3IGSA

Structure of the salmonella enterica n-acetylmannosamine-6-phosphate 2-epimerase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
230
structure length
230
Chain Sequence
b'AMSLLEQLDKNIAASGGLIVSCQPVPGSPLDKPEIVAAMALAAEQAGAVAVRIEGIDNLRMTRSLVSVPIIGIIKRDLDESPVRITPFLDDVDALAQAGAAIIAVDGTARQRPVAVEALLARIHHHHLLTMADCSSVDDGLACQRLGADIIGTTMSGYTTPDTPEEPDLPLVKALHDAGCRVIAEGRYNSPALAAEAIRYGAWAVTVGSAITRLEHICGWYNDALKKAAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylmannosamine-6-phosphate 2-epimerase 2
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Isomerase
total genus 81
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3igsA00
1FWWA 4XUGA 4ZMGA 5LGXA 4A2RA 3HG2A 4POCA 3TE9A 1OX4A 4YMZA 4LTSA 5HQEA 1VYSX 4EF8A 2YR1A 1LOSA 3NM1A 2FIQA 1W5QA 1KFBA 3GDMA 4ZZ9A 3KOFA 3MYOA 5I3HA 4AMAA 2WOQA 4L4MA 4QNWA 2RDUA 4O4VA 4UNLA 4O50A 1OVDA 3CB8A 1RVGA 5LSMA 3W7QA 4UTWA 5DN1A 5DELA 4H4IA 1MXSA 3E49A 2QCNA 1Y0EA 3WJXA 4WJEA 4JTFA 2R8WA 3GNNA 4OHQA 5EMUA 4N9DA 2H3BA 1D9EA 3G18A 4JIPA 4OGZA 2EF9A 3STFA 4GUFA 2FTPA 4BI6A 1QNVA 1TSIA 4IXXA 2E68A 3G1DA 4M19A 2RKXA 3DKJA 4Z0JA 3EX3A 4A21A 2F84A 3TCEA 4ZL1A 5FF0A 3OIXA 3MP4A 3IV3A 3NA8A 1VLIA 2VEIA 3TQVA 4MLRA 5KTLA 1Q45A 4R34A 1YXYA 3GK0A 4MYAA 2H8ZA 2FQIA 3T7VA 3TUUA 5HWNA 4CQAA 3HMJG 3FIGA 3M7WA 4DO5A 5IBXA 2YXGA 3RLVA 2F7FA 5DCDA 4IMFA 3M41A 4HNVA 4JX5A 2PRMA 4JICA 2QKFA 2DZUA 4ZQRA 3L21A 1OFAA 4RXGA 3DI1A 4BR1A 4NJJA 5F2GA 1LOQA 3FA5A 1TO3A 2ZZ3A 4UTJA 3S5OA 1F6KA 1X7FA 1Z48A 4UTIA 2C0AA 2C19A 1R2TA 3W7HA 1H1ZA 2YW3A 1GVFA 2CU0A 4JYFA 2WSRA 3LRLA 3B4UA 4Z1AA 5HJLA 1WA3A 5CG7A 3V1PA 1O95A 5H2ZA 2ZFAA 4MUZA 1NF7A 3OVQA 3W86A 1N7KA 3A5VA 5F4XA 3BG5A 3P84A 3EXTA 2NUXA 3GDTA 4CCCA 3W2UA 1RQEA 4BK9A 3ZS4A 3IIPA 5KSWA 2TPSA 3TAOA 3TAKA 2ISVA 4UXDA 3QMSA 3IVUA 1F6PA 1OFDA 1FY6A 3IGXA 1K8XA 1N8FA 2FLIA 3G1VA 4MY9A 4FX7A 3A9IA 3UY7A 3T44A 4TO8A 3EWBX 2HS6A 4HSOA 5AHMA 1AK5A 1KM5A 1JCJA 2QCHA 3M1ZA 2XN1A 4UTTC 1QDSA 2GOUA 2QJHA 3L5LA 5E93A 5A5WA 4CNPA 1OF6A 3VCRA 1K3UA 3BW4A 4ORIA 5HMSA 1H60A 1G67A 1W5OA 2QUUA 3NPVA 2WPBA 3LGEA 1SUXA 4WXZA 3W6YA 4O13A 1KFEA 3NQ2A 1BKSA 2OX1A 4LY8A 2ABBA 5BOOA 2B7QA 2PC4A 4UFJA 2E5DA 1BWKA 1ADOA 3LBCA 5AC7A 1BTMA 3KVJA 3N2XA 1GYNA 1SZFA 3HOJA 5D2VA 3PM6A 3W7PA 3M43A 1SZNA 1T96A 3NQ8A 2YPIA 2LLEA 3CM4A 1PVNA 2Y85A 5BRBA 3W23A 3R8RA 3LDVA 3L9CA 3LHVA 4MY8A 3C56A 3OHIA 3QRHA 5DCBA 1QPOA 1T99A 2Y70A 3S6DA 3TSBA 3S42A 3W1UA 2O7SA 2X1RA 3QSTA 2J6XA 6ALDA 5EKYA 1RQBA 1DHPA 1GZGA 4ALDA 3SJ3A 3IIVA 1C29A 5L6UA 1ZENA 1W3IA 2WSYA 4N02A 3LHTA 2JK2A 2NV2A 4ZQPA 2XFWA 1JCNA 5TQLA 1VS1A 5LNSA 4NJKA 5DBTA 1HO1A 3NL5A 2YYTA 3N34A 2UV8G 2C1HA 3HO8A 1RR2A 1ICPA 4O12A 2RDTA 4OT7A 3LTYA 1A53A 4O17A 1WOAA 3TW6A 2E6AA 5HWJA 1LM1A 1I2RA 1QR7A 3TJLA 1PE1A 3MI2A 2RHGA 4IMCA 5CZJA 3TFXA 4LUIA 1FUYA 1QPQA 3LXCA 2H3DA 5GVJA 3RU6A 1FWRA 2H8XA 3O06A 3PC0A 1NF0A 2GQ8A 2Y7GA 3GAYA 4RLIA 3LCXA 3NZ1A 3GAKA 2TMDA 1ME9A 3L65A 1UASA 4ZQMA 2OJPA 1LBFA 2Y6ZA 1JRBA 3G3MA 4IQLA 3VE7A 5EBUA 4GJ1A 2A85A 5LZLA 4X3ZA 1FWNA 2ATMA 2E6DA 1VHNA 5AHNA 4AWTA 1XBXA 3W1MA 1FXQA 1VYPX 3PUEA 1XBVA 3LRKA 1LLZA 2ZZ5A 1K7XA 2FDSA 4GWEA 5DBUA 4WX2A 4LUJA 2WQPA 1B57A 2NX9A 2NV1A 4CQ9A 3SGUA 1LBMA 1OFRA 1YTDA 2CZDA 3PR2A 4UTWC 3CU2A 4IUOA 2ZRVA 2DJLA 4O15A 4JY9A 4OV9A 2GUUA 3IRDA 2ZZ1A 3O16A 1H1YA 5BNKA 4FNRA 3P62A 3TXZA 1B4EA 4MZ8A 4P2VA 3C2EA 3SGZA 3R89A 2JGYA 5D33A 5I3FA 1XL9A 3F1QA 3FJ6A 3GKAA 1G4PA 1X1OA 4LV4A 1LYXA 4AB4A 3INPA 3NNTA 3A5FA 3BV4A 4JX6A 5G2IA 4N6FA 3MO7A 3NQEA 3TU9A 3BPWA 3GXPA 5EA9A 4LC8A 4JEQA 1NEYA 4MYXA 1AMKA 4RZ5A 3OA3A 5AYYA 4RV8A 3G1AA 1AL8A 4N4QA 3VFLA 4G1KA 4FX8A 4JTSA 4LOCA 4IX2A 4A3UA 1AL7A 2Z6JA 4AH7A 3C52A 3ZWTA 3QQ0A 3HPXA 4TX9A 2VC6A 3JS3A 1THFD 5LNWA 1O60A 4RCXA 4RX0A 1KM4A 4ZQNA 4LVAA 4TIMA 1LDCA 4LVBA 1OHLA 1SSDA 1YXDA 3W74A 4X2RA 2QCFA 2BXVA 3NYZA 4NUWA 3E96A 3T55A 4K39A 5K3VA 1KM2A 1WOBA 3W85A 3RF9A 2JKPA 3W7KA 1TJRA 1KTNA 3W7EA 3M5XA 2B7OA 1KBIA 1UB3A 2BTMA 1ZALA 4MFDA 3SZ8A 3UPBA 2WNZA 4O18A 5KZDA 2HMCA 2BZNA 2X1SA 4EF9A 5HR7A 2NWRA 1YPIA 2CLKA 5CKSA 1IXOA 1S3HA 4YXGA 1ME7A 4AWSA 2VEPA 4YL2A 1KLZA 2I9EA 4XBSA 1FCVA 1J2WA 3R12A 5LHFA 4Y9AA 1W37A 4GBUA 3LCFA 4IWWA 5FF3A 1LORA 4TMBA 3QZEA 3CT7A 3GXNA 4N2YA 1FDZA 2WO5A 3M5ZA 4WQ6A 3CQ0A 3STEA 1TTPA 2A21A 4QNEA 4HN4A 4LW7A 3MMTA 2CLEA 3PG8A 4O19A 2O7QA 4UUIA 1G4TA 2E6YA 4OWGA 1TB3A 3NQGA 5K9XA 1I2QA 1Q6RA 1R46A 1UUOA 2V81A 5AHLA 4C1KA 2DORA 1H7WA 2FB3A 5C5YA 1A5AA 1W5PA 2BX7A 1Q6LA 3G24A 4NNCA 1OYAA 1YXCA 3CTLA 3LLDA 2QCDB 4ADTA 5D2WA 1OABA 1TTQA 3TMQA 4RZ6A 1L6YA 1TV8A 3C2VA 3BGJA 1T8XA 1CW2A 5K9DA 1KFKA 3O6DA 4CCDA 1W1ZA 3HPZA 2YDAA 1ML1A 1OX6A 1QAPA 3B03A 5HNRA 2A6NA 2PE4A 2DZWA 4UTHA 4FB7A 2WV8A 4BFAA 4JD4A 4WOZA 1GVQA 2J9YA 1M7PA 4JNMA 3B0VC 2NUYA 4BWLA 4XTIA 1OF8A 4A2SA 2DU2A 1JUEA 4JTIA 1TV5A 3P67A 3A24A 4O16A 3TDFA 3MWAA 2YSWA 3LTPA 1PV8A 2Y7FA 4FNPA 4DPQA 2DZXA 4ZQCA 1SSGA 1IIHA 3EXSA 1C8VA 1EX5A 2DP3A 3NG3A 5CZSA 5T26A 4HNTA 2A1YA 5G1TA 3E0IA 4FHAA 2ZRXA 3HGSA 2QCLA 2TSYA 4FO4A 4NZJA 3G0SA 1GTEA 3W83A 2QEZA 1H7PA 1LROA 2ALDA 4O1CA 1HTIA 3UQNA 