3IGSA

Structure of the salmonella enterica n-acetylmannosamine-6-phosphate 2-epimerase
Total Genus 81
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
81
sequence length
230
structure length
230
Chain Sequence
AMSLLEQLDKNIAASGGLIVSCQPVPGSPLDKPEIVAAMALAAEQAGAVAVRIEGIDNLRMTRSLVSVPIIGIIKRDLDESPVRITPFLDDVDALAQAGAAIIAVDGTARQRPVAVEALLARIHHHHLLTMADCSSVDDGLACQRLGADIIGTTMSGYTTPDTPEEPDLPLVKALHDAGCRVIAEGRYNSPALAAEAIRYGAWAVTVGSAITRLEHICGWYNDALKKAAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Isomerase
molecule keywords N-acetylmannosamine-6-phosphate 2-epimerase 2
total genus 81
structure length 230
sequence length 230
chains with identical sequence B
ec nomenclature ec 5.1.3.9: N-acylglucosamine-6-phosphate 2-epimerase.
pdb deposition date 2009-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04131 NanE Putative N-acetylmannosamine-6-phosphate epimerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3igsA00
3W1NA 4K39A 3UY7A 4Y96A 5G1YA 4IX2A 2JKPA 5LKYA 2WSYA 5IBXA 2EAWA 3B03A 3TJXA 3FS2A 3BG3A 1LZOA 3ANYA 3NGJA 4UR8A 3KHJA 4FF7A 4LNYA 2ABBA 3NL5A 3P67A 1KV5A 5KSWA 4EVZA 1TPB1 4O13A 3W7NA 3KVLA 5CPMA 1OX6A 3M5XA 4MJZA 4FNTA 3DFQA 2WQPA 3LXCA 5D2XA 4E2DA 3DFPA 1BTMA 1TPEA 5CSRA 1ZAHA 1P4CA 4IWWA 3SIZA 3MP5A 1GVOA 3ZWTA 1TPC1 1QPNA 1SO6A 1N8FA 3O16A 3OEXA 1ME7A 3M5VA 1GTEA 4JX6A 4AXKA 3KOFA 3P80A 3RFAA 3NM3A 4FIRA 1KM5A 1SW7A 2A7NA 2ZZ3A 4NJIA 3TU9A 3MJYA 1SZNA 1KFBA 3EXRA 3W3OA 1RZMA 3K30A 5KMYA 1AK5A 2ZBTA 5H91A 2ISWA 3G0XA 1VCVA 3NQFA 1OHLA 4GUGA 2GVLA 3W2KA 3JRKA 1KM0A 1TCDA 1BKSA 3M1ZA 1QFEA 3RMJA 4YMZA 3G22A 3MYPA 1OFDA 1W3NA 3WJXA 2OT1A 2XFWA 4MY1A 3GYEA 4JXCA 4L4MA 5F1UA 3W84A 3S1UA 3MHUA 5D38A 3GDTA 3P5ZA 4E38A 5AHIA 1THFD 1LYXA 4FX8A 3EWWA 4DO5A 3SGZA 2VENA 4JR5A 4PH6A 1WA3A 3HGJA 1KLZA 1SZEA 4WY0F 5BMWA 4R53A 2G95A 4BWLC 1X8FA 3B8DA 4ZMGA 3LTYA 3SGUA 4BFAA 3IGUA 2DZPA 4WQ6A 3LCIA 1AMKA 5FF2A 1IGSA 5SWUA 2QCHA 2TMDA 4A2RA 5I3FA 4O52A 3W2JA 5CZSA 2V5LA 2E09A 2PE4A 3OG3A 4DF2A 3EWYA 5HUOA 1TPH1 4K36A 1I2NA 5CZJA 1XFBA 1IXOA 1DJNA 2GQAA 2CZFA 2JK2A 2YDAA 5DLCA 3DZ1A 1ICQA 2WV8A 3CEPA 2QCMA 1KTCA 4JY9A 3W07A 2RDWA 1VRDA 1W31A 1T99A 1GZGA 3GDRA 2C16A 2X30A 3QQ0A 1ZHAA 4KFOA 1ONRA 4O53A 5HNRA 4MFDA 2ZZ2A 2VFEA 2C0AA 4JTLA 3BVJA 1G7VA 2JKAA 4I7WA 4WY0B 4AF0B 1V7YA 2WOQA 3C2VA 2PRHA 3I68A 1SUXA 1AG1O 5KZMA 3F1QA 3STGA 2E68A 1VPXA 2BLEA 1SQ7A 2Q8ZA 3FJ6A 2J9XA 2FIQA 2B7OA 3NZRA 1ZAJA 4N9DA 1VYRA 2IQTA 4LVDA 4MLJA 1TTJA 2Y7FA 4M6PA 2WSRA 4FEZA 3TJLA 2Q3RA 1IXNA 2V8ZA 5K4ZA 1L6SA 2NV2A 3MBFA 3R89A 4GUHA 1XDMA 3G1FA 1F76A 5CG7A 1KM2A 3DFTA 2ATSA 2GJNA 3PSVA 1FCQA 2ABAA 4FNSA 4UTLA 3H54A 1D3HA 1KFEA 4IMDA 4HPJA 1QOPA 3IEBA 2CLHA 5T26A 1JCMP 1XDLA 2VEPA 4LVGA 2YW3A 3R2GA 2A85A 1HO1A 5D05A 4RXGA 1UB3A 4K38A 1CX9A 2YXGA 3NPVA 1ZFJA 3E02A 3EKLA 1UUMA 3EWBX 3C52A 3CPRA 5U4NA 3QPZA 4O17A 1MEIA 1OVDA 5G2HA 2Y6ZA 2ZZ6A 3CIWA 4X2RA 4FXSA 1NFBA 4IQLA 3LBCA 4MLRA 3S42A 1K8XA 1O94A 3MI3A 5KITA 1YXYA 4S1FA 2J9ZA 4FXRA 3W7PA 3GVGA 2QAPA 3A5FA 4UFHA 3NQCA 5D37A 3W9ZA 3C4UA 3DFSA 1GTHA 3HPXA 4TMCA 1GQNA 1F7BA 1KFJA 3DKJA 5DBUA 1P0KA 4FX7A 1FWSA 1E51A 3NL6A 5G4EA 3M0ZA 4WUIA 2NWSA 1O4UA 2QJHA 4G1KA 3WJSA 1WDWA 3MUXA 1C8VA 4K7YA 4A2SA 4O0ZA 2VKZG 4JYEA 3HGOA 4K6AA 4HNTA 5K9DA 2QCDB 1TB3A 1F5ZA 3GAKA 1VCGA 1OFRA 5HINA 3PUDA 3LV6A 3RF9A 3THQA 1TYGA 2VEKA 5GVJA 1G7UA 4N4PA 3VFLA 5F4SA 3W7QA 4YCOA 1DVJA 4XBSA 4LUIA 3L67A 4DBEA 1KV8A 2GPTA 1H63A 1Y0EA 1EUAA 2LLEA 3BLFA 2Y61A 3ZFHA 1HG3A 3NAVA 4P2VA 1Z42A 2X16A 3C61A 3HG2A 5FF4A 3W74A 4BK9A 5L9FA 1QPQA 1VC4A 3NQEA 1LTDA 3W87A 2V81A 3N9RA 4MKNA 3SECA 4HIBA 4KWVA 2B0MA 4UTJA 4Z0JA 1NF0A 1XBZA 2Q3OA 3B06A 3NQMA 3UWQA 4JNMA 3D0CA 4MZ1A 2V2HA 3E0IA 3TSDA 4RZ6A 4OQVA 5C54A 1VLWA 4LRSA 1Q6QA 1KLYA 3TKFA 2ZRVA 3NR0A 1ME8A 1TSIA 4IMGA 4UCGA 3TFCA 2ZZ1A 1TQXA 3KVKA 4M5PA 3TNOA 3ABQA 4N9CA 3R12A 1TPWA 3Q2DA 3QC3A 3O07A 1FCBA 2RH9A 3P84A 4UTWC 4LUJA 1WBJA 3SI9A 4UR7A 4I7UA 1SZGA 1PL9A 3THAA 1HL2A 4HSNA 4ZQMA 4UTIA 5I3HA 1DQWA 4IX0A 4IPIA 3UYCA 3GIYA 1QO2A 5F4XA 3HF3A 1TV8A 3G0SA 1YDNA 4UFJA 3H53A 3S1WA 2NX9A 1ZAIA 2UV8G 1KM1A 2Q8LA 4AHPA 3BARA 1WOAA 2A6NA 1Q6RA 3LI1A 3MBDA 2KZHA 3O63A 5HR7A 3A22A 4O8RA 3FOKA 1KFLA 2DZXA 3W1MA 3QSTA 3MI6A 2JGQA 2O7SA 5D30A 1SZFA 3A9IA 4LW7A 4AWTA 3EX3A 2CZ5A 3NQ8A 4O54A 2HS6A 1W3IA 1NEYA 3HOJA 4CNPA 3L9CA 3P62A 3QMSA 1GVFA 1X6UA 4QSHA 1GWJA 2A21A 4TMBA 4FNUA 1R30A 1LRTA 3NL2A 2YSWA 1OFAA 3GDLA 3SR7A 4YXGA 2QDHA 3QM3A 4O19A 1W5NA 4MY9A 3B0VC 1JVNA 3BW4A 3UQNA 1RQHA 2E1DA 3W7GA 3W85A 2B7QA 1RVGA 3W75A 1K02A 2E5DA 2Y89A 1D3GA 1PV8A 2WJZA 1JCNA 1G4SA 1YDVA 4CQ9A 1KTBA 2Z2UA 2QUVA 4RCXA 4KWWA 4OE7A 1KFKA 4UNKA 4XZ9A 4OU1A 2CLMA 4PFMA 3HGSA 3PG9A 4LS1A 3DENA 2FB3A 3PUOA 5KZDA 2ZTKA 4M7SA 5F2LA 1RPXA 2J27A 2GVJA 4FO4A 2V0TA 1XBYA 1LM1A 4ML9A 2YW4A 3W2LA 2PURA 1EP2A 3T55A 2ZCGA 5D33A 3LRKA 4UMBA 1KBIA 3NO5A 1I2RA 4RK8A 5DCEA 4ZVJA 5AHMA 3SY5A 5E93A 1ZENA 3G1AA 1FWWA 3PVFA 3QYQA 1F2JA 1BEUA 4N4QA 3CWOX 3C2EA 1VYPX 2R94A 1L2UA 1SU5A 1Q45A 4O16A 3I7SA 2OMAA 1TV5A 2CU0A 5CPLA 4MFEA 4XWUA 3UXAA 2JKEA 5IBXC 3BO9A 1DL3A 4NU7A 4JTIA 2HSAA 1FDJA 