3IGXA

1.85 angstrom resolution crystal structure of transaldolase b (tala) from francisella tularensis.
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
322
structure length
322
Chain Sequence
b'AMQKSVLEQLKQVTMVVADTGDFELIKKYKPVDATTNPSLILKAVKEQKYSNLVAETISKVKANNPDLNSDDLVKEIAIEILVSFGIKILDVIEGKVSSEVDARVSFNSATTIDYAKRIIARYESNGIPKDRVLIKIAATWEGIKAAKLLQKEGINCNLTLIFDKAQAKACAEAGVYLVSPFVGRITDWQMQQNNLKTFPAIADDDGVNSVKAIYKLYKSHGFKTIVMGASFRNVEQVIALAGCDALTISPVLLEELKNRDEHLEVKLTKNDDVVTQSPQISEADFRWLMNENAMATHKLAEGIRLFTKDTIELENIIKQNL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transaldolase
publication title 1.85 Angstrom Resolution Crystal Structure of Transaldolase B (talA) from Francisella tularensis.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Transferase
total genus 131
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2009-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3igxA00
3BW4A 1QDSA 5AFDA 4IXXA 4GXMA 2PC4A 1GVQA 1YDNA 2C18A 2Y7GA 3M47A 3L5LA 1JCNA 2Z6JA 3CT7A 3W7IA 4O4WA 2DU2A 4MOZA 3IIZA 2Z2UA 2ZFAA 3WFAA 1OHLA 3KHJA 4JXCA 1H7OA 3O63A 1G4PA 4BF9A 3LOTA 1VPXA 2FQIA 1ZAJA 2FPVA 1K7FA 1KM5A 3TUUA 2ISSA 3KRZA 1H7NA 3W2KA 4LRTA 4U4MA 2ZRUA 2VFIA 1OX5A 3UY7A 4LU0A 1ME8A 3THAA 4G1KA 1UUMA 3UPWA 3RLVA 4JYDA 1KM3A 2J27A 2J9XA 1SZEA 3O06A 1A5AA 4N9BA 3LI1A 2E5CA 4UR8A 2OCZA 4O1BA 1ICPA 1WA3A 3PBUA 4MZ8A 1JUEA 1DL3A 3CB8A 4UUIA 3UWVA 1W5OA 4EOUA 3I6RA 3WJWA 1W56A 4JGDA 1KM0A 3UWQA 4DQWA 5I3HA 1QCWA 2X1SA 5HWJA 3CEPA 1HTIA 3ZR4A 1C9DA 1VYRA 4FIRA 3NL5A 1NF0A 3W70A 1ONRA 1JCXA 1F6PA 5AN7A 5LKYA 3TJXA 1ICSA 1QPOA 1KFKA 2ZZ1A 3CHVA 1VH7A 4NNCA 4AH7A 1EA0A 1GZGA 2QCNA 3EEGA 3IVTA 4JTJA 3IVUA 1ZHAA 3W2UA 3WK3A 1LOLA 1UBSA 2A2IA 3CIXA 2V81A 1VQTA 3ZWSA 3M9YA 6ALDA 3NQ6A 1JRBA 2RDUA 2C0AA 5FF2A 4LS0A 3KX6A 2QJIA 1K03A 5G5IA 2JKEA 4HSNA 3HPSA 4UFKA 3EX3A 3E12A 1NFBA 1FXQA 5FEWA 3M7WA 3LHWA 1OFOA 3SI9A 1B4EA 3SJ3A 3F03K 2I9EA 2ISVA 1D3GA 5LHEA 1I4NA 1A5BA 1BWKA 1F05A 2OX1A 2NXHA 2QJGA 4O17A 3OVQA 3QMTA 4DEFA 3FEMA 3H53A 1FDZA 4ALDA 1ICQA 2V2HA 1WQ5A 5AHLA 3G22A 4FNUA 3DZ1A 3P81A 4Y90A 1W37A 1KV5A 3CEUA 5I3FA 3GKAA 3OHIA 1YPIA 3MP4A 2FIQA 3TAKA 4IMCA 3LERA 5BNKA 1OX6A 2WNQA 1H60A 1Q6OA 2J6XA 2Y61A 5D04C 3EWXA 2YW4A 3CTLA 3W7OA 3FKKA 3HO8A 4QNEA 4NJGA 4XBSA 2B0MA 4WZHA 5DXXA 1PHQA 2VEIA 1Q6QA 2R91A 5D2TA 2HS8A 4O53A 1EP2A 3GNNA 3S5ZA 2VKZG 2H8ZA 3L66A 3TSBA 1UUOA 5CSSA 1B4KA 4BR1A 2VFEA 2J24A 5DCDA 2VEPA 2EKCA 1GT8A 4NXKA 4IPJA 2B4GA 3HG3A 2TPSA 1AL7A 1M6JA 1KFJA 2NUYA 3KOFA 4DF0A 3NM1A 3PBVA 1TCDA 5I3GA 4FX6M 2RDTA 3C52A 3W1QA 3TJLA 1F76A 3B05A 3N19B 1TJPA 2ZZ2A 2DZWA 2Q8LA 4UXDA 1K7XA 3W7CA 1FWWA 3TDFA 4S2CA 2QJHA 5KMYA 3DH7A 1LP6A 5D2YA 3EKZA 2QUVA 3VFLA 4H3DA 3JRKA 3GYEA 2HS6A 1T8XA 2CLHA 1XFBA 4O1CA 4O52A 2YCEA 4UFMA 4IMGA 1YLVA 4WXZA 1MXSA 2QCCA 5CZ0A 3NQDA 3U8GA 2FDSA 3I7QA 4E0CA 1NF7A 4R53A 4UTKA 5C6MA 5K2ZA 4LVBA 1XI3A 1QO2A 3EWWA 5A8GA 5ABTA 5D03A 3HGSA 4N6EA 3TW7A 1TSIA 3O16A 3A24A 4OV9A 3ABSA 5CZJA 3DGRA 5FEPA 3SY5A 1TRIA 4BK9A 5FF4A 3TMLA 2WPBA 4DBEA 5FEXA 2CZEA 4HN4A 2CLEA 4FF7A 2QUUA 4M6VA 3E96A 3DFNA 4BWLA 3NQCA 4PA8A 1OF6A 5BRBA 4UTWC 2ZYFA 1CI1A 3B0VC 1X8FA 3BG5A 4JX6A 4DF1A 1FWTA 2H6RA 3LCIA 3Q58A 3SFKA 2V2CA 4I7VA 3W7HA 2P10A 1DQXA 1J5TA 2VENA 3BLIA 3TH6A 1TTQA 4UTWA 4NVTA 3GR8A 3MBDA 4NNAA 3WK1A 2Z1BA 3GB6A 2W6RA 1O95A 3LLDA 4AAJA 3SECA 2YR1A 3L0GA 4JS3A 4PEKA 4UFJA 1WAUA 1WYIA 4WX2A 4ZZ9A 1VCVA 3PS7A 4XWUA 1IXPA 5F1UA 1DHPA 1RR2A 3L2IA 3TX9A 2CZFA 1G6CA 3W7EA 3S9YA 2PRHA 2VFFA 1PVNA 2Y62A 2GUUA 3PUEA 3WJXA 1KLYA 2E1DA 5D32A 4ADUA 4NU7A 4UFLA 1L6YA 1YXCA 4JEQA 2QDGA 3I7SA 1KFBA 1T99A 1KTNA 3PUDA 1QWGA 2QCHA 2YYTA 3OG3A 3W2LA 1CW2A 4JTGA 1SQ7A 4JIQA 4ZVJA 1QFEA 3GAYA 4RXFA 5AHIA 1LZOA 5L9FA 1ALDA 1EIXA 3T55A 4FNPA 1WOAA 2EF9A 2ZRVA 1TPH1 4Z1AA 3W7NA 5HJLA 1PL9A 2CFFA 2EAWA 4R7JA 2R14A 3HG2A 5DCBA 3L21A 1TTJA 4RJEA 1OYBA 2A7PA 1TPWA 1X1ZA 3RFAA 1XCFA 1H1YA 3NQMA 2ZRYA 1O4UA 1H50A 2A6LA 4JYFA 5CKSA 2NUXA 3QYQA 1KM4A 4K37A 3IRDA 1SUXA 1OFBA 1S3HA 3C61A 4MIMA 4FNRA 3MBFA 4AXKA 4EIVA 3IIXA 3GX9A 1KA9F 1QR7A 1H7XA 1SU5A 2GQAA 2C19A 2GOUA 3HG5A 3MP5A 4RCXA 3QMRA 2GJLA 4TMCA 2WNNA 3M43A 1VS1A 1H63A 4JDBA 1GTHA 1YTEA 5CPOA 1TPB1 4UTJA 1GVFA 1TJRA 2D73A 3GIYA 3CQ0A 3GXTA 3W1UA 3TXZA 1SO3A 2FB3A 1YTKA 2C16A 3NQAA 3W84A 1VC4A 1G4SA 1P4CA 4GNJA 4ZL1A 1MZHA 3HIJA 2VOMA 3Q2DA 1IGSA 1OVDA 3TMQA 3W76A 2ZZ6A 1J4EA 3TIMA 2NXIA 5FESA 4NJHA 2A5HA 5D09A 2Y89A 4LRSA 2A21A 3WK0A 