIA 4AB4A 2TODA 1AQFA 4MPQA 2I1OA 4I8DA 4RNJA 1OHLA 1AD1A 2VEPA 3KBVA 4GZJA 1P0EA 4PMVA 5REQB 4FLRA 1JYNA 2ZRVA 3GTXA 4B16A 4O12A 3TSBA 1RVKA 2JGQA 2IKHA 3ES8A 2PURA 4XD5A 4IIFA 4L5ZA 3JZEA 4W84A 3MW7A 1HP4A 2YLLA 5CZ0A 4PUKA 3F1QA 1ECQA 4JTHA 2Q02A 3GWQA 1I1WA 4FK9A 5D30A 1GQIA 4S3JA 1K02A 4QP0A 1H41A 1XHGA 3NR0A 3CUFA 4X9SA 3B04A 3RR4A 3B4YA 1K4GA 3KHDA 1E9IA 2HBXA 3GG7A 3P3BA 4NNBA 4S2BA 1U83A 1Q6EA 3DESA 4TTUA 3QQ1A 5D04C 3B8TA 2CU0A 2VZVA 3XINA 1C93A 3O6AA 3UW6A 1W3TA 4W88A 1ISWA 1QBBA 4XD4A 4RDWA 2Z1XA 2XIMA 2ZA2A 3S1WA 1C7SA 2RGMA 4E4FA 5D33A 4D8ZA 3QJAA 3VAVA 4AC7C 2BGNE 4F8XA 5CG0A 3H4GA 1YDVA 3LS9A 3PZGA 1NOUA 3M7SA 1PKNA 1EDQA 3UT0A 3C6CA 4C1KA 4ASTA 4LOCA 1QCWA 4GIAA 4H8NA 3SIZA 3C5QA 3MVIA 3BW3A 4AMCA 4UZSA 1XUUA 4CU6A 2BVDA 3SZ8A 4UOQA 1IQ8A 1X1ZA 2XH7A 2XFYA 3RO8A 5C9ZA 4ZSUA 4L9YA 1KFCA 2GZXA 4Q8WA 5A69A 3CPRA 2HVMA 1F8MA 2GVEA 1R6WA 4GIYA 3WFZA 3H12A 3MU7A 1AD4A 5DBUA 4L61A 1XIBA 3WEZA 1KM0A 4R27A 4JGDA 1ONRA 4FNUA 2I9EA 3ITVA 2RDTA 2VC5A 4Z1DA 2RHGA 4LPCA 2DZUA 2ZA1A 5A8NA 4QSHA 2YBUA 2YCEA 3P8JA 3THDA 4NZ1A 3MC5A 3BW2A 4N9EA 3O9NA 3LBOA 2G95A 3FSTA 4DJFC 1ADDA 5D9PA 3MPGA 4NQ1A 1HNYA 2F84A 3LXBA 4TIMA 1IWPA 2H3BA 1EXPA 3IACA 4MWAE 2DZVA 3HMCA 1FDYA 3ARRA 3O8AA 3NDZA 3URQA 1TRIA 1RA5A 3EA1A 3MCNA 3LM7A 4JIQA 2X41A 1ODUA 4GZIA 3VIHA 4J2MA 2EO7A 3SQMA 5HJYA 3BJTA 1UR9A 2HXUA 4QG6A 1ZQ5A 3VNLA 4JN7A 3HQPA 3WQ6A 1GW9A 3H53A 1M65A 3PJWA 2NUWA 4DM2A 4RE2A 2J78A 3KAOA 3GYEA 2DFAA 3AMCA 2QT3A 4Z1CA 4IG2A 2FIQA 8CGTA 4D6JA 2VDIA 4ML4A 3GHTA 1JDFA 4UBPC 2ZICA 3M9YA 2FGBA 4X0NA 3LCXA 3UJRA 4WDWA 2GWNA 3VCNA 5E93A 1JAKA 1KRMA 1UUMA 2ZUTA 4KCVA 3BCDA 1ONXA 2BOEX 4IWWA 1TWDA 2B7NA 1KBJA 1DORA 1UR2A 4L6HA 5FJIA 4P8UA 3A3WA 3LHYA 4RR4A 3MZNA 3AHXA 3QV8A 3JRKA 3ZJKA 7PTDA 3BGJA 4B5TA 2WLYA 1UCWA 3UVAA 3GBEA 4XG1A 4A8IA 1MEIA 4D6HA 4X63A 2YW3A 1TTJA 4GXMA 3LLXA 4I7VA 1QATA 3URBA 3E9AA 2UY4A 5CSRA 1OEPA 3B8IA 3EOEA 3QY8A 4OOUA 1E4MM 1JCYA 2VCBA 4KF1A 1FCBA 1DBTA 3HGJA 4GY7A 4G7EA 1JZ7A 2JE8A 1RCQA 1KFLA 4Q4SA 5FOOA 3PN8A 3LCLA 3T2PA 4PCFA 3CMGA 2J24A 4ZOCA 4CEUC 4IIBA 4IPNB 1PKYA 2ZOXA 3QEZA 1JDEA 4MY8A 3GAKA 3OP2A 1SFLA 4QRNA 1OABA 