4JDYA 1JUBA 2ZRZA 3T40A 4UTKA 3NQ2A 2QF7A 2A6LA 3G3MA 3M41A 3DFOA 4HHPA 5HWJA 4DQWA 1PHQA 1DBTA 1K8YA 3UNDA 2EKCA 4LU0A 1P5BA 1A50A 4QNWA 2VFHA 5DY3A 3PB2A 1YTDA 1ME9A 4LV4A 3IIOA 4NXSA 3W7HA 1G4PA 2FTPA 1OFBA 1TPUA 1J2WA 1JQXA 3FYPA 4MJMA 3CTLA 4AB4A 5D2TA 3GB6A 1P0NA 2F84A 1GG1A 3PWAA 3QW4B 2QCNA 4GFSA 2NLIA 4RXFA 1H50A 3LI0A 5K3VA 3N2MA 4U4MA 4DO6A 3LV5A 2ISVA 3FKRA 1YLVA 4H6KA 2QEZA 2NWRA 3IVUA 1QNVA 3LXAA 3QMTA 5AOUA 4BI5A 1YPIA 1W3TA 2DZTA 2QCFA 2YGYA 3M47A 1WQ5A 2XN1A 2FLIA 1B3OA 2YFOA 3TROA 2Y7DA 2BZNA 4O1AA 4ADUA 1FUYA 1DV7A 1EA0A 5A8GA 3W7LA 3P8IA 3FYOA 3BLIA 3YPIA 1I8JA 3JR2A 4JTHA 1M7OA 2E6AA 1XL9A 3W76A 5FF0A 5AHFA 1PE1A 2E6FA 2BX7A 4HN4A 1NF7A 2VFGA 3DFNA 1OX4A 3NQDA 1LORA 3DKLA 4JTTA 4FX6M 4K7VA 1JCJA 3WK0A 1JULA 1WBHA 5D02A 4MYXA 4O1BA 2E5CA 2RDTA 3TCEA 5TIMA 4OT7A 3EWZA 3GXNA 5EPDA 1JRCA 5TQLA 1A5AA 1VZWA 1W8SA 3AJXA 1A5CA 3GDKA 2QCCA 4PEKA 5BOOA 1W56A 3GXTA 1SR9A 2DORA 3C2OA 6ALDA 4CNOA 1I4NA 3G1YA 4MUZA 3W2MA 3GK0A 1JR1A 2C1HA 3F03K 3G1DA 5DXXA 1R2SA 1EPXA 3L0KA 4Z08A 1D9EA 4ORMA 1PCWA 2Y88A 3LBMA 1G4TA 3W1TA 2J88A 1HUVA 4AMAA 5HWMA 4R34A 1I2OA 4GXMA 4HNVA 4FNQA 4UMAA 3W86A 4YLWA 3M7WA 2ZRXA 3CQ0A 3LB0A 2NV1A 4CCDA 4LC6A 4JDBA 1GVRA 1X1ZA 4XKYB 4WOQA 4BR1A 3LM7A 3UWUA 3NQAA 3EWUA 2NX1A 3C0JA 3G8RA 3GAYA 1ZY9A 1RD5A 1TJRA 5AYXA 3EWXA 4C1KA 3LCXA 3M6YA 4ZQCA 2A4AA 1MEWA 3QH2A 5D2YA 4QM1A 2WO5A 3KX6A 3TV8A 3PS7A 4HPXA 1LP6A 1GEQA 4Q4KA 3W23A 2BTMA 2ZZ4A 1RV8A 2R8WA 3HPSA 3W70A 4AVFA 2CLEA 5AYYA 3BG9A 3ATZA 5K4XA 1KW1A 4GNJA 4H4IA 4EF9A 2ZZ7A 3TMQA 1SSDA 1I45A 1FWRA 4WOZA 3I6RA 4ADSA 4NZFA 1QPRA 5D03A 1GVQA 3NM1A 2O7QA 1WYIA 1HTIA 4AF0A 4K8HA 5HWNA 3W73A 3INPA 4BF9A 5D09A 4LVFA 5KTLA 1W5PA 1VHNA 3NA8A 2TSYA 5AYZA 1XCFA 3KRZA 5LGXA 4A29A 3GNNA 4D2JA 4TU1A 3BGJA 4CQ8A 3L66A 1AW1A 1LLWA 4UNLA 5C2XA 3W1RA 2AGKA 3LHUA 1GJPA 1LBMA 5AC7A 4GUIA 3QEZA 1LBFA 2YCEA 3U6WA 4BWLA 3BV4A 2G97A 3S1VA 5EKYA 3DBPA 4LTSA 4YCPA 3DXIA 1FXQA 1IIGA 2QUTA 4AH7A 1OK6A 1UUOA 3BPWA 2ZTJA 2V9DA 5L6UA 3VCRA 3WFAA 4HT3A 4XKYA 1W54A 2VEMA 4WJEA 1WXJA 1FCVA 4IMEA 1XUZA 5K2ZA 1HO4A 1R47A 3TK7A 1WV2A 4HNUA 1YDOA 3LCGA 3PC0A 3H55A 4GWEA 5G2WA 3C6CA 1DQXA 2EGZA 3PY2A 1EEPA 2DJLA 4MZ8A 4WZHA 3EXSA 4YWIA 1XM3A 8TIMA 5I3IA 1W5MA 3UPBA 1B4EA 3NQ6A 3N34A 3P82A 2B7PA 1A5BA 3BGGA 4ZQOA 3NEVA 3ABOA 5G5IA 5K9CA 1GT8A 1O95A 1G4EA 3P81A 4JS3A 5HUPA 3B05A 3UD6A 1JUKA 1C29A 1OX5A 1U5JA 3WK1A 4RKAA 2A7PA 3G24A 5K7JA 1TO3A 3W1LA 1O5KA 1JJKA 5U7SA 5DCDA 3T4CA 1S3HA 1LROA 4Z1BA 1WAUA 1VHCA 4NXKA 3TW6A 5J5DA 5HULA 1XXXA 1H1YA 2FFCA 3B4UA 5J5RA 2H3BA 1OYCA 3HG4A 4O57A 5DXYA 1Z41A 3CWNA 1LOSA 4BI6A 3OVPA 5AC8A 1FWTA 3PR2A 5FF3A 3A24A 3IIZA 4B5NA 1Q6LA 1G69A 1FX6A 2TYSA 5LNUA 2NXHA 3QJAA 1F73A 1H61A 5FEXA 3QZEA 2FJKA 3KFTA 4S2BA 2X2GA 5D04C 3WJYA 4L4LA 2P1FA 2AQWA 3OBKA 3TIMA 1LRQA 4NJHA 4N6EA 4M6VA 4NX5A 3O6YX 3CM4A 4XQ6A 4NJJA 5BMXA 3GR8A 1SFJA 3PULA 3V75A 3QFEA 1OG0A 4ADTA 5DCBA 1OYAA 3C2FA 3M5YA 4FB7A 2RHGA 1H7WA 3W2UA 4RZ4A 4UTUA 1EB3A 1JUEA 2DZWA 2Z1BA 4EOUA 2X1TA 4MYAA 3PSWA 1N55A 4O11A 4HNNA 3CHVA 4IXHA 1F74A 3O6DA 4JY8A 1ALDA 4GC4A 1S5TA 3STEA 5D2WA 4XUGA 1BWLA 4W9TA 4QNEA 1W37A 3DHDA 3Q94A 3TE9A 4JTSA 4NNBA 3CU2A 4WXYA 5D32A 2D73A 2NUXA 4DXVA 3TW7A 3LHWA 1H51A 1KM6A 3F4WA 3W6YA 1M7PA 5C55A 2FB2A 3EX2A 2E6YA 2QDGA 1YXDA 3RLUA 5AB3A 5F1VA 2ZZ5A 5CKSA 3C56A 5IM51 2TRSA 3BW2A 5DELA 1NVMA 4TR9A 2NZLA 2VFFA 4U28A 1TTPA 2C14A 5BNKA 3O6CA 2NUWA 2VOMA 3NVTA 3QPYA 3GZ3A 2CLOA 3JS3A 3V1PA 5EA9A 3ZR4A 3DI1A 1Z48A 2WNNA 3STFA 3W88A 2QCEA 3W1QA 2GOUA 4GUFA 3W7CA 4ZQRA 1YYAA 1A53A 1PHWA 1TV7A 5CSSA 3CEUA 3LXBA 1LDCA 1TIMA 4IPJA 4QISA 3TUUA 3I7QA 1VLIA 1VQTA 4DF0A 2NXGA 5CZTA 3W1PA 1FWNA 1H7PA 2DU2A 3ATYA 3BW3A 3W7DA 5DY2A 5TBOA 1KA9F 3IGXA 2A1YA 3SJ3A 3UXDA 1ML1A 2Y7EA 1X7FA 3B0PA 4QITA 4S2CA 1RQBA 3VNDA 4CQAA 1EX5A 3NPXA 3E9AA 3A5VA 3UY8A 3HGRA 5BW6A 2G5WA 3OHIA 4R33A 4Y90A 1J5TA 5FI8A 3E49A 3TFXA 3HMJG 2Y63A 3P74A 3S1XA 5HR6A 1W0MA 3PBWA 1FDZA 7TIMA 3PM6A 4O1CA 4NQ1A 5AFDA 2B7NA 3UWVA 5AHNA 3VE9A 4A21A 1IXPA 2GQ9A 4Y6GA 1TREA 1AW5A 4O18A 4O14A 3NDOA 4MZYA 3G8EA 1W5OA 2WKJA 4JTUA 3DH7A 5KINA 3MYOA 3EKZA 5I3KA 4Y9AA 1LBLA 4X9SA 2CZDA 4LOCA 3PBYA 1P1XA 2E6DA 3LCLA 3L5LA 2ZYFA 1SO5A 2VFDA 4LT9A 3OVRA 4I7VA 3GKFA 5CPOA 1QMLA 1VR6A 3HQ1A 1IIHA 1OABA 3UZ5A 1OFEA 3NPUA 3R13A 1L9WA 4XTIA 1ADOA 4NJGA 4AHOA 2CZEA 1ZNNA 3LTPA 4M19A 2VELA 3EXTA 4BI7A 3N3MA 3AO0A 3KVMA 1EP1A 3Q37A 3NQ7A 2QCGA 4M7TA 3TH6A 1EWDA 3SW6A 2YYUA 4O10A 1FQ0A 2JGYA 4JTFA 5AN7A 5LHEA 4Q32A 4UFKA 2WNZA 1OFQA 2J9YA 5LNWA 1G6CA 4PC8A 1UBSA 3G1VA 4K8EA 1UCWA 4H3DA 3KRUA 4UTMA 3IIVA 3FKKA 4X3ZA 3LGEA 5H2ZA 3G18A 4GRSA 3L65A 5LHFA 3GDMA 2QCLA 1GOXA 3O06A 1ZCOA 4ZQNA 1YTKA 1MXSA 3WJWA 4NT0A 4OV4A 3FA5A 2YFNA 4KKXA 4N9BA 2OT0A 1EIXA 3OA3A 1GPWA 2WNQA 4JEQA 1L6WA 3EX4A 3HO8A 1VS1A 2X1RA 2TPSA 4GUJA 1OJXA 4WXZA 3L5AA 4UTHA 1UASA 2PRLA 3O05A 3NL3A 4JTEA 4HSOA 2A7RA 3N9SA 4DF1A 3M44A 3KRSA 2V30A 2NXIA 1VYSX 2BSLA 3HG3A 2X1SA 1F05A 1LRNA 3G1HA 1KBJA 3LDVA 2PCQA 1PIIA 2R91A 1S5VA 1W1ZA 2ZFAA 1YTEA 3MP3A 4AWSA 3FEMA 4LY8A 1TRDA 5EL1A 1GYLA 1M6JA 1YXCA 4RZ5A 3TAOA 4RLIA 1F6PA 