3IGSA

Structure of the salmonella enterica n-acetylmannosamine-6-phosphate 2-epimerase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
230
structure length
230
Chain Sequence
AMSLLEQLDKNIAASGGLIVSCQPVPGSPLDKPEIVAAMALAAEQAGAVAVRIEGIDNLRMTRSLVSVPIIGIIKRDLDESPVRITPFLDDVDALAQAGAAIIAVDGTARQRPVAVEALLARIHHHHLLTMADCSSVDDGLACQRLGADIIGTTMSGYTTPDTPEEPDLPLVKALHDAGCRVIAEGRYNSPALAAEAIRYGAWAVTVGSAITRLEHICGWYNDALKKAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylmannosamine-6-phosphate 2-epimerase 2
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Isomerase
total genus 81
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3igsA00
1D9EA 3OHIA 4HSNA 4JIPA 5I3KA 2PC4A 5BRBA 1A5AA 3NQ6A 3NG3A 3OVPA 4IMGA 1XBVA 3UWQA 5K9DA 1SU5A 1CI1A 4LY8A 1MO0A 1YTKA 4DO4A 3L0NA 2WSYA 4LV9A 2WNZA 5IBXC 1VYPX 1W56A 2P10A 4ZZ9A 3DFSA 3STEA 1NF0A 4BK9A 1TB3A 3EWZA 4OGZA 1PIIA 1KM6A 3HGRA 1OK6A 3G1YA 2ZDRA 4U28A 1H60A 2OT0A 2E5DA 2NV1A 4NXSA 1G4SA 1TJPA 3LTSA 2RFGA 3LTYA 4N6FA 4UTWA 3W7KA 3H53A 1VCFA 1TPDA 3OA3A 3TSDA 1HO4A 3GAYA 1GVOA 1LRTA 5H2ZA 1K7FA 4JNMA 4JX6A 2QJGA 3LCFA 2E68A 1R46A 3GKFA 3P8IA 5AHEA 3LBCA 3MYOA 5AFDA 3HGOA 3IV3A 3M47A 3QJAA 2A6LA 1ICQA 4JTUA 3MYPA 4JTSA 3QPYA 3W7NA 2WPBA 2ZRXA 3IVSA 1LDCA 1KFLA 3B0UX 3TAKA 4O1AA 3I7QA 2YR1A 1YYAA 5F4WA 4GRSA 3LERA 3FA5A 4HN4A 3MWAA 3G0XA 1G7VA 3NGJA 5EA9A 1K8YA 3TJLA 4C1KA 1EPXA 2PCQA 4MUZA 3W70A 3NNTA 3CHVA 1TIMA 5C6MA 4DBDA 4QAIA 1XM3A 3G3MA 1F05A 2KZHA 2A7RA 3S5OA 5AHMA 4AWTA 4AB4A 2TYSA 1ICSA 3FKRA 4GXMA 3QSTA 2R8WA 3UWUA 5DELA 1L6WA 1PCWA 2EHHA 3N2XA 3LRMA 5HR7A 3Q37A 2EAWA 3HPXA 3EKLA 1A53A 5K3VA 2NX1A 1H62A 5ABTA 3TIMA 1MSSA 4HHPA 1H50A 3W7CA 3NL2A 1WBHA 4LVBA 3W2UA 1TV8A 5AC8A 4IXXA 1G69A 3RF9A 2QCFA 3G1AA 2YCEA 1UBSA 4K7YA 3GYEA 3CQ0A 4IPJA 1W54A 2Z6JA 1PCKA 1EP1A 1S5VA 1N8FA 3KAOA 1PVNA 1J2WA 4R53A 3I6RA 4UFKA 2A0NA 2R14A 5KMYA 1KLYA 5HJLA 3HJZA 1EB3A 3UZ5A 2OZ0A 5D37A 4B5NA 3LHUA 4JICA 2P0OA 4NJHA 1OFAA 3L68A 2EKCA 3G1DA 3W23A 2CW6A 5CPMA 2WSQA 2A21A 3NDOA 4MOZA 2C0AA 1WXJA 4YMZA 5A8GA 2H8XA 3TROA 1QMLA 5G4WA 3HQ1A 4LVDA 3QZEA 2JBMA 4CNOA 3KFTA 5F1UA 4FX7A 4WZHA 3UPBA 2XN0A 1ICPA 2Y7GA 1SUXA 2WSRA 2H3BA 2ISSA 1A5SA 2B7PA 3KVLA 4KFPA 4LS0A 4NX0A 1LRNA 1PHQA 3W1NA 3Q2DA 1P1XA 3TMQA 1TTQA 4JYFA 2HS6A 4J9JA 2HSAA 4LVFA 5AHIA 1T0OA 1JCXA 3W1RA 2FPVA 3RMJA 5KSWA 2B4GA 3L65A 1JRBA 4ORMA 1GG1A 3W86A 2X30A 3W7DA 1KFCA 1T96A 4OE7A 2QUUA 4BI7A 1SO4A 5BOOA 3LOTA 1ALDA 3E96A 3P74A 3EWUA 4NU7A 1P0NA 2A85A 4D2JA 1TPWA 4LV4A 1FCBA 1GWJA 1FXPA 2ATSA 2X1SA 4RV8A 2Y61A 1H7WA 2FPTA 3D0CA 1IGSA 1FWTA 4ZQPA 4O16A 2CLLA 4WY0B 3LDVA 1LBMA 2NUWA 1I2OA 3WJWA 1W5MA 2JKPA 2B7OA 4OT7A 4KFOA 1H7XA 1ZFJA 4CNPA 4KWVA 2TSYA 1KBJA 3IVTA 3W7OA 3P80A 3N14A 3H54A 4XKYB 4HNNA 2ATMA 1UUMA 1SPQA 4ZVJA 3F4WA 2EF9A 3N9SA 4OV4A 3W7LA 3C3NA 2ZA1A 5CGQA 3LM7A 1Z42A 4AHOA 1VJIA 2DJXA 3EKZA 4LC6A 1G7UA 3CC1A 4EOUA 3IIXA 1FY6A 4HT3A 1W5QA 1YDOA 1I4NA 1GVQA 4UXDA 1ME7A 1KFBA 1XDLA 4WD0A 1XUUA 5U4NA 3GR7A 2FB3A 3LCHA 3M1ZA 4LNYA 4QQ3A 3BW2A 4GJ1A 3B06A 2H3DA 1Q6QA 2ALDA 3MHGA 4UIOA 3LTPA 3PSVA 2E6AA 4UFMA 3BK0A 4OHQA 4JY8A 4JTKA 1O60A 4O50A 2I14A 3W1TA 1DV7A 3HGJA 1GYNA 3B04A 2NX9A 4ZQNA 3QSRA 1X6UA 5FEPA 3THAA 1VC4A 1YDVA 4FNTA 2Z6IA 1XKYA 4YL2A 4M5PA 2ZZ1A 5HUPA 1HL2A 1MEHA 4TX9A 4UFHA 3HG2A 3W87A 1K02A 1L9WA 2QJIA 4PL1A 2FIQA 2X16A 2YW3A 2VKZG 4O14A 1TPFA 2E09A 4Y9AA 3EWYA 4DELA 3CT7A 3NVTA 1RD5A 1FUYA 2CZEA 4UMAA 4NNBA 2G95A 4WQ6A 4XWUA 4FNRA 3C2RA 1WQ5A 1UASA 1QWGA 4UR8A 4LUJA 4LRSA 5LNRA 2JK2A 4K6AA 3LHZA 3L5AA 2PRMA 1GEQA 2YW4A 3BG9A 1SSDA 2DZWA 1EUAA 2YFNA 3B0VC 3T4CA 1TQXA 1OF8A 4WUIA 3BVJA 1SZGA 3NPVA 4Q4KA 4N4PA 5FI8A 2ZZ7A 2FJKA 4RCXA 1ZNNA 3IRDA 1G4EA 1LZOA 5G5IA 3W1UA 3L5MA 3P60A 5FF0A 4LS1A 3R12A 1AW2A 2Y6ZA 5AYZA 1KV5A 3I7SA 3U6WA 1LLWA 1HTIA 5EMUA 1OFDA 3KVMA 2QEZA 2CLMA 3CM4A 4O13A 3KHJA 2DORA 3LCLA 1I8JA 3NAVA 5AOUA 4JIQA 3O63A 3GVGA 3QMSA 4UTTC 3G1HA 4E0CA 2F84A 3ELFA 3IGUA 1LLZA 4Z0JA 2BWGA 3PB2A 1IIGA 2ZZ2A 1G67A 3FIGA 3DZ1A 4LVGA 3NQCA 4N6EA 2YGYA 2Y88A 1RZMA 2HTMA 4O1DA 2E5CA 4JS3A 4TMBA 4RXFA 1P5BA 4JX5A 3B0PA 1F6PA 1QR7A 3UPWA 3ANYA 1KW1A 1ONRA 4Q32A 3PSWA 1ZENA 1KM3A 3UZJA 2VFGA 1TYGA 1TREA 5AN7A 3P7YA 1ZAIA 2DZTA 2GUUA 4GBUA 1EUNA 3DFNA 3M9YA 4GE8A 3R8RA 4O15A 4JY9A 2Y85A 2QCEA 2QAFA 3TQ0A 5IBXA 3M5VA 1OX4B 4FXRA 5C5YA 1H7NA 1I2RA 3W3OA 3HB9A 4MIMA 1FBAA 4A21A 4GC4A 1X8FA 4HSOA 2RH9A 4DO5A 5MHBA 2DZVA 5K4ZA 1E51A 3GKAA 1KM5A 3LHVA 3W1AA 2VFDA 1XFBA 3IGSA 4LC8A 2QCNA 4YWIA 1FX6A 2J27A 2RDTA 1WA3A 2Y7FA 4JTGA 3N2MA 1UUOA 4JGDA 1QNVA 4CCCA 4XBKA 3O05A 4MZYA 3NYZA 4IMFA 2JKEA 3A5FA 3DXIA 3TKFA 4PFMA 3R5EA 1VS1A 4E2BA 1SQ7A 3C56A 1R30A 2NUYA 3TXVA 1K3UA 4LVAA 3LCWA 4JR5A 1LM1A 2LLEA 1FWRA 1J5TA 2YX0A 1T99A 3TDFA 1K8ZA 4MYAA 1H1YA 3VE7A 4IQLA 1C9DA 3MBFA 3W1QA 5K9CA 5KZMA 4L4LA 3U8GA 3LB0A 5D2YA 3TK7A 3HPZA 1VCVA 1O5XA 1TQJA 1M7PA 4W9TA 2VFIA 3WJYA 1H61A 3WJSA 2V82A 1QDSA 3F4NA 1HUVA 1LP6A 3S6DA 3QM3A 1XDMA 5CZ0A 3ABSA 2R94A 3LRLA 2VFEA 4O57A 1W37A 3TW6A 3RU6A 4AF0B 3M41A 1FDZA 2AQWA 2VXNA 6ALDA 4PTNA 5LKYA 1C29A 1EA0A 1YDNA 