2PDHA 1WXJA 3PVFA 1YX1A 2VEKA 2GJLA 4BFAA 2CFFA 4IMGA 1GGOA 2P8CA 2VDGA 3BZGA 3WD0A 1OADA 3ARZA 4B91A 2WWDA 2C15A 3PUEA 3FKRA 2IPFA 1IIGA 2PDXA 5CXPA 1IWBA 4RNHA 2JQXA 3ONCA 4KH2A 3TCEA 2DSVA 1IZKA 1PCKA 2X7WA 1S2WA 1U22A 4JHOA 2ZADA 5FAJA 1WBJA 2Y8VA 4B15A 1PX8A 2C18A 1WZLA 4ZVJA 2PFHA 3PULA 1XXXA 1ZCOA 2X40A 5E5CA 3TJIA 4A3HA 3DX5A 3KHJA 2ZX5A 4C5ZA 3HG5A 4GABA 4FXFA 4XX6A 3LRLA 1QO2A 1TR1A 1IE7C 2BXVA 1W3HA 3HU7A 4GQGA 4K1WA 2PDJA 2F2KA 3ARVA 3ORWA 1UWIA 3I4KA 4GUGA 1TX2A 3AUOA 4WY0B 4JCMA 4YJ5A 1US3A 2GJXA 3EDEA 1ICPA 1CWYA 3TMQA 4BZYA 3MA8A 3QW4B 2P8BA 3EZ4A 2DZWA 1H7PA 3T2OA 5ABHA 3ZR5A 1G7UA 2V82A 1P1MA 3UR8A 4JTFA 3M0YA 1LROA 4LCSA 3GVWA 3AUJA 3TW6A 3VILA 3DYPA 1S5VA 3BGGA 4XZWA 2I16A 3ZSTA 1T40A 2WKJA 3FCPA 1JF6A 4IX2A 4UNLA 3VE9A 3IEBA 5C9XA 3VNIA 3VIKA 4Q8TA 3PBWA 2OQHA 2GGHA 4HOXA 4DZHA 3KS5A 4O11A 4CN1A 5XINA 3ZLFA 2NT1A 4J27A 1KC7A 2PP1A 4QLJA 3UJFA 3GIQA 4DQWA 1JZ4A 3N29A 2DY3A 3UD6A 1PDZA 3ZOAA 4J3WA 4Y96A 1XYFA 4JCLA 4LGXA 2DH3A 3PB0A 3WLTA 3LCHA 4MVAA 4WZHA 1IZCA 3HPZA 1Z41A 2TRSA 1E1EA 4GCXA 2H90A 3NQ7A 3OGVA 1YHTA 1VAHA 3LY0A 3R8RA 3P61A 1GKRA 2E9BA 2FFIA 2WMHA 4D6FA 3VMPA 1RK6A 4GUIA 3S1VA 4B3ZA 4S1FA 4Q4MA 1OCJA 1W56A 3R5EA 4NYUA 4N4PA 3M0VA 1POKA 2ZE0A 1UR3M 4J1OA 1HN1A 3M0ZA 4INFA 1CGWA 3N3MA 3CBWA 4YS1A 4Z2IA 3LDVA 5ABFA 4NZJA 1S2CA 4WHBA 4QNWA 3CU2A 4WJEA 1HL9A 1NWUA 1KWKA 1HW6A 2XM2A 1G01A 3HIJA 1QNVA 2OJPA 3JR2A 2DSWA 2PDCA 5KETA 1XDJA 3OG3A 1J0ZA 1H0GA 4PCPA 3KE0A 2NV9A 4W7UA 2P3EA 3UWVA 1R3QA 4J28A 4Z1BA 3DDMA 3ZVHA 4B2DD 3RJYA 5M5DA 3NXLA 1EGVA 3LSCA 3I3DA 1OVDA 4FNQA 4IPJA 1JCMP 4GFSA 3ITOA 4XV0A 1F6YA 3P8IA 2NLIA 4BHYA 4A8NA 3GDMA 9CGTA 5EFDA 5HA7A 2RJGA 2DV0A 5I3HA 1L6GA 1E6QM 4LFYA 2IQTA 2QW5A 5A2AA 3VVGA 2R8WA 1JQXA 1ZUAX 2HJPA 3M46A 3EX4A 3GIYA 2CETA 2OFJA 4AD0A 1S39A 2ZC1A 3KDOA 3G5EA 4DYJA 4C7DA 4BQ4A 2FHCA 4CD7A 1JGIA 3BAWA 5I79A 1P6CA 4Y9MA 3UPMA 4IGMA 3T78A 2BFGA 4F2BA 2PWDA 2QAFA 3L4VA 1O68A 1QPNA 6ALDA 2I5QA 4X2RA 4C6CA 5AOUA 3TWAA 4GA8A 3TQKA 3VIJA 4ZO6A 2CLOA 4J40A 3TNOA 1TZ7A 4AYGA 1XGZA 4I5RA 3P5YA 5A3HA 2FZMA 4EWND 2PBGA 2WZEA 4GYFA 3LUTA 1AQHA 3A5VA 2AGTA 3VNJA 5HULA 4NNCA 3H55A 5AHMA 