3A23A 4DPQA 3W7KA 2FPTA 3IGSA 3KAOA 4NVTA 3NQGA 2CLFA 3DHFA 4PCFA 3Q58A 1SPQA 2RDUA 3S6DA 1JRBA 1B9BA 5EBUA 4QAIA 3NNTA 3EX1A 1B57A 3U8GA 2GVGA 3CC1A 4IXXA 3VE7A 3ABSA 4RV8A 4DEFA 5EMUA 3W7JA 1VCFA 4RX0A 6TIMA 4ZZ9A 2C13A 3L0NA 4PL2A 1IF2A 1FXPA 4AWUA 4Y8FA 4QJ1A 4CLMA 3IIXA 3BLEA 4CCCA 3T78A 1H7XA 2ZRYA 4K37A 4LS0A 3L0GA 3TR2A 1S5WA 1K7XA 4DELA 2BXVA 3QMRA 1TPVA 5K9XA 4DBDA 5F2MA 1K7FA 3S5ZA 3TC6A 2C6QA 1R46A 1VJIA 5FEZA 3DI0A 1TTQA 4JN6A 1W5QA 2NX3A 1TPFA 4N2YA 1NAL1 2J24A 5C5YA 3IIPA 3SZ8A 1DJQA 4N6FA 3IVTA 4X22A 1ZALA 5E0KA 2E5BA 4LVAA 1B4KA 2CFFA 5FF7A 5FEPA 1T96A 5HMSA 3LRMA 3MHFA 1I2PA 4PL1A 5BRBA 3W7EA 2W79A 1V5XA 4JYDA 4NNCA 4IJBA 4O0KA 3GNDA 1KFCA 3PBVA 4MIMA 4A22A 2H3DA 4JD4A 4RJEA 3UZJA 3L5MA 2I1OA 4RR4A 5F2IA 3UPWA 3BK0A 2YZRA 4JICA 4CCEA 1ICPA 3GLCA 1QR7A 3I65A 4JTKA 4JYFA 4O12A 3LHYA 4IMCA 2ALDA 3S5OA 4MPQA 3LHTA 2H8ZA 3P61A 1OF8A 3UWYA 3ZS4A 3IVSA 1CI1A 3I7RA 2DZVA 1XI3A 3W83A 4FHAA 2CLKA 2H6RA 2GQ8A 2I9EA 4PA8A 1M5WA 1MZHA 4LV9A 2PRMA 1H7NA 2WSQA 3LERA 1SO4A 2F7FA 2YYTA 4MVAA 4O4WA 4EIVA 4ZQPA 3G3DA 3CLMA 5G1TA 3USBA 3NZ1A 3GKAA 4XTDA 2Z6IA 3W1AA 5FEWA 3LHZA 1GVSA 4AHQA 1T8XA 1YPFA 2YPIA 4FNPA 4UTTC 1GYNA 2VEIA 3W1UA 4TIMA 3E12A 3TMLA 4ZL1A 5C6MA 4Z1CA 4UIOA 2ISSA 3QF0A 3L68A 2C18A 2W0UA 2GUUA 4WD0A 1JCXA 3MO7A 2ZA1A 1H7OA 1K3UA 3F4NA 4PTNA 3LHVA 3M16A 3VKJA 3TQVA 5EY5A 5HQEA 1VH7A 2A2IA 3SSJA 2ZA2A 3B0UX 5D2VA 4O50A 3GX9A 1DORA 2Y62A 4GJ1A 2NUYA 5G2IA 3MI2A 3UWWA 4NUWA 3SFKA 1GG0A 2HTMA 1FCUA 2DJXA 3WJZA 1TQJA 2R14A 4NNAA 3PG8A 3M43A 4MY8A 3LCHA 3A21A 3U2OA 2Y7GA 3C2RA 2QR6A 5AHLA 4OBTA 3L2IA 2RFGA 2Z0IA 3TX9A 4WY0A 4UTTA 2V5BA 2CLIA 1OF6A 2J6XA 2PC4A 1K03A 2VXNA 5FESA 3TC7A 3MP4A 1TRIA 3E96A 4UFMA 3LX9A 4GE8A 2OCZA 2V2DA 5LSMA 1QO5A 4A3UA 2ZRWA 3S9YA 3L21A 3M5ZA 3W7MA 3GR7A 2QUUA 3HJZA 1XBVA 3TXZA 2YX0A 2DZUA 2BWGA 1LOQA 1JQVA 2QAFA 4QIUA 1TMHA 1KM4A 5E1QA 1J4EA 3LOTA 4Z0SA 3DGRA 3DU0A 1DHPA 1XKYA 4UFLA 3MHGA 1XBXA 4I9AA 3TDFA 3WK3A 4UXDA 2C19A 3STCA 4JIQA 4KFNA 3W7RA 1I2QA 3UWZA 1Z44A 3T44A 5CGQA 3PAJA 1L6YA 1O60A 5G4WA 3TAKA 2I14A 4Z1AA 1N7KA 2EPHA 5I3JA 1H5YA 2P10A 2EHHA 2X1UA 4J9JA 3DAQA 5F2GA 1LLZA 3LCWA 1TTIA 3QSRA 3S5NA 2E77A 2VC6A 3P5YA 1KTNA 1QOQA 4EF8A 4LC8A 1O5XA 3QW3A 1H1ZA 3NG3A 5DN1A 1SW0A 3MWAA 2H90A 3N73A 3LLFA 2HS8A 3LCFA 4WX2A 1EP3A 3TA6A 5LNSA 1U83A 1XUUA 4CNNA 4P61A 4Q33A 4YL2A 2V82A 5CZ0A 2QJGA 1FY6A 3IRDA 3QQ1A 4JX4A 1NSJA 2JBMA 3NPWA 1T0OA 2Y85A 2YR1A 3OIXA 1OFOA 4EWND 1QWGA 4OGZA 2ATMA 5MHBA 1HFBA 4R7JA 3W71A 1DKWA 1PCKA 1A5SA 3O15A 3T7VA 4IOTA 1LCOA 1H60A 5LGZA 1QCWA 3PBUA 3PB0A 3W72A 1TPDA 3R5EA 2OX1A 4JIPA 4IGHA 4KFPA 3TQKA 1EUNA 3NXFA 2OZ0A 1PVNA 3TXVA 3EX6A 3N2XA 3GXPA 4O15A 2B4GA 2GJLA 4XBKA 4E2BA 3W7OA 4OV9A 3RK8A 4O28A 4PODA 4UFIA 3W2NA 1OFPA 3P7YA 2ZQ0A 4M6QA 2QKFA 1EWEA 1WOBA 1PS9A 2CW6A 4LWWA 3RNDA 4GBUA 3HG5A 1BWKA 1AL7A 4DO4A 3R8RA 2C15A 3NYZA 3C3NA 1MEHA 1JCYA 1Q3NA 3G1XA 2A0NA 4NZJA 5LNRA 1DOSA 3HB9A 2QCDA 3WK2A 2FDSA 4N02A 1SSGA 4HKPA 3MW7A 2ZRUA 3C8FA 4C1LA 1MO0A 3HPZA 1RQEA 3MMTA 3PF3A 3W1XA 3CT7A 4E0CA 4JX5A 3N19B 1LOLA 1Q6OA 4UC5A 1TJPA 4AEOA 5LNVA 2RKXA 2Z6JA 1IXQA 3S8HA 2FPYA 3ZWSA 1OK4A 4ALDA 3TQ0A 1FBAA 1F6KA 3LRLA 2Y70A 3EB2A 3IV3A 1XC4A 3VI2A 2VFIA 3RU6A 1C9DA 1H62A 2DP3A 3BG5A 4TX9A 4LRTA 4ORIA 1QPOA 4IUOA 2CWNA 4Z1DA 1VGAA 3QRHA 4NJKA 3RLVA 3FIGA 4ONVA 4QQ3A 1G67A 1K8ZA 3EEGA 4O4VA 2AAMA 3S5YA 5KZEA 3S0CA 3LTSA 3TSMA 3NQVA 1SO3A 4POCA 1K7EA 2ZA3A 3O8AA 4LVBA 1RR2A 2P0OA 2W6RA 4N9EA 3FJLA 5HJLA 3KVJA 5EYWA 5F4WA 1AW2A 1R2RA 1X1OA 3ABRA 4JTJA 4FIQA 4NX0A 4DPPA 5LZLA 1QAPA 4JGDA 3NOEA 1CW2A 4LS2A 3G0UA 4TO8A 3HBLA 4FNRA 5AC6A 4UMCA 2A5HA 2DZSA 3N14A 2XN2A 4O1DA 2EF9A 4ICNA 5A5WA 1UJPA 2QJIA 4JTGA 1YADA 2CLLA 3FFSA 3P60A 4IMFA 4MOZA 3OVQA 3PUEA 3ELFA 1AL8A 3HIJA 1OYBA 2C3ZA 5ABTA 2HMCA 1OX4B 2ZDRA 3W7IA 1MSSA 2V2CA 1R2TA 3P8JA 2FPVA 4OHQA 3G1SA 1WX0A 3M9YA 1KM3A 4AAJA 1SW3A 3B04A 4OWGA 2XN0A 4UTWA 5AHEA 1FDYA 3CB8A 3W22A 1ICSA 3TSBA 2H8XA 1H7RA 1JCLA 3KXQA 5CPNA 2WPBA 3LLDA 2OJPA 4UUIA 1QDSA 3FLUA 5I3GA 5DBTA 2G96A 3CIXA 2FQIA 1SFLA 3O1NA 1ZJIA
chains in the Genus database with same CATH superfamily
3W1NA 4K39A 2WMIB 4HSHA 2H9AA 3UY7A 2VCBA 3CZGA 1W9XA 1IWBA 4L7ZA 3DHPA 3BG3A 1RSCA 3ANYA 4M1BA 4FF7A 3UR7A 2ABBA 2NW0A 3MMUA 3PTDA 4GFIA 3WO8A 1HJVA 1XPGA 1TPB1 4F9JA 3TZFA 1OX6A 3M5XA 4MJZA 4FNTA 1ZJHA 3DFQA 1BTMA 3CUHA 1P4CA 4IWWA 5D9PA 2HPIA 3ZWTA 1QPNA 3ITXA 2A3AA 2OX4A 2Z1VA 4Z2JA 1FWFC 4JX6A 3N2OA 3P80A 4DAIA 1KM5A 1P1MA 3MPGA 4N0RA 1RZMA 3K30A 1AK5A 2ZBTA 4H8NA 1XG4A 1VCVA 4MDOA 1OHLA 1E6NA 4D6HA 2J8GA 4S3CA 2AMXA 2HXUA 4NZCA 3RX4A 7PTDA 2G3FA 3Q45A 3VNZA 1BKSA 3M1ZA 1W1YA 3MYPA 2HRWA 1W3NA 2OT1A 4MWAD 2A3HA 2XFWA 4MY1A 4EX4A 1ZPTA 2WW5A 1GZJA 5E9AA 3MUAA 3EWWA 4DO5A 1ZTVA 1WA3A 4Q8PA 4Z2IA 4AVNA 2J13A 1SZEA 1LUCB 1U33A 1X8FA 2D23A 1JG9A 4XZNX 4ZMGA 3A9BA 3F5JA 4IQEA 3T08A 3LCIA 1IGSA 3WDJA 2TMDA 4IFKB 1J93A 1M03A 3AIEA 4DUOA 3T42A 1Z32X 2PB1A 3B97A 3HV8A 1XGDA 3MANA 1IXOA 2GQAA 3OVGA 1UHVA 1XIHA 3IS4A 2YCJA 1UD2A 2OVLA 1VIWA 2QCMA 6REQA 1JEZA 3SADA 1XLIA 1KTCA 2Q71A 3H26A 1T99A 1GZGA 3VOFA 1GKPA 4O1EA 4IZGA 4JIEA 