1OFEA 1F6KA 4NJKA 3G1FA 2EPHA 3CIXA 3GZ3A 4E2DA 3GR8A 3PG8A 4MY8A 4ZQRA 2CZFA 1VHNA 3SR7A 1KFKA 3PR2A 3LHWA 3FS2A 1I45A 1OF6A 3LX9A 3PAJA 5LNUA 2WO5A 4L4MA 3NQ8A 4WOZA 3DHFA 2V0TA 3BARA 4ZQOA 2E6YA 4P61A 3NL3A 2GVJA 3QC3A 3S0CA 2WOQA 4TO8A 4XTDA 1RV8A 1GT8A 3PULA 2QCCA 3RFAA 3SECA 1IIHA 2Z2UA 1TPUA 3TUUA 3Q58A 3PUEA 2J9XA 2AGKA 2JGQA 3TA6A 3P82A 3PUDA 2ZTJA 3ZS4A 5D04C 3W2MA 4UMBA 1QPOA 3QEZA 1KM4A 2WNNA 3P8JA 4N9BA 2RDUA 3L21A 3W9ZA 3NQGA 2CLHA 1G4TA 4ZQMA 3L9CA 2V2DA 4XUGA 1BKSA 3M43A 3W71A 4S2CA 2BXVA 1UB3A 5DN1A 1V7YA 2H6RA 4JTIA 4X22A 2Q3RA 5J5DA 3B8DA 1FQ0A 1EIXA 1D3GA 4O0ZA 1G4PA 4OQVA 3I65A 3FJLA 3NL5A 4JTFA 5HQEA 3USBA 4A22A 4M7SA 5F2GA 1SSGA 1OYBA 3G8RA 1AL7A 3RLUA 1ZALA 3SIZA 3QQ0A 1S5WA 2GQ8A 4K7VA 3OIXA 1OVDA 2QCHA 4QNWA 1QPNA 3LRKA 3NR0A 4RLIA 4LS2A 1OFQA 5DLCA 3O16A 1RQBA 3EWBX 3G0SA 1MXSA 3DI0A 2JGYA 3MP4A 1LOQA 3QW4B 3B4UA 4DF0A 3B03A 2QF7A 3C61A 4O28A 3BLFA 1LBLA 3A21A 2QCDB 1W5NA 5DCDA 1W3IA 4MZ1A 3RK8A 2ZA2A 3NM3A 1SZFA 5AB3A 3TFCA 4DF2A 5I3FA 4UTWC 3LI0A 4QJ1A 3L0KA 4WY0F 3UWYA 2OJPA 1DORA 4AWSA 1VLIA 3SI9A 4CQ9A 2W6RA 5EPDA 2YYUA 2WJZA 1F2JA 3S1UA 1TJRA 2PRHA 3S9YA 4MJZA 1KFJA 2GPTA 5G2IA 4MY1A 4I7VA 3W74A 3EXTA 1MZHA 2A5HA 4IXHA 1Q3NA 4A3UA 4P2VA 1RR2A 3ZFHA 4O4WA 4Y8FA 5D03A 1VQTA 3I68A 3W83A 3FKKA 4JTTA 3W85A 1IXQA 2ZBTA 1JULA 3G3DA 3O07A 4UTHA 4LOCA 1IXPA 3P5YA 5CZTA 1FXQA 2NWRA 5J5RA 5LHFA 3LXAA 4EF9A 1V5XA 3KRSA 2RDWA 4GUFA 2V2CA 2VFHA 4UMCA 3DI1A 3VE9A 4BR1A 4CCEA 1SO5A 1Z44A 4G1KA 3BLIA 1OFRA 1ME8A 4FX8A 5CPLA 1IXNA 1T8XA 4N9EA 1UCWA 4HNUA 3QFEA 1VR6A 1EP2A 1SW7A 4IUOA 4DPQA 1F73A 1FWWA 3MI6A 4UC5A 1WV2A 2FTPA 3P61A 3GK0A 1GTHA 3WK2A 2ZA3A 3CIWA 4FIRA 3L5LA 2FLIA 4R33A 3BW3A 2RHGA 3C52A 1LOLA 3HIJA 4K39A 4JTJA 2BLEA 4O8RA 2QUTA 4WXYA 3SW6A 1WYIA 4JTEA 1GG0A 5K4XA 1JUKA 1KM2A 2CZ5A 1WBJA 1PHWA 5G1YA 5K9XA 4ZMGA 4NNAA 5F1VA 1SZNA 2C18A 4RX0A 2C19A 3MW7A 3DAQA 3OG3A 4DXVA 4BWLC 2NXGA 3A9IA 4KWWA 5HR6A 5C55A 4AH7A 2Z0IA 2PE4A 5BW6A 3NQMA 1OFPA 5LGXA 4N9DA 1XC4A 1GVFA 1JUEA 2VELA 3TXZA 1XL9A 2E77A 3LCIA 1FDYA 3C0JA 4Z1BA 3GNDA 1F76A 1W3TA 1J4EA 3A24A 3PWAA 1DVJA 3P5ZA 3HG4A 3OVRA 2X1RA 3DKLA 3LLDA 3GAKA 3N19B 5BNKA 3ATYA 3O1NA 1O95A 5E0KA 3M0ZA 4FX6M 4S2BA 4R7JA 1SO6A 3BW4A 3N3MA 1M5WA 2WKJA 2O7QA 3F1QA 4XQ6A 4OBTA 3M16A 4XTIA 4A2SA 1S3HA 3DFTA 5E1QA 4ICNA 1BWKA 3SFKA 2ZYFA 4UTLA 4ZL1A 3EEGA 4PH6A 4FNPA 2ZZ3A 2V30A 4I7UA 3W2NA 3E12A 1BTMA 3A5VA 2IQTA 2QCMA 1GJPA 3G0UA 4AXKA 4QNEA 5AC6A 3LHYA 3UY8A 1VRDA 3C2EA 2GJLA 1SR9A 3C6CA 4PL2A 3W22A 3BO9A 3VCRA 3BLEA 4S1FA 4RJEA 3NQEA 3WFAA 3C4UA 4O54A 1GZGA 3AJXA 3W84A 3OBKA 2HS8A 2WV8A 2C13A 1C8VA 3NOEA 3LI1A 2GOUA 4Z08A 1GOXA 2Y70A 4EF8A 1X7FA 5FF4A 4MY9A 4I9AA 1A50A 3PC0A 4LU0A 1XXXA 3ATZA 1CW2A 1LORA 1GVSA 2TRSA 3M44A 2PRLA 4C1LA 4N02A 4RK8A 1TPVA 3TJXA 4K8HA 5AHLA 3LV5A 3MP3A 3NXFA 3M7WA 1OX6A 1TPH1 3EX2A 4K38A 1SW0A 3GLCA 1WOAA 2A7NA 3GX9A 1B4EA 1EP3A 2W0UA 3MI2A 1THFD 2OCZA 1ZHAA 3G24A 3PM6A 3VKJA 1TCDA 3W88A 1TTIA 3EX6A 4AHQA 1RPXA 4NXKA 2ZQ0A 3NL6A 2FPYA 1W1ZA 1GYLA 3CWNA 2EGZA 4BI6A 3GXNA 3S5ZA 4POCA 1ME9A 3BGGA 3DGRA 4XBSA 5HULA 1UJPA 3ZWSA 3GDKA 1NAL1 2XN1A 4O18A 3PUOA 2E6DA 2CLIA 2A7PA 3CU2A 5D2XA 4NJJA 4UCGA 1YXDA 3CEUA 1Q45A 5C2XA 3DFOA 3TQVA 3NQDA 1LRQA 3LV6A 1QPQA 5TIMA 4U4MA 1PS9A 2A6NA 2QDHA 4EIVA 2R91A 3H55A 5HUOA 4YXGA 3QQ1A 3UWVA 3GDLA 3G1SA 2FDSA 3NA8A 1G6CA 5F2LA 4YCOA 1KFEA 1K7EA 3IIZA 2YYTA 3QMTA 3IIOA 3W7GA 1QPRA 4QM1A 3TNOA 3QPZA 2J88A 1H1ZA 3FEMA 4Q33A 6TIMA 4FNSA 4ADUA 3G18A 1F7BA 1NF7A 3GDMA 5EKYA 4GWEA 1EX5A 3W1MA 4IX2A 2DZPA 4H6KA 1DQWA 2H90A 4UNKA 3JR2A 2RKXA 4CCDA 1AW5A 1OHLA 5IM51 5D2VA 3R13A 3BG5A 1YXCA 3W2JA 3DHDA 1IXOA 2FQIA 1H51A 1VLWA 4JD4A 1PL9A 4A2RA 1OABA 4ADTA 3P84A 3CEPA 2ZRVA 1QFEA 3TU9A 1YXYA 3O06A 2E6FA 4GUJA 4M6VA 2X1UA 5AYXA 4UFLA 4FO4A 2B7NA 2YZRA 4JDBA 1LTDA 4FEZA 3T7VA 1VZWA 1EWDA 1I2NA 2CWNA 3FJ6A 1K8XA 4HKPA 1OJXA 2XFWA 3W6YA 5CG7A 2E1DA 2GQAA 2A2IA 2ZZ5A 4NX5A 4AF0A 3KXQA 3INPA 4WXZA 4DQWA 1DJQA 4LT9A 3WJZA 4FHAA 5CPOA 4UTIA 3W7IA 1L6SA 5CSSA 4RR4A 3YPIA 1YTEA 4UTMA 2NWSA 1JCMP 3GXPA 1HG3A 2ZTKA 1YLVA 3W1XA 4NJIA 5CZSA 2CLFA 4O52A 4BF9A 4MLJA 4JTLA 2YXGA 2ISWA 3PS7A 5FEZA 3MO7A 3HF3A 1HFBA 4MJMA 4MZ8A 2BTMA 3S1VA 1CX9A 3MUXA 3UWZA 1FWSA 1P0KA 3STGA 5DXYA 2V5BA 3IIVA 2GQ9A 1B9BA 3GIYA 1DHPA 3C8FA 5LHEA 5A5WA 3LGEA 1GTEA 4JYEA 1BWLA 1L6YA 2UV8G 5FF2A 1QAPA 5EY5A 1TPEA 4QITA 5I3GA 1MEWA 2C1HA 5DY2A 1JCJA 3CWOX 4X2RA 3TAOA 3TW7A 4TIMA 3LLFA 3C2OA 5HNRA 1KBIA 4NT0A 1LBFA 1A5BA 5EYWA 1W5PA 4NNCA 3KRUA 2G96A 1SFJA 3GXTA 3TR2A 3P81A 3E49A 4IPIA 3W75A 1P4CA 1SO3A 2ZRWA 1AW1A 1F5ZA 4UUIA 3NO5A 2V5LA 4HNVA 3N9RA 1R2RA 5BMXA 5L9FA 3BPWA 1IF2A 1WAUA 3NQ7A 1KV8A 5F2MA 3ABRA 3HMJG 5CSRA 5AHFA 2J9ZA 3ABOA 3UWWA 3W7JA 1KM0A 4GFSA 3FOKA 4DF1A 1W31A 5D05A 3EXSA 3THQA 5D09A 3W7MA 2C15A 4NUWA 3S42A 5LZLA 5D38A 2YFOA 3E0IA 3TE9A 1EWEA 1OK4A 3R2GA 2X1TA 3G8EA 2F7FA 3OEXA 4K37A 4Y6GA 7TIMA 4O4VA 1X1ZA 4Y90A 3S5YA 4AVFA 4ZQCA 1VYSX 2QUVA 3QF0A 4LWWA 2YSWA 3WK3A 1YPFA 4M6QA 2W79A 3P67A 3M5ZA 3PF3A 4FF7A 4RZ5A 3PBWA 3S5NA 3EWWA 1DJNA 1XCFA 2QR6A 