4AD2A 1QI4A 3W6YA 4WVXA 1J93A 4UNKA 4PUWA 2PCEA 4WOZA 4N9CA 2FMOA 1KTBA 2B0MA 3CAKA 3GO2A 5FJRA 1CZ1A 1K9DA 2ZA3A 4AY7A 3RAOA 1E0WA 3UWQA 3M0XA 3IIVA 4BI5A 4P8WA 2NQLA 4O18A 1QDSA 4LVDA 1VRDA 4F9JA 1TV7A 4DF2A 4Q4PA 2DZTA 2PF8A 5HXMA 2NT0A 3SFWA 2NLYA 1JEZA 2Q3RA 1WUFA 1A0DA 3MWCA 1QPKA 5CJMA 3WMLA 4CU7A 4HJFA 3PJXA 1VZWA 4YCOA 2C3ZA 2BY2A 1TPH1 3LOTA 1PKLA 4ZQOA 3KOYA 4CQAA 5CBIA 5AYBA 4JOMA 2WWCA 1YBQA 1OFRA 2VXNA 3UY7A 3W9ZA 4GYPC 1HO1A 3WLOA 1U1JA 1POJA 5LIXX 1GOOA 4PUMA 5LHEA 1FBAA 4N6EA 1RAKA 1KGUA 1GW1A 2E4TA 4HD5A 2P1FA 4MJ2A 1EEXA 3AS3A 5CPLA 4MYAA 4CCZA 2ZCGA 2G97A 1R3VA 3KVJA 2FVMA 2PWFA 3UU0A 4QLKA 3RRXA 4MZ1A 2WHLA 3CHCA 1AJ2A 3TYBA 3NO1A 3M7WA 1H62A 3WF0A 3CB3A 3P0WA 1BWVA 3KOZA 3N9KA 4HQVA 1AH4A 4V27A 2EF9A 3S6DA 4PMQA 3W1MA 4Q22A 1UJPA 4I8YA 2QLYA 3TOPA 5A6JA 2P53A 2E6DA 3IGUA 1EDGA 4WY0F 3B0YA 1DJZA 3PBVA 4HTBA 4QBXA 4D2JA 4AEFA 2EPNA 3ANUA 4RL3A 5C2GA 2EG6A 3UXDA 1GVRA 3O6DA 3KVMA 1VLWA 2G3FA 3EOUA 5D2TA 4GD0A 3ABQA 2WPGA 3LHTA 3B9AA 1BKHA 4FOUA 2J6XA 4FA3A 2YL8A 1UA7A 2HMCA 1ZGDA 1EQCA 2QMJA 1Z8AA 1W91A 1ZP4A 2PDBA 3OLGA 3OOQA 3K4AA 5D05A 4RXFA 2Y61A 1JD9A 1Q85A 2BX7A 2Z1VA 3EDFA 1UWTA 3FHQA 1J5TA 1UD8A 2FQIA 3I6TA 2YJQA 1A0EA 3CJPA 4UIOA 3HV9A 4JZ5A 7REQA 3B06A 2REQA 2PRMA 1LT7A 5L6UA 1N8FA 3MUY1 5DY2A 4RX0A 1AUSL 3R43A 1TVPA 2O9PA 3V36A 1P0KA 3FN9A 2QCDB 3I6RA 3W1UA 5DT7A 4A2SA 1W31A 4R7WA 1M53A 2FPTA 3UETA 2NQJA 1UKOA 2TYSA 4FPSA 1XCXA 1J0KA 2AKZA 3ZWTA 1D8CA 1QHZA 3UG8A 3A3XA 3ABZA 4TOQA 2ZXQA 1HO4A 4DLMA 5FL0A 3U57A 2XH0A 3DKLA 4MUZA 3MUIA 2XIJA 4QE4A 3RUBL 4PTXA 4Q8UA 3R89A 4CNPA 3QZEA 4ZEPA 3UZZA 3UG3A 3KRZA 1W9PA 1EL3A 2ON3A 2QUUA 1KBBA 4DXVA 2XGBA 1A5UA 2VGFA 3NL2A 2IPGA 3HURA 1R3WA 3L65A 1JZ8A 3D3FA 1WZAA 3MCMA 4H8VA 3BSMA 4WDXA 4JDYA 5PTDA 4MWAC 2A7RA 1A53A 3FYPA 3KL5A 1M03A 1QOPA 3QBUA 2A3EA 4LYRA 2VEMA 4IGSA 7XIMA 3MB9A 4IJCA 1DJGA 4LBSA 3CHFA 3PFMA 5CLWA 1I2QA 3FDGA 2E3ZA 3MO7A 4IISA 4H3DA 4GPNA 3QV7A 1SW7A 5D2XA 1CEOA 3GXTA 3M1ZA 1M41A 2CC0A 3HFTA 1OQFA 4F40A 2QQ6A 3ARQA 3VZXA 1OB0A 2H9AA 2ATSA 4D9PA 3EB2A 1FH9A 1DTNA 4GO9A 3QHOA 1M04A 4AVOA 3OW1A 1LYXA 2E77A 4L1GA 4NAEA 1XRTA 3MI6A 5I7GA 3G1SA 2AL2A 