1LBMA 3FA5A 4UTIA 2NX3A 5FI8A 5AC6A 5KZEA 1K02A 3EXTA 3U2OA 3PWAA 2Z0IA 4L4LA 3NPVA 1X7FA 5K7JA 3N2XA 1RD5A 2A4AA 3CU2A 4GUFA 5MHBA 4BI7A 3UXAA 4Y96A 3B06A 1S5WA 4WJEA 5DN1A 2WO5A 4KWWA 4RK8A 3LX9A 1OFPA 3P67A 4UTTA 1XBXA 3MWAA 1SO6A 3R2GA 5I3JA 2CLOA 4EF9A 2DZTA 1M5WA 2B7QA 2F7FA 4N6FA 1I2RA 2E77A 1R46A 4K7YA 3CIWA 1KW1A 1LROA 3LTPA 3S8HA 4LV9A 1G7UA 4YXGA 3BW3A 2ZTJA 4A21A 1TPEA 2CW6A 3C2OA 1OFAA 3RU6A 4GBUA 1ZJIA 2YW3A 3MJYA 2ATMA 1SW0A 1NSJA 1DBTA 2JBMA 3JS3A 3FFSA 1BTMA 3GKFA 1VCGA 2NX1A 1Q3NA 3EX6A 5HUPA 4B5NA 3NQ2A 4M6QA 4QIUA 1DV7A 2Z6IA 3TA6A 1F5ZA 4A3UA 4XZ9A 2Q3OA 2VEKA 3NPWA 2YYUA 4K7VA 2Q8ZA 1SZNA 3KVLA 3BVJA 4EWND 5D02A 2EHHA 4IPIA 4O50A 4IMFA 5EL1A 1DKWA 1TIMA 2ABAA 1TV5A 3QF0A 3NAVA 3TV8A 4XTDA 3D0CA 4ADTA 3FJLA 4A2RA 2F84A 4PL1A 1JQVA 1U83A 4O16A 2DZXA 4LS2A 3KVJA 4N02A 3NR0A 1GG0A 3PC0A 3GNDA 2BX7A 2DORA 2X1RA 3W7RA 3P5YA 2E6YA 1FDJA 2Q3RA 3L0NA 3QZEA 2EPHA 5BW6A 3CM4A 2TMDA 1I2PA 2VFDA 1N55A 3STFA 3PSWA 3LGEA 5G4WA 4NX0A 4XQ6A 4AF0A 5DLCA 5T26A 3M5VA 4N2YA 3LCWA 1AL8A 1OFRA 4HT3A 3MYPA 2H3BA 1HO1A 2C14A 3LBCA 3IEBA 5FF0A 4WY0F 4E2BA 1KBJA 4M19A 2JK2A 4HIBA 3NPUA 3NEVA 4IX0A 3F4WA 5FF7A 1CX9A 1A53A 1DQWA 4UTHA 2E6FA 1R47A 2P0OA 1EWEA 4UTUA 1MO0A 4IJBA 1XC4A 4WQ6A 4IQLA 3W7GA 3UY8A 5FF3A 3SSJA 3BG9A 1YTDA 4LVAA 1G69A 2TSYA 2WQPA 5EBUA 2V0TA 2KZHA 5HULA 3QMSA 3CLMA 2ATSA 3HGOA 1OFEA 2CZDA 3W6YA 2A6NA 1TPC1 2Y7EA 3MI2A 2QF7A 1E51A 2VFHA 5AYZA 2JGYA 4ML9A 1KBIA 2JGQA 2YDAA 3S6DA 4QISA 3ZWTA 1A50A 1OK4A 3LHVA 3OVRA 5AHFA 5F2LA 5DXYA 3UYCA 1ADOA 3PBWA 4UR7A 5U4NA 3UWUA 4C1LA 2QAPA 3T78A 2X1TA 3G8EA 3QPYA 4Q4KA 1H1ZA 2ZTKA 4PC8A 3U6WA 5U7SA 2RHGA 4O13A 3TNOA 2PRLA 2QR6A 1MEHA 3GK0A 1VYPX 5K9XA 1WOBA 5L6UA 3OA3A 2V5LA 2YX0A 1V7YA 3DBPA 1L9WA 4H4IA 1FXPA 4Z1CA 1XDMA 1LTDA 1H51A 4AVFA 5KITA 4QJ1A 1FQ0A 3EX1A 6TIMA 1AW2A 1VGAA 1OFDA 1VHNA 3O6YX 1Z44A 3ANYA 3E9AA 2YFNA 3GLCA 1TPDA 4PL2A 4LUJA 3UXDA 1TQXA 1W5QA 4QQ3A 3WJYA 3NG3A 3AJXA 4MFEA 4ORIA 4TO8A 5DY3A 4LS1A 4JTFA 2PURA 3G1AA 2FJKA 3TKFA 3S1VA 3L9CA 4XKYA 5G4EA 3T7VA 2DZSA 1FUYA 2ZZ4A 2DJXA 3FLUA 1C29A 1P1XA 3C0JA 4DO5A 1B57A 5GVJA 3NM3A 4FX7A 4IMEA 5D30A 4FNQA 3BK0A 3DAQA 3A21A 4I7WA 3KFTA 4FX8A 4RZ5A 1A5SA 3T4CA 1DJNA 3CWOX 1FY6A 4GRSA 4E2DA 3DFOA 1K8XA 4JR5A 4NZJA 3EX2A 3LI0A 4HPJA 3W7QA 3VI2A 3BW2A 1Q45A 1WX0A 3P82A 3GDLA 3O05A 2QKFA 1Y0EA 2A85A 4O15A 4GC4A 3UWWA 2X16A 1Z41A 2FPTA 3QEZA 2EGZA 3NL3A 3LRMA 3W71A 5KINA 2Y7DA 4AEOA 2BSLA 3DFPA 3LCFA 3QQ1A 3W74A 1XXXA 2DP3A 1S5VA 1EPXA 4RKAA 2A1YA 3GDMA 3QQ0A 3T40A 1M7OA 3W7PA 4K36A 3NA8A 5AHEA 1LBLA 3TQKA 3W1LA 3PG9A 1B9BA 2X30A 4OE7A 3PBYA 1P5BA 4RZ4A 4ZQNA 1F7BA 3OVPA 3TK7A 3RMJA 3S1WA 5HUOA 5LNRA 1MSSA 1VJIA 2ZQ0A 1DJQA 4RR4A 2CLIA 2QDHA 5D38A 1VCFA 1EWDA 3G1DA 1LDCA 2V2DA 1LRTA 1KFCA 4MUZA 1SW3A 3TXVA 3OEXA 3MW7A 3W75A 2VELA 2V82A 1VLIA 1SO5A 4QNWA 3W83A 1JR1A 1SO4A 3DU0A 4LW7A 2WSRA 5K3VA 4JTEA 3KRSA 3WK2A 2WJZA 3QJAA 2V5BA 3O6DA 1P0KA 3NYZA 4OBTA 3KVMA 4ZQCA 1TMHA 2RH9A 4CQ9A 2GQ8A 3W7KA 1I2QA 3W7LA 3DHFA 1BWLA 1R2SA 3BGJA 1OYAA 3GXNA 4TR9A 3G0SA 5HNRA 4UC5A 2WKJA 3B8DA 1F2JA 1IIHA 2QCGA 3VKJA 3NXFA 3NQGA 4UCGA 1FDYA 1L6WA 1OABA 3A5VA 1PE1A 2LLEA 1DOSA 1RPXA 2X2GA 1SW7A 4P2VA 4FHAA 1GTEA 2ZRWA 4J9JA 1LOSA 4EVZA 5F4XA 3EXSA 1H61A 2QUTA 3M44A 3P5ZA 4O28A 5C54A 1WBJA 4TU1A 4K8HA 4UMCA 4GJ1A 4WXYA 3W9ZA 5HWNA 5CZTA 2BTMA 1XBVA 3W72A 3I65A 4LVFA 1L6SA 1IXQA 3ELFA 5EA9A 4FIQA 4HNUA 3INPA 1U5JA 2XN1A 3PB0A 3HOJA 2NV2A 3PUOA 1K8YA 3LB0A 1JCMP 1RQBA 1RV8A 3W1NA 2R94A 3C56A 5CGQA 1SFJA 5DY2A 3VE7A 2DJLA 4FNTA 1TPFA 2AGKA 4HNVA 4X22A 4PCFA 3LDVA 3O15A 3QM3A 4I7UA 5LNSA 2BWGA 1W5PA 4KFOA 4JTKA 1F74A 3M0ZA 3W7MA 5D2WA 3USBA 1KM2A 3B4UA 4YWIA 3G8RA 3W2MA 4KKXA 4GUJA 2Y7FA 3STGA 3M16A 3LHUA 3QSTA 4JYEA 4JX5A 3CPRA 4AHQA 3FOKA 3PG8A 1OK6A 4GFSA 4ZQMA 1I2NA 1TTIA 3LHTA 3G1SA 1ZENA 4UMAA 4MZ1A 5HR7A 2DZVA 1SR9A 3MI3A 5KSWA 1O94A 3R8RA 1VR6A 1LLZA 1RZMA 1W31A 4EF8A 1JJKA 4MLJA 2WNZA 1LCOA 2VEMA 3A22A 3O8AA 2ZA2A 3OBKA 5EKYA 1JVNA 5LHFA 3R89A 3HB9A 1JUBA 4S2BA 1VHCA 1HL2A 4GUHA 3TFXA 5AOUA 4LUIA 1EUNA 4CNPA 1XKYA 4BI5A 3G3DA 2ZRZA 2A0NA 4AHPA 4ADSA 5LGZA 1H62A 4UNKA 2OMAA 4IUOA 4JY9A 1PS9A 4K39A 4CLMA 4XBKA 4DPPA 3BG3A 5AC8A 2HTMA 1DORA 4DPQA 4MYAA 3FJ6A 1WV2A 4JNMA 4JTSA 2B7NA 1FWRA 5G1YA 3LTSA 1QPQA 3W7DA 4I9AA 1WBHA 3MP3A 4GE8A 5HQEA 2E6AA 5IBXC 1O60A 4OQVA 1R2TA 1YPFA 3N14A 3W1XA 2VXNA 3HF3A 4L4MA 3NZ1A 3H55A 5TQLA 2TYSA 2NLIA 1QPNA 4MVAA 3GAKA 5AHNA 4OT7A 1XDLA 1HFBA 