2Q8LA 1MSSA 4DF2A 2FPYA 4E2DA 2VKZG 1WYIA 3BG3A 5AHEA 5G1YA 2ISSA 4JGDA 5LGZA 3SECA 3ATZA 1NSJA 1V5XA 4OU1A 1RQHA 3I68A 1GT8A 2Y7EA 1TPEA 3W2KA 2I1OA 2JBMA 4PEKA 3LXAA 1ME8A 4HSNA 2G5WA 1WBJA 1GWJA 2A6LA 4UMAA 2V2CA 3G1HA 3NXFA 4C1LA 1NAL1 3MHFA 3N3MA 3WK1A 3ELFA 3GB6A 4NZFA 1C9DA 4JIQA 1I8JA 3MBFA 2ZZ4A 4LNYA 2OT0A 2ATSA 2QAPA 3TV8A 1KM6A 3OVPA 1JULA 3PS7A 4K37A 4UFLA 1K8YA 2CLOA 2Q3OA 3LOTA 1OK6A 1XBZA 1H50A 5CPOA 3O15A 3W70A 1W5MA 4NXKA 1S5WA 1WQ5A 1VCFA 1TV7A 1ONRA 3SSJA 1DVJA 5D30A 2VFFA 4PL2A 4MJMA 3EWUA 3W87A 3R5EA 4NX0A 1PS9A 3N73A 4K7YA 2ZRZA 3THQA 4LU0A 2W6RA 1EB3A 1ZCOA 1LBLA 3O8AA 5BMWA 3DU0A 4O11A 3FKRA 4GUGA 4AWUA 2G95A 2VELA 3LB0A 3S1UA 1ZAIA 2Z0IA 1SZGA 3W84A 5FEWA 3L66A 5DXYA 1WAUA 4UFHA 3DZ1A 3UD6A 4NJGA 3QQ1A 4AHPA 3UWZA 3M6YA 2A7RA 5F2IA 2X1TA 4HHPA 3PUDA 4Y6GA 3TROA 2V30A 4E2BA 1TPFA 1AW5A 3N2MA 1MEHA 3W71A 3LHYA 1EA0A 1TTIA 4UNKA 4Z1CA 3OBKA 4FNUA 1EP2A 4WD0A 1VPXA 3UWVA 4JTJA 2PRHA 4Y8FA 3UPWA 5J5DA 3UWWA 1W3TA 2JKAA 2FPVA 4XQ6A 3QMRA 3B0PA 3HG5A 1XKYA 2WNNA 4MPQA 3MHGA 4WOQA 3EX1A 1MZHA 3LI0A 3FYPA 4DPPA 1OX5A 5D38A 3VKJA 3GDKA 4J9JA 1EP3A 5I3IA 1FCBA 4E0CA 1KTBA 5CSRA 1JUKA 4JYEA 2NXGA 3W73A 3GKFA 4I7VA 4S2BA 1Q6QA 1TQJA 4DO4A 3NQVA 3EWZA 3MW7A 4K38A 3HGOA 3P60A 4TMCA 2DZVA 1BEUA 5FF2A 4AAJA 3H53A 1TPH1 1VYRA 1TTJA 4R33A 5SWUA 4KWVA 3IIZA 1Z41A 2QAFA 2Q8ZA 3KVMA 4PCFA 5KITA 2Y62A 5LKYA 3ZFHA 2VXNA 3TQ0A 2ZTKA 3S1WA 3S9YA 5CPNA 4K8EA 3LV5A 3BVJA 2CWNA 3W07A 1QCWA 1KFCA 3STGA 3BARA 3B0UX 1I4NA 2E5CA 2ZZ6A 3ANYA 5DY3A 3I6RA 3W1NA 2IQTA 2OT1A 2BLEA 5G4EA 3CLMA 1RD5A 1KBJA 1OYCA 3DFOA 3SIZA 2J27A 3LHUA 5F1UA 1LRTA 1OFQA 2ZZ7A 4IPIA 1EEPA 3NPWA 4NJHA 2P0OA 4LS1A 4N9CA 1VCVA 4WZHA 5BW6A 1TQXA 2WSQA 3M16A 3P80A 3QSRA 3LCIA 3WK3A 3L0NA 4O1DA 1SO6A 3QPZA 5G4WA 4DO6A 3NR0A 5K7JA 1PCWA 2GVJA 4LVDA 2D73A 2WKJA 5AOUA 3O1NA 4Z1DA 1MEIA 5AC6A 1R30A 2VFEA 2ZA3A 2ZDRA 3I7RA 4MOZA 1G7VA 2ZRUA 3MP3A 3KRUA 1KW1A 5DLCA 4W9TA 1LLWA 4FNQA 1S5TA 3OEXA 3IIOA 1W54A 1FWSA 5ABTA 4UC5A 1PHQA 1XDMA 1L9WA 1K7EA 3PBWA 4YWIA 1DOSA 1T0OA 4JTTA 4S1FA 1JCXA 4OBTA 5AHFA 2RFGA 1U83A 1WXJA 1XBYA 3LRMA 5J5RA 1KV8A 1ZNNA 2EGZA 4DF0A 4GNJA 3CEUA 1XDLA 4PTNA 3S5NA 4BWLC 4HNUA 3SFKA 4JR5A 3LI1A 1LRQA 3M47A 3N19B 5LNUA 4WUIA 3CPRA 1XC4A 3G0XA 1TPB1 4HT3A 4NU7A 1KFJA 3L67A 2DJXA 3EEGA 5AHIA 5LNRA 3ZR4A 4FNSA 1GTHA 4AHOA 4AF0A 3HG4A 4NVTA 4K6AA 1IXNA 5HUPA 2J24A 2NLIA 3C3NA 5AB3A 2A2IA 1JCYA 2R14A 1VH7A 3FOKA 4FIRA 1XUZA 2QCDA 5L9FA 4RJEA 1ICSA 2OMAA 1A50A 2WNQA 1DJQA 4CNOA 3S0CA 4AHQA 4Q32A 1XI3A 1IF2A 3AO0A 3HPSA 2CZ5A 3LCGA 1MO0A 1GVOA 3SR7A 2WJZA 2XN2A 2NWSA 4KKXA 3MHUA 3DKLA 4NT0A 2EPHA 2ZRWA 4RXFA 1YLVA 3C0JA 2QJGA 3GDLA 1W31A 3TKFA 2YGYA 3HB9A 4A22A 1X6UA 3PY2A 3GX9A 2ISWA 3ZWSA 3LHZA 3NPUA 1J4EA 4R7JA 3LERA 3A21A 5CPMA 3P5ZA 4O28A 4XWUA 4LVFA 4M6PA 3W72A 4MZYA 1FQ0A 4LVGA 1FX6A 4NQ1A 3EWXA 4XKYB 4XTDA 1SQ7A 3IVSA 4CCEA 3IIXA 2CZEA 1U5JA 5F2MA 3B05A 5IBXC 5LHEA 2GQAA 1F73A 3P5YA 4H3DA 3QYQA 3S5ZA 4UIOA 1FCQA 1IIGA 4O0ZA 1UBSA 4GUIA 3DAQA 1QWGA 1QPRA 5TBOA 2A7PA 2I14A 3C2FA 1QOPA 1SU5A 1F5ZA 4OE7A 1VC4A 3BLEA 2X30A 2ZCGA 2X16A 2J88A 3UXAA 3EKLA 4IOTA 4XBKA 5D05A 4CQ8A 3P7YA 2E09A 1TIMA 4GUHA 4K36A 3PSWA 3GVGA 4JS3A 5D02A 4JY8A 3RFAA 5LNVA 1TRIA 2W0UA 3GNDA 4UMCA 3MI6A 1GG0A 4GXMA 5K2ZA 1R2RA 2PCQA 3G1SA 2C16A 4LWWA 1V7YA 4LRSA 1PL9A 3AJXA 1S5VA 3WJSA 1WV2A 3LM7A 1SO5A 2Y88A 3DGRA 3LCLA 4FF7A 3C2RA 1VHCA 2QUVA 4IMGA 1JJKA 2HTMA 3BK0A 1P0KA 1OFEA 3TNOA 1SO3A 1H51A 1ZHAA 5D09A 4ORMA 3PF3A 1SO4A 1WBHA 2E6FA 1QPNA 1JR1A 3GIYA 3LHWA 3IEBA 3QPYA 2ZZ2A 3O63A 4HIBA 4QSHA 3PG9A 3UYCA 3TA6A 2C15A 3PAJA 4EVZA 1L2UA 2J9XA 3DBPA 3NVTA 1FXPA 2Q3RA 4O14A 4ZVJA 1EP1A 2JGQA 3VI2A 4MLJA 5D04C 1ZJIA 3PB2A 3KRSA 1H62A 4M6VA 2YFOA 3LTSA 4IPJA 2ZQ0A 5G2WA 4I7WA 2ZBTA 3BGGA 1OK4A 4LT9A 4ONVA 3W7OA 1XXXA 3S5YA 4K7VA 1KV5A 3P74A 2X1UA 4L4LA 1D3HA 1OFBA 4YCPA 3PWAA 1BWLA 1O5XA 3PVFA 4AF0B 4UTKA 1GG1A 3K30A 3KVLA 2V8ZA 1G4EA 1P0NA 2ZYFA 4PA8A 5U7SA 4YLWA 3W7JA 2XN0A 5AFDA 3QW3A 1YPFA 4WXYA 2NXHA 1KTCA 3O05A 3G22A 4O1BA 2HS8A 2C13A 3A23A 1VZWA 3IVTA 4O0KA 4AVFA 1IGSA 4QISA 3KRZA 3W7LA 1F05A 3A22A 4QIUA 3NO5A 3N9SA 4DELA 5MHBA 1TRDA 2QCCA 4GFSA 4UMBA 2V2DA 4RR4A 1EUAA 5AC8A 5A8GA 3F4WA 4IMEA 3EX2A 4PFMA 5FEXA 5HINA 1H61A 2B0MA 3PUOA 1WDWA 1JUBA 3G1XA 3W2MA 5CGQA 4O1AA 3G8RA 3BO9A 5FEPA 3WJYA 3TC7A 4NNBA 5F1VA 1YDOA 5KZEA 1ZAJA 2PURA 1LZOA 1HG3A 1QO5A 3S1VA 3EWWA 2QUTA 1GEQA 4LS0A 2YCEA 3T4CA 2RH9A 4GUJA 3KVKA 1JQVA 4WY0A 1PIIA 1SPQA 5C2XA 4CLMA 4QITA 3M5YA 1E51A 3B04A 1H5YA 3NQFA 5EY5A 1R47A 2B7NA 1KA9F 5K4XA 2VOMA 1L6SA 4M7SA 4DBEA 3NL6A 4AXKA 4Q33A 4B5NA 2YW4A 3LCWA 2BSLA 3V75A 3F4NA 3USBA 3QM3A 3TXVA 4E38A 3R2GA 4QJ1A 5I3GA 3WK2A 3QC3A 1EIXA 1W8SA 3Q2DA 3LXBA 1IXQA 1SW0A 1W5NA 2GPTA 2CZFA 3NQMA 5KINA 2C14A 4BI7A 4ML9A 2VEKA 2VFIA 2CFFA 3GXTA 3PSVA 3CIWA 3NM3A 1H7OA 2TYSA 3SI9A 5H91A 3NDOA 2V2HA 1I2PA 2ZRYA 1FCUA 4EOUA 2V5LA 3O07A 1LCOA 1VQTA 3MBDA 3MI3A 5G2HA 3W2LA 4OV4A 1OG0A 3TQKA 2C18A 1B4KA 3W76A 4FNTA 2NX1A 3W7RA 2QF7A 4IXHA 2FPTA 2A4AA 1DORA 2JKEA 2VENA 3CWOX 1G7UA 1IXPA 4MFEA 1Q3NA 