1FWTA 3D47A 1V77A 1EP1A 5LNWA 2A3HA 3MANA 2CESA 3VOHA 2DUAA 4XBJA 1SPQA 5BXSA 3TH6A 1KBIA 2CLLA 5JIPA 3WDIA 1HGYA 5AB3A 2VENA 2WJDA 1YNQA 5T26A 2ZZ2A 3MHGA 1Y65A 5C2CA 3TYCA 1HKKA 5A6LA 4QFUA 1V0MA 3KBNA 3BOXA 4B5UA 1Q65A 3AI0A 3FAWA 2XVLA 1AW1A 2I7GA 3GXIA 4E8GA 4AZ7A 1B4EA 2NVCA 3W0KA 3VIOA 4YTRA 1UZ1A 3FFSA 1EP2A 2TMDA 1U30A 3BQ6A 5BROA 2WQPA 4IT1A 5H8UA 2XYLA 1YXDA 3ENLA 4XZLX 1G5AA 4XSLA 4YYCA 1E71M 1B9BA 3UXAA 4IFKB 1E0VA 1G0CA 1KNWA 1KXHA 3NSMA 4LYKA 1H0IA 2WVSA 2VD8A 1HJWA 1W1TA 4WSJA 2Q8XA 4ZCWA 1B1YA 1D2KA 5CCZA 4W7WA 4W86A 3V5CA 2XZ7A 1UPPA 3C2VA 2VFIA 4NJJA 3SADA 3C0SA 2BODX 3PUGA 3SUTA 4F9DA 2V5DA 4EPBC 3CHDA 1F05A 3PWGA 4U3AA 4HK7A 1GVQA 2CCRA 4MAVA 1MRQA 1XI3A 3ARTA 4TVUA 5C9RA 1YRRA 4WD0A 5I02A 1O66A 3UYCA 2DVXA 3ABOA 3T07A 4O14A 1Q6QA 3F2BA 3PG9A 3S2MA 2GJNA 5LKYA 1EOMA 1PV8A 4O52A 2YPIA 4M5PA 2R1NA 2VEGA 4C60A 4GVHA 5JH1A 4G1KA 3CV2A 4NX5A 2YB4A 1IT8A 1VEOA 3PSWA 1JDDA 5EA9A 2D2OA 3WH7A 1QRQA 2TSYA 4MFEA 1XYCA 2WNWA 4AVFA 5A6BA 4LV4A 4XIMA 1I0DA 4DWSC 1KLZA 1FTXA 4PBGA 2PDNA 2VEFA 4XKMA 3UWUA 2CITA 1REQB 1OCBA 4HA0A 4PMXA 2BTMA 5H1WA 2TAAA 4PMYA 3WF2A 1J2BA 2V81A 3UERA 3WQVA 3VDHA 2HTMA 3DG6A 5G2HA 2E1DA 1FH7A 2Y4SA 4REQA 5A8GA 2RUSA 3E49A 1QW8A 4F0LA 4YYFA 1EYEA 4PSPA 2OTDA 5HWMA 2NW0A 4KERA 3E12A 2O9RA 1I9CB 1AL7A 1TO3A 4BEUA 1B2YA 4GY0A 3VDGA 4F2TA 1SO3A 2ICSA 1TPFA 1KB3A 5M03A 4XISA 4G56A 3NNTA 1GOMA 4HNOA 3DI1A 2DJLA 3CQIA 1DWHM 2VI0A 1NP0A 5AYIA 4DJDC 2JKAA 1JR1A 3LCGA 3DFPA 2JALA 3AO0A 4D72A 3W26A 3RF9A 3H26A 4PUJA 3TTYA 2EGZA 3Q4DA 1H50A 4CGTA 2MANA 4UZUA 3P60A 4LU0A 3SECA 2RDXA 3BGAA 2E5BA 1RA0A 3GR4A 3LZ5A 3HMJG 1WDWA 2VGBA 5HJXA 5CQ1A 4XUYA 3G0SA 3WY1A 4PCSA 2OQYA 2INZA 4UQEA 4JS3A 5U7SA 3GHUA 4OVXA 1VPYA 1ZRQA 4JIIX 3W7CA 1JFXA 3EB3A 4AH7A 4M6UA 3G1YA 3VPLA 2YYTA 4AUBA 5CSYA 1YXYA 3KWSA 4I5UA 3TYEA 3EB4A 1O7AA 5D8WA 4B92A 1EQPA 1QK2A 4C6OA 5DMLA 2WHMA 5CJ5A 4MMWA 2VWSA 3BO9A 4LB3A 4FAMA 5HOSA 1XUZA 3W2LA 4AF0A 1JQVA 1H1ZA 4W8AA 3G22A 4HMEA 3K8LA 3SEPA 5BWAA 2VJXA 4GI8A 2QVNA 3NZRA 2CEQA 1KV8A 1OX4B 4K1GA 2WOQA 1E43A 1E0UA 4MFDA 1TPWA 1NWTA 4ACZA 2ZRWA 1UC5A 4EPDC 3DFYA 4BY3A 4WUIA 4JTAA 4RZ6A 3GAYA 5KSWA 