4RXGA 4O1DA 4HSOA 1EEPA 4YL2A 1TREA 3RNDA 2W0UA 1O5XA 5IBXA 3HBLA 1IIGA 3I68A 2H8XA 3QPZA 3STEA 2Y70A 3NQFA 2C6QA 1D3HA 3LRKA 3B04A 3O1NA 3G1YA 3O6CA 3ATYA 3TQVA 4ZQPA 3DFTA 5K4ZA 4DELA 3MYOA 4WY0A 4FO4A 3G1FA 3UZJA 4M5PA 4FB7A 5CPMA 3BARA 4X9SA 3SR7A 3OIXA 4NT0A 4NZFA 2A7RA 3NL6A 1D9EA 1ME9A 1AMKA 1FX6A 4UTMA 1LM1A 3BV4A 2C15A 1X6UA 2I1OA 5K9DA 1SZGA 4O54A 1GWJA 4JX4A 1GEQA 4NX5A 3W1RA 4NXSA 1T0OA 4LT9A 1W3TA 4NJJA 5F2MA 2WSYA 3HMJG 2BXVA 1YYAA 2YGYA 1FWSA 1QNVA 2QCDA 1ZAIA 3DENA 4DBDA 2C13A 3LXBA 3W7JA 4D2JA 3PY2A 1UJPA 2ZZ5A 1OFQA 5D2XA 4MY9A 3TR2A 2ABBA 3A9IA 2B7PA 5LZLA 4RZ6A 3B03A 3W22A 1S5TA 5G2WA 2ZA3A 1EP3A 4A22A 2I14A 4O14A 1H7PA 3R5EA 3IV3A 3E02A 4JDYA 2J9ZA 5DCEA 2QCMA 5TBOA 2YFOA 2NWRA 2A7NA 4O11A 3NPXA 5FEZA 4XTIA 2X1UA 2IQTA 3SZ8A 1C8VA 4KFNA 4OHQA 1RQEA 3CWNA 2CZ5A 1KTCA 3TW6A 4JD4A 5BMWA 5EY5A 4RLIA 1SZFA 3S0CA 3NZRA 5KTLA 3A23A 1OYCA 4PTNA 3QW4B 4ONVA 3WJZA 1GOXA 5E1QA 2OT0A 5G2HA 5CG7A 5KZDA 2V30A 4O18A 4MZYA 2R8WA 3C3NA 2ALDA 5A5WA 3MUXA 1PCWA 4C1KA 3IGXA 1OX4A 3PM6A 1JQXA 2GQ9A 3TE9A 3P8JA 3E49A 3TFCA 2YZRA 4O19A 1LBFA 3IIPA 3LCLA 3C8FA 1LRQA 4AF0B 5BOOA 3VCRA 4N4QA 4HNTA 4CCEA 3HPXA 5EMUA 5HWMA 4JN6A 3LHZA 1W3NA 4R34A 4AWTA 4LV4A 3N2MA 3NDOA 1OX4B 4FNSA 4NJKA 1LORA 2QCFA 3PSVA 1NVMA 4MY8A 2NUWA 1ZY9A 1GG1A 3W88A 3SIZA 3MI6A 5C55A 4P61A 3EB2A 4ICNA 3NQEA 3TSMA 1G4TA 4S1FA 3BGGA 3NL2A 5F2GA 1LLWA 2ZBTA 1MEWA 3DI0A 4IXHA 1OG0A 3V1PA 3LTYA 4MFDA 2FFCA 4AWSA 4AMAA 1EUAA 3P8IA 4X2RA 1TPUA 4GWEA 3W1MA 4JICA 1UASA 2AQWA 3HG4A 1SSDA 3P61A 1W0MA 1YDOA 3R13A 2YXGA 3TU9A 1WXJA 1DVJA 3P74A 3M5YA 4AHOA 3G1XA 3LHYA 5LNVA 4M7TA 3UNDA 1XUZA 3GVGA 1H7RA 1JCLA 3BLEA 2CLLA 1AK5A 2V8ZA 4FEZA 1G7VA 2YPIA 1I2OA 2E5BA 5CPNA 4O4VA 1P0NA 2G95A 4QSHA 1IXNA 3C2EA 3NVTA 3SGZA 3KXQA 1TO3A 1V5XA 3NGJA 1GPWA 3ATZA 3P7YA 2OT1A 3L5MA 1ME7A 3IGSA 4UTLA 3DKJA 3F1QA 4CCDA 1ML1A 5EPDA 5E93A 4N4PA 1TPVA 3NQVA 1KM1A 3ZS4A 2CU0A 1IF2A 3ABOA 4O10A 1LRNA 1TB3A 3SGUA 5CPLA 4YCPA 5H91A 3LV6A 3TC6A 3BPWA 1Q6RA 1Q6LA 3GR7A 3LM7A 3DFQA 3W85A 4JY8A 3LV5A 3W23A 2XN2A 1VZWA 5H2ZA 2HSAA 3G0XA 1THFD 1QOPA 2J88A 2PE4A 4LY8A 7TIMA 3C2RA 2GVLA 4ZQRA 3BLFA 3W86A 5AYYA 4X3ZA 4A29A 4CCCA 4O57A 4XKYB 1SSGA 3N34A 2H90A 4XUGA 4Z1DA 3B0UX 1SFLA 3DI1A 4HPXA 2E68A 4OGZA 1XBYA 1SPQA 5F4SA 1I45A 4NQ1A 4O12A 3T44A 5AB3A 4M6PA 2G96A 3RK8A 1OJXA 2XFWA 1IXOA 1ZNNA 3SW6A 5EYWA 4CNNA 1XUUA 1KFLA 1K7EA 4WD0A 2JKPA 3PR2A 2O7SA 3FIGA 3P60A 4O0ZA 3A5FA 2GPTA 4TIMA 3C2VA 4Z1BA 3N73A 5BMXA 3W07A 3TCEA 4N9CA 3M1ZA 3G0UA 1L2UA 3AO0A 4QITA 1GVRA 3FYOA 1RQHA 3NO5A 3R12A 5D37A 3W87A 2AAMA 5HINA 1RVGA 2ZA1A 1PV8A 3HGJA 3W1TA 3N9RA 4HKPA 1JRCA 3L5AA 2NX9A 3M6YA 5DELA 4BI6A 4K38A 1O5KA 3MHUA 4CQAA 4WOQA 2Y85A 1N8FA 3S42A 2BZNA 1EB3A 1OF8A 1KFEA 2O7QA 4R33A 2GJNA 4Y6GA 1EP1A 5CZSA 1JCJA 4LNYA 3ABRA 3L68A 1GVSA 4OWGA 1G4EA 3CC1A 3P84A 1WDWA 2WOQA 4LC8A 2QAFA 4MPQA 3W3OA 3O07A 1HG3A 1NEYA 4PH6A 4TX9A 1NAL1 4LTSA 4Z0JA 5E0KA 1YXYA 3ZFHA 1UB3A 2FB2A 4Z08A 8TIMA 4MKNA 5D33A 4GUIA 4TMBA 2V9DA 5I3KA 2C1HA 2NZLA 3W1AA 1YDVA 3N9SA 3LLFA 4BWLC 5IM51 3HGRA 4YMZA 5TIMA 3TROA 3LCXA 4UFHA 4YLWA 1GYLA 2Y6ZA 2JKAA 3GZ3A 3C6CA 3NOEA 5KZMA 1JULA 3RF9A 3HPZA 2GVJA 3VE9A 1A5CA 1Z42A 2RKXA 3EX4A 1KTBA 3BO9A 5K9CA 3W1PA 1I8JA 3L0KA 3RLUA 4ZMGA 1F73A 4WUIA 3G18A 4HNNA 1QOQA 4UFIA 1VLWA 1W8SA 4QAIA 4RX0A 4E38A 3VNDA 4HHPA 4ZQOA 2ISWA 3FKRA 4MJMA 2DZUA 2J9YA 4CQ8A 1VYSX 4UIOA 2DZPA 3QRHA 3C2FA 4LOCA 3QSRA 4NNBA 4AWUA 1K8ZA 3EXRA 4Y8FA 4RV8A 4JIPA 3STCA 1R30A 1YXDA 1BEUA 3EKLA 3UZ5A 2Y63A 3LXCA 4PFMA 3GXPA 3MMTA 4MY1A 3UD6A 2VC6A 1XBZA 5D05A 1BKSA 4BFAA 1TYGA 2WSQA 3F4NA 5CSRA 1Z48A 3G24A 1ZCOA 5DBTA 4UNLA 3B0PA 1KV8A 1TTPA 2H3DA 2RFGA 3S5NA 1N7KA 2E5DA 3S1UA 2OZ0A 1VRDA 4GUGA 4KWVA 2BLEA 4DF2A 5I3IA 4PODA 5DBUA 4N9DA 4OV4A 1FCQA 5AYXA 3KAOA 5D2VA 3TSDA 3LCHA 1HUVA 3HJZA 4POCA 3NQ8A 3IIVA 4JTUA 1FWNA 4JTTA 4UMBA 3DXIA 1QO5A 3DHDA 2FLIA 2VFGA 1JUKA 5LNUA 1ZAHA 4W9TA 1W1ZA 3YPIA 1TQJA 2WV8A 3N3MA 3PAJA 3GDTA 2TRSA 4JTHA 2NWSA 1K3UA 3V75A 4A2SA 4H6KA 4Y9AA 3LCGA 1W5NA 1XL9A 4DO6A 4Q33A 4CNOA 1JCYA 3EWZA 2ZRXA 1QMLA 1W3IA 3DFSA 2FPYA 1EX5A 3L67A 1R2RA 4IMDA 1W5MA 3KRUA 2NXGA 2W79A 2CLKA 4AB4A 1X1OA 3E0IA 3M41A 3EWYA 1GVOA 4DO4A 1PCKA 1LOQA 3I7RA 3LRLA 4K8EA 1FBAA 5SWUA 1G67A 1M7PA 4K6AA 2OJPA 1YADA 1QAPA 2NV1A 2FTPA 2ZZ3A 3EWBX 5F2IA 2GVGA 3IGUA 3P62A 5LSMA 3W73A 1KLZA 5G1TA 3FYPA 3TAOA 3GDKA 3PB2A 3FS2A 4MJZA 5C2XA 2ZCGA 1QPRA 2CLMA 4IWWA 2E6DA 3M5XA 1H5YA 2PCQA 3QH2A 