2X05A 3VOGA 2WJDA 4GYFA 4O53A 5HNRA 1S46A 3VIOA 4CQDA 1ZSXA 1FWEC 1G7VA 2PDGA 4BEQA 3PZOA 3C2VA 1R3SA 4LAOA 3WH6A 1JGIA 3VUSA 1QU4A 3FJ6A 4PSPA 2PDWA 4J1OA 3CZJA 2Y0FA 2IQTA 4LVDA 3LZ3A 2PC8A 4GMEA 1XLGA 2WSPA 4FEZA 1RD6A 4B3ZA 8XIAA 3URAA 4M82A 3NO3A 3UA4A 1XDMA 5CG7A 1F76A 5EMKA 4UBPC 1KM2A 3ENLA 3ITVA 2BGSA 1UH2A 2W3ZA 1XIGA 3R7MA 3EBVA 4PRRA 3OBEA 4HPJA 1ZLPA 4I6KA 1JCMP 4BCEA 4MB1A 2CWXA 5HANA 3H23A 2XGBA 2YW3A 1HO1A 3CHDA 4K38A 4JIRA 2YXGA 2ZDSA 1UUMA 4XZHA 1NP0A 2OYLA 3QPZA 4AFYA 1MEIA 5BOFA 5FL0A 3V5OA 1LL4A 4XVEA 2VEGA 1U1HA 2VI0A 2A3LA 3GQYA 3KBNA 4S1FA 4HOXA 4FXRA 3A5FA 3KWSA 4UFHA 2POZA 1GTHA 3GU2A 4TMCA 5A6SA 1FWBC 6PTDA 4FX7A 5CXPA 1FWSA 4CEXC 1E51A 3PZ9A 5G4EA 4WUIA 3SRHA 1EJTC 1WDWA 1A3HA 3L4WA 4E4FA 2VKZG 1PDYA 3ZZ1A 5CC6A 1TB3A 1F5ZA 1RBLA 3TJIA 3PUDA 4PUEA 1T8QA 2Y5SA 2VEKA 5REQA 4H9ZA 4N4PA 4ERAA 1RJPA 4REQB 2OGJA 2ZUNA 4H9MA 3PHAA 2GPTA 5EMMA 1Y0EA 1EUAA 2GOKA 3W26A 4K8GA 1Z42A 3C61A 3W74A 3NQEA 1LTDA 1XIEA 1K9TA 3N9RA 2VUYA 3SECA 4KWVA 2JE8A 4Z0JA 1AJ0A 3NQMA 4IP7A 4LNCA 5HPCA 4HU0A 4QFUA 2Z7KA 3LLXA 5C54A 1KD0A 3IJIA 1Q6QA 3FNDA 3GH5A 2ZRVA 3TKFA 3VIFA 2XH4A 3WMCA 4UCGA 2ZZ1A 7TAAA 5PTDA 2AKMA 3BCJA 2DH2A 6XIMA 1XRSA 3B9OA 1KGUA 1EQPA 3ZM8A 3R0KA 1WBJA 4GZIA 3SI9A 3ZT7A 4LBUA 3WLMA 4AZGA 1IR2A 3AIRA 4ZQMA 4UTIA 3MKKA 5I3HA 1DQWA 1Z89A 3GIYA 5F4XA 1TV8A 3G0SA 1YDNA 4G1NA 3H53A 2G4JA 4RDVA 2NX9A 5A8NA 4J2PA 7REQA 2Q8LA 1IV8A 3BARA 3BAKA 5GJNA 3DCPA 3MBDA 2KZHA 4ZENA 1YNYA 2WK2A 4QLJA 4C5YA 1E1FA 3PJWA 3W1MA 3MI6A 2O7SA 3PANA 5D30A 3A9IA 4AWTA 4DB7A 3NQ8A 2BHZA 3GY1A 2PMQA 4ENLA 1NEYA 4XV0A 1XISA 3AMDA 4TMBA 5TNVA 3UJSA 1F07A 4UQBA 2XVNA 2V67A 3AU2A 3N9KA 3PFRA 2VDGA 2YSWA 5HJYA 4GYPA 1OFAA 1UZ1A 3H8AA 2QDHA 4O19A 3OGVA 1W5NA 3RPTA 3U3HA 2R1KA 2WNWA 1XQKA 4AD0A 1JVNA 1WAWA 1YPXA 2XVKA 5HNNA 4HTBA 2E5DA 2Q01A 3VZZA 1TVLA 4JHOA 2CXGA 1UZ4A 3RILA 3B9DA 4PFMA 3WIJA 4F48A 4LS1A 3ONBA 4FO4A 1W8GA 1MNSA 3QZ6A 3E2RA 3U2ZA 2BB0A 2TODA 3W2LA 4XIMA 1KR0A 4PBEA 2V3GA 3NO5A 4WR3A 3SB0A 1FA2A 3WF3A 1IQ8A 4RPPA 4C6JA 1J0JA 5E93A 3WD3A 1FWWA 4DHGA 3QYQA 4FK9A 2WMGA 1F2JA 1C7SA 3CWOX 2PDNA 2YLAA 3C2EA 3MT1A 1EJWC 2R94A 1L2UA 2Z1XA 1Q45A 2ZWZA 2O92A 2R1MA 5CPLA 1L2QA 4XWUA 5A8PA 3V5CA 3GTIA 4NU7A 4FOKA 4IIFA 2WHJA 4JDYA 2J7CA 3PJXA 2ZRZA 4FLQA 2WHMA 4UQCA 4URIA 1KCXA 4AXNA 3CPGA 2D2GA 3HQOA 4A6GA 2P3EA 1DBTA 4LU0A 3RN6A 3FY1A 3N6JA 1UKOA 1A50A 4ASTA 1BXNA 4GGHA 3U7VA 4NXSA 3GZAA 4KS0A 1J2WA 4MDPA 4MJMA 1CWYA 3CTLA 1EDQA 3QW4B 1CENA 4GQ0A 4PCNA 3N2MA 4DO6A 2ISVA 3FKRA 3UVIA 1YLVA 1C8YA 2QEZA 3EGJA 1QNVA 2WBKA 5AOUA 4OOUA 1BD0A 3TW9A 4MF4A 1VEMA 3M47A 3R10A 1WQ5A 2ACQA 1J96A 1RJQA 4P7QA 2Y7DA 1OGBA 2EPLX 4ADUA 5I3DA 1FUYA 3LQLA 3V0TA 4MADA 3W7LA 2QMKA 4JTHA 1E55A 2VYOA 3JR2A 3DECA 1Q6GA 1WZLA 2Z24A 2BX7A 2VFGA 1NF7A 3DFNA 4YPJA 4JTTA 3N3TA 4FX6M 1JULA 3ITLA 3CUZA 1BTCA 3OZYA 2E5CA 3TCEA 1G94A 2VWSA 2PWFA 1TMLA 3AZSA 3EPMA 1W8SA 3AJXA 3EPOA 4PB4A 2W4XA 2PUZA 4AEEA 2DORA 1QI0A 4CVWA 3QR0A 4YYFA 1NWRA 1D8WA 5HOSA 2C1HA 1E1CA 3BQ5A 1XKJA 5DXXA 2D22A 4XX6A 1G4TA 4C7DA 3RM8A 1HUVA 1EF3A 4R34A 3VMNA 1WDRA 3OLEA 1ONEA 3W86A 1O7AA 3CQ0A 4KGJA 3DG3A 3S83A 2E9LA 1BRLB 4CCDA 1J79A 2J75A 2FDMA 3QV6A 2G37A 2POTA 2ALRA 3GAYA 5AYXA 3LCXA 3M6YA 4ZQCA 1UIOA 1MEWA 5ABFB 2EBNA 3ABZA 1TCMA 3QH2A 5D2YA 2WO5A 4YTUA 3CAKA 3AHXA 1OGSA 4PRWA 3W70A 2CLEA 1XICA 3GU1A 3UXKA 1BQCA 3ATZA 5K4XA 4EF9A 2XTKA 4DNHA 2ASHA 3TMQA 1OIMA 1SSDA 3VDAA 1KCLA 4WOZA 2QDDA 4C6PA 3EDFA 3R25A 2BNJA 1JI1A 2O7QA 3QVQA 3BAWA 3BJFA 1VHNA 1XLJA 4I6VA 2FHFA 1V3IA 4BKNA 3ITOA 1JZ6A 4A29A 3EMQA 4GYJA 2PU0A 3RYSA 1AW1A 3W1RA 2AGKA 2PPGA 2QGYA 1GJPA 3O2LA 2XIMA 3QEZA 4B5WA 4NAEB 1UPMB 3MSYA 4QLLA 2DQWA 3V35A 2Z1SA 1P6WA 4LTSA 1X98A 1B54A 1IIGA 1DIOA 4AH7A 3GG1A 1JZ3A 2ZICA 1UUOA 1RBAA 1GKRA 2V9DA 3POCA 4Z17A 3R0UA 4DVOA 5C7VA 2OGYA 1W54A 3BL3A 2X40A 3UBPC 3QZAA 4MNLA 1FCVA 4IMEA 1XUZA 1UP3A 2WWDA 3WQOA 2QPSA 3TK7A 2EEXA 3H55A 1Y8BA 3CQHA 3F4CA 3W02A 1JL8A 3LS9A 3BWWA 3NSMA 4JTDA 2EGZA 3LEPA 3PY2A 4WZHA 3M0IA 3ZR6A 4Q4SA 1M65A 2D2HA 1B4EA 1XFCA 3BGGA 5G5IA 2J66A 3UWEA 2YA0A 3C8NA 2HBVA 4AUBA 5HUPA 1C29A 1QPKA 3WK1A 4RKAA 1EGZA 4FMVA 4Q6JA 1CT5A 4R5EA 3T4CA 2OKTA 5CSYA 4J3ZA 4LY4A 4Z1BA 1WAUA 4NXKA 1GJWA 1JD9A 3TW6A 2INEA 3ZSTA 5I24A 2DUXA 5J5DA 4K1GA 1XXXA 5J5RA 4LPCA 1OYCA 4CD6A 4X0VA 4ERGA 1E0TA 4TVUA 4GO8A 3TYAA 4TV6A 1OC7A 3SO7A 5FF3A 4JFUA 3IIZA 3M64A 1OBAA 2A79A 1XRTA 4B5NA 2D3LA 4IFOA 4S23A 2TYSA 3WUEA 1B9ZA 1F73A 1IZCA 4F0MA 3TNBA 2PGRA 1KGXA 5TD4A 1ITQA 2WYSA 4N6EA 1XLCA 3CLWA 3AMKA 4E2VA 3TN6A 3B9NA 2NQ5A 4B15A 5I77A 1X6LA 4QJ5B 1FHLA 1X1NA 4DJEA 3C3UA 4YN5A 3WG6A 4UTUA 2ISDA 2DZWA 2CBIA 2WVUA 3ARZA 1E4IA 4XG1A 3PSWA 1N55A 1ADDA 1F3WA 1F3XA 4I5XA 4L9XA 1PIGA 3CHVA 3S5SA 3P6LA 1V93A 2PWHA 1ALDA 1ITUA 1W37A 3PJTA 2E40A 3TE9A 1SFSA 4X61A 4CQCA 5HNTA 4AWEA 3TW7A 3KM8A 1KM6A 4P7LA 1DIKA 3F4WA 1K77A 1M7PA 4IL0A 3W6YA 5C55A 5D9OA 2E6YA 4QEHA 1YXDA 5I7GA 5AB3A 5IM51 5DELA 5H8MA 3ARVA 2PFHA 4L6DA 3O6CA 2NUWA 2VOMA 1S5MA 1TV4A 2CLOA 4AMCA 4GI6A 1AH4A 1Z48A 3WMLA 2QCEA 1Q6DA 1CYGA 2GOUA 4RE4A 1YYAA 3TOYA 3GVQA 2V5CA 1MQQA 1W6TA 4IPJA 