1X39A 1UBPC 4JBRA 2RDUA 1R85A 4BKNA 3QPEA 4FS9A 4OWGA 5IFTA 3CUJA 2QZRA 2GDVA 1Q2RA 2E6FA 4YTTA 4PMRA 1CIUA 3O07A 3O0FA 1MW3A 2FTWA 3VKBA 4EIVA 3T4CA 3S5NA 3F4DA 1PTGA 3CWNA 2VP8A 4XWUA 3IVSA 4H00A 2E09A 3M64A 2I5IA 4DZIA 3COTA 2Z6IA 4HMNA 4YLWA 4FALA 4NILA 3RK8A 4M19A 3LPFA 3VIPA 4FF7A 3CLWA 2X1RA 3SN4A 3AU6A 3BG3A 1GHSA 3GXMA 1GTHA 2HVNA 1Z3NA 4IF2A 4XTIA 1QW7A 3U48A 1D3GA 4PB4A 1Q6GA 1OC7A 4O0QA 2WKLA 3NQCA 3KBJA 3T81A 3IGHX 4BJHA 5CZSA 3EDKA 4GNVA 1LF1A 1KM6A 3PP7A 2WZIA 5A2BA 4NP7A 2XH2A 4AIEA 3PTKA 5DCBA 3MZ2A 2TPSA 2POZA 1SFJA 9RUBA 2X30A 3DUGA 3AWNA 3S47A 3T6CA 1IYXA 3MUZ1 5DFAA 2CPUA 4UFIA 2FH8A 4QE5A 1RBAA 5K7JA 3GTFA 2E1WA 1K1DA 3QTGA 4XO6A 1XLIA 3RNDA 1GORA 3WO8A 1WXZA 3CH0A 4MNKA 1RJPA 2VFGA 1UIOA 3OVPA 4P2VA 2IKJA 1Y5VA 3S83A 2C71A 5CZTA 3W85A 3W7OA 4AD5A 2GVGA 1YDNA 1TPC1 3NA8A 4ERAA 3PB2A 2HK1A 2I57A 1T8QA 3S8HA 4DBSA 2WVTA 3A47A 1LUCA 3EX1A 1CXHA 4JX5A 3AIQA 3TLLA 3HB9A 1HVQA 4JPGA 4J2PA 2FH6A 5D09A 5HMDA 3UP8A 1Q6LA 3HGRA 2PBOA 3B8DA 3KOFA 1JCTA 4QHRA 1DXEA 2DPEA 2RJHA 3HO8A 2OYKA 3IV3A 3CQHA 2V69A 1XGEA 2QKFA 2Y2WA 3HPFA 4E2OA 2VGGA 4XZNX 4M24A 4ALDA 1JPKA 2F7FA 2C0AA 3S2JA 5BCAA 4AD4A 4HOWA 4ICNA 4IGHA 4C1NA 9XIMA 4W93A 4H9XA 1SMDA 1TQJA 4I9JA 2BWGA 3FXGA 3E74A 2CW6A 1DE6A 4C7GA 4YVVA 4A3YA 1FHDA 2W3ZA 1LL6A 1EC9A 3AHTA 1GJUA 1R7OA 1CXFA 3MUXA 1JG9A 2FHBA 2IQDA 3TYDA 2WYSA 5M17A 4AU0A 1IGSA 3T0DA 4JFUA 2DIKA 2XJ7A 5JMUA 4HHMA 1GVFA 4UTIA 5K4ZA 2KAUC 1W1B1 2FDSA 3QF0A 2BOFX 4HNVA 4WKAA 2YA2A 3M5XA 1BF6A 3VZZA 1VD6A 4QEHA 2Y70A 3CL7A 1VPXA 1WV2A 2A7NA 3TU9A 1NP2A 2NWRA 4F0SA 2ZRZA 3IJQA 1K77A 1ISZA 3V1HA 1KRAC 5GPRA 5GVJA 4MPKA 3FVDA 3OA3A 4Z2KA 1E6PA 1NDVA 1GUVA 5DN1A 4FNTA 1T5AA 4UQBA 4AZCB 3Q37A 2ZZ1A 1PWMA 3AYSA 5CG7A 1CGTA 5IHRA 3GB6A 3TJLA 3ITCA 3H22A 2GDQA 1NQKA 1OJXA 1OX5A 2CNCA 4DYKA 1YTDA 3P5ZA 3N18A 3DHUA 2HQAA 1QNSA 1OCNA 3AXMA 4D8LA 2QUVA 5KZEA 5HR6A 1CXLA 1HG3A 3HG2A 4GK8A 3B3DA 4DJFD 3CIXA 4UR7A 4R53A 3WFAA 4XBKA 1ZJBA 4UFHA 3UQNA 1TV4A 3RU8X 3LSBA 3BV4A 4OECA 1KKRA 2Y63A 1RVGA 3G6MA 1AH3A 4DX3A 3BAXA 1LBMA 3U2OA 4HA4A 3PZQA 3LB0A 4DJEA 1Z32X 1A47A 3WH8A 1W8SA 4PC8A 1OFOA 4KGJA 2EEXA 3R1ZA 1OFPA 