2YSWA 2QCLA 3HQ1A 4YCOA 4DXVA 1FCBA 3WJSA 3MHFA 4Q32A 3M5ZA 5K4XA 3G3MA 1LYXA 1ZALA 3P80A 4IOTA 4U28A 2XN0A 1PHWA 4UTTC 4MLRA 3TQ0A 4FXSA 4KFPA 4O8RA 1TV7A 2P1FA 3QC3A 5J5RA 2ZZ7A 3QW3A 3GDRA 2CLFA 2PRMA 3H54A 2RDWA 1FCUA 2CWNA 3PF3A 4LVGA 1F6KA 4NJIA 3NNTA 1AW5A 4LC6A 4O1AA 2QCEA 5G2IA 1H7WA 4WY0B 3S5YA 3THQA 5F4WA 2Y88A 3PVFA 4MYXA 4N9EA 2QEZA 1TV8A 5C5YA 3UQNA 3MO7A 1GQNA 1GYNA 1HO4A 3JR2A 3IVSA 1W54A 3S5OA 1TRDA 1UCWA 1B3OA 1PIIA 3L65A 3PULA 1FCVA 1XM3A 3G1VA 3MHGA 2B7OA 3IIOA 4ORMA 3UWYA 4M7SA 1T96A 2G97A 5AHMA 3LBMA 3UPBA 5J5DA 3EWUA 4IGHA 2QCDB 4FXRA 1MEIA 4NUWA 5AC7A 5LGXA 1J2WA 4JTIA 4Z0SA 5HR6A 5F1VA 2UV8G 3G1HA 2G5WA 4OU1A 3QFEA 4QM1A 1GJPA 4JTLA 2ZDRA 2E09A 2HMCA 1KM6A 3Q37A 3Q94A 5LNWA 3DKLA 3UWZA 1ZFJA 4LWWA 4IX2A 5HMSA 4O0KA 3LXAA 3K30A 3S1XA 2C3ZA 3TC7A 3C4UA 3NQ7A 1AG1O 3W2NA 3ABQA 4WOZA 1AW1A 4LVDA 3W2JA 3KVKA
chains in the Genus database with same CATH superfamily
4GBDA 3GU1A 3CO8A 2FZDA 1E43A 1YDNA 3LPOA 3RCYA 3L5LA 3WMSA 1V6TA 4IFOA 1JDFA 1UIPA 1JCNA 3CT7A 3W7IA 3BLKA 2DU2A 1RLCL 3WFAA 1OHLA 4Y2WA 3TYZA 4J4KA 3VKAA 3VGHA 4DJFA 1ZBCA 1TV4A 4LF2A 1DE5A 2FQIA 1ZAJA 5HOSA 2FPVA 1JD9A 4M51A 3GBEA 3AJ7A 3ARXA 1ZP4A 2WCGA 4YVPA 4S3DA 2VGIA 1E40A 1OX5A 3UY7A 1GOQA 4E3VA 4LU0A 1ME8A 4U5IA 4QE1A 1KWKA 3PZUA 4C6BA 1A5AA 4N9BA 3MA8A 4O1BA 4YVXA 1ICPA 3WQFA 4FOJA 4MZ8A 4AY1A 2O92A 1W5OA 1W56A 4F0HA 1Q7ZA 1XISA 4PUWA 1R3WA 1UWAA 5HWJA 3CEPA 3VX0A 1GPFA 3VDBA 3ZSTA 4Y7EA 2FTWA 1F6PA 4IUGA 3MS8A 1TA3A 2MUCA 3B8SA 4RE2A 1XSIA 4AH7A 1CNVA 4PB5A 1GZGA 3DBNA 3QQWA 1ZHAA 1RD6A 1LOLA 1F4AA 4CQDA 3ZWSA 2NV9A 3M9YA 4H9UA 1EA9C 3NQ6A 2PDYA 1MFVA 3R1ZA 4TUFA 4MMWA 5FF2A 4LS0A 1K03A 2XIIA 3EX3A 3SJ3A 1S39A 2I9EA 1D3GA 1F05A 4GYFA 3S9IA 3GVRA 4LAOA 3QMTA 4GJIA 3W00A 3BSHA 3FEMA 2WW5A 3CAKA 1FDZA 2HVMA 1ICQA 2V2HA 4ALDA 5JBFA 2WXDM 2D24A 4GIEA 3DZ1A 2PWHA 2G3MA 5CEWA 3OHIA 1EZWA 2FIQA 4J28A 3E1F1 2ACRA 4WR3A 1OX6A 1VFUA 4QS5A 4ZXLA 2Y61A 2PDFA 2BBFA 3UZZA 2YW4A 2GVEA 4MTVA 4D71A 4QNEA 4WZHA 5T8GA 5DXXA 3EYPA 2W92A 3KWXA 2HS8A 4U5KA 4O53A 4TXEA 5REQA 1ZU8A 4GCAA 4BR1A 2J24A 4NRRA 2ACSA 4Q22A 2MNRA 4NXKA 4IPJA 4PBGA 4AD2A 1HKVA 1TCDA 2RDTA 3EBVA 3WKZA 4IP7A 4QLLA 2ZZ2A 3KTSA 2Q8LA 3SIMA 3L4ZA 1MW2A 2QJHA 5A8OA 1WE5A 5D2YA 4CU8A 4D6DA 4AC1X 3VFLA 1YQ2A 4ZFMA 7PTDA 1T8XA 3GG1A 3AXMA 2PTYA 3AISA 4O52A 2YCEA 4UFMA 2D2OA 4IMGA 1YLVA 4QG6A 1YMYA 2WAGA 2XVNA 4XSMA 2HPMA 4DAFA 3W27A 2HVOA 2GQ3A 4UTKA 2VDGA 2OFJA 1XW8A 1XLHA 5ABTA 3ZO9A 1VFOA 3O16A 3DFYA 5CJMA 4HMNA 4BK9A 4BA0A 1PDZA 1VD6A 2POZA 3A4JA 2CZVA 3DFNA 4BWLA 2OODA 4PA8A 1V79A 4AY7A 3ZJ7A 3GO2A 4ZB0A 1CI1A 3BG5A 4Z17A 2WWDA 4DF1A 2VD8A 2ZXQA 2GDVA 4C91A 3W7HA 3GXIA 3N4EA 3U7BA 1XD1A 3FA3A 3QVQA 1OC5A 1J5TA 5EFDA 4OOZA 4UTWA 5GNXA 1QVBA 2OB3A 4NNAA 3WK1A 2Z7GA 3GB6A 1BSLA 4AVOA 5IOBA 4UFJA 4CD8A 4WX2A 4ZZ9A 1UMLA 1CCWB 1IXPA 2AMGA 2CZFA 4KRUA 3VNMA 1D2KA 3WJXA 1PVNA 3WBAA 2E1DA 5D32A 4NU7A 5FJRA 3TJIA 1YXCA 4D6IA 4WJXA 4ICMA 4EAMA 3PUDA 3CPUA 3QR3A 1QWGA 2QCHA 2NVDA 1E4MM 1E0WA 4LY4A 1E3XA 5AHIA 5L9FA 1LZOA 1ALDA 4L6DA 3KOWA 2MANA 1FFQA 3EPOA 3O6AA 3WH9A 1HXJA 4A3QA 2R14A 3NSNA 3CV6A 3B3DA 3SCWA 1KC7A 1IT8A 1OYBA 4AD1A 5CC3A 2QPUA 1UWUA 1X1ZA 1XS2A 1XCFA 1BYAA 3IJ8A 2A6LA 4QX4A 1LLOA 2NUXA 3AIVA 4HK7A 1KM4A 3CBWA 2XISA 3IRDA 3HURA 4MIMA 4FNRA 4QLKA 2NQZA 4AXKA 4HTBA 2PDCA 4MPKA 3IIXA 4JN7A 1QR7A 3AXIA 4FLSA 3EMQA 4PRRA 2GQAA 2C19A 3MP5A 2WNNA 1GTHA 5H8MA 1F3WA 4UTJA 3UVIA 1UHVA 1ZP3A 3CQ0A 3GXTA 2PC8A 2FB3A 2DV0A 3NEHA 1F3TA 1J10A 4YPJA 1UW9A 1P4CA 4GNJA 4ZL1A 5BXTA 4GVIA 1OVDA 4J27A 3TMQA 4A05A 4WKFA 5BRQA 1R9ZA 5HJXA 3QTPA 2CHOA 2NXIA 2DQWA 5FESA 1A5MC 4FP1A 2G4JA 1DEDA 3WK0A 3NGFA 1GKPA 3RUBL 3ITTA 4UTIA 1GKRA 3N4AA 5AC6A 4U10A 1MRAA 2Z1VA 1FRBA 1PZ0A 1O1ZA 3BAXA 2BHYA 3N2XA 3LSBA 1RD5A 2YDQA 2E1WA 3DYPA 4FR6A 5MHBA 4BI7A 1OEPA 4UQDA 4IM4A 5DN1A 1A49A 1DWGM 1E1FA 1XBXA 4HHLA 4EF9A 3ISIX 1EDGA 4G6CA 1ZQ5A 2B7QA 3DG6A 2GLKA 5A6KA 3PBMA 1BVZA 1MNSA 4F3HA 4M82A 3M0LA 1G7UA 4YXGA 2ZTJA 4L4PA 3TN4A 3N12A 3FYYA 3KEHA 2J8FA 1E4NA 4G7EA 3VD5A 4LJ3A 2NSXA 3GD6A 5ABFA 5HUPA 1KRAC 4M6QA 2PDMA 1X6LA 3OGSA 4YWSA 5GNYA 4H9MA 1KGXA 3MCOA 4A3UA 1YE6A 2W27A 2YYUA 1VEOA 2Q8ZA 1T5AA 5D02A 1EJSC 1DKWA 1TIMA 3QF0A 2QJMA 4XTDA 1VRXA 4ADTA 3FJLA 2F84A 4WSKA 4REQA 2VHLA 2AKZA 4IIGA 2DIEA 2DZXA 3FJ4A 4N02A 4GX8A 3V0TA 3HFTA 3VUSA 4LAZA 3LYEA 3H2FA 1VBJA 1QI2A 1FKXA 1M53A 4Z2HA 3QZEA 3OTRA 4R5EA 1CGXA 5E5CA 3PSWA 3EZ4A 3LGEA 1S5NA 4GC3A 4GGBA 1EF2A 3SY1A 