1TIMA 3ARTA 3TUUA 5CZTA 4R88A 1H7PA 2DU2A 2EPNA 3JW7A 3QHOA 4GIAA 3LK6A 2A1YA 2E1WA 5A2AA 3ONCA 2VZOA 2EPOA 5GJPA 3ZJ8A 4PBFA 1XLHA 1X7FA 3ZLHA 1R0MA 4KEMA 3VNDA 3NPXA 3E9AA 1ZBWA 1V03A 4XAGA 2PLMA 3CQJA 3H21A 1S3TC 3HGRA 4AQLA 1EYEA 2VX5A 3OHIA 2WBGA 4C91A 1YE4A 5ABHA 3TFXA 2MANA 3PBWA 4BA0A 1B3WA 3AS1A 4ZO7A 3RHGA 3GSMA 3K4AA 3VA8A 4Y6GA 4O18A 3II1A 3NDOA 4EK7A 1W5OA 5JVLA 2C7FA 4D8AA 1LBLA 4PSRA 2GUYA 2CZDA 1RAKA 2VCAA 2E6DA 3LCLA 4R3UA 5EGRA 1UD4A 2OSYA 1ZU8A 3OVRA 1XHGA 5CPOA 1IIHA 1OABA 3UZ5A 4C5ZA 1WCGA 1AQMA 1CEOA 1E1EA 1Q6CA 1ZNNA 3SCUA 4OVXA 1R8LA 3EXTA 4TVCA 1CGXA 3KVMA 1EP1A 3NQ7A 2W9MA 4KW2A 4O10A 1FQ0A 2JGYA 4W89A 4PULA 1IEXA 2WVVB 4WVXA 3VVGA 3A4WA 1J12A 1TJ0A 3NSXA 1U2YA 4K8EA 3IIVA 4JQ4A 2PEVA 3G18A 1DIEA 3GDMA 3LSCA 3LPOA 3ARRA 4DZAA 2WCAA 3WJWA 4NT0A 4OV4A 3FA5A 5CJMA 2YFNA 3F7JA 1EIXA 3ZLFA 4ES4A 3P3BA 1QVBA 3D46A 1OJXA 3L5AA 3O05A 4V33A 3PZNA 4PUKA 3VNLA 2E7FA 3QTGA 3SCRA 1V0MA 2V30A 1KRMA 5A6KA 5MKGA 1LRNA 3PZIA 2HVNA 3G1HA 4R9OA 1KBJA 3LDVA 1O6IA 1EOMA 2VWTA 1A80A 1S5VA 1YTEA 4LY8A 1HKIA 3HPAA 4PMRA 3TAOA 1XLDA 4MPKA 1E5JA 1F6PA 3A23A 3QV8A 2FPTA 1QHPA 2OR2A 3H2OA 2BY1A 5HMDA 1C9WA 2EPMX 3G5EA 3UG5A 1PZ2A 1CBGA 2JQXA 1R3VA 2WKLA 8A3HA 1SPQA 1XQLA 1XIJA 3BUVA 2F2KA 1B9BA 5EBUA 3PZQA 1PTAA 2OB3A 3NNTA 1EO7A 3WDRA 4DJDC 3OZOA 1I0DA 3CC1A 4J3WA 3CYJA 3GHUA 4DWSB 4L6OA 3MUCA 4J3SA 3RO6A 3WBWA 3QOMA 3H7RA 1R9ZA 4PL2A 2CBJA 1FXPA 2ZE3A 4QJ1A 3WF0A 3N18A 3T78A 3USZA 4K37A 2VQTA 4LS0A 1P43A 3IJ6A 1S5WA 4H6EA 4GZJA 3WEZA 1QJWA 1UR2A 3OPSA 5K9XA 2D24A 1K7FA 4A3YA 4KQNA 3BDKA 4G8TA 3W0KA 1QATA 4G9PA 1W9UA 4XAYA 4BF7A 4WGHA 1TTQA 2UBPC 2NX3A 4AG0A 1V6XA 1YBQB 2C1GA 1K4GA 4NASA 2J79A 2HZGA 3GC4A 3FXGA 1GOMA 2D2OA 5E0KA 2AAAA 4XZMX 1UYQA 2VZTA 1JPHA 3H2AA 3KTXA 4BF5A 1ISYA 5FF7A 1MQPA 2PBGA 4HHMA 1TE1A 1I2PA 4IUGA 3MCOA 3NWRA 3T0AA 1YKWA 2EXOA 1KFCA 1LL6A 3PBVA 4MIMA 2I1OA 2V3EA 3UESA 3VD9A 1GQIA 4UB9A 3GTHA 5HA7A 2DT0A 3TYZA 1XLBA 4LANA 3H24A 2ZVRA 4JYFA 2J8FA 1UIPA 4IMCA 1SYTA 4U5IA 2QZRA 2H8ZA 3UWYA 3ZS4A 1CI1A 2PP0A 1XI3A 4Z42C 2CLKA 2H6RA 1H0GA 3CUIA 1H7NA 1LG2A 3LERA 2YYTA 4ZQPA 3G3DA 4H01A 3CLMA 1V3JA 3SBFA 1Y5VA 3MZNA 3USBA 2QV5A 1GVSA 4AHQA 1YPFA 3GE7A 4FNPA 1S5NA 4G7EB 3TMLA 5C6MA 3QF0A 2PZNA 4HU8A 3FVMA 2ZA1A 3F4NA 3BTNA 4M81A 3LHVA 2FVLA 4LAUA 3VKJA 4FR1A 2A2IA 4V28A 3SSJA 1DYSA 2G50A 1GW9A 2Y62A 4NUWA 2VT0A 3GTXA 1MW0A 3U48A 1GG0A 1PZ1A 3WJZA 2DJXA 4NNAA 1Q6EA 3PG8A 3XIMA 3LCHA 5DT5A 2YIHA 2Y7GA 3LNPA 5AYBA 1O12A 2RFGA 2QHAA 2CLIA 3WY1A 2PC4A 4L5ZA 2VX4A 1FWDC 4PTDA 1PPIA 3VDHA 1FTXA 3B0YA 1IE7C 5G4HC 1DTUA 1H3GA 4RZBA 3RU8X 3QKEA 4HK6A 1HL9A 3UZXA 3WNOA 1R3TA 3IJ8A 3AHVA 1XLLA 1X6NA 1W9PA 2E3ZA 1JGMA 2DZUA 4W85A 3W6MA 5JBEA 1V7AA 1UWRA 1Q65A 2OEMA 1J4EA 1HKWA 5GQBA 1XKYA 3VIKA 3TDFA 3CMJA 4QXIA 4TQTA 2G0WA 2QIIA 3WD0A 3EOSA 4JIQA 3CBWA 1CLVA 3UWZA 4QE4A 1GCYA 4Z1AA 1N7KA 3V4BA 2BY3A 2EPHA 2EHHA 1R38A 2X1UA 3A47A 4AEFA 2WANA 1LLZA 3LCWA 1XLKA 1HF6A 4AY1A 2HNHA 1Z9AA 2Y5EA 4CUCA 5DF0A 3VIMA 5DN1A 1SW0A 1AZ1A 3LLFA 3QY6A 1EP3A 1KRBC 1U83A 1XUUA 4UR9A 2V68A 3MV01 1ECEA 1XIIA 1HKKA 1W3HA 3WMSA 3VC5A 3VTRA 2GDVA 2PD5A 2O9TA 3OIXA 4E8GA 4EWND 4IJCA 5LIWX 2ATMA 5MHBA 4R7JA 1DKWA 3VKKA 4WJXA 4IOTA 3FGCA 3PB0A 2F9RA 2FJUB 4M3PA 1HKVA 4IGHA 4R7WA 5HATA 3WL1A 1AA1B 3ZVHA 4KWSA 4QX4A 3EX6A 3GXPA 3L2LA 7CGTA 1EH9A 1GVYA 5CCZA 4XBKA 4E2BA 4HU3A 3JUGA 4XSMA 1QI3A 3RK8A 1E15A 3P7YA 4H83A 4MWAE 1XGZA 3JU2A 1WOBA 2OLSA 4LWWA 1ZP4A 4US5D 4GBUA 4MAVA 3HG5A 2C15A 1CDGA 1V02E 1HVXA 1L8PA 1D8CA 2D0FA 3IK4A 3IJQA 1UR1A 4XZLX 2YL6A 4GCAA 4EP8C 4HKPA 3GU9A 1EJSC 3D6NA 3N19B 1Q6OA 5LNVA 5JXQA 2Z6JA 1WXYA 1NJJA 3S8HA 3VINA 1MFVA 2J4GA 4S3AA 4ALDA 1MMFA 3ZQ9A 8RUCA 4Q4OA 3EB2A 1TX0A 1C9DA 1HX0A 1OC6A 1KCKA 3P2VA 4LRTA 1O68A 4Z1DA 2CWNA 2VR2A 1VGAA 3L7RA 3QRHA 4NJKA 1XX1A 3RLVA 3WBEA 3OA5A 5CQ1A 4AIOA 3FXYA 5IXEA 4EPDC 1BRLA 3UG4A 1VEPA 3LTSA 3T9PA 3NQVA 2NSOA 3DHUA 5A6MA 1EXPA 2W6RA 5HJLA 5F4WA 4UCFA 1ISWA 4NX0A 1RY0A 4LUTA 2W92A 2AL2A 1QAPA 4NILA 5I00A 3NOEA 4GJIA 4LS2A 5LA1A 5AC6A 4UMCA 2DZSA 3N14A 3UXLA 2X0YA 2OQHA 3N2CA 4RPQA 4ICNA 2HQAA 3A4AA 2CLLA 4IMFA 3ELFA 2CXEA 3KP0A 3M4HA 4F4RA 3NYDA 2C3ZA 5GNYA 2MNRA 3BAYA 5BXPA 3Q4DA 4C60A 3C0QA 3W7IA 1MSSA 5LIUX 2KX9A 3P8JA 2FPVA 2WXDM 1KM3A 2R9RA 4OWGA 3TCSA 2FTWA 1A0EA 1FDYA 3CB8A 2YBTA 4WCJA 2H8XA 4PMUA 1H7RA 2E28A 1JCLA 1PWLA 1S38A 5DBTA 3FJ4A 2G96A 3B9AA 3CIXA 3H7UA 2YA1A 4REQA 1VBRA 4B92A 1E71M 1BYBA 1ZJIA 3WX7A 2DVTA 2XHYA 2E8YA 5G1YA 3S2CA 4IX2A 2IKIA 2UWFA 3L4UA 1SJCA 4A8IA 2JKPA 2AQOA 3FS2A 1LZOA 1X38A 3M0KA 1DJGA 1PKMA 3NGJA 4UR8A 3KHJA 1U5VA 1QNSA 4J3XA 5IFTA 3NL5A 2BXZA 3P67A 3RMEA 2Y8UA 4HZ6A 4O13A 4X0NA 2YDSA 2GGHA 1ADSA 2WQPA 3ITYA 1TA3A 1TPEA 5CSRA 3NZGA 2W27A 1TPC1 1TG7A 1HKMA 3O16A 4GPNA 1X8CA 1LLOA 1GTEA 1YBQA 4AXKA 4YWSA 4PCTA 4Q8TA 5A94A 3AS0A 4B5VA 1SW7A 2EQDA 2ZZ3A 1SMAA 3TU9A 3MJYA 1SZNA 4H9TA 2IPWA 4DYKA 3V0UA 3GDBA 2V63A 4Y7EA 3G0XA 4JTQA 5CG0A 1UPPA 3AXMA 4MJ4A 3WFLA 3CAWA 3GC5A 4E4PA 3VGFA 1X97A 1RCOB 1P7TA 1TCDA 4Y8EA 1QW7A 4KBXA 1CPUA 2VO5A 4YMZA 3DC0A 3WJXA 4XO6A 3GYEA 3FSTA 4JXCA 4L4MA 5F1UA 3MHUA 5D38A 2NVDA 