2V9DA 3G1VA 1ZAJA 3TSBA 1FDJA 4MKNA 1RQHA 4LUIA 1X1OA 3HOJA 4R34A 2QCGA 3C2FA 3NM1A 2QCDA 3MJYA 3W7EA 1R2SA 2VFFA 2NLIA 2TPSA 3MI3A 5HWJA 4BFAA 3O15A 1TV5A 1HO1A 1F74A 3W73A 2WQPA 1QOPA 4KKXA 5D32A 4FXSA 2NV2A 3PG9A 4YCPA 3IEBA 4N4QA 4Z1DA 2CLOA 4RKAA 3IGXA 3L67A 4OV9A 1KLZA 1QO2A 2VEPA 4IMEA 1TTPA 1B4KA 5SWUA 3BGJA 1N55A 2VOMA 3KRZA 2BSLA 1RVGA 3KVJA 2OMAA 4ML9A 1WX0A 5G2HA 5FEXA 3QYQA 3W7HA 2A1YA 2H8ZA 3L0GA 2Y7DA 1KTBA 3DU0A 1EEPA 3HPSA 3TC6A 1YPIA 4BWLA 3TV8A 3G1XA 4O10A 2I1OA 2J24A 4UR7A 4Z1CA 4BI5A 1OG0A 2C3ZA 2QJHA 3STCA 3M6YA 3SGUA 2ABBA 4MPQA 2FFCA 1TPC1 4MLRA 4X9SA 5DCBA 3HG3A 3LBMA 2J9YA 3NEVA 3L66A 3E02A 4O11A 1S5TA 1OX5A 5GVJA 3HO8A 3GNNA 4WY0A 5AHNA 5DBUA 3VNDA 2DU2A 4TR9A 1BEUA 1WDWA 2ZZ6A 3VFLA 5KZDA 4HNTA 2QKFA 2VEIA 3S1XA 3FYOA 3C2VA 3DFQA 3ABQA 4JX4A 4NZJA 2E5BA 5FF3A 3UXAA 4FB7A 4GNJA 5G4EA 4CLMA 2I9EA 4UFIA 4XKYA 2NZLA 3O8AA 3FYPA 1O4UA 1D3HA 1JR1A 2ZRUA 3BV4A 1ADOA 1GQNA 4M19A 1JQVA 3UYCA 1ZJIA 4TU1A 1OYCA 2AAMA 2V8ZA 4NZFA 5T26A 1TSIA 4Z0SA 3EX4A 2JKAA 3O6DA 4JXCA 2YPIA 2C6QA 2DZUA 3TX9A 1DL3A 2DJLA 2QCLA 3Q94A 4RXGA 4IJBA 5HWMA 2CLKA 5H91A 5D2WA 1R47A 5I3JA 4CQAA 1OFBA 4IX0A 5KINA 1XI3A 3V75A 3JS3A 1FCUA 1JCLA 3RLVA 3N34A 3UQNA 2DZXA 3R89A 3PY2A 4PODA 3RNDA 1AG1O 1WOBA 1FWNA 2ZRYA 3W7RA 4O19A 4AWUA 1Q6OA 3EXRA 1H7PA 4JDYA 3CPRA 3ZR4A 3NPXA 4WX2A 3DFPA 5D33A 3DENA 1TPB1 5FESA 4QSHA 1TV7A 1VHCA 2OX1A 2Q3OA 2GJNA 5EL1A 3ZWTA 2C16A 1KTNA 5U7SA 3T40A 3JRKA 5LGZA 1Q6LA 5D30A 4N9CA 1RQEA 1H7OA 4K8EA 3IVUA 1AL8A 3DH7A 3GDTA 1N7KA 1U83A 3CLMA 5G2WA 3STFA 3SJ3A 3SZ8A 2B0MA 3G22A 4GUGA 4MFEA 3WK0A 2GVGA 2DP3A 3NQFA 1QCWA 3S1WA 2DZSA 3M5XA 1TMHA 5F4XA 3S8HA 5G1TA 1NSJA 3EX1A 4UTTA 4UFJA 3GDRA 4N2YA 1YADA 3E9AA 3FLUA 4DEFA 2A4AA 1JVNA 1XBZA 2Y7EA 3EX3A 3MP5A 3FFSA 4FNQA 3QW3A 1Y0EA 1JJKA 3NPUA 5D2TA 4IWWA 2ZCGA 3BG3A 3TC7A 3TH6A 1K03A 1JCNA 3M5YA 3MHUA 5KZEA 3WJXA 2G97A 3V1PA 5DCEA 2D73A 4EWND 3EWXA 5DXXA 3U2OA 4O53A 4MVAA 3A22A 2P1FA 3UD6A 1LYXA 3TMLA 2WNQA 1JQXA 4UTUA 5EBUA 1O5KA 1FCVA 3QMRA 4JN6A 4E38A 4DPPA 1XBXA 2ABAA 4OWGA 1QO5A 3I7RA 3LCGA 3CTLA 3AO0A 4LRTA 3TQKA 3O6YX 1DOSA 1NVMA 2ZZ4A 1VPXA 4CQ8A 3LCXA 2X2GA 4IMDA 4XZ9A 1TRDA 1KM1A 2VENA 4Y96A 5LNWA 1U5JA 4NQ1A 3UXDA 3KOFA 3CB8A 4NVTA 5K2ZA 5E93A 5TBOA 4Z1AA 1AMKA 4JYDA 4PA8A 1VYRA 2V2HA 2YDAA 1O94A 5KTLA 3LXBA 3MHFA 2Y89A 3HBLA 3LHTA 2OT1A 5DBTA 4RZ4A 4UTJA 2HMCA 1LOSA 2BX7A 2ZRZA 5LSMA 1TTJA 3W1PA 4AHPA 4IOTA 3P62A 2ISVA 3W76A 4QISA 1DQXA 1KA9F 3OVQA 5KITA 1SZEA 4M7TA 4RZ6A 2NUXA 3W1LA 2J6XA 4OU1A 1VGAA 2G5WA 1ZCOA 3QH2A 2Q8ZA 2PURA 1NEYA 5F2IA 3L2IA 5CZJA 3O6CA 4DO6A 4H3DA 1SFLA 2C14A 8TIMA 5D02A 3T44A 1OFOA 3W7QA 1GPWA 1I2PA 2CLEA 1H5YA 4O1BA 2O7SA 3IIPA 4O12A 5CKSA 4TMCA 4GUHA 4PCFA 1K7XA 1H63A 1TRIA 3SY5A 4FIQA 3T78A 1TO3A 1Z48A 2CFFA 1L2UA 1W0MA 4AMAA 1OX4A 1KTCA 4AAJA 3PBYA 5FF7A 4AEOA 1LCOA 3W07A 1SW3A 2Y63A 3EB2A 4DBEA 2Z1BA 4IGHA 5K7JA 3NQ2A 3UY7A 1ML1A 2Q8LA 1MEIA 2CU0A 1W8SA 1VH7A 4MFDA 4O1CA 1ZAHA 1JRCA 1Z41A 2VEKA 5AYYA 5C54A 5LNSA 3W7PA 5BMWA 2QDGA 2ZFAA 4YLWA 5L6UA 3N73A 2GVLA 2BZNA 5HINA 3SSJA 2NX3A 3W2LA 1JUBA 3PB0A 5CPNA 2XN2A 4JTHA 4H4IA 2TMDA 1DKWA 3TCEA 4K36A 5AC7A 5DY3A 1Q6RA 1NFBA 5LNVA 1B57A 4PC8A 1GVRA 4KFNA 3W72A 4FNUA 4MYXA 2NXIA 4A29A 3F03K 5F4SA 4HPJA 4ADSA 4LTSA 1H7RA 2NXHA 3PBUA 4QIUA 3NQAA 3PVFA 3MMTA 2VEMA 4HPXA 4WOQA 1AK5A 3QRHA 4M6PA 3T55A 5FEWA 4NJGA 4UNLA 3NZ1A 4GUIA 1JCYA 1FCQA 3HG5A 1LROA 4O0KA 3KVKA 4IMCA 2CZDA 4ALDA 2VC6A 2B7QA 4JEQA 5HWNA 3A23A 3LXCA 4ONVA 1PV8A 4CNNA 4LW7A 3NZRA 1YTDA 4HIBA 4WJEA 4PEKA 1PE1A 3VI2A 1A5CA 3GB6A 3NQVA 1W3NA 3SGZA 1R2TA 3TFXA 1OYAA 1I2QA 2V81A 3B05A 3PBVA 5TQLA 3DBPA 4I7WA 5I3IA 3UNDA 3NPWA 1M6JA 3WK1A 3MBDA 1M7OA 1W5OA 3KX6A 4X3ZA 3K30A 3DKJA 5HMSA 1XBYA 4ORIA 1B3OA 1XUZA 2Y62A 1VCGA 3TSMA 1ZY9A 4UTKA 1DBTA 5I3HA 1QOQA 3HGSA 4O17A 4EVZA 2QAPA 3W2KA 2FB2A
chains in the Genus database with same CATH superfamily
2PC4A 3MKKA 1XBVA 3QTGA 3RR1A 1SU5A 4GVHA 1MO0A 3PZTA 3L0NA 2QIIA 1V8EA 3CGTA 1ISXA 4TXEA 4ASTA 1B5TA 2KAUC 4HJWA 3AIWA 4KRTA 1E6QM 4BK9A 1TB3A 1Z6KA 2YL9A 5C9XA 3CJPA 4QE1A 4E2OA 3BCDA 3HGRA 1OK6A 3G1YA 2IPGA 3BL3A 2CYGA 1HJSA 4N6FA 4RE0A 4UR9A 3G2GA 3SCRA 3TSDA 5I79A 1D2KA 4KEVA 2WCSA 1LRTA 3GQYA 1K7FA 7ENLA 2QJGA 3FAWA 1SZRA 1R46A 1QI4A 3MYOA 5AHEA 3FY1A 3ARPA 4OBSA 5E6ZA 4H2HA 2ZUSA 3QPYA 5BXPA 3NFUA 1V0MA 1B3VA 3N11A 1KFLA 4O1AA 2YR1A 1VBJA 1YYAA 5F4WA 4GRSA 1UWIA 3FA5A 5DQPA 3MWAA 3TJLA 3H2CA 4NZCA 4J1OA 1TIMA 4LF1A 4G2DA 3WQ6A 1OINA 3GHTA 4Q7NA 2QPXA 1ICSA 3QSTA 1MQPA 5DELA 1UROA 2EHHA 1EJTC 3NO3A 3Q37A 2NSOA 5C2CA 4M56A 1Z89A 1A53A 4RW3A 4HHMA 4LQ1A 2NX1A 3IJ8A 4JL1A 1UQYA 2XGZA 4D9PA 2ODOA 4ML4A 3KP1A 4IG2A 3W6MA 5D8ZA 4XD4A 1REQA 2QCFA 3G1AA 4WKAA 3QV6A 4WDXA 3RIKA 4JFVA 5ENLA 1ZTVA 4J4KA 2R6OA 2WM1A 2XH7A 2VC5A 4P8XA 1KLYA 1HL9A 1UC5A 3HJZA 3SFWA 4NZ4A 4P5UA 1T8QA 3ITYA 3IJQA 3HPAA 3AWOA 1QNRA 3UZ5A 5D37A 2F61A 2P3ZA 5FJRA 2P0OA 1IT7A 3NDOA 2PWVA 3KBMA 1AH4A 1SJAA 1WXJA 2WLZA 5A8GA 5G4WA 3HQ1A 2JBMA 4GI8A 2XN0A 1ICPA 2Z29A 3NZPA 4GQQA 3AXIA 4MKSA 1SUXA 2I57A 2WSRA 1PBGA 4NX0A 1LRNA 