3QH2A 1G69A 5DXXA 5U4NA 1HFBA 4FXSA 3THAA 1GVSA 2E1DA 1QO2A 3F03K 5D03A 5C6MA 5HR6A 3W1XA 1MEWA 3LV6A 3LCHA 5EPDA 4UFKA 1VRDA 4ZQOA 2P10A 3M44A 3NQ7A 1NVMA 1D3GA 1KM3A 1W0MA 3I7SA 7TIMA 4JTGA 3M9YA 3NAVA 3NQDA 3W22A 4XZ9A 1YTEA 3W3OA 3UZJA 3B8DA 4U4MA 3L5MA 4LS2A 4LRTA 1SFLA 1R2SA 5D2TA 3DFQA 3KX6A 4QM1A 1M5WA 3FLUA 3P81A 1VR6A 4Q4KA 4N9EA 1QFEA 3NOEA 2CLHA 3PBYA 3CC1A 3MP5A 2PRLA 2KZHA 3W1RA 5E0KA 5FI8A 3TMLA 2ABAA 4S2CA 3HG3A 3KFTA 3FKKA 1ICQA 1HUVA 5FF7A 3UZ5A 2QCMA 2VEMA 3W7MA 4GRSA 1F7BA 4MY1A 3CHVA 5FESA 2ZA1A 4GE8A 1GOXA 2NXIA 2QR6A 1H7NA 2QDGA 3TH6A 3RK8A 1ZFJA 2AAMA 2GJLA 3W1AA 1RPXA 4DXVA 4O4WA 3UWYA 2VFHA 4IX0A 3I7QA 3O6CA 1GJPA 1P1XA 3Q37A 4XKYA 4IMDA 3TC6A 1DKWA 3WK0A 1F76A 4M7TA 2Y89A 2P1FA 3WFAA 1OFOA 4JTLA 3DHFA 3TSMA 3P8JA 3W75A 4AEOA 4IJBA 1F74A 4CNNA 1KM1A 2QCEA 3PBVA 5I3JA 3IGUA 1SW7A 3N9RA 3L5AA 3W1QA 2HSAA 4UFMA 4RZ4A 3ABSA 1UUMA 4UCGA 1AW2A 4UFIA 1FWTA 5HULA 1OYBA 2CLMA 1TPUA 1OX4B 2EKCA 4WY0B 3GR7A 5DY2A 1M7OA 3C6CA 3IGSA 3QFEA 1DV7A 5D37A 4KFPA 1G4SA 1JCLA 1ALDA 4Y96A 1GVRA 1KLYA 1H63A 5D2YA 4O52A 3SW6A 1VCGA 2C6QA 4FIQA 3CWNA 1K8ZA 2CW6A 5AYXA 3HGRA 3DFPA 3PBUA 1JQXA 3WJWA 1Z42A 5HUOA 1VLWA 1H7XA 3QW4B 2GVGA 2CLLA 1LRNA 3DH7A 3C2OA 3PB0A 3TW7A 3PULA 5BMXA 1Z44A 1H7RA 2A7NA 2QJIA 2J9ZA 3QJAA 4DQWA 4EIVA 4N9BA 3NL2A 2AGKA 2C3ZA 4M5PA 4MIMA 3UWQA 4JXCA 4K8HA 4BI5A 1HL2A 3HQ1A 5K4ZA 4JN6A 3NQAA 3GLCA 1K02A 5CZ0A 5EYWA 4O10A 2DZSA 2V82A 1FDJA 3QF0A 4KFOA 4ADSA 2DZPA 1GQNA 3KAOA 2YZRA 2V9DA 4JDBA 4FXRA 3E12A 4NJIA 3W88A 3M5VA 3S1XA 5F2LA 3P82A 1XM3A 4A29A 4TU1A 3RNDA 5D2XA 4LC6A 4M6QA 3M0ZA 1RZMA 3TFCA 5DCEA 2R94A 2R91A 2Y7DA 3R13A 3S8HA 4IGHA 3T40A 4QQ3A 4TR9A 5AYZA 3DFSA 3UWUA 3BW3A 1W3NA 1EWDA 4R53A 3C4UA 4JDYA 4KFNA 1SW3A 3L68A 2RDWA 3W7GA 1P4CA 3DHDA 4MZ1A 3CEPA 1TPDA 3O6YX 4JTKA 3HJZA 4O54A 4JTEA 3MYPA 1I45A 2Z1BA 4Z0SA 5G5IA 4UR8A 8TIMA 2ZA2A 3VE9A 4UTMA 3ABQA 3ATYA 2FB2A 4FEZA 4UTUA 1SZEA 3LLFA 3FFSA 1N55A 3SY5A 3YPIA 1CI1A 2W79A 3NQ6A 4MKNA 5E1QA 1TPWA 3G1YA 1QOQA 2QCGA 3ABOA 1FBAA 2GJNA 5AN7A 4HPXA 3L2IA 3RLUA 1HO4A 3U6WA 3UY8A 3W1LA 2AQWA 5KMYA 1X1ZA 4UTLA 2G96A 3W1TA 2DZTA 4HPJA 3FS2A 2E77A 3L0GA 4ICNA 2NUWA 5IM51 3NQCA 1NFBA 1O94A 1DQWA 2EHHA 3OVRA 4JX4A 3NEVA 2CLFA 3GYEA 1O4UA 5D32A 1J5TA 4P61A 3W9ZA 1L6WA 4WY0F 1LTDA 3MJYA 4QAIA 4RK8A 5TIMA 3W7DA 1Q6OA 1PHWA 1VGAA 2QDHA 1TJPA 3DFNA 3P61A 3OG3A 1QMLA 3W7CA 3HF3A 3KHJA 4UR7A 4PL1A 2V0TA 4KWWA 3VNDA 5CZTA 1TREA 5CSSA 1JRCA 3W2NA 3TR2A 3JRKA 5FF4A 1TPC1 3UXDA 4EWND 3FEMA 5EL1A 2B7PA 4I7UA 1ZY9A 3LBMA 3FYOA 2Z2UA 4PODA 4I9AA 3BLFA 1OJXA 2GVLA 2YFNA 4N4PA 3RMJA 1EUNA 1SR9A 5C54A 5HWMA 1F2JA 3HIJA 1XFBA 3DI0A 4DF1A 1LP6A 1SFJA 1DBTA 1O5KA 2NZLA 5F4WA 3HGJA 1B3OA 1RV8A 4DBDA 1A5CA 1EWEA 3G0UA 3U2OA 5FEZA 2ZTJA 4O8RA 4UTTA 2OCZA 4NNAA 3D0CA 3DENA 3NZRA 1K03A 3B06A 2B4GA 3C8FA 4JYDA 2FFCA 1WX0A 1JVNA 3EWYA 4GC4A 1XUUA 3G8EA 1TCDA 2YYUA 2Y61A 3Q94A 2GQ9A 1KM0A 3W7NA 1YYAA 4NX5A 4MVAA 1PCKA 3DXIA 3TIMA 3NL3A 4JTUA 3TJXA 1JCMP 3NPXA 3BLIA 4PH6A 3EKZA 3FJLA 3EX6A 3Q58A 3QMTA 6TIMA 3QEZA 3ABRA 4N6EA 3T78A 3TSDA 1KFLA 4D2JA 2H90A 5F4SA 3P8IA 2TRSA 1XCFA 4OQVA 3EXRA 3W1PA 3W2JA 1YADA 4HNNA 1AW1A 1GPWA 1LOLA 2OZ0A 4O53A 1YTKA 3C61A 2G97A 4Z08A 4X22A 2A0NA 3W7IA 1TMHA 4BF9A 2VFGA 1M6JA 5I3KA 1A5BA 1FDYA 4DEFA 2E5BA 4PC8A 5K9CA 4ADUA 2Z6IA 3GR8A 2H6RA 3NGJA 2EAWA 5KZMA 4Z1BA 3CIXA 4O57A 3EX4A 3I65A 3STCA 2BWGA 4MJZA 2CLIA 3TK7A 3HBLA 3DFTA 2V5BA 1TYGA 2A5HA 3N14A 3GDRA 5CPLA 4YCOA 1UJPA 3MUXA 2NX3A 1P5BA 2FJKA 3BG9A 1OFPA 3GZ3A 1DJNA 2YX0A 1DQXA 3H54A 3TX9A 1YDVA 1K7FA 4RKAA 3LX9A 3E02A 1AG1O 1CX9A 1DL3A 4FX6M 2X2GA 4H6KA 1B9BA 3EB2A 3L0KA 4HKPA 4Y90A 4JTHA 1X8FA 5C55A 3KXQA 1GYLA 4LV9A 3G1FA 1YDNA 1I2NA 4U28A 3U8GA 1TPVA 3BW2A 3G3DA 3JR2A 3UNDA 1VJIA 1ZAHA 1W56A 3WJZA 1G6CA 1I2OA 1EPXA 1UCWA 2Y63A 4X9SA 4NXSA 1A5SA 2VFDA 3E9AA 3H55A
chains in the Genus database with same CATH superfamily
4US5D 4TOQA 5H8MA 3CQJA 3TE9A 1OX4A 3TYEA 4ATWA 5HQEA 1LOSA 3U2ZA 1JPMA 3GU1A 3GDMA 4AU0A 4ZZ9A 1NQKA 2QS8A 1A4MA 4L4MA 4YTRA 4UNLA 2DEPA 4O50A 1OVDA 3OLGA 1RVGA 1F3WA 2CEQA 3C86A 1PB0A 5DELA 4L9YA 3VKAA 1EFZA 1Y0EA 3WJXA 3MS8A 4MNLA 3GNNA 5EMUA 3BDKA 2H3BA 1D9EA 2XFRA 3G18A 1UWSA 2EF9A 3QZAA 3UP8A 1GOKA 3AWOA 3CLWA 4IXXA 4YPJA 2PS2A 4Z0JA 4A21A 3CUGA 2NT0A 5FF0A 3OIXA 4QTGA 3AS2A 3ARZA 2X7VA 4YTSA 4PRTA 3UZZA 2PZNA 4QROA 3T7VA 4QLLA 1UR0A 4LX4A 3JW7A 4PUJA 4DO5A 3VXGA 4D6GA 3DYOA 2CKRA 2YXGA 3RLVA 1GGOA 5DCDA 3NQBA 2DSVA 2PWGA 3DI1A 1I6NA 3UJFA 1TO3A 2A79A 3T4WA 2ZZ3A 4H9XA 5FACA 1F6KA 1MFUA 2C0AA 2XVKA 2C19A 1R2TA 4HGXA 1GVFA 3VD9A 3H2CA 2B31A 3O0KA 2XIIA 1EJVC 3V1PA 1O95A 4MUZA 1NF7A 3W86A 2HE5A 3BG5A 1M41A 2GL5A 3IJ8A 2NUXA 3GDTA 3TJIA 1DQUA 1UKTA 2L5HA 5C2CA 1WNOA 3IIPA 1IQ8A 4F0LA 1PZ2A 4DNMA 4UXDA 4I9JA 1KCXA 3LSCA 2J7HA 3CYVA 2X1IA 3QR3A 1E4IA 5GNZA 3G1VA 4FX7A 3R43A 3EWBX 3N12A 3UEQA 1JD9A 1JCJA 2CYGA 2QCHA 2ZX6A 3PZUA 1TUXA 2XN1A 5E93A 2O9RA 3BW4A 5HMSA 3NPVA 1WZAA 3THUA 3GQYA 1QT1A 3W6YA 2ZUUA 4PULA 1KFEA 4LY8A 1BKSA 2OX1A 3BL3A 2PC4A 4AY8A 2QIIA 4BKNA 4IM4A 2XWDA 4TXEA 2C1IA 1BTMA 