1M9HA 3WJZA 2QJGA 1AQMA 3W7GA 2QEZA 3S2CA 2R91A 3GNNA 3S2NA 1XL9A 1TVLA 1D8WA 2XWEA 4HIBA 3L21A 3QRHA 4I7UA 3IUHA 4N2YA 3MP5A 2C79A 3UR5A 1SW3A 4EX4A 3VGBA 2WMGA 2F2HA 3VNZA 3UWYA 3CO4A 3UGVA 4AZHA 5HUPA 2WMIA 5JQ9A 1B3YA 3N73A 4R33A 3FW6A 1KXTA 4XAGA 4RUBA 3CEPA 3FA3A 5AHFA 4IGNA 1TZ9A 3GKFA 4BA0A 1JUBA 3B40A 1YEYA 4IPLA 3NO3A 4NRSA 2ASHA 3VD5A 3PSVA 4RZBA 3M07A 4EPKA 5LIWX 1LWIA 4HZ7A 3TOYA 3HQNA 3SUVA 1EC7A 1IXQA 3KRBA 2GOUA 5IDZA 1MNZA 2H8XA 2X16A 2DSZA 1YNYA 3H54A 1M68A 3OJGA 3EWYA 3NOEA 3TC6A 4AWEA 2G37A 1JVNA 4ZTXA 2QUNA 5JU6A 4K39A 1QW9A 2CLFA 3WJWA 4NZ4A 1GOIA 4H04A 4D6EA 1YTEA 5ABTA 4CCEA 1HJSA 4ZSTA 4PA8A 1GK8A 3ZJ6A 1ZBWA 4ZENA 3WUEA 1R87A 4DBDA 3NEHA 3WK3A 4EXBA 4JFVA 3WK2A 1LWHA 1L6FA 5G4HC 3U8GA 2NXHA 5FD0A 1QI5A 4ZFCA 2YBTA 3CMJA 1P48A 1KLYA 3CPGA 2JKPA 3QV6A 4GI4A 1K9EA 1XBVA 2FZDA 3NQDA 3WK0A 1FFQA 1WOBA 3WJXA 1L0PA 2QJIA 4ZB2A 3K5XA 4ORIA 3WLLA 3U5UA 1JCXA 4Q6JA 4MY9A 1S46A 3NQ8A 2VTFA 1QI3A 4ZZ9A 1W1ZA 4AWUA 2Q8ZA 3RPTA 4L1XA 4KIEA 4RV3A 4LF1A 1EIBA 1FVPA 5M2FX 3ARUA 4ERIA 1E1CB 2WPBA 3VX0A 5BMXA 3WLNA 3FGCB 2WO5A 3OA5A 3OTRA 5MKGB 1XYMA 1EJRC 4V28A 4ZQCA 3RLVA 2J25A 5K9CA 4KPLA 4O54A 3L23A 3UZYA 1OZQA 1VJZA 3DOPA 2V5BA 3WLKX 4PTDA 1I75A 1PTAA 5KTLA 1Q3NA 1TIWA 4WEVX 3GZAA 4DUWA 3A3HA 4RZ5A 1XW8A 1X1NA 2PDLA 3EOOA 4E3VA 2HXTA 2XFWA 1QFEA 4CNSA 1ITUA 3N2OA 1MO0A 2QNEA 2YCIX 3IIOA 4O1AA 3CAVA 2NQZA 1V8EA 4NF7A 1BEUA 2O9TA 3S9YA 3A23A 2A3LA 4Q33A 2OLSA 3H2FA 2XN2A 2YDRA 4ZXOA 3CQJA 2AGKA 2VZSA 1E5NA 2J7GA 3GVRA 4UQDA 4KCWA 1E4IA 4ML9A 3MSGA 4IMAA 2W61A 1G9HA 5FJOA 1BWLA 4L9ZA 4MLRA 3UJSA 2OX4A 1G6CA 5J04A 3HG4A 3MDUA 6XIMA 3N4EA 1V3LA 2E9MA 4LS2A 3WQCA 3DG7A 2XIIA 5H2ZA 2HE8A 2ZXAA 3H7UA 4N6FA 1PBGA 5HPCA 1VYRA 2GJRA 4DF1A 3KRSA 4C65A 1H5YA 1Z42A 3N11A 3RM4A 1I4NA 3PZ9A 4R9XA 3MP3A 3PR2A 1UWAA 2NVAA 2UBPC 1H5VA 4DZAA 2HE5A 2ZRYA 4MB3A 1E56A 3PPGA 3RITA 2YBVA 2VQUA 1W9BM 2OOFA 1V79A 1KTNA 4RDZA 1EWDA 3SCOA 4J5NA 4MJZA 1XRVA 4LANA 1QNQA 3M0HA 3FOKA 2YKKA 4K68A 2VGIA 1XIGA 3OB8A 3FY1A 2JF7A 4LY8A 1GG1A 2WHKA 1WDQA 1IEIA 4LUSB 1JGMA 2WNQA 4P7OA 1C8XA 4HCLA 4O57A 2H6RA 4JIRA 1JNEA 3PPCA 1GPFA 3HOJA 6REQB 2VELA 3W1XA 4AISA 