1PHQA 2QV5A 3KTCA 4QX4A 3Q2DA 2BY1A 4I8DA 4V33A 4JYFA 3TZNA 1L6GA 2A3CA 3MQTA 3PPHA 2Y1HA 3K1DA 2WZHA 3E74A 2X30A 3FV9A 4BI7A 1ALDA 3E96A 3P74A 1XKJA 1P0NA 2AL2B 4H7VA 5LIWX 3RPTA 4D2JA 1TPWA 1B3YA 1FCBA 3BH4A 2X1SA 2Y61A 1H7WA 3DYMA 4PSPA 4NHVA 1AZ1A 3VZZA 4WY0B 2ZX5A 1LBMA 3GIPA 5DT7A 2NUWA 4W8LA 3WJWA 1KCKA 2PA6A 4NYYA 5DT5A 2B7OA 4GY7A 1ZFJA 5G4HC 4CNPA 4KWVA 3W7OA 1S2UA 3SCPA 2ATMA 1MQRA 3ZJKA 4FR1A 4KCVA 1VEMA 1VD6A 2WMJA 2GDVA 3F4WA 2EF9A 3N9SA 3W7LA 2CKSA 3LM7A 1Z42A 3EKZA 4LC6A 1W3LA 4EOUA 4PBFA 3IIXA 4YNGA 4JHOA 1W5QA 1I4NA 4JFWA 1HKJA 1NJJA 1O1ZA 3R25A 1KFBA 1J0JA 4WD0A 1XUUA 2NQHA 4IGNA 3JVAA 3B06A 2H3DA 3SQLA 4MGGA 1EJSC 3URQA 2IMRA 2RJGA 1H1NA 3LTPA 2PC8A 4G5DA 1O60A 4ZSUA 3W1TA 4ZXLA 1ZJHA 3OODA 3M0XA 1DV7A 3HGJA 1W1A1 4AX7A 5A6KA 2NX9A 4L7ZA 5FEPA 4D6CA 1VC4A 4L1WA 1XKYA 4C6LA 4M5PA 5HUPA 2W91A 4IIFA 4KEZA 3UR8A 3CXOA 1L9WA 2QJIA 4D71A 2FIQA 2HNHA 3A13A 2VKZG 4O14A 1DJIA 2E09A 4U31A 4Y9AA 1QHPA 3CT7A 1EC8A 4US5A 1RD5A 1XLBA 1OBAA 1PAMA 3II1A 1S2CA 3C2RA 4GACA 1WQ5A 3M4HA 2FKPA 1QWGA 1O5RA 1G5AA 4HSHA 5LNRA 2Y4SA 4K6AA 1W9DM 3OIHA 4BEUA 3UG4A 1CXIA 2DZWA 2GWNA 2YFNA 3B0VC 4V27A 3T4CA 1TQXA 1Y7VA 4Q4KA 1PX8A 2ZZ7A 2VZSA 3IRDA 1DJZA 3N17A 1LZOA 1T40A 1E0TA 2UY5A 4RZBA 3L5MA 3P60A 4WSJA 1A3WA 3R12A 3UXIA 4S3EA 4AD5A 3S4TA 1AD4A 3WNPA 3TN4A 1TELA 1I8JA 1YE6A 4ZR8A 3VIMA 1P48A 4Q8UA 2RUSA 1LLZA 4D6IA 2OO0A 1VPYA 3T2QA 2PDNA 4J3SA 3FIGA 4KESA 3WLPA 4LVGA 2Y88A 2Z2AA 3VABA 5AZ1A 3BURA 3VCCA 3R7MA 2EKGA 1P5BA 3DX5A 4JX5A 2XTKA 1QR7A 1KQZA 4E6MA 1F07A 3TCSA 1KW1A 3FGCB 1CXHA 1GOOA 1ZENA 3U3HA 1JYNA 1TYGA 1TREA 1ZAIA 2DZTA 4GBUA 4HCDA 1Q7ZA 2BXZA 5D9PA 4O15A 2VCBA 1W2VA 4AZ6A 2WC4A 2QAFA 4X63A 1HKKA 2I17A 3M5VA 2XINA 3KM8A 1XIMA 2O4MA 1CB7B 3HB9A 2E9BA 4C6JA 4C7FA 4EXQA 1OGGA 1FBAA 4A21A 4C6IA 3L7RA 2DZVA 3LSCA 2QZRA 2VFDA 4K68A 3EPOA 1XD1A 4ZEPA 4YWIA 2J27A 5LIXX 2E8YA 4JTGA 3DUGA 4A3HA 4FA3A 1EFZA 1QNVA 4XBKA 3APGA 5IHRA 3GS6A 3A5FA 3EOSA 2QUMA 4PFMA 4X0NA 4E2BA 3ZJ6A 2F38A 3SQSA 2NUYA 4GVIA 4I3GA 4KH2A 4B2DA 2D24A 4MB4A 4NAFB 3WO8A 1OEPA 4LVAA 3ONCA 1MXGA 3EMQA 3AXKA 1TUXA 4JR5A 1LM1A 1QNSA 4TUFA 1C9DA 3W1QA 5K9CA 4L4LA 3TYUA 3U8GA 5AY7A 5D2YA 1VCVA 2O55A 3ARRA 1ZP3A 1TQJA 3OGRA 2IKGA 2CZVA 4LBRA 1QDSA 2VTFA 1C9WA 5DEZA 2DSUA 2E3ZA 3LRLA 3QBUA 4JTQA 2VVSA 3SB0A 3MDUA 3OOQA 1P43A 4J2PA 1FWEC 1XPYA 2DY3A 5DF0A 3AYRA 1EA0A 3R10A 2P50A 1HP4A 1EIBA 3G1FA 3GZ3A 4ZQRA 5FJTA 4ROQA 5DMNA 3FS2A 1I45A 1XYZA 5JIWA 4L4MA 1E6PA 5A6LA 3A9BA 1Q4NX 3DHFA 4YYFA 3APYA 1DIDA 3UGVA 4D8LA 1J0IA 2WBKA 5JBEA 4P61A 1HN1A 2ZE3A 3IK4A 1TX2A 2GVJA 4QHRA 3S0CA 3PZNA 4TV5A 3RFAA 3SECA 5EGRA 1UIPA 4C5ZA 2XFYA 3Q58A 4RE3A 3MCMA 4MPKA 4NG3A 2GOKA 2JGQA 1RBOB 3PUDA 2ZTJA 1XLFA 5D04C 1JDFA 1E0XA 4DNHA 4LAZA 4NZ5A 2CLHA 3CHCA 4TQTA 3RXZA 3L9CA 3RDKA 2OKTA 4RNJA 2AL1A 3W71A 4CU6A 3EGJA 3GTXA 2BXVA 3CAQA 4TTUA 1V7YA 2H6RA 3TOPA 2DV0A 3R43A 1Z3NA 4C6PA 3I65A 1FWAC 3BOFA 4S3GA 5RUBA 4JTFA 5HQEA 3WQCA 4A22A 4IM4A 3QYSA 1SSGA 1WNOA 1W1PA 1NDVA 2GUYA 3KL0A 1J12A 4HQVA 5J04A 5DANA 1A5NC 3OIXA 1OVDA 2QCHA 1QPNA 2FMOA 3LRKA 4RLIA 4R7WA 3WEZA 4CCZA 3EWBX 3DI0A 2NW0A 2JGYA 3GWQA 1I0DA 3B4UA 4V15A 3VOFA 3R58A 4O28A 3H2NA 1JFXA 1W5NA 5DCDA 4MZ1A 3RK8A 1SZFA 2G50A 1RJRA 1V6WA 2GGIA 3OGSA 3TFCA 4ZB2A 4G56A 1CBGA 2ACQA 4DF2A 1ZU8A 3SY8A 3LI0A 4QJ1A 2CBVA 1DORA 2WZEA 2GFTA 3AOFA 1VLIA 3R0UA 2CERA 1X6LA 2AL2A 2D3LA 3WNNA 3A3XA 2XSBA 1IEQA 1CLXA 1F3WA 2XUCA 4J3WA 4WDTA 3EXTA 1MZHA 2A5HA 1UW9A 4PEEA 4H8VA 5I09A 3H6OA 5DRIA 4A8NA 3ZFHA 1E0WA 3WD3A 3TTSA 2ZDSA 5D03A 3EEZA 1VQTA 3GXIA 1UWUA 3FKKA 3ES7A 1QW7A 4UTHA 1MRQA 3GG1A 3P5YA 3CAKA 3KRSA 4GUFA 2V2CA 3N2CA 1PZ0A 4GYFA 4G1KA 4RNFA 5ABEA 1OFRA 3WF4A 5CPLA 1NM9A 1Q8AA 3QFEA 1SW7A 5I3DA 1TWZA 2OLHA 4KWSA 4FXFA 1TE1A 1QI2A 4FIRA 3LA4A 2ACRA 2RHGA 4UQEA 1EKOA 2INEA 5K4XA 3XISA 4PCNA 1H49A 1AJ0A 2GSJA 5K9XA 1BLIA 2XYLA 2C19A 1MQQA 1A5KC 2NLYA 3OG3A 1TMLA 2AGTA 3WEMA 3CUFA 3A9IA 5C55A 4J7RA 2RGMA 5DMMA 4GVGA 3NSXA 3NQMA 1XC4A 1GVFA 1HJQA 2EPKX 6A3HA 3LCIA 4GKTA 5HJXA 4BQ3A 5GNYA 2XIMA 5EB8A 1YQ2A 1W3TA 2VRKA 3A24A 1DVJA 1E4MM 4WEVX 2X1RA 4DI8A 2YDRA 4H7ZA 3O1NA 4Z2GA 4PMRA 4S2BA 1ITUA 3GYCA 1VF8A 1M5WA 2WKJA 4A2SA 4OBTA 4H9MA 1XSJA 1BWKA 2GGJA 2XIQA 1KWKA 2WK2A 5BWAA 2V30A 5CSYA 1MFUA 1PXGA 4JZ5A 7XIMA 4LF2A 4YPJA 2VT0A 1GOIA 4V1YA 3LHYA 2V68A 3SRDA 3VZYA 3C2EA 1MDRA 3U2EA 2GJLA 3C6CA 3RO8A 1OIFA 4AY7A 4PGLA 1FTXA 3BLEA 1KKOA 2NT1A 4S1FA 4RJEA 4O54A 3WDHA 1GZGA 2HS8A 2WV8A 2CETA 1XF0A 3NOEA 1BYCA 1EGMA 4Z08A 4CD5A 3AHYA 5HAOA 4AZBA 5C9UA 5MF5A 2WWCA 2HRWA 5FF4A 3ATZA 1GVSA 4GXPA 4L65A 1NTHA 1OD8A 4N02A 4K8HA 2UZ9A 5I77A 3DDMA 2HDJA 4CU8A 3M7WA 1OX6A 3EX2A 3CZLA 3GLCA 3MMWA 1WOAA 1UZ1A 2OCZA 3PM6A 4DJFA 1XRVA 3K4DA 3SRKA 2FZMA 1KR0A 5EMYA 3VKJA 1TCDA 3EX6A 1V6VA 1PKLA 3GO2A 5EMJA 3CHFA 2FPYA 1VBRA 3FGCA 1RK5A 2FZDA 3UR2A 1GYLA 3GXNA 2ZUMA 4B91A 1QU4A 3WQGA 1EJ7L 4XBSA 4O18A 3PUOA 4UQBA 2CLIA 5D2XA 2D2OA 4UCGA 1N8IA 2EQDA 1W8GA 5DO8A 4PR4A 1S1RA 4KEMA 3DFOA 4WSKA 3TQVA 5BXTA 4MKVA 1XIGA 3TTEA 3NQDA 3AISA 5HNNA 2WVVB 3MPGA 1QPQA 4YXGA 5HUOA 3QQ1A 2FDSA 