3T0TA 5CLWA 4L1XA 3ICJA 4JN7A 4NI3A 2V38A 2VGGA 3PM6A 1SZNA 1ONWA 2I9UA 3W23A 2VX7A 3CBWA 3L9CA 4MY8A 1JYWA 1PSCA 3H7UA 4JKLA 5DCBA 4C1NA 3PBMA 4D6IA 1B90A 3RGTA 2NQJA 2CCRA 4BQ3A 2WXDM 5I3DA 2CBJA 2JEQA 3VAVA 4ALDA 3IIVA 4IISA 1ZENA 2WSYA 4DBWA 1KGWA 2HBVA 4LANA 4ZQPA 4JNYA 5CZKA 3N04A 2ICSA 1JCNA 5TQLA 3VGFA 3SIMA 2E7FA 5DBTA 1QUMA 2FTYA 2FMOA 3NL5A 3VDAA 2UV8G 2C1HA 1XYCA 1XIEA 5BU9A 5C7HA 1E5NA 1JDEA 5CH9A 1WOAA 4NI8A 3TW6A 2E6AA 1LM1A 2PD5A 3KP1A 1QR7A 4WCJA 4IMCA 5GVJA 3MVIA 2H8XA 5KEZA 1NF0A 1TVNA 2GQ8A 3IANA 2BY3A 4RLIA 3SJNA 3LCXA 2V5KA 1MRQA 4U2ZA 4GGHA 1AODA 3VKBA 1UASA 4ZQMA 2WHKA 2DT1A 3WLOA 2Y6ZA 3E1F1 4GJ1A 4W7WA 3TTYA 3UR5A 3VMOA 2ATMA 5AHNA 1S2CA 3K8LA 1XBXA 2IQDA 2OSXA 1XC6A 1VYPX 3PUEA 5HJYA 4D6HA 5C9ZA 1SJBA 3PBGA 1K7XA 3GBEA 1B5TA 1QK0A 2PDKA 4FXFA 2NX9A 4L6HA 1TWSA 3KLKA 3SGUA 1YTDA 2GDQA 1R3QA 2G3MA 2DDXA 2ZRVA 4QDWA 4NG3A 2DJLA 1GONA 4O15A 2W91A 4WVXA 3P0WA 5JU6A 3WLHA 1VFOA 3P62A 4GQ0A 3IS4A 1B4EA 3GXIA 3I3BA 4P2VA 3R89A 1D8CA 3N29A 2IKHA 3GKAA 2VJXA 4LV4A 3WLMA 1ISWA 1LYXA 5C71A 2KAUC 3WEZA 4AB4A 4JHZA 4Q8TA 1JXKA 3W53A 4N6FA 3NJ3A 1V0MA 1QNPA 3V3WA 2TAAA 1BF6A 4KEUA 2DW6A 4RZ5A 3QLLA 5AYYA 5IRPA 3LPGA 4N4QA 4G1KA 4RPQA 4LOCA 2UY3A 4IX2A 4A3UA 1AL7A 3VD4A 4B91A 1ZBKA 4W7UA 3HPXA 1ISVA 3ARPA 3JS3A 4Q8OA 1C90A 3SO7A 3ITOA 2J7BA 2ANUA 2J75A 4HSHA 1KM4A 4ZQNA 3FX4A 4LVAA 5C8BB 5HBFA 5CPQA 4IPNB 1RBOB 4X2RA 2QCFA 2BXVA 3AMLA 3NYZA 3LPPA 4NAFB 5K3VA 1KM2A 1IT0A 4IFKA 4JTAA 2WJFA 3FW6A 2JKPA 3W7KA 1TJRA 1KTNA 3RO6A 4IP4A 3QOKA 2ZUTA 2FFIA 2BTMA 4MFDA 5I24A 2BZNA 2SFPA 4EF9A 3ARQA 3WLQA 1IXOA 4AWSA 3RJXA 1A3HA 1KLZA 2I9EA 1SYTA 1J2WA 3R12A 5LA0A 2GYIA 4Y9AA 5A6BD 2VCAA 4CEXC 4QBXA 1JZ5A 4F8XA 1Q6GA 4QSFA 2I5QA 3H70A 1TTPA 1E3ZA 4AD3A 1MQRA 2GDVA 3TYZA 2YA0A 2O7QA 4OBRA 1XRTA 2YIHA 1TB3A 5E0CA 3TONA 2OZ8A 2GOKA 2P53A 4GI8A 1R46A 3FDKA 4AIOA 2J47A 3CZGA 2XGZA 1A5AA 3THDA 3QBUA 7ODCA 1RA0A 1BRLB 4X2PA 3CTLA 2WBKA 2J62A 1E6NA 5HNTA 1XLEA 1I1XA 2QCDB 2BVTA 4B5UA 3VOIA 2YA1A 3L4TA 2D0FA 3TMQA 1HGWA 1TV8A 3HM7A 3BGJA 1T8XA 1V6VA 3O6DA 1Q7QA 1LUCA 1W1ZA 1XF0A 3AIRA 2YDAA 3UR8A 4Z2IA 1I0DA 1PWMA 2A6NA 2REQB 4YVPA 4UTHA 2DT3A 3B0VC 1VIWA 4BWLA 1OF8A 2DU2A 4JTIA 2JE8A 4KERA 4N42A 1TV5A 4PTWA 1S5MA 3KBJA 4DJFA 1POKA 1HF6A 1CT5A 3I3DA 3LTPA 1WUFA 3TVAA 4RE0A 4DPQA 5LYRA 4OVXA 1SSGA 5ABHA 2DP3A 1HKWA 4YS1A 2D2JA 4ZB5A 1RJPA 3G0SA 3W83A 3STPA 3CQHA 2V69A 4DF2A 2FPYA 5IOBA 3B8WA 4JGDA 3HPAA 1JIBA 2R1KA 3EOUA 1NSJA 1PX4A 2Y24A 3UXIA 1FHDA 3FVMA 2PI6A 3GHRA 4MAZA 4CN6A 1Q5MA 4L7ZA 3T42A 2Y7EA 4PEKA 1EJ7L 1ME8A 1TZZA 1OC5A 1WBJA 3U3HA 4D8ZA 3GC2A 3MHFA 4RE3A 1OZQA 1UWIA 3N3MA 3REQA 3WNKA 4Q22A 4JIQA 3TYUA 4C7DA 1HJQA 2ATSA 3OVPA 1K4GA 2EG6A 3PS7A 4UFLA 3UCDA 2HRWA 4GZJA 4LCRA 4R3UA 1Q4NX 1MQPA 5J04A 3O15A 3HMCA 3EOOA 1GQJA 3VDGA 3VIIA 1TV7A 1DVJA 4NX0A 2ZRZA 3SQLA 2W6RA 1F6YA 3O8AA 3DCPA 2PU1A 5CC6A 1OG6A 3DU0A 3FKRA 2FVKA 1MYRA 3WEOA 2Z0IA 3MVTA 3T0BA 3W84A 5FEWA 5DXYA 3ZM8A 3ANVA 5A8MA 4NJGA 3UWZA 2A7RA 1XIHA 3TROA 1TPFA 1QBAA 3W71A 1UC4A 3LHYA 1Q7MA 2IW0A 2DIJA 4Z1CA 4FNUA 4WSHA 3V18A 1EP2A 4WD0A 4PCNA 1YNQA 2WC4A 3UWVA 5EMYA 3N9KA 3QHOA 4GYPA 4Q8MA 1UR8A 5J5DA 2XINA 1KRAC 2DGAA 3SCRA 2F6UA 3UWWA 4DAIA 3SM0A 1B1YA 2FPVA 1DYSA 4L9ZA 3GIQA 2WNNA 1J5SA 4QE1A 4WOQA 2QJJA 1M53A 1JFHA 3LI0A 2CIPA 2OSYA 3B9AA 5I79A 3GDKA 1EP3A 2PWFA 1A49A 1JUKA 4JYEA 3VKDA 4H9YA 4DO4A 2XTKA 3EWZA 4HPHA 2DZVA 2WMGA 4NYUA 3K8MA 4KWVA 3UBPC 4RL3A 2Y62A 3BQ6A 3TQ0A 2ZTKA 3S1WA 4B3LA 3DFYA 3LV5A 2FVMA 2YB4A 5CGTA 4DZAA 5I03A 1XD0A 3ZQ9A 3ANYA 5DY3A 4EANA 2VR2A 4QLJA 2IQTA 2MNRA 2OT1A 5G4EA 3SIZA 4HBKA 4EP8C 1UQZA 5F1UA 1OFQA 4FLSA 5CLTA 2I7GA 3QVQA 1M01A 3OIHA 1W9VA 1EEPA 1UW9A 4NJHA 2VDGA 5BYWA 4HHMA 2P0OA 3EOSA 4LCQA 1VCVA 1TQXA 2FTWA 3P80A 2XVGA 3VCCA 1XV8A 4DO6A 4NZ1A 4LVDA 5AOUA 4Z1DA 4MPKA 2AQOA 4ERGA 3V5FA 2VEGA 2ZRUA 4I8YA 1E9ZB 1KW1A 2D2GA 2QVHA 5AYIA 1HKKA 5FL1A 3OEXA 3T1GA 3IIOA 3GFZA 3TNBA 1K9TA 1WKEA 3PBWA 5CG0A 1VB9A 1DOSA 1T0OA 1ZJAA 4JTTA 5MKGA 4OBTA 1BF2A 3LRMA 4DXXA 1V3LA 4AW7A 4ZGYA 4UB9A 3AHZA 1OQFA 4DF0A 1LT7A 7REQA 4S3AA 3UXLA 2BASA 3GRIA 4NYYA 5LNUA 4WUIA 1XC4A 1TPB1 1R3VA 4MJ2A 4JFUA 3W28A 1GTHA 4AF0A 3T2PA 3OGSA 5XINA 2A2IA 1T5AA 3FOKA 1XUZA 4D71A 4RJEA 1EDQA 4Q8PA 3CH0A 2WANA 2CBIA 3R1ZA 4RDWA 3VIMA 4XSMA 3HPSA 2CZ5A 5D9PA 4KKXA 3MHUA 2OLAA 4JCLA 3EKGA 4RXFA 1JGIA 3C0JA 2JALA 1TV3A 2VWTA 3WLKX 2X42A 3PY2A 2ISDA 4V33A 4L6DA 3SCNA 1U5VA 4V28A 3WDRA 1J4EA 4A3QA 1UD8A 3SSZA 4HMEA 3LERA 5CPMA 4O28A 4XWUA 2QNEA 3T8QA 3W72A 1FQ0A 3VIOA 2GFTA 4XKYB 3IVSA 2I17A 2OG9A 1F73A 3P5YA 3QYQA 4UIOA 1ZBVA 4NHVA 2QT3A 3IARA 1Z69A 2G37A 5CSUA 2DZAA 1E0XA 4LNCA 1QPRA 1J0IA 3MCNA 1W6TA 2OYMA 1IWBA 2TODA 3VNIA 2J88A 3NSXA 4F2TA 4XBKA 5D05A 3P7YA 2E09A 4GUHA 4JS3A 4XZBA 4OOZA 2EPMX 3P93A 4GGBA 4B3ZA 5ABFB 1EL3A 3VZYA 1Q2RA 1OY0A 4GXMA 3XIMA 5K2ZA 1AQHA 3WNNA 4Q8QA 1U2YA 3T2QA 4R5EA 3M64A 4LRSA 1PL9A 5TNVA 1V6WA 3UZWA 1A5MC 1WV2A 3LM7A 1H1NA 3ZVHB 4GH1A 4DWSA 3DGRA 3LCLA 4IUGA 3WO8A 4FF7A 1HKMA 1VHCA 2QUVA 4LUSB 1JJKA 3BK0A 1OFEA 2P50A 1EQPA 3UCCA 3TNOA 3W38A 1Q85A 1KXQA 