4HMCA 3QHNA 2OWCA 2Z2BA 2Y0FA 1RCXB 1V7AA 4PMNA 4J3SA 3FV9A 1EZ2A 4JQ1A 3R12A 1AH0A 2G96A 4TX9A 4G8TA 2R14A 3M5ZA 1H7NA 2QUMA 2EPHA 4QNEA 4HA3A 3AROA 4IMDA 4LAMA 5C8BB 4NSBA 1HGWA 1Q63A 2A1YA 4FHAA 4HPNA 1RUSA 1OFDA 3DC8A 1DQUA 4QX4A 1F8IA 2W4XA 1MQPA 3C2RA 2HVOA 4S3GA 2PI6A 1OCQA 1VIWA 2BASA 1GNXA 5CZKA 1VKFA 1ML1A 1VYPX 1XLKA 2Y8UA 2Z24A 2ZTKA 3CNYA 3HBLA 5JBDA 1W3LA 3HPAA 1TKKA 4O17A 1ZJIA 2WB5A 4OTKA 3R79A 2OZ0A 3SRFA 1JPDX 4GZEA 4FI4A 1SZGA 4KFPA 3ANYA 1SU5A 3W82A 2HNEA 5AVHA 4H83A 5B7ZA 2IKIA 4ONVA 4PB5A 4C6KA 1ODZA 2IXVA 1AFSA 3RGTA 5A8PA 2DW6A 3EMQA 3P0XA 4JFTA 3VK5A 4E3TA 2X1SA 3NJ3A 4QITA 4UQ9A 1FXPA 4YWSA 4H6QA 1J5SA 2BBFA 4QS6A 4MJMA 3CZGA 1A3WA 3ZWSA 2ISVA 1FY6A 4JQ3A 5M1TA 3V75A 2P0OA 2QIIA 3CXOA 2AOSA 4TUFA 4WSHA 4GXWA 3HV8A 2V3DA 3PPHA 2VKZG 4K6AA 4JNZA 1RBOB 1F7BA 3PBGA 4QR6A 4LUYA 4AWTA 2QS8A 4MOZA 1OC5A 5CKSA 3VKKA 2OSXA 4MWAB 4LAUA 1TPVA 4MY1A 4YTUA 1UD2A 4ZGYA 4Z2HA 2PB1A 1XLAA 4F79A 1HKVA 3HPSA 1GJWA 1BGAA 3AYRA 3BJSA 3UA3A 3N9RA 3WD4A 4GIRA 1UR1A 1ELSA 4HB7A 3TLQA 1XJBA 4S3AA 1J10A 3MI2A 5T8GA 4RJEA 4LCQA 1DPMA 2CERA 4AZGA 1LLZA 4TV5A 1RK5A 4NJIA 4KEMA 3ITTA 2WMFA 1KXVA 4JTQA 4RLIA 4XSMA 4EP8C 3VD3A 2BVTA 4KBXA 4PL1A 2VVSA 1VGAA 3ABRA 5CPOA 1CPUA 2GQ3A 3T0TA 1B3VA 2RH9A 1FA2A 3EMZA 3TONA 1TWSA 3L5AA 3LBMA 4YU1A 3W70A 4KT2A 4GQBA 3RCMA 2YDSA 4M3PA 1A5OC 3THUA 1WB0A 1Y5WA 4QG8A 1XCFA 3B0UX 3PTQA 4W7VA 4MF4A 2X05A 3W6LA 3SCNA 4H19A 3VX1A 4YWIA 4YN5A 4O1BA 1TTQA 2DIEA 3ALFA 1W9VA 3OODA 4XVEA 5T91A 1XIEA 3QN3A 5U4NA 1K7XA 4HT3A 5KINA 2ZBTA 1UR0A 1BD0A 2HV5A 1YIXA 6TAAA 2Y89A 3QFWA 1K8CA 1H3GA 4L6DA 4GO8A 4ATWA 5DRIA 2QCFA 1B90A 1U2YA 2V38A 3BAJA 1GVYA 3H2EA 3N14A 2PC4A 2J13A 4GG9A 1R3SA 2XHYA 1DE5A 4NJKA 3GSMA 3R58A 2YXXA 5I77A 4C6BA 3BPWA 3W22A 2AAAA 3A5FA 1XH0A 3RIKA 2HDJA 2OKOA 3GG8A 4H8HA 1V6TA 1W8GA 1N82A 2QV4A 3OZMA 4FMVA 4H9TA 1OFBA 4FX8A 3BLEA 3WDQA 5LNVA 3M41A 1M1BA 2OODA 3W7LA 2QULA 1OFAA 5ENLA 1PUDA 1ZALA 4DBWA 1MW0A 3L4WA 1B54A 3DFOA 2D73A 5DMYA 3B4UA 2BSLA 5F2LA 3R4IA 5LA2A 3MHFA 4EK7A 4PEKA 2ACUA 3F4CA 2BVWA 1S5MA 4KCUA 1ISVA 3UFYA 3P14A 1VIZA 3WUFA 2PU0A 3G0UA 1UH2A 1EBGA 1A4LA 2WVVA 5CSUA 4W5ZA 1K8XA 