4P8WA 2DH2A 3BAIA 4WLCA 3IIZA 5J8LA 1BKHA 2DVUA 3Q67A 3K8KA 1XLKA 3TONA 3ZLFA 2WQDA 1H1ZA 4Q33A 2Y5SA 4FNSA 3H2MA 4H41A 3GDMA 4GWEA 3W1MA 1DWFM 4P7QA 2DZPA 1DQWA 4IL0A 3JR2A 1OHLA 5D2VA 3T0TA 2BASA 2FH6A 1WPCA 4XBJA 1UR0A 3HFYA 3BG5A 1YXCA 3ITTA 1XDJA 3E0WA 2F6XA 4CN6A 3DHDA 4AZ5A 4B5SA 1VLWA 4NY2A 3O0KA 2F2KA 2ZUUA 4AY8A 4A2RA 2W67A 3NO1A 2HROA 1TWWA 4ADTA 3KE0A 1QFEA 3TU9A 1YXYA 3H23A 3N6JA 3E1F1 5GJMA 4UFLA 3DECA 4OKDA 1R8LA 1KBBA 3FJ6A 3E2RA 4GZEA 1OJXA 2P76A 5CG7A 3C8NA 4GY1A 2XVLA 5FA5A 1HP5A 4I9JA 2GQAA 2REQB 3F4CA 5T8GA 1PPIA 4MG4A 3KXQA 3INPA 4Y9MA 4FHAA 3SAZA 4UTIA 3LPPA 4RR4A 4E2VA 4UTMA 2E9MA 1JCMP 3GXPA 1HG3A 3PJXA 5HPOA 2ZTKA 1YLVA 3VX0A 4NJIA 1LG1A 4O52A 1BSLA 3OZYA 1L8NA 5GNXA 3PS7A 4DBSA 3MO7A 1UD6A 4DAFA 2FHFA 3N6HA 4MZ8A 1TMQA 3I6TA 1O6IA 4R3UA 3WDRA 1WKYA 4XX6A 1P0KA 1ZJAA 1KBKA 3TVAA 4C6DA 4JFSA 4C6CA 1B9BA 3KBSA 1DHPA 1VPQA 2PDIA 2UV8G 3G1RA 1QAPA 1TPEA 4QITA 1DWIM 5FJIA 3RO6A 3RILA 2Z25A 3FJ4A 4JTAA 4U33A 3N2TA 2YBUA 1V3LA 6REQB 5EYWA 3WCZA 1ITQA 2IPJA 4XZMX 5LA1A 2I5GA 4HMEA 1J8VA 1F5ZA 4UUIA 3NO5A 3WQPA 1R2RA 5L9FA 3CQIA 3BPWA 2D1ZA 3MKVA 1UG6A 3ABOA 4EP8C 4MNMA 3K1GA 3FOKA 1R6WA 3VOJA 4I9TA 3TLQA 4DUOA 3S42A 5LZLA 5D38A 4KW2A 3ITGA 1EWEA 4OOZA 1GCYA 2F7FA 3PK7A 2UY2A 1ZBKA 3WUBA 1X1ZA 4AVFA 1R3YA 3WNLA 1VYSX 3PUGA 1EHAA 3NDYA 4LWWA 1TUFA 2Z24A 3N15A 1V03A 3WK3A 4I5RA 2Y2WA 3WH8A 1Q6FA 1KWGA 4RZ5A 2ON3A 3PBWA 3S5NA 1J0KA 2PD9A 2QR6A 2V9DA 1FDJA 1HJWA 3HOJA 5FJPA 1JD9A 3GXDA 3C5QA 3UPMA 4H9VA 3NM1A 3EMCA 1MFVA 3AC0A 2NLIA 3MI3A 2DSKA 5FD0A 4BFAA 1XYFA 3VUPA 4AWEA 4WGXA 4BZYA 3W73A 1P6WA 1QOPA 4KKXA 4FXSA 4YCPA 1EXPA 1HKMA 1YIXA 3IUDA 2CLOA 3L67A 4OV9A 3WQ8A 3BGJA 3KRZA 2BSLA 2OMAA 3THUA 2PP0A 2PWFA 1CECA 3W7HA 2BV9A 3ITLA 2Y7DA 3TC6A 3NZQA 4BWLA 3TV8A 5D9MA 2JALA 2I1OA 4UR7A 2FGZA 1CDGA 3LM3A 3OB8A 3MUCA 4JHZA 1OCQA 1JGIA 3EOLA 3M6YA 4LYKA 2HXUA 2YL8A 3VNMA 1FWHC 1PX3A 1E43A 1WDQA 4X9SA 3LBMA 3NEVA 4U3AA 4QEHA 2PTYA 4FOKA 1XSKA 5ECVA 1S5TA 2YCLA 3VD4A 1T7LA 3RLGA 1BEUA 3R79A 1WDWA 2ONEA 1CT5A 1J0ZA 2VEIA 3S1XA 4DO7A 3C2VA 3DFQA 4JX4A 3ZT6A 1W1B1 4GNJA 1Q2RA 1TA3A 2ZRUA 3L2LA 2PDGA 1IQ8A 1EBHA 2YA1A 3IACA 4Q4QA 3GZAA 4B3KA 2AAMA 4HNCA 5T26A 2C6QA 3U2CA 4DJEA 2QCLA 5G1MA 5HWMA 5H91A 5D2WA 4AEFA 4A35A 2FGBA 1XI3A 3JS3A 2NQ5A 4NAEA 4A6GA 4UCFA 4C6EA 3R89A 3PY2A 4PODA 1JNDA 1AG1O 5C7HA 4Q8MA 2ZRYA 2BNJA 3DC8A 3LZ5A 4O19A 4AWUA 4RNIA 3NPXA 3DFPA 4HU0A 3COTA 1P0DA 1BRLA 3BLKA 4IHCA 2Q3OA 1UD8A 1MWOA 2AAAA 3ZWTA 5IFPA 1GQKA 1S2VA 1RXOB 9XIMA 4FLOA 4PMUA 5LGZA 3G6LA 3I4KA 3IVUA 1NDWA 4AQLA 2DSVA 3GDTA 3CLMA 3STFA 3SJ3A 3SBFA 4PMXA 4OBRA 4AD3A 1DJYA 4QBXA 3AROA 1DHKA 3AIRA 2Y8UA 3E9AA 3FLUA 3Q45A 2Z1WA 2A4AA 2X0YA 1XRSA 2O92A 1Y0EA 5JIPA 1CGXA 1JJKA 3AIUA 4W4QA 3VKCA 1K03A 3MHUA 3WLTA 1E4LA 2G97A 3VMOA 5DCEA 4EWND 1YEYA 4DIAA 5DXXA 1UH2A 4O53A 2P1FA 3FA3A 1M04A 1LYXA 1EF2A 2WNQA 1JQXA 4KRUA 2P0IA 3QMRA 4R85A 2W92A 4JFUA 1XBXA 4OWGA 3F2DA 1M65A 4W7VA 4MF4A 3O6YX 4CQ8A 4IMDA 1TRDA 1KM1A 2VENA 4GIAA 1YDYA 5LNWA 3IARA 4NVTA 5K2ZA 1F3TA 3P93A 4GC3A 1BVWA 5FL1A 3MUAA 3BXWA 1AMKA 3F5LA 3LXBA 4A3RA 2Y89A 4GVFA 5DBTA 3QY6A 2WC7A 2EJAA 2OYKA 3PFRA 1GZJA 4TOQA 2HMCA 3VO0A 2BX7A 5LSMA 2ZICA 1TTJA 3W1PA 2IPWA 4I8YA 2C1GA 4IOTA 3WBWA 3P62A 3N18A 3KHDA 3WBYA 3VKKA 3OVQA 3QC0A 3C0LA 2KX9A 1DE6A 1UR9A 4M7TA 3UJRA 4A4AA 5KITA 3NVDA 4TTGA 3BSMA 4AMCA 1B54A 4S3AA 2FJUB 1RJPA 4OU1A 1W1YA 1AUSL 2PGRA 1ZCOA 4LH8A 5AZ0A 1U30A 4WGHA 1M1BA 4PMNA 1NEYA 1NWSA 3O6CA 2WMHA 4NRSA 4L5ZA 4DO6A 4H3DA 4H2CA 5D02A 3T44A 3ARWA 2NT0A 4XAZA 4JIIX 2CLEA 2O7SA 2OU4A 1UR2A 4F9DA 3GUGA 4PCFA 4B92A 1XGEA 5BOEA 1BPLB 2YZ5A 1R0MA 1Z48A 2CFFA 1W0MA 1ZS2A 4BCEA 4EACA 3PBYA 3UGRA 4K2SA 3D5HA 2W63A 4W88A 4IGHA 2O0TA 2DEPA 3NQ2A 5F7UA 3W53A 4Y7EA 1LQAA 1ML1A 1ONEA 3TYBA 1BG4A 3VILA 3B8SA 3OO2A 1Z41A 2UY3A 4V1XA 5EMMA 5C54A 3WENA 4GA8A 2ZFAA 3VNLA 3LBOA 1EGZA 5FSDC 1A3XA 3SSJA 4C6MA 1TVNA 4JTHA 1YKWA 4H4IA 4KBXA 2B81A 3TCEA 2DT2A 1OCNA 1HW6A 5LNVA 3W72A 5BXSA 5F4SA 4ADSA 1H7RA 2NXHA 1H4PA 3BAJA 3NEHA 4Y9PA 1US0A 3KBNA 3QRHA 1KQYA 5REQB 4M6PA 1NH6A 4PUEA 2VX5A 4GUIA 4Y9NA 4ZO6A 1FHUA 4IPNB 1LROA 2BOFX 3KVKA 4IMCA 1WAWA 2R1NA 2OG9A 1OC5A 2PSNA 1YPXA 4H83A 4HYVA 3LXCA 1M68A 2VX7A 1PV8A 1QBBA 1V51A 3TYAA 2I9UA 2G4JA 4GJJA 2BXYA 3T8QA 1C8XA 3EOUA 3NQVA 4X2PA 2ZUTA 3QLLA 1I2QA 4AVOA 3B05A 2RDXA 2C8NA 3PBVA 4KCUA 5I3IA 3ZVHA 3UNDA 3LUTA 3WF1A 1M6JA 3WK1A 3MBDA 3WMSA 1M7OA 3RN6A 1W3JA 1TJ0A 4E3VA 1J11A 2G41A 1XBYA 1WDSA 3H4XA 1VCGA 4CKQA 3TSMA 2VDGA 2W3ZA 3NTYA 1S5MA 2FVMA 4LAKA 4C1NA 2Q6ZA 2QAPA 3GC5A 4HSNA 5I3KA 4IQEA 4L64A 3UVAA 4LY8A 1D8CA 3U4AA 5D8WA 2A3HA 2X7WA 3CL7A 1YTKA 4JNZA 2WHJA 2ISFA 1W56A 4ZZ9A 3DFSA 3STEA 3FDGA 3CO8A 3BOLA 3FN9A 1PIIA 4LB3A 2OT0A 2E5DA 2HQAA 3B9NA 4B15A 3DFHA 4UZSA 2XISA 1VCFA 3E3HA 3CL8A 3GAYA 2EEXA 1GVOA 3GDBA 4RDYA 7A3HA 1U22A 4JX6A 4JNMA 1T41A 3LCFA 2E68A 4LGXA 3GKFA 3LBCA 3RITA 4HTYA 4LBSA 3HGOA 4A05A 3UNTA 3EDDA 2PLMA 3W29A 2ZRXA 3SSZA 4ERGA 4TV6A 4IJCA 3WQDA 2R1MA 3I7QA 3AYVA 1B3XA 4HN4A 3UZZA 3FXGA 5EA9A 1K8YA 1GOWA 3GFZA 1ODUA 1C7SA 2VZTA 4AU0A 