2V3EA 3ES7A 1JR1A 3CV2A 4R7WA 4K1GA 3QPYA 4PTXA 4KRUA 3TA6A 2C15A 3PAJA 4EVZA 1L2UA 3DBPA 4E4UA 3NVTA 4JQAA 3UGRA 3VI2A 2R1MA 2XM2A 3VPLA 3GXMA 3SB0A 2OO0A 3AXXA 1FWJC 3H23A 3JZEA 4LT9A 1PTGA 2WKLA 4AG0A 1XXXA 3S5YA 4L4LA 1O66A 1JYNA 5BXRA 3N6QA 3GTXA 1BWLA 1QNQA 3O2LA 3KVLA 3A3XA 1TUFA 1P0NA 2ZYFA 4K8GA 1UKPA 4PA8A 4YLWA 3W7JA 4PB5A 4ZCWA 2EXOA 1YPFA 3AXKA 4WXYA 4CU8A 1E4LA 4HTBA 1DJZA 4O1BA 2CBVA 2HS8A 3H12A 1UROA 1M68A 3A22A 3GM8A 3WQWA 4M80A 4QIUA 4G7EA 1TRDA 4GFSA 5GPRA 2GK1A 2O9TA 4RR4A 1FVPA 2WNWA 4RW3A 3DUGA 5HINA 5FEXA 1J01A 2B0MA 1UIOA 1UZ1A 4QGCA 4M1RA 1ZL1A 3CAVA 3ENLA 4IP5A 4DJED 4P7RA 1V51A 3QYSA 5FEPA 3BO9A 1ZP4A 3TC7A 3VOHA 3EDEA 5HXMA 4IG2A 5F1VA 4CCZA 1MW0A 1QO5A 3TYDA 4FMVA 3M46A 4ZO8A 4E4PA 3HV9A 4DRSA 1SPQA 3G77A 4H9ZA 3B04A 2CHNA 3NQFA 4B16A 5EY5A 1R47A 3FAWA 2B7NA 2XIOA 1JNDA 1L6SA 5D8ZA 5BXTA 4M8UA 3RCMA 3LCWA 2BSLA 3V75A 5A2CA 3IPWA 4AXNA 2DUXA 2ZIDA 4ZA0A 5AC5A 1BQCA 3R2GA 4QJ1A 4I9MA 2WJDA 1EIXA 3MUZ1 5EMLA 1UMLA 3NQMA 4LEQA 4BI7A 2VEKA 2VM8A 2CFFA 3CO8A 1XSKA 3UT0A 2INEA 4NAEB 1RBAA 4QCFA 3MQTA 2YCIX 3VGGA 2V5LA 4WDXA 1LCOA 9CGTA 2WYSA 3MI3A 3QTPA 3POHA 3TQKA 4DBSA 2C18A 1DWHM 2J77A 3NGFA 1D2KA 3W76A 4FNTA 2NX1A 3W7RA 1NOFA 2WLYA 1JF5A 2O9OA 3CWOX 2AMXA 3RCNA 3CGTA 1UMYA 3O7UA 1ZZMA 3T05A 1HFBA 1Z8AA 3KS6A 5C6MA 4HD5A 1Y5VA 1W1B1 4X61A 3UNTA 5BZAA 1QHZA 1V08A 3LCHA 4UFKA 4ZQOA 1W1PA 4S3KA 3M9YA 1LLOA 4XZ9A 4CNSA 1NIUA 3LD5A 1R2SA 5D2TA 3KX6A 1M5WA 2PSNA 3MDUA 4QS6A 2VUNA 4I8DA 4Q4KA 3CC1A 3CZEA 2INZA 3TYAA 3WD4A 2C8NA 5E0KA 5FI8A 1BVWA 3AI0A 3PJXA 4GMEA 3DHUA 3NZPA 3FKKA 5FF7A 2ZXQA 2QCMA 3VGBA 4PB3A 3CAKA 2YXXA 3QGVA 1B0IA 1KBKA 2ZA1A 2FDMA 1OD0A 4ZENA 2NXIA 1H7NA 3TH6A 1BG9A 3BCJA 2AAMA 2GJLA 1XIBA 1X39A 4O4WA 3ES8A 2WC7A 3OQEA 1P1XA 5IDZA 3TC6A 4CQDA 4J3SA 1UKSA 2G0WA 2QVNA 2P1FA 5EMJA 5FJJA 3WFAA 4JTLA 3QOMA 3HA1A 3DHFA 4AISA 1F74A 4S38A 4KRZA 3QV6A 3PBVA 1VFMA 1MVYA 2CXEA 4ZB2A 1UWRA 3J7HA 5LXXA 5CBJA 1AW2A 4NILA 2WZEA 1TA3B 4P8XA 4JZ5A 5ABGA 4ZTYA 3VMPA 4WY0B 2YOCA 4LAOA 2G3IA 3VC5A 3IGSA 3QFEA 5RUBA 3KRBA 5D37A 4KFPA 4D6JA 3NZQA 1H63A 2X40A 1P43A 4H6RA 4DZHA 3HFYA 1A0CA 2C6QA 2VR5A 4GIYA 3IV8A 2Y1HA 2J8FA 3HGRA 3RR1A 3H7VA 3CZ8A 1VLWA 2ODOA 4U5KA 3PJWA 2XH4A 3H2AA 2GVGA 4DYEA 1JL8A 3C2OA 3PB0A 2CXGA 3PULA 2A7NA 1H7RA 2VHLA 1KKOA 1V0LA 3NL2A 2C3ZA 2PDIA 2PLCA 4JXCA 4A8IA 2P0IA 1HL2A 3LNPA 3MB9A 3MCMA 3HQ1A 2Z29A 2GJXA 2P8CA 3TQPA 1WO2A 2G3NA 5LXEA 5D4YA 1XYAA 2DZSA 1FDJA 1PO9A 1SZRA 4ADSA 1B2YA 3KAOA 2YZRA 1JDDA 4FXRA 3S1XA 4IIBA 1XM3A 4A35A 1FFRA 3HPFA 3H4XA 4W84A 2ZXDA 1HJXA 5IFTA 4QQ3A 4TR9A 4DJFC 2EPNA 1JZ4A 3FXYA 3UWUA 3BW3A 4JTQA 2PDUA 4JDYA 1SW3A 1REQA 3WH8A 3W7GA 1P4CA 3DHDA 3APGA 2Z00A 4HA0A 4NY2A 3PTDA 4O54A 1I45A 2DIKA 3KCJA 3VE9A 4MWAA 4UTMA 3U2EA 1KQYA 2FB2A 2A3HA 2PP3A 3AHYA 4FEZA 1ONEA 3F2BA 3QPEA 4JIHA 3IAQA 2ZWZA 3YPIA 2W79A 4FP1A 3PTMA 1HL8A 1TPWA 1QOQA 4Q4OA 4ZO9A 4H7CA 2GJNA 5KMYA 2OSWA 3FS2A 3ONBA 3PNZA 2E77A 4ICNA 3NQCA 1X97A 4JX4A 3NEVA 3CHEA 4ML4A 1O4UA 3B9EA 5CPSA 3T6CA 1EGVA 4LUTB 3MJYA 1J0YA 3VX1A 1HKVA 3PTKA 2QDHA 1TJPA 3W7CA 1E1CB 2OWWA 5HQMA 1EXBA 4UTFA 2QXWA 4PL1A 5LIXX 4DI8A 1EC8A 5CEWA 3TR2A 3JRKA 2WPGA 1KWGA 3E0WA 4L4PA 4EWND 4JCMA 4R7OA 1O5RA 1FWFC 3LBMA 1P1MA 3DYPA 1PYFA 4AD1A 1PKMA 4KWOA 1EA9C 3EDDA 1XFBA 2WHMA 4LF2A 4F4RA 2NZLA 3HGJA 1B3OA 1P6CA 1RV8A 1B54A 3G0UA 3L4WA 4UTTA 1A47A 1OIFA 1OCBA 3NZRA 4U3AA 1WX0A 1JVNA 4GYPC 1H2JA 1EC7A 3WCZA 5E09A 4TX8A 2WB5A 3OLEA 4O1FA 4MVAA 3TIMA 4JTUA 1JCMP 4TV5A 3FHAA 4FR1A 1JZ7A 4PH6A 4P8WA 3Q58A 3KOYA 4DO7A 2XIBA 6TIMA 3ABRA 4N6EA 3T78A 1Q4WA 3GE7A 1KFLA 4D2JA 3FYYA 4H6QA 3S5SA 3P8IA 4PBFA 2HQAA 4HYWA 1F9CA 3P0XA 5EMMA 1PTAA 2FGLA 4AZCB 3NVDA 4O53A 1R7OA 4EPDC 2ZXBA 3W7IA 1MXGA 3WENA 1TMHA 1K6AA 4DEFA 1A5LC 2JEPA 4C6DA 4XIMA 4MNJA 2XWEA 4IGMA 2NQHA 2A3CA 3CIXA 4PFHA 3ZJ8A 4O57A 1FH8A 3I65A 3EDJA 4MJZA 2CLIA 1F3TA 4UQDA 2DV0A 1TYGA 3BH4A 4YCOA 3ITTA 1UJPA 3EWCA 3Q4DA 5HMDA 1OFPA 3KWSA 1DQXA 2V5JA 1J8VA 1OWQA 2W9MA 1YDVA 3E02A 3GTHA 1AG1O 2MANA 1CX9A 1EXPA 3L0KA 3OPSA 4JTHA 1X8FA 2P3EA 3KXQA 3RM8A 4LV9A 1CB7B 3G1FA 4BF5A 1I2NA 2AQVA 3JR2A 3TOYA 4MWAE 3MA8A 4PE8A 3CHCA 4Y9PA 2BGNE 3WJZA 2BGQA 2XSXA 2Y63A 4X9SA 4NXSA 1Q8AA 1ZLPA 2VFDA 1RLCL 3APYA 4ACZB 2NW0A 3PANA 5BWAA 4A2RA 4KESA 3HG2A 1E6XM 4LTSA 2PLKA 1VYSX 4UQEA 2YR1A 2QPXA 4RUBA 2O92A 3IWPA 4GQBA 3K4DA 2PU0A 5EGRA 4CEUC 4QNWA 1DXFA 4AZ7A 2QGYA 1WZMA 3B8VA 2XH7A 4JIEA 1G94A 1L8PA 2BDQA 3EPOA 2XGIA 1JD7A 3R8GA 3W7QA 1MXSA 2X09A 1TELA 3BSMA 4JTFA 2OU4A 1DJYA 4N9DA 3RLHA 1JPDX 2IS7A 4WF7A 4GX8A 2FTPA 1YHTA 1XLCA 3LQLA 1QNVA 2V6AA 2OKOA 4GPNA 4KETA 3AUJA 2RKXA 4GY0A 3EX3A 1V93A 4LSBA 4IIFA 2G4FA 4NZ5A 1W2PA 2Y8UA 4ZL1A 4R9XA 1W8GA 3NA8A 1VLIA 4MLRA 4BJHA 4GC3A 3BLPX 5KTLA 4US5A 1BHGA 2X0YA 1XYLA 2DH2A 1YXYA 2H8ZA 3MTWA 3TUUA 3CT2A 3WQCA 3BAWA 2WC3A 1GVIA 5HMEA 4TVUA 3ISIX 4IMFA 4HNVA 5I02A 4XAGA 2PRMA 4JICA 1VFHA 2DZUA 1HL9A 1GOIA 3FA5A 4HA1A 1IWPA 3WBWA 3GNPA 9XIMA 2V3DA 1G0CA 1X7FA 5C9UA 2ZOXA 3U7BA 1H1ZA 4D8LA 1JAKA 1U1JA 3WQ5A 2CU0A 4L5ZA 3LYEA 4Z1AA 4LAUA 5HJLA 1MUCA 5E5CA 4GO9A 3TA9A 