2BB0A 1XLLA 1UR3M 4J3TA 2C14A 4AD5A 5FF0A 1P6CA 6REQA 1FWFC 3A47A 2GJXA 3GXFA 3NPUA 3GZAA 1XP3A 1V7AA 5A1AA 4X0VA 3MVIA 2P0OA 1MO0A 4IJBA 1DHKA 2XVKA 1E9IA 2VT0A 1QW8A 3UY8A 1V51A 4D8ZA 5GPRA 1U1HA 3R4IA 1W3LA 3KCOA 3LK6A 3KBVA 1G69A 2WQPA 3CLMA 2ATSA 3HGOA 3W6YA 1HT6A 1TPC1 2Y7EA 2XH2A 5IFTA 2OSXA 2REQA 5IFPA 2R24A 2JGQA 4ZCWA 1H0GA 4QISA 1LUCB 1OK4A 3LHVA 5F2LA 5AC4A 3PBWA 6ENLA 4BJHA 5M2FX 2OYLA 4Q4KA 1SJCA 3GM8A 4CGTA 2XTKA 5CLTA 3ZQ9A 2PRLA 3GK0A 3OA3A 2BHZA 3DBPA 3PZTA 5KITA 4UOJA 6TIMA 3EX1A 1QHOA 2Q8XA 2D0HA 3IJ7A 3V35A 1VHNA 3M0XA 2VC7A 4DUXA 3CT2A 1EJXC 3WD1A 4FALA 3H7RA 4LUJA 3LQLA 1W5QA 1FH7A 5DY3A 3BANA 1F61A 1ZB5A 4LS1A 4IFKB 3B8UA 2HPIA 3G1AA 4JPGA 4XKYA 1NDWA 3CV1A 2DJXA 1YRRA 1C29A 1GJUA 2W4XA 4AX7A 5JUVA 4ZFCA 4NI8A 3A21A 3KFTA 1ZUAX 4AFYA 3B4YA 1ECEA 3HU7A 4W8LA 3CWOX 3I3BA 4GRSA 1K8XA 4JR5A 4HPJA 1TX0A 3I3DA 3BJFA 1ODZA 3O05A 2QKFA 2A79A 1E6ZA 4JKMA 3W4RA 2OG9A 3F5KA 4DAIA 1UMYA 1Z41A 3QKEA 4QCFA 1R8LA 3W71A 5CBJA 3PP7A 5KINA 2BSLA 4MAVA 3JW7A 3QQ1A 3W74A 2G37A 1M41A 1XSJA 4RKAA 3SCRA 3GDMA 3C0SA 1M7OA 4M56A 3EDEA 5IDZA 1Y7VA 3W7PA 1K70A 3C0LA 3J7HA 3HJEA 1O6IA 4GHRA 1J12A 1WZLA 2DVTA 3T8QA 4OE7A 3NQBA 3K2GA 4JTCA 3CB3A 1F3XA 3OVPA 3TK7A 2D0FA 4DJDD 1PX8A 1MSSA 1VJIA 2WQDA 1HL8A 1AZ1A 2YCIX 2P8BA 1EWDA 3G1DA 3GTNA 5D9MA 1I60A 1LRTA 5C9UA 4MF4A 3WD0A 2ZDSA 2XUCA 1GZ1A 3KZSA 1UD4A 2DDXA 3M46A 4V15A 3DU0A 1H49A 1B3WA 4LNCA 4Q8WA 1J0JA 4GZIA 4PTXA 1I1WA 4ZQCA 4FXFA 2GQ8A 4L61A 1TMLA 1I2QA 3OZYA 3RHGA 3WNOA 1R2SA 4EPBC 1O5QA 3M0JA 3GXNA 3TTOA 2WKJA 2QYGA 5JU6A 3VKJA 2C8NA 4FXJA 1FDYA 4EACA 1ZGDA 1L6WA 1OABA 4GVGA 2WJFA 3IACA 1LL6A 2QVNA 1W1PA 4AZCA 4FHAA 4ZO7A 3HV8A 4CQCA 1AJ2A 3EXSA 1X98A 4K8HA 1A4LA 1XBVA 4LVFA 4DWSA 3TOYA 4XZHA 3S9ZA 3K46A 1JI2A 1WB0A 3HOJA 4JIEA 4F0LA 1XX1A 1XFCA 2HNHA 7ENLA 3PUOA 3FNDA 3LB0A 1FFRA 4Q4RA 5DT5A 2RUSA 3VE7A 4J3SA 1TIWA 4FNTA 2BGSA 5XIAA 1OCNA 1AMYA 4PCFA 2O9PA 4X22A 3O15A 3HA1A 3QM3A 5LNSA 2BWGA 2IPFA 4MKSA 3WZ0E 1BRLA 1KM2A 3VGBA 3B4UA 3E5BA 4L9XA 1LT7A 3W2MA 4GUJA 3CPRA 4KEMA 3FOKA 1UWSA 4MB4A 1OK6A 4GFSA 4ZQMA 1I2NA 2D20A 5HR7A 3FDKA 4B9ZA 5JBEA 4F0KA 1SR9A 3GNPA 4W87A 5KSWA 1FTXA 1NY1A 4S38A 3LQGA 1FWDC 1RZMA 4C6CA 4FA3A 1LCOA 2VEMA 2A3LA 5EB8A 2ZA2A 2KX9A 3OBKA 2XM1A 1V6VA 3HB9A 2P5NA 1T6MA 4D6FA 1EUNA 1CB7B 2IKJA 4BI5A 4LYKA 2OGYA 2ZRZA 4XV0A 3VXGA 3UZXA 3VNZA 4IUOA 4JY9A 1PS9A 1HX0A 3PZNA 4DPQA 3K8MA 1WV2A 4JNMA 3LTSA 1M04A 3IJ9A 2ZUMA 4PMYA 1QPQA 3W7DA 4I9AA 4MWAA 2GGHA 3EOLA 5HQEA 3VIOA 3D6NA 3GH5A 3W1XA 4YN5A 4KERA 1RSCA 5AKQA 1UOZA 3FVMA 1AQMA 3CJPA 2NLIA 2WNWA 4OT7A 4O1DA 2Q6ZA 1FP9A 4LB3A 1TREA 4GVHA 1R38A 4R85A 1O5XA 5IBXA 3HBLA 2FMOA 4E8DA 1IIGA 2PZNA 3WBEA 3UBPC 3N3TA 2C6QA 1LG2A 2VX5A 4I9MA 1KR0A 3A13A 2CETA 3S6TA 3WDIA 5K4ZA 5IRPA 3A6OA 1R9YA 1R7OA 4FO4A 3QFWA 3AOFA 1DWFM 1EFZA 2A7RA 2BGQA 5DMYA 4L7ZA 1LM1A 2GSEA 5K9DA 2I1OA 1SZGA 4O54A 4PUNA 3U4FA 3TQPA 3VYLA 4GK8A 4JX4A 4QFUA 1FHLA 1IWAA 2WSYA 3FY1A 1OSEA 2VZVA 4GOAA 2YGYA 4KCVA 1U5HA 2IPGA 3LXBA 1CGWA 3BMWA 5DT7A 2DVUA 4J1OA 3KW3A 3PZOA 4WSHA 4RZ6A 2Y8KA 2UWFA 3B03A 3W22A 5G2WA 2ZA3A 3R5EA 3IV3A 1IEVA 1J5SA 2XG9A 4JDYA 5DCEA 2NQHA 4GQ0A 4KCUA 2A7NA 3VDHA 1R3QA 5FAGA 2J79A 3SZ8A 1C8VA 3EOSA 1RQEA 3TONA 3TW6A 4RLIA 4UOQA 3DG3A 1SZFA 3RN6A 3WJZA 3F4CA 5MKGB 4P8WA 1BLIA 5CBBA 3EPMA 4H7VA 2EG7A 2GQ9A 5ECVA 1ELSA 4C6FA 4EANA 4QHRA 2PLCA 3LCLA 1CXHA 5EMUA 3REQB 3LHZA 1W3NA 2J8TA 3MTWA 3N2MA 1BG9A 4JZ5A 4XAGA 4ZBCA 3U7VA 3WDRA 4HZ6A 2NUWA 3QN3A 5BCAA 1Q8JA 3OW1A 1S5MA 3W6LA 4FOKA 3ARPA 4ZXOA 2D0GA 1LLWA 3W02A 3WUFA 1E6SM 1OG0A 3LTYA 1BXBA 4MNMA 4X2RA 2IKGA 3KHDA 2Q01A 4JICA 3S5SA 3HG4A 4PUUA 1OGGA 1QHPA 2WVUA 2BOEX 4ZE4A 3P74A 3VCNA 5TNVA 3LHYA 3V5FA 3VPLA 4OBSA 3UZWA 1YW1A 3WLIA 3LMYA 1H7RA 2I9UA 1ZL1A 1AK5A 4B2DD 1G7VA 4XG1A 2E5BA 5CPNA 4O4VA 3MPGA 4H2CA 1XKJA 2WMJA 3N2OA 2PP0A 2UY5A 5CJNA 1TV3A 3IGSA 4IIHA 2DEPA 1XIFA 1B5TA 2YBUA 1ML1A 4JEJA 3PUGA 3SADA 1GCYA 4I6VA 2OEKA 1KM1A 1F4HA 1DXFA 4O10A 2PDPA 5CPLA 1Z69A 5H91A 3TC6A 1HZYA 3LM7A 7REQA 5H2ZA 1TR9A 2AAAA 1J18A 1THFD 7A3HA 1QOPA 4DZIA 7TIMA 3C2RA 4ZQRA 3GC5A 2HBXA 1LL7A 1XLMA 1QI4A 1DWHM 4CCCA 4O57A 3N34A 2H90A 1PJ9A 4HA3A 1UJQA 1R5YA 1M65A 1M1BA 1I45A 2BGNE 4O12A 3WX7A 1WKEA 1BAGA 1XUUA 2FZBA 5I24A 3R10A 4WD0A 4XZIA 4MDOA 1J2BA 5J04A 3A5FA 1RK5A 5CPQA 3ES7A 4AX6A 1RCQA 4D72A 5AYIA 2ALRA 3WFLA 3PJUA 2VO5A 3TCEA 1XYLA 4JFUA 1UKPA 3ARQA 4H8UA 1MXGA 4H7CA 3BAYA 5D37A 2EPLX 2ZA1A 3HGJA 5A6AA 4YYFA 2GL5A 