3GDTA 4E38A 5AHIA 1LYXA 1I60A 2VENA 3M6DA 4ZO6A 2AL1A 4AY8A 5EMJA 3QY7A 2Y5JA 5BMWA 4R53A 2BBFA 4H9UA 2DH3A 4MM1A 3U0HA 2HXTA 2VGBA 3E1F1 5FF2A 5SWUA 3MJMA 4A2RA 5I3FA 3I6TA 3L2MA 1X39A 1TPH1 4JL2A 1XFBA 4FLOA 1C8XA 1D7FA 3AYSA 6ENLA 2A3EA 2YDAA 3OLIA 3CZ8A 3DZ1A 4NL1A 1FWIC 2VR4A 4OZOA 3PNUA 3W07A 2RDWA 2OSWA 3U4FA 1VRDA 1W31A 4F0RA 1ZJAA 3GDRA 1ZBVA 2CIPA 2J7BA 3DBNA 2XFFA 1JYWA 4CKQA 3OGSA 3EA1A 1FKWA 2VFEA 5LIYX 2JKAA 4AF0B 2WOQA 5KZMA 3STGA 3MZ2A 3VZXA 2BLEA 4MWAA 4W8BA 2J9XA 2B7OA 3NZRA 4MLJA 4I9TA 1GGOA 1TTJA 3QV7A 1CGUA 1DJYA 4M6PA 4WDWA 1KXTA 4UQAA 4BS0A 1IXNA 2V8ZA 5K4ZA 3T0TA 3CO4A 3MBFA 4GUHA 3G1FA 2W66A 1VBJA 2ABAA 4FNSA 3H54A 4IMDA 5HMFA 1QOPA 2O9RA 5T26A 3UCCA 2EPKX 1B0IA 4H2HA 1UB3A 4DUVA 1ZFJA 4EXAA 2VZVA 1A5KC 1RALA 1OCBA 2O9PA 4FXSA 4X2RA 3LUTA 5J8LA 1Q8AA 3S42A 5CGTA 1MVYA 2BGQA 1NWSA 3M0LA 3UJFA 2YB1A 1R85A 2AKZA 3WDQA 3C4UA 1M41A 1XYCA 4JPGA 5E6ZA 4X2PA 1F7BA 3QXBA 1K4HA 3BGAA 2ZUVA 3M0ZA 5D4YA 3PZMA 2NWSA 2QJHA 5XIMA 2PDMA 4JYEA 5K9DA 4ZTYA 3GAKA 1VCGA 1IZJA 1OFRA 3SQMA 5M3WA 1POKA 1QOXA 5GVJA 1UOKA 3VFLA 3QN3A 1Z3NA 2FMNA 3ZJKA 3EOUA 4DBEA 2JFEX 1Y5WA 1A5LC 4Y9PA 2LLEA 3ZFHA 2XINA 3IV8A 3NAVA 1CB2A 4P2VA 5L9FA 3HG2A 3LMZA 5FF4A 4C6CA 1QPQA 2ICSA 3W87A 4MKNA 1X7IA 4ZSTA 3IANA 2B0MA 4UTJA 5C9XA 2E8ZA 2BOFX 1R7AA 3M0XA 1NF0A 1XBZA 2CITA 2Q3OA 4ZA0A 4JQ1A 3SQSA 3D0CA 4MZ1A 3L4YA 3TSDA 1Q13A 4OQVA 4LRSA 1KLYA 4OFCA 3STPA 3NR0A 1YE6A 2XWDA 4GYPC 4CNUA 3TFCA 3NURA 3MCMA 3KVKA 1AQ0A 3ABQA 3R12A 1GQJA 3Q2DA 2PDJA 4AC1X 1FCBA 3MO4A 2RH9A 4HOWA 3P0WA 4UR7A 2VX7A 2P53A 3R1ZA 5AKQA 2OQYA 4LUTB 1SZGA 4TTUA 4HB7A 3H70A 3W6LA 4P7OA 4JTCA 3TLLA 3UYCA 1QO2A 1JDAA 3WQ5A 1JPKA 4LQ1A 4UFJA 3S1WA 3VPLA 3KOZA 5HBFA 3IJLA 2FHCA 3S2MA 4AHPA 3QLLA 2A6NA 5EMYA 5HR7A 1ITXA 3A22A 2YBVA 4HMEA 2DUAA 2GGEA 2VVSA 4QROA 4XAPA 2JGQA 1SZFA 2OXNA 2CZ5A 4O54A 1TUXA 4GXPA 2PI6A 3QV9A 3HOJA 3KL0A 1UWSA 1RVKA 3L9CA 4P8WA 1R3QA 3P62A 3QMSA 4RNIA 4LCQA 5CAKA 1X6UA 1EA9C 4QSHA 4MB4A 1R30A 4C6BA 1J6OA 1XD1A 2J7DA 1AQHA 4IM4A 3SN4A 3GDLA 3TP4A 1I9CB 1EPVA 1UQYA 3SUSA 3TZNA 3B0VC 1JZ4A 3MVIA 1XYZA 5AC5A 3W7GA 1ZP3A 5BCAA 3GXDA 3IUHA 3W85A 1RVGA 1K02A 2Y89A 1D3GA 2WJZA 1NTHA 4C6MA 2Z2UA 4DZIA 1KFKA 3WLTA 4OU1A 3HGSA 3DENA 5KZDA 4M7SA 1H2JA 1K9FA 2QLYA 1RA5A 3QGVA 4ACYA 2QVNA 2GSJA 2GVJA 2DIEA 5A95A 1A4MA 1XBYA 3UP8A 2YW4A 1HL8A 1VENA 3SN0A 2PURA 1EP2A 1QI4A 4K3ZA 4F79A 3T55A 5D33A 1KKRA 3WDIA 3H2EA 1CNVA 4UMBA 4PUDA 1NH6A 1QUMA 1JZ7A 3N13A 1SFTA 4ZVJA 4D6JA 1Z8AA 4JCMA 2JEQA 3GW3A 4AX7A 2I56A 2OMAA 4MFEA 5E0FA 2JKEA 3AUJA 1Q2SA 5FAGA 4U2YA 3CH9A 1FDJA 3DC8A 1DE6A 4L9YA 1JUBA 3GVVA 5G1MA 3UXIA 3RIKA 4LBRA 4DIAA 3DFOA 3ICJA 4W8LA 1XH2A 4DQWA 3M07A 1P5BA 1QT1A 3KCJA 4QNWA 1IWPA 2DSVA 4RNJA 1FWAC 1YTDA 4GISA 4CN1A 3WLJA 3IIOA 2W63A 1LF1A 3N6HA 9CGTA 1Q4WA 5HK4A 3GB6A 3PWAA 4HA0A 4GFSA 2NLIA 3MWCA 3UT0A 5FAJA 4RXFA 1ISXA 3VNJA 3KHDA 5K3VA 4U4MA 5LIXX 2REQA 3K4DA 2NWRA 4XUYA 3CL7A 3LXAA 4BI5A 1MXDA 1R87A 1YPIA 2HPMA 3QYSA 2F2HA 2D2JA 1XR2A 3WLQA 5M2FX 2CPUA 2YFOA 2PWEA 2WMFA 4P5UA 1KCZA 1EA0A 5A8GA 3CZKA 3YPIA 1UC5A 1C8QA 1M7OA 2E6AA 1NDWA 1XL9A 1ZGDA 3NO1A 2ADAA 5GNZA 2XWEA 5FF0A 4ZBCA 4PUMA 3DKLA 3WK0A 3SCWA 1WBHA 3AIWA 1QASA 5D02A 1CGWA 1KBBA 4MYXA 1PO9A 3GXNA 3AWNA 1XPYA 4IMAA 3SQLA 5TQLA 2QCCA 4LJ3A 4NYYA 4QHRA 1LQAA 1SR9A 1JYVA 6ALDA 3I3BA 2PS2A 1TJ1A 5A1AA 3GK0A 3VK5A 3F03K 4DI8A 2PP3A 1R2SA 1D9EA 3I4KA 4A05A 3W1TA 4AMAA 1I2OA 4FNQA 4FALA 1IR1A 4CGTA 2ZRXA 1UBPC 2NV1A 4LC6A 1GVRA 5JIPA 4XKYB 4C1NB 4BQ5A 4BR1A 4DYEA 3UWUA 4DJDD 2NX1A 5C9UA 1U30A 3C0JA 2ZOXA 3FK4A 3I4EA 3CHEA 1RD5A 1VBHA 1L8NA 1J8VA 3GUWA 5IHSA 3H22A 3T2OA 1EC9A 4HMCA 3TV8A 4HPXA 2FMOA 4Q4KA 2INZA 3W23A 2BTMA 4GVHA 1MZRA 1CXIA 4AVFA 1OGGA 2GSEA 4J40A 2GJXB 2O56A 4H4IA 4IFRA 3QKZA 3AMLA 3BLOA 2Y8VA 2PDQA 2UY3A 1JAKA 3I6RA 4I5UA 4ADSA 1HJUA 5D03A 5EU9A 2XGZA 4AF0A 3QFWA 2OLHA 1R3YA 3RX2A 4M1RA 2BASA 3TJ4A 3ID7A 1PDZA 3BGJA 4CQ8A 4AY7A 5DFAA 1LLWA 4C6IA 4UNLA 3IUDA 4S39A 1E5NA 4G6CA 5AC7A 5I03A 3MSGA 2PF8A 3UGVA 4BWLA 4OECA 1Z69A 3VOCA 2C91A 3WUFA 1CECA 2PU1A 3BV4A 3DOPA 3RCNA 4F0HA 1E4MM 1O66A 1BSIA 3DBPA 2C1IA 3PBMA 3DXIA 2DPEA 3CYVA 1KXHA 3QTPA 4UQDA 2QUTA 1B5TA 4GNKB 2ZTJA 5L6UA 3V3WA 3VCRA 3BMVA 1YDYA 1ZB5A 3SY1A 2F6KA 1WXJA 1UWQA 1B3ZA 2BODX 3CV2A 4HMNA 5M03A 1TWZA 1R47A 3TTYA 4H8VA 4CU7A 4HNCA 2W62A 3AS2A 1OD8A 3C6CA 1W1A1 4MZ8A 3UETA 1I75A 4HA1A 4GLEA 3TR9A 8TIMA 1SM9A 1GOWA 3GG7A 3IUIA 3P82A 3N34A 4LCRA 2GGJA 1DWAM 1A5BA 2DDXA 4ZQOA 1NELA 3KP1A 3NEVA 1RK5A 5B80A 5K9CA 3HTWA 3ARYA 3I3DA 4A8RA 1GT8A 4JEJA 1GW1A 2E9BA 3P81A 4ZOAA 5C7HA 5BXSA 2FZNA 1FOBA 1U5JA 3S2NA 2A7PA 3G24A 4LYQA 1T7LA 4IIHA 3UJRA 1O5KA 5U7SA 5BYWA 3KZSA 3AMGA 1WO2A 3OLGA 3ARSA 4TUFA 3F5KA 2H3BA 3EZ4A 4JOMA 5EFFA 3O6AA 2B31A 3HG4A 1DWFM 2PDCA 3CWNA 2GFTA 1LOSA 4BI6A 1YQ2A 3OZMA 3A24A 2P8BA 2YBUA 1J11A 3AUOA 1S39A 2I5QA 3EMCA 4KCVA 3VAVA 4OOZA 4H1ZA 5LNUA 3FEQA 3TONA 3KFTA 4S2BA 1D2KA 1VFFA 3TIMA 3M0VA 4GI8A 4JKMA 4KRUA 1F9CA 1NIUA 3CB3A 4NJJA 3N4FA 1WZMA 1SFJA 3PULA 3ITTA 1N2VA 3QFEA 4L4PA 1KQYA 4ADTA 4PMXA 3M5YA 2RHGA 1H7WA 1ODZA 1FHUA 3E2VA 1SMDA 2Z1BA 4FOJA 3JZUA 