2F6KA 1N7KA 4L56A 5AKQA 3GZAA 3N2TA 3EXTA 2RUSA 4CCCA 1E40A 4MNMA 1R3RA 4DVOA 2A3BA 3IVUA 1RAKA 3KBSA 2IQ0A 4GA8A 3L4ZA 1K8XA 1J11A 1N8FA 2FLIA 4IPPA 4MY9A 3E6EA 3T44A 2WWDA 3CIVA 1AK5A 1KM5A 3QFWA 1QDSA 4ZB0A 2GOUA 2QJHA 4YNGA 1KR1A 1IGWA 5CPTA 3E38A 4CNPA 3G6MA 4HOWA 4BEQA 4CQCA 4L9XA 4ZR8A 1GK8A 4JFTA 3ZMRA 2JF6A 2QUUA 4OBSA 1KRBC 5BOOA 2ABBA 4MHBA 2ZWYA 3CYJA 4WGXA 4DZIA 2OKTA 1MUMA 4UOJA 4AEEA 1FP8A 1MNSA 1W9BM 4S3CA 1UG6A 3NQ8A 1T96A 4E6MA 4JTRA 1LQ2A 5BOEA 6CGTA 4P8UA 4JFVA 3OHIA 1JPIA 3QRHA 1QW9A 2Y5SA 2ZUWA 3W1UA 2J6XA 6ALDA 4N7QA 1DHPA 3SJ3A 2WW5A 1J96A 2D3NA 5L6UA 2O55A 1WKFA 5C9WA 2JK2A 1SMDA 3SCSA 1XRVA 2NV2A 3IJ6A 4NASA 1XINA 5LNSA 3VNLA 3FDGA 3N34A 3WLPA 2GJRA 4GXPA 1ICPA 2RDTA 4OT7A 2FHCA 1YX1A 2C71A 3L23A 2CKSA 1RXOB 1I2RA 3U5UA 3TJLA 3AIWA 2IUZA 3FEQA 1PE1A 3MI2A 3WELA 1UBPC 1X38A 3TFXA 1QPQA 2H3DA 2W4XA 1E15A 1V6TA 3NZ1A 3GAKA 2TMDA 3EAUA 1YNYA 4QG8A 1EJSC 1LBFA 2W61A 5BXPA 3G3MA 5EBUA 1VHNA 2HNEA 2QMJA 2WJEA 1B3YA 3AYVA 3WLRA 1FKWA 3DX5A 3LRKA 4I6VA 4J2MA 4PMOA 4TQTA 1U1UA 4WRHA 3E0VA 3I10A 5DBUA 5REQA 3SCPA 4WX2A 1GW1A 3BURA 4LUJA 4DYKA 1V3MA 3ZJ7A 1CGXA 4KQNA 3FV9A 1HJUA 2BMBA 1LBMA 1OFRA 3PR2A 4UTWC 3QZ6A 4IUOA 4PN2A 4OV9A 5ENLA 4JHMA 1H1YA 1AH3A 1VP5A 4TUFA 5BNKA 3EPNA 5FOOA 1AZ2A 4FNRA 3QY6A 1EDTA 4HHHA 1HKIA 3SGZA 1E0UA 2JGYA 2P88A 3LBOA 3UESA 1M7XA 1XL9A 3F1QA 3N25A 5DMMA 3RM9A 4QRNA 1BXNA 4RW5A 4KEVA 1TWDA 3WD1A 3K4AA 5G2IA 1A0DA 1JPKA 3MO7A 3NQEA 4CU6A 2J7GA 3F4VA 1H3GA 1KXTA 4H41A 2ZVIA 1BG4A 1NDYA 3VFLA 4JTSA 2NQLA 1JI1A 4LEFA 6REQB 4MAVA 4WJ8A 1O60A 5BXSA 1NWTA 1TV4A 3EDKA 4LVBA 2CETA 3QV7A 3VUSA 2PDXA 2PODA 5M17A 2FZ8A 4DY1A 1BYDA 1SSDA 1YXDA 2Z7KA 3W74A 2OR2A 3TWBA 4NUWA 2Q8XA 3E96A 4I5XA 1VIZA 2Z25A 1F3EA 2I5IA 1XIMA 2FMNA 4LJ3A 4HTYA 1V3HA 2PLJA 5XIMA 1WOBA 1YBQA 3RF9A 3F4CA 3BWWA 1GQIA 3VZZA 5JBFA 3MMUA 1KBIA 5FD0A 1VPQA 3GS6A 4XKMA 1Z3NA 3ITCA 2WNZA 4O18A 2HMCA 2GGJA 3R8HA 3EA1A 1EZWA 5GJPA 4YL2A 1GKRA 3V0SA 1FCVA 3I4KA 2PDGA 1W37A 3BTNA 4B15A 4AFYA 5HPOA 4S39A 4JQ2A 1HXJA 1AJ0A 4XO6A 4AD5A 3QZEA 3RLGA 1WP6A 4GABA 3CT7A 5DO8A 3QY7A 1KC7A 3GXNA 4N2YA 3A3HA 3RRXA 3C8NA 4QNEA 1LF1A 3OVGA 3PG8A 2G8ZA 1IV8A 3WF2A 2E6YA 3GG8A 3KS5A 4OWGA 3WNPA 3DDMA 5HDRA 5K9XA 1I2QA 1SJCA 5H1WA 1Q6RA 2V81A 2DORA 1IT7A 2FB3A 2BX7A 4EAYA 3AMKA 4CUCA 2XIQA 3L2LA 3PWIA 3G24A 3UJSA 4NNCA 3CPUA 1YXCA 4DZ5A 4RNJA 3EA2A 3DIPA 1BGAA 4H01A 2V5DA 3EMCA 3WFZA 4AUBA 3C2VA 1CW2A 2OEJA 3ECQA 2D20A 5A6BA 4K3ZA 1M65A 2HVOA 3HPZA 3E5BA 1OX6A 1UKQA 5HNRA 3WIJA 3MUAA 2DZWA 5D9OA 2WV8A 2GWGA 4JD4A 4X0NA 1G1YA 4JNMA 3FXGA 4CU7A 1R9ZA 4A2SA 1JUEA 7CGTA 3KLLA 2YSWA 4DB7A 3AIQA 1PV8A 3MV01 1QHOA 1DE5A 2DZXA 4GI4A 4L65A 1EX5A 3OTRA 5CZSA 5GNXA 2HPIA 4AEFA 2BS9A 3HGSA 1KRCC 2D0HA 2TSYA 1XGDA 4V2XA 1W1YA 1TJ0A 3V16A 3PNUA 2ALDA 2DSKA 1HTIA 4JKKA 3PPGA 2H9AA 4E2DA 2ZE0A 5AHEA 1VFLA 1VRXA 2Y2WA 5LGZA 3SECA 4JQ4A 1S46A 4OU1A 1RQHA 3SADA 2V67A 1TPEA 2I1OA 2JBMA 1Y65A 4W93A 5JXQA 4HSNA 2G5WA 1ENUA 2DT2A 2V2CA 1P7TB 4C1LA 3WK1A 3SEPA 1UH2A 1CXIA 3UPMA 3VGDA 2QPSA 2OT0A 3TV8A 1JULA 2WK2A 3KL5A 1M03A 1XIIA 2AGTA 2VD9A 2OELA 1QI3A 1XBZA 5CPOA 2EPKX 1W5MA 1JZ3A 1PBGA 4XZIA 1ONRA 1Z7AA 1R3WA 4HJWA 5D30A 3ZJKA 3R5EA 1PS9A 3THQA 4LU0A 1FWHC 1EB3A 4YHGA 2FZ9A 4S3JA 4AZHA 3S1UA 1R85A 3UYIA 2XZ9A 1SZGA 3L66A 5BWFA 1CXFA 1WAUA 1GJWA 4UFHA 2IPJA 3DZ1A 1ECEA 1L8NA 3ALGA 4AHPA 3B0XA 3H2MA 3VOGA 5F2IA 4HHPA 3L2MA 3S2JA 1JZ6A 2RJGA 2FZBA 1MEHA 1OADA 4IL2A 2PP1A 4QJ3B 5FJRA 4UNKA 1KO0A 1QW8A 5XIAA 1RA5A 1FHLA 4Y8FA 1JDFA 1IEWA 3UPWA 3VD3A 2JKAA 3QMRA 1XKYA 4XIAA 2XYLA 2PPGA 1FCBA 4E0CA 3M7SA 4S2BA 1R5YA 4U31A 3HGOA 3P60A 4TMCA 4YYFA 1BEUA 4JAWA 4AAJA 3KZPA 3HQPA 4R33A 5SWUA 2Q8ZA 2YCKX 2PDHA 2D24A 4PCFA 5I77A 5LKYA 5CJ5A 2VXNA 3U48A 2PTDA 1FP9A 5ECUA 2CWNA 2X0HA 3DECA 1S2WA 1AUSL 2E5CA 1GUVA 4JEJA 2GGGA 3PHAA 4H8VA 4GBDA 3RAOA 2BLEA 2Z1WA 3LY0A 1E9IA 2ZZ7A 1DWJM 3CAQA 3ZXWA 4NAFA 3E74A 4IH3A 2W67A 1HVXA 3AXMA 4XZMX 4N9CA 1ZBWA 5BW6A 3QSRA 3EWDA 3L0NA 4O1DA 3FJ4A 5G4WA 3H2OA 1F4AA 3NR0A 3KOXA 4J3VA 2D73A 2WKJA 3AYRA 1E6PA 3K8KA 4NF7A 1K6WA 2VFEA 3C5QA 1EO5A 1LLWA 3DC8A 1FH9A 1S5TA 4PUWA 1FWDC 3M0KA 3W01A 4B92A 1NU5A 1PHQA 1XDMA 3CUXA 4YWIA 3T2OA 3WBYA 1CNVA 5J5RA 2V63A 1G9HA 5H6HA 4R27A 5DEZA 1E4MM 4GNJA 4PCPA 4PMQA 3S5NA 4F9DA 1X96A 3M47A 3N19B 4XVDA 1QNOA 4A3RA 1NDWA 3CPRA 3G0XA 4RNIA 5M2FX 3ARTA 4HT3A 1AQFA 1KFJA 2BVWA 5LNRA 3BAIA 1PWLA 1C3FA 1VEOA 5I7GA 1I1WA 3WY1A 4WLCA 4FNSA 1MW3A 4LY4A 1JZ8A 1BRLA 1GVYA 5HUPA 2J24A 4KCUA 4FK9A 1VH7A 4FZIA 1TWIA 4E5TA 1IEXA 2QCDA 5L9FA 4J1OA 2WNQA 3GG0A 4ZBCA 4AHQA 1IF2A 5FCZA 1QI0A 4KPLA 3SR7A 4PTMA 2WJZA 1EYWA 2XVPA 3WQVA 4LBUA 4MUPA 5EBAA 3PP7A 1CENA 2REQA 2J7EA 1TIWA 1VENA 3HB9A 1DJHA 3PUGA 3EB3A 1OEPA 3GX9A 3ZWSA 2FH6A 3LHZA 3NPUA 1HP5A 4DM2A 4PMNA 1PZ3A 3KOWA 3WZ0E 4MZYA 4UZUA 5BU6A 4XTDA 6XIMA 2I5GA 4H3DA 3A4JA 1JXJA 1FCQA 2PEVA 3KDOA 1IIGA 3WH7A 3HN3A 1UBSA 3QQWA 2HNHA 2A7PA 2AKZA 3C2FA 5DQPA 3C0LA 1SU5A 3D47A 4OE7A 1FWEC 1MFVA 1VC4A 2QIWA 3BLEA 3CZJA 3PWGA 4MADA 3UXAA 3EKLA 4IOTA 3PTQA 4JIIX 1TIMA 3KBVA 3GVGA 1E71M 4HZ7A 1TV2A 