5DELA 4BI6A 1E6QM 3DCPA 1Y65A 2ZXAA 3EWDA 2WHMA 1EB3A 1OF8A 1J9YA 2E40A 1G0CA 4R33A 4Y6GA 1EP1A 1JCJA 4ZTXA 1GUVA 1KFWA 1P6WA 4LXFA 3ABRA 1ADSA 4OWGA 1G4EA 1V3KA 5KZ6A 1MXDA 2AGTA 2IPWA 2QDDA 4LC8A 4PBEA 3UXKA 1IEXA 2XSBA 1RA0A 4GI9A 4Z0JA 5CJ5A 2FB2A 1N8IA 4Z08A 8TIMA 1BVNP 3RITA 5I3KA 3USZA 3W1AA 1FP8A 5RUBA 5ECUA 4OOUA 3VIPA 3HGRA 1KBKA 3N25A 4B3LA 1FWCC 5A6MA 2IPJA 2G3IA 5JQ9A 3GZ3A 3NOEA 2PWDA 1R9XA 1QJWA 1JULA 3OLIA 2VP8A 4ACZA 2GVJA 1A5CA 1NWSA 1E0TA 2E4TA 2FGLA 3L4VA 2X8RA 1UROA 2I56A 4HNNA 4UFIA 1VLWA 4WDXA 4RX0A 1XLBA 2ISWA 5FJTA 4CQ8A 3O0KA 1WZMA 4NNBA 3IARA 1K8ZA 3ARUA 4UOZA 2VUNA 4Y8FA 4RV8A 4DNMA 3UZ5A 2Y63A 3LXCA 4C1NA 1W3KA 3MMTA 4MY1A 1BXCA 1XBZA 4LUTB 2YCLA 5EMYA 2QNEA 5HNNA 2WSQA 2NQJA 1Z48A 3G24A 1ZCOA 4UNLA 3B0PA 3CQHA 1KV8A 3S5NA 2H3DA 1DIDA 3FGCB 4UQBA 2XZ7A 4L80A 2I57A 1V02A 3ZT7A 3SY8A 4H9TA 1FCQA 4IMAA 1PIFA 1CT5A 2Q71A 4IIDA 1Q6GA 1DYSA 3IIVA 3R11A 4JTTA 5A6BD 1KBBA 4PB4A 4M1BA 4I9JA 4OIFA 2VWSA 1OT1A 1JUKA 4LAMA 1ZAHA 4W9TA 2VWTA 3AMLA 4DWDA 4AISA 3FW6A 3ZM8A 1TQJA 4Q4SA 2WV8A 2R1MA 4XSLA 3RO8A 4A2SA 1E0VA 4H6KA 3L12A 1XL9A 4CNOA 1MW3A 3K4AA 1QMLA 4H9YA 3DFSA 1R2RA 2XVLA 4C65A 3I6TA 4F0RA 4AIBA 3EWYA 3BCFA 2EPMX 3I7RA 5SWUA 5D9NA 1M7PA 3IUIA 2WM0A 3SQLA 3MMWA 4BEUA 3DC0A 5F2IA 4M3PA 3IGUA 4JKLA 5G1TA 3FYPA 2PTDA 3TAOA 3GDKA 4Q3MA 5I79A 3RCMA 3H2OA 3ARRA 3B8WA 1JPIA 2ZCGA 1QPRA 2CKRA 2VCAA 1GOWA 4H8VA 1H5YA 1B31A 2YSWA 2VEFA 1I0BA 1PDYA 3WD3A 5EMLA 1E1EA 1FCBA 5BZAA 3H26A 5EGRA 3Q4DA 4Q32A 3CQKA 1Q2RA 2W63A 5K4XA 3G3MA 1ZALA 2O4MA 1AD1A 1E0XA 2XGZA 1KGWA 3TQ0A 4FXSA 3DX5A 3QW3A 4ZOEA 1CWYA 1MZRA 4ROQA 4ZR8A 4DJFD 3AS0A 2YL5A 1ESWA 3ANUA 3GWQA 4M80A 2RDWA 1FCUA 5JH1A 3F5LA 3MCNA 1NDZA 4LVGA 1H7WA 2JFEX 2FHFA 3PVFA 4GI6A 1A5KC 4IHCA 4E4FA 4TTGA 4B5VA 5C5YA 2PTWA 1GQNA 1GYNA 1HO4A 4Y8EA 4EXBA 1RLDA 3OG2A 3VABA 3GW3A 3IVSA 3VCCA 3GVQA 3GG7A 1TRDA 2W66A 2WBKA 1VBGA 1B3OA 2ESCA 3C3UA 4ZOBA 5C9ZA 3PULA 3MHGA 1XIDA 3IIOA 3NZPA 3UGRA 3AHTA 4ORMA 1T96A 2C1GA 4GLEA 2Z24A 5J5DA 1CGTA 2QCDB 4FXRA 5AC7A 5C8BB 2BS9A 5T91A 4QM1A 4ERIA 4JTLA 4OFCA 1RJRA 5BXSA 5C7VA 3FK4A 2GGGA 2Q02A 3PPGA 3V1HA 1FVPA 4H04A 2YJQA 5HMSA 4AW7A 3LXAA 3K30A 4GYKA 3WO8A 3Q45A 3TC7A 1QPKA 3C4UA 3CYVA 5I02A 1N82A 3L4TA 2J47A 1P0BA 4LVDA 4WOZA 1WAWA 4WHBA 3QY8A 3A3XA 3CZEA 4A8NA 3PBGA 3AC0A 5C9RA 4NAFB 3OU8A 3ICJA 1A5NC 1OY0A 4I8DA 3RPMA 4O4WA 2WJDA 2J66A 3VOHA 2ZFAA 4L5ZA 3KHJA 4CEXC 3O63A 1K4HA 1D8WA 4BF9A 3LOTA 1RBOB 3ARVA 1K7FA 3TUUA 2DSUA 2DUZA 2DQXA 1V6YA 1Y5WA 1FH9A 2GVYA 4U4MA 3CTTA 2ZRUA 3URNA 2VFIA 1VFHA 3THAA 1UUMA 1H11A 3IJIA 4JYDA 1KM3A 2J9XA 5D8WA 3RILA 2GGEA 3LI1A 5B80A 1WA3A 6XIMA 3GNOA 4C60A 1JUEA 1DL3A 4HNCA 4EOUA 3I6RA 1XF0A 4JGDA 1KM0A 3CGTA 3PN8A 1GVEA 1HF6A 5I3HA 1GOKA 1HTIA 4FIRA 3W70A 3KZPA 5AN7A 3BAJA 5LKYA 3TJXA 1M3UA 3C2YA 1ICSA 1YDYA 1X97A 3N6HA 2ZZ1A 1BGAA 3OZOA 4MWAE 3FSUA 2PWFA 2Y1HA 3G77A 4JTJA 3IVUA 3GC2A 3MO4A 3WK3A 1UBSA 2A2IA 4BZYA 1S2VA 3CIXA 2V81A 1E4IA 1VQTA 3PNZA 6ALDA 4KEUA 2CBJA 3DGBA 1JRBA 1N2VA 4LAKA 4NIRA 1PBGA 2V69A 5G5IA 1EIBA 1P43A 3PTMA 4HSNA 4I90A 1C3FA 4NAEB 4P8VA 3E12A 5FEWA 4EPKA 4AD4A 3AIRA 1OFOA 5C9WA 3F03K 1ZJAA 2ISVA 4INFA 1RAKA 2L5HA 1A5BA 2AKMA 4DHGA 1GW9A 2V3EA 2QJGA 3VFCA 1S2AA 3BQ6A 3OVQA 4O17A 4DEFA 1M03A 1JYXA 4YYCA 5EFFA 1WQ5A 3QR0A 3G22A 2Z2BA 2ZX9A 4Y90A 2X09A 1CZ1A 3R0DA 3UJRA 5I3FA 3GKAA 1YPIA 1J79A 3G6MA 3LERA 1XIJA 3WLRA 1HJQA 1J6PA 1KGUA 5BNKA 5D04C 3THDA 5F7UA 1CXLA 3UCDA 3BLOA 3ECQA 3UJSA 3A4WA 3QV9A 3W7OA 3CMJA 3FKKA 3HO8A 4XBSA 2B0MA 3EDFA 1PHQA 3H70A 1Q6QA 4DNHA 2VVNA 3VC5A 5C0QA 1EP2A 3GNNA 3S5ZA 2H8ZA 3L66A 5CSSA 1B4KA 4L56A 2VFEA 1VBUA 4KGJA 3RRXA 1DTNA 2CXGA 4HPGA 2PSNA 1ZPTA 2TPSA 1AL7A 1GHSA 4W88A 1C8YA 3FCPA 4FX6M 5I3GA 1UD6A 1F76A 1Z32X 2ZC8A 1E56A 3B05A 1TJPA 1VJSA 3CZJA 4HSHA 1FWWA 1Y5XA 4WDTA 2Z1SA 4E5TA 4S2CA 3BLPX 3WQ4A 1ZBVA 3GR4A 1LP6A 1BPLB 4GQRA 1WDPA 1IT0A 3OHMB 3B9AA 3NDYA 3JRKA 3THUA 3ITVA 1EJ7L 4RDWA 3E5PA 4WXZA 1MXSA 4O0QA 4HQVA 1V3MA 4A8LA 4JFTA 3ZVHA 1YEYA 2GGIA 5CZ0A 1C90A 1JAKA 3VD3A 8A3HA 3DOPA 2O56A 3I7QA 4E0CA 2ZWZA 1NF7A 4R53A 4TTUA 4LVBA 1J93A 3EWWA 2OYKA 3H7VA 1VENA 3HGSA 4ZODA 1WUFA 3UR7A 4H83A 3VAVA 1EF3A 2UY4A 4XZNX 3KCJA 3AIWA 4HN4A 2CLEA 4M6VA 4CU7A 3WN6A 2X41A 3E96A 3NQCA 1LWIA 3DECA 3T0AA 1OF6A 4MJ4A 1HKMA 2R1KA 2ZYFA 1OCBA 3B0VC 1X8FA 4US5A 2H6RA 4H9XA 3Q58A 3SFKA 2V2CA 1R3RA 3QHMA 4RDYA 1S38A 3GNXA 2IXVA 2A3CA 1UYQA 3SN1A 3IS4A 3GR8A 4NVTA 3MBDA 2Z1BA 2EPOA 2Y24A 1O95A 3SECA 