1QRQA 3O6DA 4JY8A 1MDRA 2O55A 4C7FA 1TIWA 1H11A 5D2WA 5AVHA 4JAWA 4XUGA 3BAIA 5DQPA 4W9TA 1S2TA 1UMLA 4QNEA 3OB8A 2VD9A 3QHMA 3PFMA 3DHDA 2F8QA 1UKPA 3SUVA 1FH7A 1W17A 4U3AA 3CU2A 1K6AA 1UR4A 4WXYA 5D32A 4AIEA 2NUXA 3BJSA 1Q85A 4PCSA 4AD1A 2ZZ5A 5CKSA 4A3HA 2FHBA 5I09A 3BW2A 3VGBA 1MQRA 5CLWA 1P0DA 4GJJA 2J8TA 2NZLA 1LT8A 4B5UA 3TYEA 5H8UA 4L1WA 1BXBA 4D1JA 3GZ3A 3ZR4A 5EA9A 1RCQA 2YXXA 1KRAC 2WNNA 3STFA 3W1QA 4KEZA 4ZQRA 3K8LA 2G3MA 5CSSA 1OQFA 4QISA 1VLIA 1VQTA 5A6LA 2NXGA 3W7DA 3ATYA 1XIBA 2NQHA 1KFWA 5C9WA 4AZ5A 2BFGA 2QNEA 3PZTA 4GINA 3VDBA 1KA9F 3TYUA 2PDLA 2YXOA 3S47A 2J7FA 2EO7A 1VFMA 3VNMA 1BF6A 2Y7EA 4A4AA 4IGSA 4S2CA 1IEWA 3R58A 3UY8A 4L1XA 3S1XA 4CU8A 5HR6A 2YL8A 1W0MA 1EHNA 1EGMA 3B8TA 1VFUA 7TIMA 2OSXA 2FGBA 4ATWA 1TWIA 4KETA 1RBOB 4IISA 1JD7A 3VE9A 1AW5A 4O14A 4AZHA 4PUNA 3WBXA 2WCSA 2WKJA 6CGTA 3SCOA 4C90A 5KINA 3MYOA 4HCLA 3UYIA 1RY8A 1TR9A 5DT7A 3IGHX 1P1XA 2OEKA 3L5LA 2ZYFA 1XLMA 3F4DA 2Z2BA 3A3HA 4LT9A 4DWSA 7XIMA 1JXKA 1GQLA 1C3FA 1QMLA 3HQ1A 5HAOA 3EB3A 4TVDA 2OZTA 3ARPA 4Q3MA 3ES7A 4MB5A 4BI7A 3N3MA 1OCJA 4M7TA 3U57A 1JCTA 1EWDA 3SW6A 4JTFA 5AN7A 5LHEA 3DYMA 4Q32A 4KESA 2GWNA 4V1YA 2J9YA 1UBSA 1XYBA 3G1VA 1UCWA 3JVAA 4H3DA 3LGEA 3MUIA 4Y2WA 1Q7QA 4LF1A 3O06A 3T07A 4J2MA 2QXWA 1YTKA 4DJED 4KKXA 1E3ZA 2CBVA 3AC0A 1GORA 1PX8A 1L6WA 4NI8A 4A3QA 3GIQA 3BSGA 2TPSA 1E40A 4WXZA 2VRQA 3GNOA 1EEXA 1UASA 3AIVA 1Q66A 2GWGA 2FH6A 3FHQA 1WDSA 3MCNA 4PR4A 3KRSA 4ZCWA 2NXIA 4YVXA 2PGEA 1VYSX 2X1SA 4F40A 2WJFA 5I06A 4XD6A 2IQDA 4JQ2A 3VD5A 1XYFA 1JYXA 3UZZA 4D9PA 1PIIA 2OWCA 2R91A 3CUJA 1JZ2A 4Q6XA 4Q8WA 2DIKA 5FL1A 4C6LA 1TRDA 5EL1A 4EPEC 1BKHA 1M6JA 1MI3A 1NWUA 4OKDA 3IGSA 3AI0A 1QNQA 2XDFA 4NYUA 3KRBA 4OBSA 4EPBC 2CLFA 2NVAA 3N4EA 3R11A 4PMYA 3ZOAA 3BLLA 1E6XM 5C8BB 3U8GA 1KC7A 2GVGA 5CC5A 4QSFA 2GUBA 5BRQA 4RV8A 2EG6A 4DJEC 1M7XA 4IIEA 4W8AA 5EMUA 1VCFA 3O3RA 5CZKA 3MS8A 4ZZ9A 3PZVA 3E0LA 4AWUA 4Y8FA 4BQ4A 1XYMA 2G3JA 1H7XA 2ZRYA 4H2CA 1TFVA 2R1NA 2V5JA 3FJNA 1QW9A 1TX2A 1XH0A 4QQUA 2BXVA 1J0HA 2XH7A 5I2UA 3CV7A 2W5FA 3PTMA 4DBDA 5F2MA 1PXGA 1OWQA 2C6QA 4PFHA 4Q4RA 3M7SA 2PDBA 4DJDA 4HJFA 3PZGA 1PTGA 3DI0A 3GXFA 1TPFA 2J24A 4KH2A 4E8DA 5DO8A 3I10A 3GXIA 1Q5MA 5C2GA 1GONA 3UCDA 4WDUA 4U2ZA 3ALGA 4BQ3A 2E5BA 4LVAA 1IGWA 2YCLA 1DWGM 1S2VA 1W1VA 1T96A 1V6UA 3EOOA 4E8CA 1XW8A 2W79A 1V5XA 3EB4A 3IJ9A 3RRAA 4HPHA 4C65A 3UNTA 2PD9A 4A22A 3ALFA 2H3DA 4JD4A 1E9LA 1WPCA 3TYCA 3UZJA 1W9BM 4RR4A 2A3CA 3L4VA 3R79A 4CCEA 6A3HA 3OBAA 1S1RA 2CNCA 1FHDA 4O12A 1E6PA 1G01A 1XS2A 2ALDA 1LQ0A 2C71A 1UKTA 3HN3A 1OF8A 3KTCA 2D0HA 2VDHA 4D6IA 2ZC1A 4GI4A 1HJXA 3AS3A 5AZ0A 3I7RA 1QNOA 1MW2A 4XZBA 1MZHA 2WSQA 5A2CA 1IT7A 2QVHA 1JPIA 4EIVA 5LA0A 4AIUA 2ZUWA 2OU4A 3CAQA 2PDHA 3QHNA 5G1TA 3NZ1A 2XJ7A 2Z6IA 5FEWA 1VEOA 4IPNB 3FW6A 2VEIA 4ZL1A 4Z1CA 3MO7A 4IICA 1NM9A 1GOQA 3NSNA 3MDWA 1U22A 5EY5A 5HQEA 5B7YA 4O50A 4GQBA 4E3TA 3VNKA 1H49A 3KBJA 2I16A 4TV5A 3SFKA 5BROA 2WZIA 4LUSB 3GH7A 4OTKA 3RRXA 3V0SA 2HTMA 4IQDA 1TQJA 4UZUA 3VD4A 3TYBA 2NT1A 3PP7A 2YZ5A 3WCZA 1A5OC 1UR9A 2ZXAA 4X60A 2IQ0A 2V3DA 4G7FA 4ZODA 5C9RA 2CCRA 1HW6A 4NSBA 3MKVA 5FESA 3TC7A 3W29A 2IMRA 4HMDA 1EC7A 5JUVA 1NOFA 2ZRWA 2INFA 4ZFMA 3S9YA 1UD3A 3WL0A 1H1NA 3M5ZA 1EYWA 3V5FA 3W7MA 1XBVA 4FLSA 3TXZA 2ON3A 2BWGA 3N11A 4RW5A 3BAXA 3KS5A 3BCDA 1LOQA 1JQVA 3BXWA 4QIUA 4GH1A 2DSZA 3RPMA 2DIJA 3MU7A 4H04A 4UFLA 3MHGA 3KOYA 1XBXA 4HPGA 3WK3A 3RITA 3T44A 1B3VA 5IFPA 3UG3A 2MUCA 5EFDA 1L6YA 1O60A 3CJPA 5G4WA 4B90A 1MRAA 1DE5A 4J3UA 5I3JA 3CL6A 1RP9A 4ICMA 3ZO9A 3DAQA 3KOWA 5F2GA 4GVGA 4R9XA 4AZIA 4YTTA 4YYCA 1A49A 1TTIA 4ZB2A 2E77A 2EKGA 3L4TA 4WGXA 4LC8A 1O5XA 1REQA 1H1ZA 3QW3A 3NG3A 5A6TC 2H90A 4WX2A 5LNSA 2OELA 4P61A 3GXMA 5JH1A 3IRDA 4AZBA 4JX4A 4DZHA 5T91A 3EEZA 3WQFA 1VPQA 4OGZA 3T2QA 3ZXWA 1HFBA 3W71A 3VD7A 3T7VA 5BWFA 1CXFA 3CZEA 5DMMA 3PBUA 4G7EA 3ZLGA 1XD0A 3KLLA 2XVLA 5FJJA 2WSKA 3NXFA 3A3WA 2OZ0A 1DEDA 3UERA 3TXVA 4ILSA 2JF7A 2GJLA 3NUKA 3CZLA 3W7OA 4LAMA 4O28A 3EDEA 4PODA 3WZ0E 1LG1A 1YHTA 3TTQA 2PP1A 2QKFA 3QC0A 1PS9A 4GVFA 3BJTA 4C6QA 3UZWA 2QIWA 1BWKA 2XZ7A 3F4VA 4GG9A 5A3HA 1MEHA 4Q4QA 3WQ6A 1Q3NA 3BOFA 1K9DA 4GOAA 4NZJA 4QDPA 2QCDA 2E67A 4DBWA 1SSGA 3KCLA 4LEFA 3EA2A 3C8FA 2I17A 3LYEA 2ZVIA 3HPZA 3W1XA 4HOZA 3H2CA 4UC5A 1TJPA 5KZ6A 3AIUA 1IXQA 1U1JA 3W53A 4D72A 4F2UA 3IAQA 2FZ9A 4UOQA 3TQ0A 4NRSA 4M0XA 1P6CA 2Y70A 3IV3A 1UWIA 1XC4A 2DP3A 2ZKMX 4RE2A 1BF2A 1QPOA 4CU6A 3WLIA 2AAMA 3KBMA 2RJHA 3S0CA 3MMDA 4I5RA 1J0YA 2O0TA 4POCA 4LVBA 3O0FA 3OODA 2P0OA 2HVOA 5XINA 3KVJA 1ELSA 1R2RA 2I57A 3U2EA 3VXGA 4FIQA 1REQB 3REQA 4JGDA 1T5AA 3L23A 2FZDA 3G0UA 2A5HA 4O1DA 5A5WA 3P60A 3FFSA 3OVQA 4ZO8A 3HIJA 3AXIA 2ISFA 1NDYA 2ZX8A 3U2CA 2HMCA 4C6EA 2OO0A 3VOJA 2YLLA 4MHBA 1HJSA 3IK2A 3WEOA 1R2TA 4LEQA 4OHQA 3G1SA 3M9YA 4RL3A 4AAJA 3S9ZA 2XN0A 3S6TA 1VJSA 3TSBA 3KXQA 5CPNA 4UUIA 1QDSA 1I1WA 3DDMA 2EJAA 3VGEA 4KEVA 2FQIA 1KXQA 2W61A 3LU2A 3O1NA 5E70A 4RUBA 2OZ3A 3GHTA 3OLDA 4Z1YA 4GKLA 4Y96A 5LKYA 1AD1A 5A6JA 1A4LA 3B03A 5EMLA 3TJXA 2I5IA 1VIZA 1MUWA 4V15A 1V6YA 4GACA 4CD4A 4LNYA 3CO8A 4AZ7A 4DXKA 1KV5A 2XUCA 3AXKA 2PCEA 3W7NA 3KVLA 5CPMA 