5D02A 4HZMA 4KCVA 1E73M 2YA2A 4GISA 4IMAA 3O9NA 3KM8A 4DJDD 5FJOA 1TRIA 1XCXA 1BYCA 2AL1A 4AD2A 1K70A 3GNDA 4AYGA 3MI6A 1XISA 1BD0A 2ZICA 2PD9A 2PCQA 3ZIZA 2C16A 1LWIA 1V7YA 1RJQA 5A6MA 1OB0A 3W00A 1A4LA 2Y88A 3ME3A 1S39A 4XAFA 3C2RA 4IMGA 4PTDA 5CC5A 1P0KA 1RPKA 1S1PA 4F0MA 1OBAA 3AQUA 1H51A 1KGUA 1ZHAA 5D09A 1QPNA 3IEBA 2HBXA 3LZ3A 4DHGA 3UYCA 2DVXA 2J9XA 1QATA 1WKYA 1K9FA 1DTNA 3KL0A 1W1VA 1QWKA 4ZVJA 5MKGB 3VDBA 1RJRA 3CNYA 1EOKA 1ZJIA 1KBBA 3TN3A 4M6VA 4LYRA 4LB4A 3MT1A 3CUIA 1HZYA 2ZQ0A 1V6UA 2PDPA 1FOBA 3VOFA 4GINA 1W3HA 2CPUA 2DIEA 3SUSA 1DP0A 1UR1A 1Q2SA 2IKIA 1OFBA 4YCPA 4IQEA 4YIWA 2WAGA 1WKDA 2WMHA 4AF0B 1E0WA 3FSUA 1G4EA 4DIAA 4B2DD 3V0UA 5CCZA 5U7SA 3B8TA 3EMQA 2XN0A 3RPMA 1E1EA 3QW3A 1BVNP 5A2AA 3O05A 2J79A 4OJYA 3A23A 1VBGA 4O0KA 4J3UA 4W8BA 4J28A 4QISA 3W7LA 3BAYA 1F05A 1TFVA 3UA4A 3SAZA 3NO5A 4C6FA 5MHBA 4QDPA 4UMBA 4EXAA 4C91A 5LIWX 5A8GA 3BAXA 1MWOA 4WIWA 3F4WA 1X8CA 4NZ3A 1I75A 3EX2A 2X41A 1H61A 3QXBA 1YQ2A 3W2MA 2WCAA 2G3JA 2PCEA 4BQ2A 4W8AA 4F40A 3AYSA 4NNBA 5KZEA 1ZAJA 3EWWA 4FOJA 2QUTA 1GEQA 2RH9A 1J79A 1TX0A 3WLTA 2W63A 5C2XA 2EG7A 3M5YA 1UR9A 1AJ2A 1H5YA 3R0KA 4QLKA 1CXLA 2E40A 2DY3A 1OCNA 3K1GA 4RDZA 4XD3A 2VOMA 1P0EA 4DBEA 4Q33A 2YW4A 1HJWA 2X05A 3CL8A 3USBA 3QM3A 3AIBA 4G5DA 5I3GA 3WK2A 3AUOA 3Q2DA 3LXBA 1IXQA 2CZFA 2VFIA 4YWSA 3CIWA 3NM3A 2TYSA 1NDVA 3AU6A 1UR3M 1BFNA 4DJEA 2QQ6A 2V2HA 2ZRYA 4GJJA 4EOUA 3O07A 4XZWA 1VQTA 4M81A 2BOFX 2VGBA 2QV5A 5FSDC 4JQ3A 2QF7A 3BSGA 2A4AA 1J0ZA 1TX2A 1G7UA 4MFEA 1G69A 1DIOA 4ECLA 1GOWA 3MMDA 4FXSA 3THAA 5C9XA 3F03K 5D03A 2UWFA 3H8AA 3GYCA 3CTTA 2AMGA 1H0GA 1ZCCA 2P10A 5A94A 1NVMA 1P48A 4CQBA 4W86A 3HTWA 5JH1A 4JTGA 2IXUA 2NVDA 1KCZA 1YTEA 3UZJA 3B8DA 3R7MA 3TZFA 3ZR6A 5ABEA 1JYXA 2XIMA 2E8YA 3WBAA 3P81A 1C8QA 1VR6A 3NOEA 2CLHA 3PBYA 3MP5A 2PGEA 2PRLA 3PJTA 1K8CA 2ABAA 3URNA 4LUYA 4WSJA 3HG3A 1ICQA 1HUVA 1QASA 3CQIA 3KCOA 4GRSA 1TE6A 3NEHA 3JU2A 5AZ1A 1T8QA 2O9PA 3CHVA 3UVAA 2OVLA 2ALRA 2QR6A 5DF0A 3NO1A 3RK8A 1OINA 4H00A 4DXVA 2UY2A 2D22A 2VWSA 2VFHA 2ESCA 4HVXA 4G7EB 3RDKA 1AZ1A 3Q37A 3RCYA 4XKYA 2GK1B 1VJZA 1QNSA 1PIGA 4C5ZA 6TAAA 4M7TA 1RCXB 1OFOA 3RYSA 3P8JA 4JBRA 4AEOA 3DC0A 4IJBA 1VBJA 1KM1A 2QCEA 5I3JA 3IGUA 3KUMA 3RILA 3N9RA 3L5AA 2XHYA 2HSAA 4IG2B 3T09A 2BB0A 2X7WA 3Q67A 5HULA 4F66A 1OYBA 4GVFA 3SRFA 5DY2A 1M7OA 3C6CA 1E3XA 1DV7A 2VZSA 1BGGA 2RAGA 1VFUA 4G56A 3VUPA 2WVUA 1KLYA 1VCGA 4PMRA 3RR4A 1K8ZA 1XLIA 5AYXA 3A4AA 3DFPA 3VM5A 1Z42A 1SGJA 2BHZA 3QW4B 3TOPA 2NQZA 5DFAA 1HP4A 4LUSA 4Q4SA 3A3WA 1QNRA 3BAJA 1MXDA 5JVLA 1H41A 2AGKA 4M5PA 4MIMA 5DT5A 1N2VA 4BI5A 4GVIA 3UR2A 3GLCA 2XGBA 3KBWA 5EYWA 3IUIA 3QF0A 4W8LA 5CJMA 3E2RA 1EJRC 4PMDA 3W88A 5F2LA 1R8LA 4A8RA 5DRIA 1ITXA 4TU1A 3RNDA 3SGGA 4M6QA 2ZUSA 3UG8A 1E6RA 4E3VA 1VJSA 1KQZA 4HA4A 3WQOA 2UY4A 4WEVX 2WCSA 3NDYA 4B5TA 1DEDA 3R25A 3RUBL 4H7VA 1K1DA 4W7VA 5JQ9A 1W3NA 4GX9A 1JFXA 2DPEA 3K13A 4KGJA 3POCA 3MUCA 4JL1A 4WHBA 3WF0A 4MZ1A 1Z32X 4P7LA 3VZXA 3PZIA 4JTEA 3MYPA 3NUKA 2Z1BA 4C65A 4Z0SA 1AH0A 1BXCA 3VX0A 2PTYA 1HKJA 1SZEA 3TYBA 1N55A 1QXLA 4KWSA 1XLGA 4PGLA 1CI1A 2DUZA 3NQ6A 5FJTA 5A6KA 3G1YA 4GLEA 5AN7A 5I5RA 1SM9A 3L2IA 2HXUA 4LYQA 2BOGX 3FNDA 3W1LA 4YHEA 1X1ZA 1AFSA 2HK1A 3KTCA 3L0GA 4F0KA 2J25A 4ACYA 4C6NA 4E8GA 4QE4A 3IGHX 3MZ2A 3OVRA 4S23A 3T07A 5D32A 3EOLA 4P61A 3W9ZA 1UOKA 4ZXLA 4QAIA 1HVQA 3DFNA 3P61A 3I6TA 1QMLA 4H9MA 4PUDA 3KHJA 1E43A 4FLRA 5CZTA 1R9YA 4MKSA 2ACRA 3W2NA 4WKHA 1B31A 3KP0A 1FWAC 4OKDA 3UXDA 4HZ6A 3B8UA 4IGNA 3USZA 5EL1A 4ATDA 3F5LA 2OPJA 1UH4A 4PODA 1WB0A 2YFNA 3IJ7A 1DIDA 1NH6A 3OA5A 1EUNA 2CHOA 4AD4A 4GYFA 1SR9A 4Y2WA 3VNMA 2EO7A 5J8LA 2JQXA 4DF1A 1SFJA 3QKZA 3CB3A 1XGZA 1OCQA 4MB3A 4C7GA 3ZO9A 4DYJA 2XH2A 3CUFA 3U2OA 3LU2A 5FEZA 2ZTJA 2OCZA 1ADDA 4NNAA 2W3ZA 2B4GA 3B06A 2WQDA 1XUUA 1R6WA 1ZQ5A 3G8EA 1TCDA 2YYUA 1XR2A 4C60A 4KW2A 3CL6A 2OOGA 2GQ9A 4B3KA 3IJ9A 4NX5A 1PCKA 4KEZA 5LIUX 3CHDA 4QG9A 3EX6A 3QMTA 5FSEC 3ARXA 1QPKA 2H90A 5T8GA 5F4SA 1XCFA 3CUZA 2ZC1A 2WMKA 1H0IA 4H1ZA 3NURA 1GPWA 1LOLA 2OZ0A 1DJWA 3F7JA 4FR6A 1JGMA 2A0NA 4RE2A 1M6JA 1A5BA 2NSXA 3ORWA 5EMKA 4R9OA 3RPTA 4ADUA 2Z6IA 2H6RA 2XDFA 1GZ1A 5KZMA 1REQB 2OGYA 2XZ7A 2P8BA 3EX4A 4Q4PA 3STCA 4US6A 3M0YA 3LPOA 4D6FA 1W9XA 4A3HA 2IMRA 1KXVA 3P3BA 2ZX7A 4DUWA 2QPUA 3BG9A 2YX0A 3H54A 1R0MA 3UWEA 3UETA 4CVWA 4YN5A 2EQDA 2WVVB 2F9RA 4QR6A 1DL3A 4FX6M 1EF2A 3EB2A 4Q8UA 1EBHA 3ZOAA 1XLLA 4QFUA 4Y90A 3EPMA 5C55A 1GYLA 1LWJA 1YDNA 1TPVA 3BW2A 1C93A 3G3DA 1HN1A 3UNDA 3MWCA 1C7SA 2QMKA 1VJIA 1ZAHA 1IEQA 4EPKA 2PDYA 4HN8A 1UCWA 2ACSA 4KBXA 3S9IA 3QGAC 2R1LA 1XIJA 1TA3A 2E9MA 3B9OA 1VKFA 1FWWA 4ZMGA 5LGXA 3PZ9A 2GSJA 1A5UA 3OW1A 1UYQA 3GBDA 3CV7A 3BUVA 3NM1A 2PTWA 3FA4A 1KFBA 3KOFA 1V3JA 4V1XA 2JIEA 3MSRA 4G8TA 3LN3A 4CD4A 4O4VA 1IZKA 2RJHA 1EDGA 5LSMA 5DN1A 3S47A 5AY7A 1UJQA 4H4IA 2HWGA 4B5XA 4OHQA 3NXLA 5DX7A 4UZSA 3VDCA 4JIPA 4OGZA 1IT8A 2DVTA 4BI6A 3OLIA 1TSIA 3VIFA 4MM1A 4QCEA 2BOEX 4Z1YA 3TCEA 1UWAA 3GU9A 1YMYA 3UJEA 4P7OA 1SFTA 3IV3A 1TMLA 3TQVA 4XD4A 4M51A 3N11A 3M0IA 3GK0A 4MYAA 4X60A 1CECA 3IK4A 2ZX5A 5HWNA 1TZ7A 3M7WA 4UNIA 3BV7A 