3SUTA 1OT2A 3MJMA 1QRQA 3U57A 4RDZA 1H09A 1VCVA 3PS7A 4XWUA 4P5UA 4M29A 4C7DA 4LH8A 3W7EA 2PRHA 2GUUA 4FI4A 3WQPA 1US3A 4PMQA 1L6YA 5I09A 4JEQA 4AD0A 5I5RA 3NXLA 2GDUA 2WB5A 1BG4A 4JTGA 3QTGA 1O1HA 4JIQA 2PDGA 3GAYA 3BLLA 1XPYA 3T55A 3AS3A 1WOAA 2R1NA 2EF9A 5I78A 2GYIA 3NFUA 4AG0A 3VNJA 4Z1AA 3IJLA 4PMUA 2VEGA 4ATDA 3KDOA 5HJLA 1PL9A 3AMGA 4PCSA 4W4QA 3L21A 4RJEA 2A7PA 1TPWA 3R94A 3RFAA 1H1YA 1PYMA 2Z1WA 2ZRYA 1O4UA 5CKSA 3QYQA 5ABEA 1SUXA 3C61A 1ZBWA 2OGJA 1UWIA 4EIVA 1UA7A 1KA9F 1H7XA 3BZGA 2J7BA 3HG5A 1XLGA 1AQ0A 1FWIC 2VRKA 3M7SA 5AVNA 2OLHA 1H63A 4JDBA 5CPOA 3AXKA 1TJRA 3STPA 3TTQA 1YTKA 4PUEA 1G4SA 3A3HA 3HIJA 1W2PA 5EBAA 3HMCA 1QNOA 1FWEC 1J4EA 4XIMA 4BQ3A 4WJ8A 3HTWA 2A21A 4RNIA 3WQEA 1W1A1 3TCSA 1Q7QA 3SB0A 2WYSA 3R6IA 3NSXA 5BOEA 2PDXA 1NARA 1UWRA 2G3NA 2E3ZA 3U2OA 4L4LA 4GXPA 2DIKA 1WO2A 2OO6A 4GUFA 2C1IA 4F40A 1S5WA 2QUMA 4PB3A 2QJNA 3CNYA 3P67A 4BQ2A 2OOGA 5DEZA 1SO6A 3R2GA 3WUEA 2CKSA 2QPSA 1J96A 3UYIA 4J2MA 2OELA 1NOWA 4N6FA 3BOXA 2E77A 1LROA 4L65A 3LTPA 5AYBA 3W24A 3S2NA 4AYGA 4A21A 4W7VA 1X7IA 2FH6A 2CW6A 3RU6A 1ZJIA 2YW3A 4YVVA 3WLKX 1RK6A 1PPIA 1NSJA 3WD2A 4L6OA 3JS3A 3AWNA 1HGWA 3GKFA 3PNUA 1VCGA 1Q3NA 1HP4A 3EX6A 4H8NA 4M0XA 1J6OA 3NQ2A 2PP1A 2Z6IA 2PDIA 1F5ZA 1NOFA 5D4YA 5FJUA 2QW5A 3GNRA 3VIFA 3BJTA 2NQLA 4B5UA 2Q3OA 3VIMA 1NH6A 4CUCA 4KRTA 2PWVA 1Q8AA 4V1YA 5EL1A 3WELA 2ABAA 3NAVA 1ITUA 1XG4A 2OSWA 1QT1A 3ONBA 4A2RA 1JQVA 2Z26A 2PDUA 4L1XA 4KGLA 3KVJA 4JQ2A 4CN4A 3W7RA 1KXTA 3GH4A 1IHIA 2E6YA 1FDJA 4MDPA 1V02E 5FSDC 1JZ7A 5G4WA 3GTFA 4AF0A 1LWHA 4U2YA 5KETA 1Q7MA 5T26A 3M5VA 4LYQA 3LCWA 2H3BA 1HO1A 3LY0A 3K5XA 4HN8A 4WY0F 4M19A 3S6OA 2JK2A 3UESA 3VOCA 3NEVA 2WVTA 3KL0A 3AIEA 4NY2A 1DQWA 1R47A 2D3LA 3NIYA 1XC4A 5D9OA 1MI3A 4WQ6A 3P0XA 3W7GA 5BU6A 1A0DA 2PWGA 3BG9A 1RBLA 1YTDA 3CMFA 3LA4A 4GINA 4RV3A 5A6LA 4KETA 1OFEA 2I17A 2GGJA 3MI2A 1PX3A 4LCRA 3UR8A 3AZTA 4AZ5A 5AYZA 1P1MA 3T42A 4ML9A 1F6YA 1CGUA 1KKRA 3ZWTA 1A50A 5AHFA 3WF4A 3FX4A 3LBOA 4UR7A 3UWUA 3VDAA 4C1LA 1I75A 5LIWX 3ITXA 1TA3B 1EGVA 5HA7A 4RL3A 1AJ0A 2ZTKA 3U6WA 4XAPA 3BMXA 3T09A 2QR6A 3WNNA 2WMIB 3TA9A 2F8QA 2V5LA 1PTDA 2P53A 2YX0A 1FXPA 1ODUA 1XDMA 1LTDA 1H51A 4NYUA 2XFYA 2YXXA 1RH9A 3ABZA 3MCMA 4GH3A 3ANYA 4IFKA 4W5UA 4GZ7A 4PL2A 1MNZA 2XFFA 5CPTA 4QQ3A 3KRBA 4ORIA 2B31A 4NKCA 3QV8A 3CAQA 2PURA 5A6JA 2PFHA 4CNTA 4A3RA 3S1VA 5G4EA 4CNUA 2DZSA 3U2ZA 4NILA 1B57A 4IMEA 5D30A 4P7RA 3AXHA 2GZXA 2WZHA 4I7WA 4FX8A 1B2YA 4RZ5A 3T4CA 2E25A 4L1WA 3FDGA 3EX2A 3LI0A 3W7QA 1XH1A 3VI2A 4HJFA 4QQUA 4JQ4A 1M7JA 1GK8A 3QHNA 3GDLA 3KLLA 4KCWA 1Y0EA 4QE5A 3WG6A 4E6MA 4O15A 2QHAA 1VAHA 3UWWA 4JL1A 5A2AA 1H3GA 2FPTA 2EGZA 3LRMA 4PMZA 1T40A 4C5YA 5REQB 4DWSD 1S5VA 3VK5A 4Q7BA 3KTCA 3NZGA 5C9XA 4DJEC 3KBMA 1H2JA 1OCQA 1E1CA 3W1LA 1SMDA 1H4PA 1B9BA 2ZICA 3VM7A 1XYBA 4RZ4A 3PBYA 3B40A 2XVPA 1F3EA 4ZE5A 3RMJA 3S1WA 1EBGA 2ZQ0A 1DJQA 4J7RA 4RR4A 3MVTA 1GQJA 2CLIA 1LQAA 3GBDA 1U33A 1LDCA 3RYSA 3UG5A 3XIMA 3TXVA 3OEXA 1SO5A 4WVXA 3CV2A 2EJ1A 3W01A 1JR1A 1XINA 1OIMA 3RX4A 3AMKA 4LW7A 4QE4A 4U33A 3B8TA 1MRQA 3KUMA 4IQDA 4ZB2A 3WK2A 1IT7A 1DPMA 2V5BA 3TZNA 1E6PA 3WBYA 5I6SA 3WF2A 5FJIA 4PTWA 3KOYA 3LPGA 1OM0A 1QWKA 3NURA 4V2XA 3BGJA 1H0IA 1AH4A 3G0SA 4TR9A 1IQ8A 3PK7A 2WMHA 2QCGA 2I5QA 4HA0A 4IG2A 4UCGA 1OZMA 4AIEA 3A5VA 5TF0A 1RPXA 3U9IA 2R1LA 2BDQA 1SW7A 4P2VA 3AIQA 1GTEA 2ZRWA 4GD0A 1H61A 5PTDA 3P5ZA 4MWAD 4Q4QA 5CXPA 1OZQA 3W9ZA 5HWNA 3T0DA 2WMFA 3NCOA 5CZTA 3S2CA 3W72A 4BEQA 3QR1A 3L4YA 1BTCA 3T9PA 4WKHA 1EYEA 3QV7A 3INPA 1XQLA 1BGGA 3U48A 3H12A 2NV2A 1C8XA 4YTTA 3AICA 4JTRA 2VL4A 4W84A 1JCMP 1RV8A 2R94A 3I10A 1OC7A 5HBFA 3OOQA 5DY2A 4PMDA 3VNKA 4I7UA 1R6WA 1W5PA 5D2WA 1E9ZB 4KKXA 4EPEC 3QSTA 3CK5A 4JYEA 4JX5A 3CPGA 1TTIA 1B0IA 3LHTA 3G1SA 3N15A 1WP6A 2DZVA 1A80A 1NWTA 4LYRA 1BVWA 2WM1A 4HZMA 4BF5A 3R8RA 3PTKA 1LLZA 4XZMX 7TAAA 2WNZA 3GFZA 1Y8BA 3GXDA 3PANA 4F2BA 3O8AA 1TVLA 3HFYA 1EJTC 2EG6A 2YZ5A 3JVAA 1YE4A 3L4UA 2Z27A 3MKCA 3CUFA 2OU4A 4GUHA 3TFXA 5IXEA 4LUIA 4CNPA 1CXIA 1XKYA 5M5DA 1G94A 2VGGA 3GU9A 5EMJA 5BWFA 4V28A 1C92A 2A0NA 1H62A 4F0MA 1TX2A 2DY3A 1TZ7A 2OMAA 4L6HA 4C5ZA 1KXQA 1DWIM 4UBPC 1L2QA 2GFTA 5GNZA 1LJYA 3TR9A 3FJ6A 2B7NA 5HMEA 1FWRA 1FWHC 1W32A 1WBHA 1EJVC 1HJUA 3L2LA 4GE8A 4AZ6A 4BKNA 1JZ3A 2OSYA 1E73M 4OQVA 3CL7A 4IF2A 1ENUA 1V3HA 3XISA 4NASA 3E38A 1QTWA 2VZOA 3BE7A 4RXGA 1LG1A 3AMDA 1QASA 4YL2A 4UTFA 4PEEA 4ACYA 4GFIA 3I68A 3Q65A 4F66A 2H8XA 1H5VA 1C7SA 4G8TA 3G1YA 4IZGA 4ZEPA 3ATYA 1XRSA 