2XG9A 5IHSA 1TV3A 1JI1A 3VKDA 3HGOA 2O7QA 4PMZA 3B8VA 2PDMA 3ZT7A 3TQVA 2C13A 2OLAA 1BRLA 2J88A 5CBJA 1IHIA 1TE6A 2I56A 2NUXA 1CECA 2V30A 3OLDA 1F3XA 3V35A 2VO5A 4AQLA 1GOQA 2CBUA 3S9ZA 4UTHA 3TROA 1NF0A 1R0MA 5F7UA 3S0CA 1E6XM 2Y7EA 4GVFA 4HZ6A 5AHLA 1PHWA 3VMOA 4U4MA 1VFFA 2LLEA 4I6VA 1M7XA 3G1XA 4PRTA 3T7VA 3AZRA 5BU9A 1UQYA 4MWAD 1MW1A 3CWHA 4IJRA 4UMAA 3CEUA 3FKKA 4LUTB 4O4VA 3NXFA 4RKAA 3JS3A 3WIJA 1MVYA 2Q01A 3TQPA 2Z25A 5FJTA 1LZOA 2FGZA 3W2KA 3W1TA 2PS2A 3MUAA 3H7RA 3O2LA 3II1A 4N9DA 4K7VA 4S38A 3QGKC 4XUGA 5FEXA 1CBGA 1GZGA 3ATYA 4R88A 4U33A 5D2VA 1DKWA 4IL0A 3TTEA 3E0FA 3ALGA 3WLMA 3SDOA 1SGJA 3B0PA 1NARA 1B4KA 5F4XA 4DBUA 1AG1O 3P6LA 3L5LA 2E6AA 3AS1A 2YOCA 3CO8A 4U5KA 1UUQA 3NL6A 3E96A 4IP7A 1EHAA 1RBLA 2XVNA 3RO6A 2WXDM 2YW4A 3DAQA 3EPOA 4H8UA 4BCEA 5LXXA 1CENA 2VEIA 1JL8A 4Q8OA 4PL2A 2OR2A 5HNUA 5CGQA 3FEQA 4GGBA 2H3DA 1BG4A 2NSXA 5FCZA 4XKYB 1HJVA 1UIPA 4EF9A 1KFJA 1CXIA 1NFBA 1UASA 3GC4A 1ZJHA 1F4AA 1HUVA 1TTIA 2F6KA 3BLDA 3MMDA 1VP5A 1XWYA 2DH2A 1A5SA 4TXEA 1E15A 4TX6A 1Q5MA 5E0KA 3QOKA 3QC0A 1X97A 1CW2A 1GOKA 3EWZA 1TJRA 4W9TA 1B3ZA 1GQNA 1MDRA 4NAFB 2BGQA 4BQ3A 3SGGA 3BAKA 2I17A 3UG4A 5G1MA 3P67A 2PLMA 3WBWA 1I0BA 1HKIA 5F2IA 5E9AA 3HA1A 5FF0A 4LYPA 3L9CA 4JXCA 1LL4A 1ZBCA 3ZXWA 3PFRA 4UUIA 4FX6M 5KZDA 3F2CA 3TK7A 2QCLA 5C9WA 1HF6A 4LNYA 1V3IA 3AJ7A 2WJFA 3E5PA 3CC1A 4PBFA 5I3DA 1PB0A 3Q65A 4AEOA 2Y7DA 4YVXA 4DB7A 2WJEA 3SCTA 1V02E 1EDTA 1M7PA 4XD6A 3RX2A 2J27A 2A5HA 1C9WA 1QJWA 1A50A 1DWJM 4CN6A 1BXNA 3CZEA 1TA3B 3PBUA 4AHPA 1IIHA 3QM3A 5CZJA 2OPJA 1DP0A 3KRUA 4W8LA 1AZ1A 2OG9A 3LMZA 4N0RA 3MO4A 3R11A 1NSJA 2GLKA 3GDLA 2FJUB 1VFOA 4DWSD 3VGFA 4QISA 2EAWA 4A3QA 4JR5A 1QK0A 4F66A 1W6TA 1DIDA 4X9YA 1V0NA 2X42A 3PZVA 2J8FA 3MJYA 3N3TA 4A29A 2P3ZA 2RKXA 2YL6A 3SUSA 1XLHA 3KVKA 4DAIA 1NU5A 1AJZA 5KEZA 1QVBA 2ACQA 4LVFA 2MNRA 3KW3A 2ACSA 1UWQA 1ZAIA 4E2DA 4MGGA 4F0KA 2V2HA 3PC0A 4FO4A 3AISA 2OB3A 3PUDA 1XGDA 1QOQA 4GYJA 2PF0A 3IVUA 1P43A 2VCCA 5BMWA 2W79A 3FJNA 4DZ5A 3GNOA 2GWGA 3CWOX 3SCVA 5FF7A 3SCPA 3VOIA 3BLLA 5I3FA 2VFEA 1RH9A 3EWUA 3I3BA 1H60A 1KXQA 4ROPA 3G8RA 1JULA 1EJTC 1SMAA 2Z0IA 2UY2A 3RCYA 5HATA 4DJDD 1CNVA