1W3KA 2DW7A 2J78A 4PE8A 2DZBA 3THCA 1XM3A 4J27A 1F05A 5MKGA 2V3FA 1TWSA 3CYJA 4AWTA 2BVDA 4GXMA 3SQMA 3PJWA 5HR7A 1WDPA 3DYPA 4M1RA 2XFRA 3HPXA 2Z28A 1OSEA 3M0JA 4HMCA 5K3VA 3PZQA 4GQGA 2YLLA 4FZIA 3EDEA 1RBAA 4LVBA 3AHVA 3W2UA 1TV8A 5AC8A 4HPNA 4GYPC 2YCEA 3UP8A 1O1HA 3GYEA 1XG3A 3CQ0A 1J5SA 1PCKA 1CXKA 3VDBA 3I6RA 2R14A 1V6YA 1EB3A 2WLYA 4D6HA 4B5NA 4JICA 2WSQA 4EXBA 4L4PA 4AZIA 1FRBA 3H70A 3DG7A 4LVDA 5CCZA 5DMLA 2PDCA 3KFTA 2PWHA 5F1UA 5AC4A 3V5CA 4DRSA 4LUSB 2ISSA 3W1NA 1TTQA 3T07A 1WDDA 4JQAA 1T0OA 3B9AA 3LMYA 3CASA 3W1RA 1M03A 1E1CB 2VP8A 3QR3A 2B4GA 3L65A 4GFIA 1KFCA 1T96A 1SO4A 4NU7A 4LFYA 4GCAA 4LJ3A 4PRRA 4LV4A 5HANA 2ATSA 1WE5A 1POJA 4RV8A 4F0SA 2VL4A 1IGSA 1FWTA 2CKRA 3AHTA 4HD5A 5JBDA 3LDVA 3BE7A 3W0KA 3O9NA 1W5MA 4OT7A 4PUWA 2WZTA 1XYBA 4URIA 3PZMA 3FNDA 2TSYA 8XIAA 3N14A 5JQ9A 4M24A 1QI5A 3T1GA 4HA3A 4DZ5A 1G9HA 4OV4A 4TX8A 3UXLA 3C3NA 5CGQA 3BLDA 1QJWA 2ACUA 3I3EA 2E28A 4AHOA 1U1UA 1FY6A 4HT3A 1YDOA 4OJYA 1GVQA 4UXDA 1XDLA 1EQPA 2FVKA 1JZ6A 5U4NA 3GR7A 2FB3A 1S2WA 2BY3A 4LNYA 4QQ3A 3WX7A 3BW2A 4IT1A 4Y8EA 2ALDA 3MHGA 2I16A 5H8UA 1H0IA 4XZHA 2ZVIA 1ONXA 1JYXA 4JTKA 4O50A 4DYEA 3M0LA 4GI9A 5C0QA 4UBPC 4ZQNA 4GNVA 3THAA 4D6EA 4JHMA 4JQ2A 4I90A 2Z1XA 2PDWA 3B9EA 4MDPA 2ZZ1A 3MV11 4PL1A 2YW3A 3M64A 5CC3A 2J7CA 4LSBA 3CLWA 3ZOAA 2G95A 4XWUA 2QXWA 4E3TA 1UASA 4F2BA 2OSXA 2EG8A 4AX6A 4CD7A 1PYFA 4E4FA 4RW5A 3VIJA 5BZAA 1S46A 2J7EA 1SSDA 4H01A 4MNKA 3RU8X 4WUIA 3BVJA 3AMDA 2Z4GA 4RCXA 3GRIA 3GTNA 1G4EA 1BF6A 5G5IA 4G1NA 5FF0A 2ESCA 4LS1A 2Y6ZA 4P7OA 1KV5A 3U6WA 1XWYA 2GVEA 1UKSA 1OFDA 3KVMA 2QEZA 1E56A 2CLMA 3CM4A 4HN8A 1V3MA 2J66A 3NSMA 3D46A 1V6UA 2SFPA 3RGTA 5AOUA 4L9YA 4ACYA 3QMSA 4UTTC 2HZGA 2F84A 3ELFA 4ZA0A 4HU8A 1JL8A 2WZMA 3PB2A 4JCLA 2A79A 2ZZ2A 5CPQA 3NQCA 4EE9A 4O1DA 3WUFA 2YCIX 2E5CA 1QW8A 5CH9A 4JS3A 4NSBA 2JE8A 4AD0A 4L9ZA 1BQCA 1F6PA 4UTFA 3WLRA 1IZJA 3ZLGA 1TWIA 5CPSA 1Z9AA 3VKDA 5REQA 2OLAA 4H8HA 3UZJA 2VFGA 4QFUA 5AN7A 5LA0A 2GUUA 4GE8A 4JY9A 3R11A 2Y85A 1P7TB 2QLYA 2W4XA 2HBXA 2D0FA 3HQPA 3TQ0A 5IBXA 1JYWA 4W8BA 4Z2JA 1W1IE 3DGBA 2DT1A 1L6FA 1NOWA 4JTRA 3ZT5A 4GC4A 5I24A 1XLJA 3QKEA 5K4ZA 4QROA 5MHBA 2VWSA 3XIMA 3GKAA 1KM5A 5ABGA 5M17A 2TODA 1ISWA 3IGSA 1ISZA 1EA9C 2RDTA 3PZUA 3TJ4A 4AZCB 4UQCA 2PP1A 3M07A 3WQ5A 3N2MA 1BXCA 2X09A 3ME3A 1VIZA 2IW0A 4JGDA 4CCCA 2QGHA 4MWAD 3NYZA 4IMFA 2JKEA 1MRAA 5HQMA 1UQZA 2VD8A 3CUGA 1QPKA 2HNEA 3C56A 1EJUC 2R1PA 3D47A 4XUYA 3LCWA 2LLEA 2YX0A 4LX4A 3TDFA 4HP5A 1K8ZA 4MYAA 3VE7A 3WLHA 1Z7AA 1DJWA 3V0TA 3LB0A 2CCRA 3HPZA 3PZVA 2J62A 3VD9A 3WH9A 1H61A 3SUTA 5CJMA 1HUVA 1LP6A 3S6DA 2OZ3A 1GQIA 3BLOA 5E0FA 3ABSA 4PMYA 5A6MA 4O57A 3TW6A 4ZOEA 1OC7A 2Y5EA 3M41A 5D4YA 4NILA 6ALDA 4OIFA 4XO6A 3RPDA 4PTNA 3MB9A 1UPMB 1YDNA 2INFA 4WSHA 2VQUA 1UWSA 4K1GA 3RCNA 2EPHA 3CZGA 3FW6A 5CGMA 1P6CA 1W32A 3M0MA 2Z1VA 3BJSA 4DLMA 5D9OA 3PR2A 1BXBA 1WKDA 2OWCA 1NY1A 3MSRA 2HJPA 5CLTA 3S83A 3PAJA 3VDCA 3I6EA 2WHMA 4CQCA 4JKLA 3CPGA 1LJYA 4WOZA 4XAFA 4V2XA 2VCCA 2E6YA 3URNA 1J18A 5LIKX 1JPMA 4QDPA 3NL3A 3VAVA 4YTTA 5TD4A 4XTDA 4HMNA 1JPDX 1IIHA 1RLCL 1YBQB 1CEOA 4M1BA 2J7GA 3SUVA 3PNZA 3PUEA 1B90A 1LL7A 3C2YA 2QNEA 3GVRA 2DZAA 5CGTA 1PWLA 3VNKA 3W2MA 4UMBA 1QPOA 3QEZA 1IGWA 2WNNA 3P8JA 1HL8A 2RDUA 3L21A 1HGYA 3NQGA 4ZQMA 2V2DA 4OZOA 5FOOA 1HQTA 3L4WA 1X96A 4S2CA 3T0BA 5DN1A 4JTIA 4X22A 3KBVA 2VEFA 3B8DA 1C3FA 1EIXA 1D3GA 4O0ZA 2OQYA 1G4PA 1OT1A 3BSHA 3WQ4A 4OQVA 2IS7A 3MZNA 4L6OA 1CLKA 3C0SA 3WG6A 3DFYA 1XYMA 4QLLA 4DVOA 3G8RA 3GHUA 1RPKA 2OB3A 2O9OA 1S5WA 2GQ8A 1R87A 3GBDA 4QNWA 4GI6A 5DLCA 3O16A 1CGWA 1RQBA 3G0SA 1TZZA 3MP4A 5HNTA 3QGAC 4WF7A 2PTZA 2QF7A 1EQCA 4LUSA 1PZ1A 1ZBCA 2QVNA 3BLFA 3A21A 1XGDA 5HBFA 3NCOA 5AB3A 3E2SA 4ICMA 2E0PA 2XVGA 3PWIA 1GKPA 3LGDA 1MDLA 4WY0F 1EO7A 3UWYA 4S3BA 3V16A 4IG2B 3SI9A 3TC3A 4D6JA 4S38A 5EPDA 1U1JA 5M2FX 4LAUA 1F2JA 1TJRA 4MJZA 4C5YA 1B3ZA 3TYDA 4KS0A 2HE8A 4AZHA 2WC3A 1XLDA 1E5JA 1Q3NA 3EOEA 3S3GA 1UR8A 4P2VA 1RR2A 3ITCA 3A3WA 4W85A 3TWBA 4Y8FA 3H2FA 3W85A 1R3WA 3DEQA 1IXQA 2ZBTA 1JULA 3G3DA 3O07A 4XZLX 1FXQA 1MW0A 3LXAA 5XINA 2VFHA 3DI1A 3VE9A 2PGFA 4CNSA 2PDFA 4HMDA 1ODZA 5HJYA 4FX8A 4DM1A 1IXNA 1T8XA 2IQDA 1V02E 1AQ0A 3F4DA 1VR6A 3PBGA 1EP2A 3D3FA 2Q09A 3AYTA 4YIWA 3LY0A 3P61A 3GK0A 3S2JA 3KLKA 4QSFA 4GK8A 2FLIA 4DUVA 3WEOA 1WXYA 2BLEA 1XGZA 1F3XA 1WYIA 4JTEA 4IPPA 3GUWA 1KM2A 2CZ5A 1WBJA 2QIWA 4NNAA 1GVIA 1UWQA 3MW7A 3DAQA 3JZUA 4RDZA 4BQ4A 3KRBA 3TWAA 3BAYA 3OW1A 3I4EA 1KRBC 3F2BA 2MNRA 3C0QA 1XJBA 2PE4A 1PTDA 1PIGA 2GSEA 4J40A 1XL9A 3VK5A 1X7IA 1DP0A 1F76A 1EH9A 1E4NA 2VM8A 3AXHA 3HG4A 1VJSA 3DKLA 4M8UA 3K13A 3PZOA 5BNKA 3ATYA 4PUJA 4FX6M 1POKA 4J2MA 4R7JA 3T4WA 1SO6A 1XH0A 2XU2A 3I3BA 3F1QA 4XQ6A 4XTIA 1DJHA 3PJTA 4O1FA 2IUZA 5E1QA 1NU5A 1XRFA 3SFKA 1EDGA 3EEGA 4FNPA 3DERA 2QGYA 1BTMA 3A5VA 4QS5A 1GOKA 1E0VA 4TX6A 5I5RA 3V5OA 4LNCA 1NIUA 3G0UA 5GPRA 1JCTA 3DHUA 4QNEA 5AC6A 3CWHA 1WUFA 1JF5A 1CZ1A 1UWAA 3BLLA 3AIEA 3W22A 3BO9A 4MWAC 2D2GA 4GPNA 3BC9A 2V3EA 1GZ1A 3SRFA 3AJXA 3W84A 3OBKA 1NOUA 4Q8QA 4JFTA 1MUCA 3VDAA 4H9TA 1C8VA 2QPSA 3CZJA 3UCDA 2GOUA 1GEHA 2Y70A 