1XRVA 5D2XA 4E2DA 3LMYA 4MGGA 3BQ6A 2OWXA 1ZAHA 3H4WA 3SIZA 3VIGA 1N8FA 1EJRC 1I6NA 3OEXA 2I5GA 5ABFA 1WKFA 1ME7A 2X0SA 2OTDA 1HGWA 2ACSA 2WM1A 3KOFA 4JIIX 2VJXA 3OYZA 3NM3A 4FIRA 4X9YA 2PODA 3ORWA 2A7NA 4S3KA 1KFBA 3EXRA 1V79A 2GJPA 3W3OA 1E70M 2J7EA 4QR6A 2ISWA 4GUGA 4ZTXA 2CKRA 1DXFA 1YX1A 3VU2A 1KM0A 4CNTA 1QXLA 1E56A 4MB3A 1QFEA 1HKJA 3RMJA 3G22A 5FA5A 2VC7A 4N42A 1VD6A 5B7ZA 3PPHA 3W84A 3S1UA 1UUQA 4PZVA 1JNEA 3P5ZA 3VKBA 3WLNA 4JR5A 2QJJA 1KLZA 2J25A 4H00A 5BXTA 3IJ7A 3AU6A 5AZ1A 2ZX7A 3SGUA 5DRCA 4BFAA 3IGUA 2DZPA 1GK8A 1TE6A 4EPKA 1LT7A 4IJRA 4DUXA 4NHVA 5CJNA 4YTQA 1UR0A 3W2JA 3VNIA 5CZSA 2D0GA 2E09A 2XVPA 3OG3A 4DF2A 2V6AA 5HUOA 4K36A 3NDZA 1DJNA 4AW7A 1U1UA 2CZFA 1DWJM 4PMVA 3WLLA 5DLCA 2WV8A 5FACA 1BPLB 1CXKA 4Q8OA 2XSXA 4JY9A 4GNVA 1DWHM 1A3XA 1UZDA 3VOIA 1H09A 1QW8A 3QQ0A 4CNSA 3IRSA 4KFOA 4WRHA 3D47A 4HHLA 4WY0B 2C0AA 4D8LA 2PRHA 1AG1O 2E68A 1JXJA 2YOCA 1RXOB 2Z1KA 1SQ7A 1G0CA 2Q8ZA 2IKGA 2P8CA 1Q2RA 2FIQA 5J04A 3GVWA 4GH3A 4B9ZA 2PDUA 1VYRA 4QLKA 3OTRA 3VMOA 4A3RA 2WVSA 2WSRA 4GZ7A 1P7TB 2Q3RA 5M17A 3UFYA 1W3KA 4S3JA 1A0DA 4S3GA 3BMXA 4JKKA 5ECUA 3R89A 2VGFA 2OLAA 4B4HA 5D9MA 2ATSA 2GJNA 3EYPA 3PSVA 1QHOA 1FCQA 3AALA 1S2UA 1QWKA 2JIWA 4JBRA 3WNNA 1OT2A 3IEBA 4GYKA 1V4YA 2CLHA 4GABA 1XDLA 2VEPA 2VTFA 3F5LA 4LVGA 4CQBA 4TTGA 1P0EA 3DYPA 4PTWA 1XYAA 5DEZA 5D05A 4RXGA 3NPVA 4W88A 3WLOA 4KIEA 4O17A 2CHRA 4YU1A 1OVDA 2QW5A 4J27A 2ZZ6A 1NFBA 5LYRA 3LBCA 2OYKA 1E4LA 3KOXA 1K8XA 3MI3A 4EAYA 5KITA 1YXYA 3T05A 2J9ZA 1TKKA 1BXCA 3NQCA 3TTEA 4YTRA 3KBSA 3DFSA 3RR1A 3A4XA 1GQNA 5JIWA 3DKJA 1P0KA 2Z00A 4NRRA 4AD3A 3NL6A 1O4UA 2FGZA 3HM7A 4G1KA 1CGYA 3RX3A 3MUXA 1TV3A 3PWGA 4O0ZA 3F2CA 1V77A 3P93A 2YKKA 3VZYA 4HNTA 3W4RA 2C79A 2QCDB 2QS8A 1P0BA 1A5MC 1DTNA 2YDRA 2YDQA 1TYGA 3A12A 4LFYA 1G7UA 2E9MA 3NOYA 3T8LA 5F4SA 3W7QA 1UROA 1DVJA 2GK1A 1H5VA 1FH8A 3K8KA 3L67A 1KV8A 4PB3A 3AIQA 1H63A 2QV4A 2Y61A 2HK1A 4BK9A 4PGLA 1M04A 2JALA 3AYVA 3NDYA 4XD5A 3WQCA 1XYLA 4B2DD 3W24A 3R94A 4GCXA 4F0KA 1CXHA 3UWQA 1VFSA 4JNMA 2WZEA 3E0IA 4RZ6A 1RLCL 1VLWA 1L6GA 4IT1A 2O9OA 4GI9A 3ZR5A 4WK9A 4W93A 1ME8A 4DBUA 2J6VA 3QQWA 1PAMA 4JIHA 4N9CA 3FA3A 1TPWA 1BQGA 3O07A 3SCSA 3P84A 3WQVA 1V3HA 4UTWC 2GSHA 4ZOBA 4KIRA 5D9NA 4ZB5A 4YTSA 3S2JA 4IIDA 1PL9A 3FSUA 3THAA 1HL2A 4JL1A 1KO0A 4IX0A 1BYDA 2PA6A 4IPIA 1CGVA 4OJYA 5ENLA 4QE1A 1ECQA 1KM1A 3MA8A 3FAWA 3O63A 4A8NA 2WQDA 4TXEA 4O8RA 3MDUA 2GDUA 3H4XA 4JQAA 3Q67A 3QSTA 1VBGA 2O4MA 2C0HA 5JMUA 4LW7A 3EX3A 2HS6A 2HVMA 5A8QA 4CNPA 1DP0A 3LY0A 1V8EA 2VP8A 8CGTA 4XD4A 1GWJA 2A21A 3C86A 2OQLA 1MRQA 4JN8A 3SCQA 4MKVA 1X96A 2Q8XA 2G8ZA 2OEJA 1GZ1A 4MY9A 8XIMA 3SCNA 3XINA 4L65A 3CS2A 2B7QA 1YDVA 1BSLA 4RCXA 1TZ9A 4UNKA 4XZ9A 2CLMA 4UOZA 3WQPA 3PUOA 2ZTKA 1OC5A 4EKJA 3K1DA 1RPXA 2J27A 4Q8NA 5T9CE 2BVWA 4AYSA 3AXXA 4ML9A 4RDWA 2ZXDA 4YS1A 3LRKA 1KBIA 1I2RA 1J0ZA 2WVVA 5AHMA 2QUMA 3UGRA 4EXQA 3G1AA 1UWUA 5CBIA 3PVFA 4N4QA 4HA4A 1TV5A 2CU0A 3WDPP 1DL3A 4JTIA 2HSAA 3ARUA 4AZCA 1WZAA 2V5DA 3NQ2A 1BAGA 4LALA 4D1IA 3OIHA 2QF7A 2X7WA 4XISA 2A6LA 1A3WA 1PHQA 1K8YA 3M46A 1VF8A 1E1CB 2Z26A 3OJGA 4B91A 2Y24A 3NQBA 4WEVX 4LV4A 3KLKA 2GVYA 3EOEA 3CK5A 5AY7A 1G4PA 4INFA 1VP5A 1RK6A 1ZL1A 4GQRA 3FYPA 4KF1A 1GG1A 4PUWA 1JZ8A 2QCNA 1ENUA 4XIAA 3LI0A 1GKQA 2XSAA 3LV5A 4IH3A 6REQB 4H6KA 2PDPA 3IVUA 3OZPA 3QMTA 4PTMA 3VX1A 4IGNA 2DUZA 2FKPA 4H41A 2P88A 1W3TA 2DZTA 2YGYA 2PLCA 4HYVA 1CZ1A 2XIIA 2XM2A 2F6UA 2FLIA 4HYRA 3TROA 4O1AA 4PUJA 4IIGA 1E0UA 3FVDA 4GO9A 3V18A 3B8VA 1EIBA 2NSXA 2REQB 3NXLA 3BLIA 4TX6A 1B31A 3PWIA 4PMDA 3UVAA 5I79A 1UW9A 1XP3A 5AHFA 2E6FA 2G41A 1PKNA 1OCQA 4EE9A 3NQDA 1OX4A 1LORA 2Z25A 4R7OA 1UH4A 1JCJA 3TTOA 2VRKA 2RDTA 5TIMA 4OT7A 3EWZA 1GOKA 3R4IA 3URBA 5EPDA 1OSEA 3GDKA 1A5CA 1R86A 3GXTA 1F6YA 1VJZA 3PUGA 4CNOA 3EKGA 3G1YA 3E0WA 4MUZA 1W91A 2R1LA 1HN1A 2BXYA 3B3DA 3G1DA 1JIBA 5CPTA 1UR8A 2WC3A 3LBMA 3O0KA 2J88A 4GXMA 4HNVA 4KMQA 3LB0A 2XFRA 3LENA 4JDBA 1MUMA 1F3TA 4UQEA 1X1ZA 4WOQA 3WN6A 3IAPA 1AMYA 2DFAA 1TJRA 4NZ1A 4C1KA 1MFUA 5E6YA 3RUBL 3VM5A 2HEJA 4QM1A 3KX6A 1LP6A 1GEQA 5MF5A 3HPSA 4LAKA 3B8IA 5AYYA 3BG9A 3VX0A 2YL5A 2ZZ7A 1Z6KA 1XF0A 3SCVA 3SUWA 1FWRA 1NOWA 3AQUA 2DV0A 1WYIA 1HTIA 2P76A 4K8HA 4MNKA 4MTVA 3W73A 3V36A 1WP6A 3INPA 1TELA 3PJUA 4BF9A 5D09A 2TSYA 4RNFA 5AYZA 1L0PA 1XCFA 4IQJA 2NVCA 3AMCA 3CWHA 4TU1A 3H7VA 3ZVIA 3RLGA 3BLDA 3EWDA 3L66A 4DWDA 5C2XA 1SGJA 3COTA 3BC9A 4HNLA 4EANA 4C6NA 1LBMA 2GLKA 1KR1A 4FZIA 3SEPA 4DRSA 4JZ5A 1PJ9A 3S4TA 3KBWA 2YCLB 1CCWB 1UP2A 1T6MA 2G97A 3B9EA 4IGMA 4BHYA 4JFWA 2NQLA 1QI5A 4YVVA 1XH1A 5EKYA 4D6CA 4YCPA 3QGKC 4XD3A 1FXQA 2OPJA 1OK6A 1EKOA 1PKLA 4XKYA 2VEMA 1KB3A 1UJQA 1KNWA 3PN8A 1MUCA 2R82A 4XZWA 1HO4A 1W3LA 5BU9A 4HNUA 3LCGA 2IPFA 3PC0A 4EACA 1DPMA 2DEPA 3VABA 1DQXA 1EZWA 1EEPA 2ZX9A 3FN9A 3EXSA 4YWIA 1PX3A 1XM3A 1EF2A 5I3IA 1W5MA 3FCPA 4UWMA 3KWXA 4QRNA 1V6TA 4S3BA 3QLDA 2DGAA 4GXWA 2CKSA 3B05A 5HXMA 2FGLA 2SFPA 5K7JA 4S3EA 3ARQA 3GVRA 4LAZA 4OIFA 1LROA 3H4GA 3C5QA 3B4UA 1VAHA 3SRDA 2RGLA 1UOZA 3SFWA 1UMYA 3VDGA 2DVXA 4O57A 5DXYA 4GQGA 3WENA 4J4KA 1ITCA 2OWWA 2QMJA 3NJ3A 4HPNA 1FWTA 4PMJA 4ZEPA 1V0NA 1G69A 3E2SA