2GVYA 1XRSA 1M1BA 1U30A 4LH8A 2E3ZA 1RD6A 3M41A 3MDWA 1H49A 4JX5A 1MZRA 3L21A 1OFAA 4RXGA 4EWJA 1L0PA 1WCGA 1C92A 4BR1A 3M0JA 3KZSA 3AHTA 3IACA 4V27A 3WDJA 5CBIA 2Z1XA 4DLMA 1CGTA 2CC0A 3S5OA 3T0AA 4OUEA 3GR4A 3U9IA 4PMJA 1ZSXA 3B4UA 4O1EA 2OB3A 4YYCA 3WQDA 1WA3A 5CG7A 3SUTA 1C7TA 3W25A 2WCGA 3OVQA 3GDBA 5F4XA 3P84A 1AMYA 3VK5A 1RQEA 2PWVA 3ZS4A 2TPSA 3LG3A 1R7AA 4HMNA 3PK7A 3W82A 2UY5A 3V1HA 2ISVA 4JN8A 3QMSA 1F6PA 3A9BA 4TVCA 2GSHA 1FY6A 2VQTA 4JTCA 4GFIA 3JVAA 1FHVA 3R11A 1RH9A 4J5NA 2BXZA 4BHYA 5I23A 2HS6A 4DUVA 5LA1A 2QDDA 4XK2A 4LUTA 3M1ZA 5A6TC 3L5LA 3N17A 2YBTA 1A5NC 1N8WA 1OF6A 1Z9AA 4ORIA 1GYMA 2D23A 3BOFA 3EBVA 1GNXA 5BCAA 1H60A 3AOFA 1G67A 1W5OA 2ZVRA 3NQ2A 2OLSA 2QYGA 4UFJA 2E5DA 4DX3A 5T9CE 2ZUNA 5AC7A 1S2UA 3KVJA 2J8TA 4XO7A 1ESWA 3IAPA 3O3RA 5BRQA 4BA0A 1GYNA 3HOJA 4RNFA 2QUNA 5D2VA 3CM4A 4H8HA 1PVNA 4FAMA 1XYBA 1J93A 4RV3A 2PBGA 5BRBA 1F07A 3FSTA 4REQA 4PYSA 4XV0A 4ATLA 4F2BA 1GHSA 5CBBA 1C8XA 4Q6XA 3LDVA 3R8RA 1CYGA 4PCSA 4UQ9A 1UPMB 3AMGA 3GH4A 2Y70A 3GH5A 3S6DA 3TSBA 5M3WA 3S42A 4IJRA 4NP7A 3ZLHA 3T0DA 1B9ZA 1RQBA 2BODX 3OBAA 1W3IA 2OTDA 4N02A 3LHTA 4LAZA 1B30A 3VIGA 1VS1A 1J6OA 1TVPA 4GYJA 3NSNA 4FS9A 4AZIA 4GVHA 2YYTA 1XFCA 1D8WA 4J3WA 4O12A 4QE5A 1ITQA 4GCXA 4TV6A 2IXVA 3AIVA 4XVEA 1A53A 4O17A 4DWDA 1TWWA 1XQKA 5HWJA 3BJSA 3LZ5A 1XQLA 5FJIA 3OG2A 1FUYA 4K2SA 3LXCA 4RDVA 1FWRA 3M4HA 3PC0A 1EPVA 2Y7GA 3TTOA 2YDSA 5GNYA 3R4IA 2W27A 3GFXA 3N15A 5LA2A 4ZSUA 1NM9A 1JRBA 4GVGA 2A85A 1FWNA 2E6DA 3W1MA 1GW9A 1SR0A 3AHXA 2HROA 1XBVA 1E4NA 3TC3A 4Q7BA 4GQGA 2VDHA 4MGGA 3L4UA 3DGBA 3MSDA 3ARWA 4L61A 4XBJA 3V5CA 1JG9A 5C7VA 3CU2A 1J9YA 3NDZA 3D5HA 2HZGA 2Z24A 3VGEA 4JPGA 2A3AA 2OEKA 2ZZ1A 3O16A 3VA8A 4AD0A 3AXIA 3VOCA 1BWVA 5AVNA 3FAXA 4MZ8A 5BOFA 4DJEC 1EJTC 1Z89A 2BXYA 4XG1A 4F0HA 1G4PA 1X1OA 2OYKA 1MDRA 3TTEA 2VRJA 3INPA 3NNTA 4QS5A 3KDNA 4J3TA 4D6EA 3TU9A 3BPWA 3GXPA 5EA9A 1XYZA 3VNYA 4JEQA 1NEYA 5LIYX 1W9PA 4MYXA 1WDRA 1AMKA 1UPPA 1XIDA 5KETA 4EPBC 2C79A 1AL8A 1IZCA 2Z6JA 1QTWA 4PMXA 3SN0A 3C52A 3ZWTA 2IKJA 1J2BA 1THFD 2OZTA 2PGRA 4AY1A 4TIMA 1LDCA 1GKPA 2YDQA 3MKVA 1GCYA 4ICCX 3ANUA 1OHLA 3VD5A 4Z2KA 3HJEA 5HNNA 3CL7A 3T55A 4K39A 2AKMA 1CGWA 1S3TC 5HNUA 3F5KA 2E28A 4S3DA 3FGCA 1YE6A 4PSPA 3M5XA 2O0TA 2EPLX 4BQ5A 1UP2A 1ZALA 4GZEA 3SZ8A 3B9DA 5KZDA 5HR7A 1M04A 4M0XA 3H21A 3DESA 2NWRA 1YPIA 2CLKA 1ZU8A 5CKSA 1S2TA 2FYMA 3PPCA 2VEPA 4XBSA 3LEPA 2KX9A 3EYPA 3WL1A 1KXHA 3OGRA 5LHFA 1Y5WA 1W9DM 4JOMA 4GBUA 3KBMA 3LCFA 1VBRA 5FF3A 1LORA 1RK5A 1GQLA 4JFWA 1X98A 4F0RA 4MG4A 5I2UA 1FDZA 2WO5A 3M5ZA 3QR1A 3CQ0A 3STEA 4EXQA 3UERA 4HN4A 3OZMA 4Q8WA 1WPCA 2QJMA 3MMTA 4P5UA 4O19A 2YCJA 3OZYA 3AICA 3FHQA 4UUIA 4C6JA 4PEEA 1G4TA 1V79A 4HZ8A 1A80A 3ITVA 4ERIA 3KE0A 3NQGA 5AHLA 4C1KA 3SY1A 1VBHA 5C5YA 1UH3A 2G4JA 1W5PA 1KGXA 3LPFA 1Q6LA 3DERA 3SURA 3N4FA 3TYCA 3U7VA 2DQXA 4OIFA 3LLDA 5D2WA 1OABA 1TTQA 4RNHA 4P7NA 1XKJA 3CQKA 3ZT7A 3M0LA 1R86A 2D0GA 5K9DA 1KFKA 3TP4A 3A4WA 1ML1A 3QGKC 1QAPA 3B03A 2PE4A 1GEHA 1ZJBA 5PTDA 4Q7NA 4F79A 2UZ9A 4WOZA 2HPMA 5M03A 2J9YA 3SUUA 2J4GA 1IEIA 4XTIA 3AAMA 2VNCA 4D1JA 3P67A 3MPGA 4YVVA 3S2CA 5HANA 4N0RA 3L4VA 5AECA 4GCAA 3EXSA 1IIHA 1C8VA 5T26A 4HNTA 1U1HA 1TWZA 3NG3A 4TTUA 2W62A 5G1TA 3E0IA 1XLJA 4FHAA 2VQUA 1AQ0A 3CASA 2QCLA 2NVCA 2XVLA 4NZJA 2WZHA 5A6SA 1YDYA 2QEZA 1H7PA 4O1CA 2Q8LA 3HURA 4GACA 1MSSA 4RDYA 2VKZG 1WYIA 4UR9A 4XZHA 3H26A 5G1YA 3U4AA 2ZC8A 4XD6A 1UZDA 3WMLA 4Y7EA 1VAHA 1RLDA 3W2KA 4XZLX 4H83A 4HYRA 2GZXA 2J78A 3LXAA 1DJGA 2A6LA 4UMAA 3NXFA 1NAL1 4AVNA 4H2CA 1YBQB 4DAFA 1KNWA 3GB6A 2EJ1A 3QHNA 3MBFA 2ZUMA 2VYOA 4LNYA 2JFEX 4K37A 4UQAA 3RG6A 3CZLA 1EIBA 2YCLB 3GFYA 1K8YA 4B4FA 4U2YA 3LOTA 1P6BA 3GNRA 1V6YA 3R0DA 1OK6A 4Y9MA 5HA7A 1H50A 3W70A 3TLLA 4NXKA 1S5WA 1WQ5A 4J40A 3WSUA 3RO8A 3A64A 4PL2A 4MJMA 2ZDSA 4K7YA 4MB4A 3LMZA 5EFFA 1LBLA 1ODUA 1XP3A 1YRRA 1UP0A 4O11A 3A12A 3GVRA 5A69A 1XIGA 2G95A 2VELA 1W91A 4C6CA 3URAA 1XRFA 4LF1A 1RSCA 1PKNA 2VI0A 3KCLA 3BSHA 3A6OA 3NIYA 3GG7A 2FGZA 2WMIA 3M6YA 3ERPA 4ES4A 3PUDA 4V15A 4Y6GA 2V30A 4H9VA 4PRRA 3OBKA 3BCFA 3URQA 4F0SA 1E0VA 2PRHA 8CGTA 3B40A 2FHBA 1LL4A 1W3TA 2EEXA 3SUWA 3HG5A 2DT0A 2PDQA 1XG3A 3FA3A 3MHGA 2P5NA 3EX1A 1MZHA 4FI4A 1DXEA 1WXZA 2Z1VA 4DPPA 1RALA 3VKJA 5I3IA 4FOKA 1KTBA 5CQ1A 4I7VA 1Q6QA 1TQJA 2FHFA 3NQVA 4GIRA 2XFFA 5FJUA 3H53A 1TPH1 2AL2A 1VYRA 3WFLA 2XSBA 3BGAA 1US2A 2QAFA 3TLQA 2V68A 3KVMA 3AZTA 4WJXA 3ITXA 6REQA 1LT8A 3NOYA 3S9YA 2WBGA 3N4EA 3QR0A 1IWAA 3BVJA 1KFCA 1E72M 3STGA 3B0UX 3C2YA 2ZZ6A 1PIFA 1KBJA 1OYCA 3DFOA 3LHUA 6PTDA 3CJPA 1LRTA 4BCEA 3L12A 2IKGA 4U33A 5H8PA 5E9AA 1XLDA 5IDIA 2H9AB 1E9LA 3P6LA 5M1TA 4DUXA 2WSQA 1PKLA 3LCIA 4HNOA 3OQ8A 3QPZA 2QDEA 3N2BA 2BBFA 2VO5A 3E2VA 1PCWA 3LM3A 2GVJA 2D1ZA 3O1NA 4ZO6A 4H04A 3HZ3A 4UCFA 5AC6A 4Y9NA 1HW6A 4MOZA 5BRPA 2YL5A 3MP3A 3KRUA 4XUYA 2WKGA 2ZXAA 4HPGA 1FWSA 4C6LA 4UC5A 1J6PA 5JH2A 1L9WA 1K9DA 3ARVA 1V0KA 1M7JA 4S1FA 3V36A 5AHFA 2RFGA 1U83A 1WXJA 1XBYA 3KWXA 1KV8A 1AA1B 1ZNNA 1IYXA 2EGZA 3GO2A 3P2VA 4ZE4A 1ZPTA 3CEUA 1XDLA 4PTNA 4BWLC 4AIBA 4B90A 4D9PA 3VYLA 3W27A 1EGZA 3WLNA 4LCS<