3BQ5A 4EF8A 1X7FA 4MY9A 5BRQA 4I9AA 4ZODA 1A50A 4LU0A 1EJXC 2GGEA 3W4RA 5I23A 3BAKA 1FH8A 3MP3A 2XH0A 1Q2SA 3LZ3A 2A7NA 1THFD 3GVVA 3R6IA 6TAAA 3KCLA 2UBPC 2ALRA 1RLDA 1RVKA 3AQUA 4AHQA 1RPXA 3PTQA 2OTDA 1VFUA 2AMXA 1SYTA 3CWNA 4BI6A 4G7EB 1XG4A 3S5ZA 1XIDA 1UJPA 3ZWSA 2XN1A 2A7PA 5C2XA 2MUCA 4XVDA 3AUJA 3TTQA 3N12A 1P7TA 2DT0A 4Z2IA 5E0CA 1MW2A 2NVCA 4U4MA 2QDHA 4WCJA 1BVNP 1XV8A 4QEEA 3EDKA 3U4FA 4C7DA 4YCOA 3USZA 1PEZA 2YYTA 3LPGA 4AUBA 3QMTA 1XYAA 4UQAA 1NFGA 1QPRA 3VU2A 1XQLA 2XM1A 3GU1A 1E4IA 2J88A 5AYIA 2ZUWA 9XIAA 1PYMA 5E9AA 4IFKA 3K5XA 2VEGA 4AZCA 1EX5A 4IX2A 3V3WA 4Q7BA 2RKXA 4CCDA 2PLKA 3R13A 3GM8A 1XD0A 2ANUA 4PCPA 3E5PA 2XPKA 4JD4A 5ABHA 4PTVA 2Y0FA 2ZRVA 2FYMA 2FGLA 4M6VA 4Q4PA 5AYXA 1US3A 4DJDA 2VD9A 2R24A 2DQXA 1VZWA 2DUZA 1F4AA 2CWNA 4HKPA 4E8DA 3V36A 2XFWA 3W6YA 3PBMA 2E1DA 3ARYA 1ZL1A 3G77A 3UERA 1J01A 1PUDA 2A2IA 3EPNA 5GJNA 1DJQA 1OG6A 5HQLA 4DHGA 4YYCA 4US6A 1VIWA 7REQA 2O4QA 4R7OA 2YXGA 4DWSC 3ZVIA 5FEZA 3HQNA 1R5YA 2BTMA 2XZ9A 1PDZA 3ARVA 4U2YA 5XIMA 3UESA 3K46A 3S1VA 1QWKA 4DZAA 1ZCCA 1ITXA 2GQ9A 3GIYA 4UWMA 1NDYA 5A5WA 3WFZA 3P6LA 2Q8XA 1EJVC 3A64A 1YBQA 5ABFA 1MVYA 3U9IA 1F3EA 3KCOA 2X7VA 4BHYA 4R27A 5HNRA 1KBIA 2H9AB 1LBFA 2V3DA 3ZYZA 1EXBA 4QCFA 3V18A 3GXTA 4GZJA 4ATWA 3CUHA 5H1WA 3E49A 1P4CA 3N9KA 4US5D 4HNVA 3NQ7A 1W9XA 3ABRA 3H7VA 2W66A 3UJSA 2J9ZA 2FHCA 3PAOA 5M5DA 4AZ7A 1DTUA 4DF1A 1B31A 1DPMA 5D05A 3EXSA 2E4TA 5D09A 5CJ5A 2C15A 1X8CA 4IH3A 2YFOA 3ZO9A 3SY1A 1OK4A 3R2GA 2X1TA 4PTMA 1JG9A 3WLJA 4Y90A 2XM2A 3E0FA 3RRAA 3QF0A 4JQ1A 2QV4A 4A8RA 4C6QA 1YPFA 3CPUA 4CUCA 1HVXA 3VGFA 1XCFA 3SURA 1V93A 4C6KA 4GI4A 4BA0A 1DTNA 4NF7A 3W7EA 1XYCA 4KMQA 2TPSA 2OOFA 3O15A 1HNYA 3GXMA 1DXIA 2WW5A 3UWEA 3EKGA 3QHMA 4GY0A 1CXLA 5D32A 4XZNX 4O0QA 4ENLA 4HB7A 4RKAA 3IGXA 1E72M 3GNXA 5C71A 1QO2A 5SWUA 1TTPA 1B4KA 1CYGA 2VOMA 1CPUA 1RVGA 3KVJA 5AECA 4F0KA 2J8FA 4ML9A 5G2HA 2PDJA 1UD5A 2PDPA 4YU1A 3A4AA 3LSBA 2CHRA 1QTWA 3HM7A 4MM1A 4O10A 3WQFA 2WM0A 5A2BA 2QJHA 3RR4A 3GVWA 2A3EA 3HU7A 1E73M 4MPQA 3ES8A 1E6XM 2FFCA 1K77A 4S3DA 4PUMA 2I56A 3E02A 1R3TA 2PPGA 3HO8A 1KRCC 1H5VA 1UD2A 1K9DA 2NSXA 1J10A 4RPPA 4B3ZA 1E9YB 3KWSA 2ZZ6A 3BOXA 1F8IA 3OQ8A 3FYOA 4FB7A 5FF3A 2E5BA 5G4EA 4XKYA 4JKMA 1BTCA 1ENUA 2NZLA 4M82A 4XVEA 1O4UA 3H12A 1D3HA 1V3KA 3BV4A 4M19A 1JQVA 2V8ZA 4W89A 1TSIA 4EAMA 3TX9A 1YHTA 2DJLA 4RXGA 5IHSA 3MWCA 3IJLA 5C9WA 1QHZA 3WQVA 3WDIA 2WJEA 5I3JA 4H8NA 4ZO7A 1OIMA 3V75A 4B2DD 1FCUA 4CEUC 4N42A 3RLVA 1D3CA 5AYBA 5BWFA 3G5EA 3RNDA 4ACZA 4WJ8A 1H7PA 3ZR4A 3GU2A 3AIVA 4CN4A 3CUIA 5D33A 3DENA 1VHCA 2YOCA 3T2PA 4LEQA 3T09A 5EL1A 1OZQA 2C16A 5HMEA 4BF5A 5A8OA 5U7SA 3T40A 3JRKA 1E1EA 3TTOA 4K8EA 3DH7A 1E6ZA 1U83A 1IT0A 5G2WA 3G22A 5CPTA 3WZ0E 2GVGA 1UC4A 2Z00A 3M5XA 4DNMA 5AVHA 5G1TA 3S8HA 4UTTA 3CS2A 1WKFA 4D1JA 4N2YA 3SIMA 1XICA 1O68A 2ZX7A 1R3VA 5CC5A 5D2TA 3M0KA 1V0KA 3HV8A 3BG3A 1LWJA 3TH6A 1JCNA 3M5YA 4J3XA 3MUY1 2PD5A 5KZEA 3REQB 3WJXA 1DE5A 4MB3A 1N8WA 3V1PA 2DIJA 4JTCA 3U2OA 4MVAA 3A22A 2WJDA 4LALA 7CGTA 4UTUA 1IR1A 5EBUA 3AMKA 1FCVA 4E38A 2BOGX 3HURA 1QO5A 3TQKA 2JIWA 1DOSA 2ZZ4A 4PBEA 2V67A 4ZE4A 3VGGA 2QS8A 1U5JA 4NQ1A 1LL4A 1QXLA 1UZHA 4C6OA 2OPJA 1ZUAX 4NI3A 3U5YA 4JYDA 1VYRA 2V2HA 2YDAA 5C8BB 4E8CA 3U57A 3AICA 4KWUA 1QI3A 1PWMA 1XH2A 3GXFA 1LOSA 2ZRZA 3AIQA 4F0RA 1JEZA 2V38A 4AHPA 2PAJA 4Q8WA 3W76A 1LF1A 4G7EA 4QISA 4RZ6A 2YIHA 2PTDA 2JQXA 4LCRA 1GORA 4MJ2A 2GK1B 3P0XA 1ECEA 3QH2A 2OVLA 4XKMA 4EX4A 1E15A 5F2IA 3L2IA 2X8RA 4GQRA 1HKVA 3EYPA 2C14A 4ZTXA 4TVDA 8TIMA 3W7QA 1NWUA 1GPWA 1I2PA 3MMDA 4H6EA 1H5YA 2QDDA 2HVMA 2BBFA 3S1GA 1J6OA 3UA3A 3T78A 4FIQA 1SFSA 1WCGA 3F7JA 2Z1KA 3FSUA 1L2UA 5A2AA 3QPEA 3U0HA 2XH2A 1OX4A 4AAJA 2FVLA 3VM7A 1LCOA 4MJ4A 1SW3A 2Y63A 3EB2A 4H9ZA 4DBEA 1F61A 1GNXA 3UY7A 4NZ3A 5C70A 1QNPA 1UKTA 2HCVA 2CU0A 1VH7A 4O1CA 1ZAHA 1K70A 3UG3A 3GR4A 3NUKA 1TR9A 3LGGA 3W7PA 5LNSA 1RK6A 3N73A 3ANVA 3WNOA 4AC7C 3THDA 3HZ3A 3N4FA 5JXQA 2XN2A 2TMDA 4PUKA 1XIBA 3SCVA 5DY3A 1NFBA 1B57A 2ZOXA 4KFNA 1P6BA 4FNUA 4FOUA 3F03K 3CV7A 4PTDA 4LTSA 3IGHX 3NQAA 2NQ9A 4HPXA 2VEMA 2VGIA 2OEMA 3ZR6A 1JPKA 1JCYA 1FCQA 3EZ4A 4G9PA 3ZR5A 4HGXA 1GW9A 9CGTA 3GHSA 1EDTA 2VC6A 2HPMA 5HWNA 1EOKA 3A23A 5A8QA 2ZVRA 3MS8A 4JQ3A 4CNNA 2VRJA 2WSKA 3OVGA 2AQVA 2WVTA 4B16A 2D2JA 5T9CE 1ZP4A 3GB6A 1G01A 3OLGA 1R2TA 2DQWA 1FH7A 3NGFA 4QS6A 4YHEA 3TFXA 2V81A 2F2HA 1GJUA 3JW7A 5TQLA 1XHGA 1VEOA 1JDEA 1B0IA 1W5OA 4NZ1A 3SGGA 4X3ZA 3VIKA 3UCCA 1CIUA 1C92A 3OJGA 4ORIA 1S2AA 2Y62A 3CTTA 3DN5A 4DUWA 3WD0A 3P3BA 1FP9A 1QI0A 1KXTA 2H9AA 1VKFA 2FZNA 3W82A 4XZIA 1TWDA 4GIYA 4IIEA 4JIPA 1PTAA 3EMZA 5I00A 1XLCA 1A5AA 3NG3A 3OVPA 5K9DA 3MCOA 4F9JA 1XS2A 1JZ3A 1TZ9A 4DO4A 4LV9A 2XIBA 3BUVA 3UR7A 1VYPX 4MDOA 3NQBA 2P53A 3WL0A 2PLCA 3W38A 1VFMA 2PDYA 4I5UA 1ZJBA 4OGZA 1KM6A 3KZPA 2BVYA 2PF0A 1LLOA 4U28A 4C6NA 1H60A 2NV1A 4NXSA 1XLGA 3LTSA 2RFGA 4FK9A 2O9RA 1HO4A 5HPCA 1CB2A 5H2ZA 1RCQA 2XHYA 4XD3A 4AYGA 3WLKX 3TN6A 4DBUA 4S23A 3M47A 3E5BA 1A4MA 1ICQA 4M0XA 3MYPA 4JTSA 1NWRA 3W7NA 3RX3A 2WPBA 3BGAA 1Q65A 5GJPA 3TAKA 1JYVA 3G0XA 1G7VA 3QR0A 1N82A 1SJBA 4GGHA 2G4FA 4MUZA 3N29A 3W27A 5C6MA 3VD5A 1FWDC 3VMPA 4DBDA 4QAIA 3AYSA 1KB3A 2KZHA 1JNEA 3KEHA 2A7RA 4F3HA 4IPLA 3S5OA 4DJFD 1J79A 4AB4A 2QF8A 3FKRA 2X1IA 1QHOA 4YN5A 1PCWA 4QG8A 2EAWA 2QJJA 2P5NA 3EKLA 2FZBA 4IISA 2CXGA 3ALFA 3TIMA 3UEQA 1UOKA 4HHPA 2HEJA 3W7CA 3NL2A 1WBHA 4IXXA 4L1GA 1G69A 3WQWA 3PZGA 3V7PA 4C6FA 1KGWA 3VYLA 4IPJA 3ZSSA 3MANA 3M0YA 4UNIA 1S5VA 3KAOA 1J2WA 4R53A 3GY1A 2PDHA 1I60A 4UFKA 5CXPA 3VIIA 3GVQA 5KMYA 1XPGA 3FAXA 1A0CA 1KXHA 2OZ0A 2OKOA 3B4YA 3IAPA 2FTYA 4LAMA 3KP0A 3L68A 1AFSA 5I2UA 2EKCA 3V5FA 1HT6A 3G1DA 2CW6A 4LUYA 3W23A 5CPMA 1NDZA 3KS5A 1TR1A 3DHPA 3TROA 4QR6A 1UUQA 4ZENA 4Q6JA 1BWVA 4CNOA 4FX7A 4WZHA 3UPBA 2DFAA 2Y7GA 1WZLA 4QTGA 5IRPA 1MNSA 2H3BA 4KFPA 4KEUA 3TMQA 3E6EA 4ZOAA 1KBLA 3SADA 2HSAA 4W5ZA 3UW6A 5AHIA 3QHNA 1AQHA 4F0LA 1JCXA 3KDNA 1R85A 3W7DA 4OE7A 2QUUA 5BOOA 5IFTA 5CZKA 3VXGA 5BRPA 5HATA 4OECA 1GWJA 3L23A 1SJCA 5BU9A 5A6BA 2FPTA 3D0CA 3AWNA 4MUPA 3TEVA 5CQ1A 5H6HA 2YCLB 1EYEA 1R86A 3KOZA 1I2OA 3FYYA 1V08A 1WDRA 2JKPA 5IOBA 5DRCA 4KFOA 3B9OA 4BEQA 3PHAA 3P80A 1CCWB 3SCQA 4HNNA 1UUMA 2WVUA 1SPQA 5CSUA 2WJFA 1BYBA 1TA3B 1OM0A 1KC7A 2ZA1A 3MA8A 4HHHA 3MV01 1VJIA 1KGUA 2DJXA 3CC1A 1TV3A 4PULA 4ZCWA 3REQA 1FFQA 1ME7A 5TAOA 3GG7A 3OLEA 1Q13A 3P2VA 3M1ZA 3VMNA 3LG3A 2MANA 4GJ1A 4NAEB 4WJXA 1Q6QA 4OUEA 3PSVA 2E6AA 4UFMA 2PWGA 4OHQA 4QJ5B 4JY8A 4Q4MA 1TJ1A 2I14A 1BRLB 1GYNA 4J5NA 2XVPA 3B04A 4S39A 1X6UA 4FP1A 4FNTA 4CD6A 3WLLA 3KUMA 1OADA 1JFHA 4TX9A 4UFHA 2HV5A 3PNUA 5JU6A 4HZ7A 1VB9A 4GZ7A 2G8ZA 1UR1A 3URAA 1TPFA 4Z17A 2YA0A 4DELA 3AMGA 1BGAA 3GW3A 1R9YA 2NQJA 4ROPA 4DXXA 2CZEA 3GH4A 1FOBA 4UMAA 5JUVA 4WQ6A 1QW9A 4H1ZA 2GK1A 2WPGA 3L4VA 4LRSA 4IF2A 4AFYA 3LHZA 4ZXOA 2EPOA 1IWPA 1PDYA 2PDUA 3BG9A 2Y5JA 2PDQA 4U3CA 1EUAA 4H00A 5C9ZA 3NPVA 5FI8A 1XLEA 1CENA 4IP4A 1ZNNA 4D8AA 5A6AA 3W1UA 1C8QA 4RNHA 1AJZA 4JIHA 4IICA 3I7SA 1HTIA 1EC7A 4O13A 3ZM8A 3KHJA 2DORA 3LCLA 4GABA 3NAVA 2VX4A 4EK7A 1PTGA 4ZFMA 3MSYA 3O63A 3GVGA 4FLSA 4KT2A 4E0CA 2W62A 3IGUA 3GG0A 1ITCA 1Q6EA 1T6MA 1IIGA 1A47A 4WK9A 1G67A 3DZ1A 3O0FA 2Z1SA 4N6EA 1RZMA 2HTMA 4AW7A 2WMIB 5E70A 4DWSA 1AD1A 4TMBA 1EX1A 3OYZA 4RXFA 2XGBA 5A6JA 3W24A 1RP9A 3B0PA 2DH3A 3PFMA 2NQLA 3UPWA 2F6UA 3ANYA 4GIEA 2WB5A 1V6TA 3WH5A 1BF2A 3CH9A 3MO4A 1X39A 4A3QA 4Z2LA 2OWWA 3JZEA 4XO7A 1JZ5A 3EOOA 4Q8VA 1C93A 1S38A 3P7YA 4AC1X 3M9YA 3R8RA 3NYDA 1S5NA 3VTRA 2QCEA 1IYXA 3BZGA 4O1EA 4FXRA 5C5YA 3CT2A 1H7NA 3W3OA 3LYEA 3EAUA 2CITA 3WLQA 3CQHA 4QE4A 1XLLA 3AZSA 1J6PA 4P7RA 5BYWA 3U2ZA 4W86A 4DO5A 2BHZA 1TFVA 4REQA 5EU9A 1ESWA 1ZGDA 2BP1A 3ARTA 4DJED 5A95A 1XFBA 2PDMA 4IFOA 4DXKA 4QGCA 2QCNA 3WBEA 1V02A 3VD3A 2D0HA 1KNWA 1A4LA 3N04A 1WA3A 3GTHA 4DJFC 1JI2A 2ZXBA 4GQ0A 3HTWA 1UUOA 1R3QA 3QQWA 3LD5A 3ARXA 4MZYA 8RUCA 3DXIA 2OELA 4B5TA 3EWDA 1PKYA 3TKFA 3R5EA 4KWOA 1DJXA 3TXVA 4Y9OA 1ZSXA 4EPDC 1K3UA 1A5UA 2WMGA 1P0EA 1YMYA 2V6AA 3QN3A 4HZMA 3IUIA 1FWRA 3VOGA 1T99A 4IQLA 3MBFA 5KZMA 3OU8A 2V5DA 2WHLA 1N2VA 2NV9A 3H4GA 2XZ7A 2XIOA 1O5XA 3POHA 3WJYA 4GHRA 4R5EA 3BCJA 5D9NA 3QM3A 1XDMA 5CZ0A 2R94A 3SCSA 1BGGA 4PMZA 1D7KA 3HN3A 2VXNA 4XSLA 1IEWA 1C29A 1RHCA 4ZSTA 3ZVHB 1OFEA 1F6KA 5C2GA 2PBOA 3L12A 1IHIA 2G3MA 3CIXA 2GJXB 5JMUA 4E2DA 3GR8A 2CZFA 2WCGA 1KFKA 3A12A 3LHWA 1OF6A 8XIMA 4R9XA 3LX9A 4ZOBA 2WO5A 2W9MA 4XK2A 4PMJA 4C1NB 1U2YA 3QOKA 3WDQA 5IDIA 5I78A 2E9LA 1UD4A 3N2OA 3QC3A 3SM0A 2WOQA 4TO8A 3PULA 3WF0A 3AALA 5A8MA 3S6OA 2J7BA 2PF8A 1TPUA 3TUUA 1W1VA 5FCZA 4M51A 1OGBA 2AGKA 4C91A 2OLSA 2DDXA 4AIUA 2JEPA 5A8PA 2Z7GA 2PFHA 1VRXA 4CD8A 5A6SA 1OCBA 3POCA 3AU2A 4UQDA 4AG0A 3VOHA 1W2PA 1C90A 4KETA 1G4TA 2Q02A 4XUGA 3M43A 4W84A 5I6SA 6XIAA 4M81A 2Q3RA 2Z2BA 3GFYA 2VI0A 4AVNA 3H4WA 4PRWA 2ZADA 1W9VA 2V63A 1XCWA 3OTRA 4YVXA 3VC5A 3FJLA 3NL5A 3USBA 3UG8A 3FK4A 5F2GA 1FHLA 3GBEA 1OYBA 2G37A 1AL7A 2YCKX 3KOYA 2F9RA 3N4AA 3RLUA 3SIZA 4K7VA 1GONA 3NR0A 4PUUA 3WLMA 4M80A 4B5UA 1QOXA 1RA5A 1MXSA 1ZRQA 5FIPA 1J93A 4DZHA 5MKGB 4PN2A 3QW4B 4DF0A 3ZSTA 3B03A 5TF0A 2CBJA 3C61A 2QYGA 4JTDA 1XR2A 1BVZA 1LBLA 1KGXA 3NM3A 4H7CA 1Y5XA 3ARZA 1MW1A 2E8ZA 1TIWA 5I3FA 4UTWC 3GNPA 3JU2A 5JH2A 3FHQA 1F9CA 6XIMA 3L0KA 2X05A 4AWSA 4GJIA 1W1TA 1UWTA 1LUCB 2W6RA 3QV9A 4OUIA 4D6DA 2J7HA 2YYUA 5JVLA 2WJZA 3S1UA 2PRHA 1KFJA 3W00A 2GPTA 5G2IA 4QQUA 3W74A 4IIDA 4A3UA 4XAYA 4OFCA 4HVXA 4Y2WA 2CXEA 3I68A 2P8BA 5DMYA 1EGVA 4NKCA 1IXPA 4C6BA 2NWRA 1V5XA 3R4IA 2RDWA 4UMCA 3PZ9A 4AD1A 1W6TA 3W02A 1QNQA 1W9PA 1Z44A 3CAWA 2ASHA 4N7QA 4ES4A 1ELSA 4MNJA 2OSWA 4RV3A 4FSAA 2WANA 3TN5A 2OEKA 1O12A 1UCWA 2QQ6A 4HJFA 6PTDA 4AIBA 1F73A 1FWWA 1WV2A 2FTPA 2UY4A 1NOFA 1GTHA 4XV0A 3SCUA 3CIWA 4I6VA 2ACSA 3KW3A 4GYKA 1Q85A 4JTJA 3SW6A 1XSIA 3BANA 4B3LA 1GG0A 1JUKA 5G1YA 5LIUX 4X61A 4RX0A 3WH7A 4XD6A 4BWLC 4BY3A 4KWWA 5HR6A 2XWDA 1XP3A 3E2QA 3R94A 1OFPA 1NWTA 4N9DA 4IGSA 3AMCA 1BHGA 3AZRA 4HTBA 1IT8A 1JUEA 4JOMA 3WBXA 2E77A 4HPGA 4IP7A 1XC6A 3EA2A 2WBGA 4EANA 1DJGA 3UXKA 3ITXA 1UBPC 3OLDA 1EHNA 4UOZA 2VUNA 4J3VA 3QZAA 3LLDA 2Z7KA 2XIIA 4HCLA 1JPHA 3KZSA 2D3NA 2PTXA 5FL0A 1H09A 2O7QA 1AQMA 5FJJA 1PSCA 4GG9A 1IZKA 4ICNA 4GH1A 3MSGA 2BB0A 4PH6A