2YBTA 4ZQPA 3H22A 3CASA 3AZRA 2WVVB 4H9ZA 3FXYA 4WY0A 2C7FA 2HJPA 5DO8A 1UKSA 5D8ZA 3S83A 4JOMA 2P8CA 4DVOA 3OLDA 3RX2A 3GVWA 4IGNA 1X6UA 2JALA 5I07A 2RJHA 2UY2A 3VM5A 4ATWA 1YBQA 4NXSA 1T0OA 1L6FA 1XDJA 3HMJG 4NYYA 2EJAA 3QY6A 3AS1A 3HPFA 1CB2A 3OVGA 1XGEA 3W7JA 3SDOA 3BOLA 2IUZA 2ZADA 3A9IA 2B7PA 5LZLA 3VKCA 5ABFB 3M0MA 4HNLA 4B16A 4A22A 5BROA 3BAWA 3QHOA 1JDEA 3CUHA 2J9ZA 2YLLA 2OOFA 1NIUA 2W3ZA 2F6UA 1I1XA 5TBOA 4DI9A 3NPXA 5FEZA 3RJXA 4M1RA 2X1UA 4FS9A 4KFNA 5MKGA 4RDVA 4KIRA 2ZUTA 1EO5A 3WCZA 1XLAA 1EHAA 4BHYA 3QW4B 3B9OA 4X60A 3WNLA 2ONEA 1RCXB 2OT0A 3G2GA 5CG7A 1ZRQA 2PZ0A 3ENLA 5KZDA 3CAVA 3ITLA 4MZYA 2HQAA 1VEMA 5A5WA 7CGTA 3LD5A 2X05A 3TE9A 1RJQA 4MB5A 4HMEA 3TFCA 2YZRA 4O19A 4HCDA 2HVNA 3IIPA 1R87A 4HU4A 3VCRA 4HNTA 1HJXA 4WDUA 1XICA 4LV4A 2CWXA 1POJA 3NDOA 1PYFA 3BZJA 3WQ6A 2QCFA 6REQB 1NVMA 4R3UA 4MY8A 3MT1A 3RXZA 2GJXB 2G8ZA 3EOUA 3O2LA 1GG1A 1GQLA 2WHJA 4S3KA 1QBAA 1CPUA 5C55A 2G0WA 1K6WA 4P61A 1N8WA 2Z29A 3TSMA 1G4TA 2CBUA 3W26A 3W38A 2DIJA 3DI0A 4XAFA 3V1PA 4HMCA 2BY0A 4MFDA 2FFCA 4AWSA 3SCTA 4AMAA 1EUAA 1TPUA 4GWEA 3W1MA 3SCPA 2YXGA 3TU9A 1WXJA 1DVJA 2I16A 3OYZA 2OEMA 2WC4A 1XIHA 4KWUA 1KCZA 3AUOA 2G3FA 4GQGA 5HDRA 4FEZA 3VNIA 2YPIA 4PTVA 3EMZA 3LNPA 3ARWA 1UD8A 2YA1A 3SGZA 4HVXA 3U2EA 3W6MA 1V5XA 3QGAC 4L64A 1B3ZA 1Z7AA 2Z00A 4C6OA 3GC4A 3RPDA 2OT1A 1ME7A 4C6DA 3DKJA 3CV7A 4CCDA 4N4PA 2WLZA 4DXKA 3UF9A 3T81A 3NQVA 1DP0A 2BOGX 1IF2A 3RR4A 3SGUA 3LV6A 1REQB 2ANUA 1Q6RA 1Y5VA 5C7HA 3DFQA 3W23A 3AUJA 2FDMA 2HSAA 3MZNA 1JFHA 3G0XA 2J88A 3DYOA 4LY8A 3SO7A 1ISWA 1MDRA 3BLFA 2GUBA 2OXNA 5AYYA 2Y0FA 2DT1A 4XKYB 1SSGA 2Y5JA 4XUGA 4Z1DA 3VIGA 1QI0A 1XBYA 2Q09A 1DTUA 1JG9A 2P76A 3RK8A 1OJXA 2XFWA 3GHRA 4O8AA 4W93A 5EYWA 1KFLA 1K7EA 3HM7A 4PMVA 3FIGA 1E5NA 4Q7IA 2GPTA 1GQIA 4GCXA 3DYMA 3GE7A 3QOKA 1VBRA 5XIMA 2VCBA 2XIOA 5BMXA 1TJ2A 4UZUA 4YHEA 1DIOA 1RQHA 1IE7C 3ZXWA 4AVNA 5B7YA 4JNYA 3W87A 2PU1A 2XSAA 2ZXDA 4HKPA 3OPSA 2NX9A 4GACA 1CEOA 2PB1A 4DJEA 4WOQA 4LCQA 1WXZA 1N8FA 2WHKA 3S42A 3NO3A 4ATLA 1KFEA 3ID7A 5CBIA 1NWRA 1V93A 2CBVA 3AIUA 1GOOA 3NVDA 3L68A 2OWWA 1V3IA 3CC1A 3P84A 1LQ0A 3W3OA 1QI5A 4D8LA 3E0VA 4TX9A 4P8XA 4LTSA 5E0KA 1YXYA 1P0EA 3RJYA 1UB3A 4F2TA 5D33A 4TMBA 2V9DA 3W0KA 2NZLA 2VRQA 3SURA 4Q8UA 1UD3A 3DHUA 2DT0A 1W17A 4YMZA 3TROA 4GI8A 4BCEA 1S2WA 3B9EA 2BXZA 1Q6EA 3C6CA 3LM3A 4K1GA 2E9BA 2QS8A 4XX6A 1LL4A 1UC4A 3VE9A 4JTQA 4C6IA 3IK2A 1KTBA 1ISXA 1KKOA 1JNEA 3W1PA 1SGJA 1BKHA 4WUIA 2FVKA 1MUMA 1UD2A 5I03A 1V6WA 1NOUA 1QOQA 3WQ5A 3VNDA 3UG3A 1GEHA 2NQ5A 3PPCA 3FKRA 4FR1A 4UIOA 3C2FA 1ONWA 4AWUA 4GIYA 4DWSB 4MGGA 1YXDA 1BEUA 3UA4A 3N29A 1V0MA 3BSGA 1X8CA 2VC6A 1YNYA 3LG3A 5CSRA 4YS1A 1HJWA 1MDLA 1N7KA 3CHCA 4S23A 1IV8A 3NWRA 4KWVA 2BLEA 2CC0A 1PB0A 4D1IA 1BRLB 1DJIA 5D2VA 3ITCA 3QKZA 3TSDA 4V1XA 3SCOA 3HJZA 4POCA 1SVDA 2CLPA 3NQ8A 4AZBA 1W9PA 1FWNA 2J62A 1CGVA 1P7TB 3ITOA 3DHDA 5HMFA 3KBSA 2FLIA 3V5CA 3VTRA 1W1ZA 3W53A 3N3MA 3GDTA 1K3UA 1MUWA 1XD0A 3LCGA 2J4GA 4GO9A 1JCYA 4X61A 2VTFA 2ZRXA 9CGTA 2X7VA 1EX5A 4IQEA 1W5MA 2D22A 3KRUA 3VMPA 3CUZA 4C6QA 3KM8A 1UUQA 1PCKA 2WMKA 4YIWA 4PTMA 1FBAA 1Z3NA 2OJPA 4C6JA 1QAPA 2NV1A 2FTPA 2ZZ3A 4IP5A 5CSYA 3WBXA 2GVGA 3P62A 3W73A 3RPTA 1KLZA 2G50A 3S2JA 4MWAB 4UQAA 4D6GA 5J8LA 1EC7A 5C2XA 3H2EA 2CLMA 4IWWA 2E6DA 2WLYA 1GKQA 3M5XA 3QH2A 2QCLA 3HQ1A 4YCOA 3UR5A 2QVHA 1DE6A 1WPCA 4GI4A 3RM8A 3P80A 4U28A 1PHWA 2EBNA 5IHSA 2YIHA 4GX9A 4U31A 4Z2IA 4KFPA 1U22A 1XRFA 1TV7A 1WUEA 1ZJHA 4HU0A 3KBJA 2CLFA 3IAQA 4DYJA 3APYA 1PKYA 4M6UA 3SRKA 4RW5A 4NJIA 4LC6A 2QCEA 5G2IA 3S3GA 4JL2A 1Q6CA 2VVSA 4N9EA 2QEZA 3HN3A 1E55A 3PWGA 5GJMA 3BSMA 1W54A 3PJWA 2INFA 3S5OA 5LXXA 4HP5A 4DZHA 1UCWA 1PIIA 3L65A 4QXIA 1FCVA 1XM3A 3BC9A 1K9DA 2B7OA 1UKTA 4W86A 5XINA 2GJRA 4IGSA 4ROPA 3UPBA 3FHQA 2PDQA 2OWCA 4LEFA 1DQUA 3EWUA 5I77A 5LGXA 1J2WA 4Z0SA 3CXOA 2UV8G 2G5WA 3RRAA 1SR0A 2E09A 1A0CA 3OA5A 3Q37A 3Q94A 4V33A 4W85A 4F9DA 4N7QA 3DKLA 5T9CE 3UWZA 4IX2A 2OX4A 4S3AA 3R8HA 1UH3A 1VJZA 3S1XA 2C3ZA 2EQDA 4BQ5A 5A95A 1AG1O 3W2NA 4ZA0A 4H9VA 2DSWA 1AW1A 3W2JA 4FOUA 3KVKA 4DJFC 3BW4A 3WBWA 5AFDA 1E6RA 4GXMA 1FHUA 2PC4A 3MKKA 1GVQA 4E2OA 2C18A 1HGYA 3M47A 2J7FA 1OIFA 4PUJA 3ABXA 1R7AA 3WDPP 3EDKA 4MOZA 5T9BG 4XO6A 2Z2UA 1H7OA 1G4PA 3UXIA 4D6JA 4Q4OA 1Q13A 3MUCA 1VPXA 5FAJA 5LA1A 4Y9MA 1WNOA 4GXWA 5FKYA 3KRZA 1C93A 4S39A 4LUYA 3W2KA 4FSAA 4KESA 3AU2A 1W9UA 4TOQA 2BY3A 1XCWA 1RBAA 4GKLA 1XYZA 3ZR5A 4G1KA 3UPWA 1KO0A 4ZOCA 3RLVA 1SZEA 1KD0A 1HJVA 3O06A 4UR8A 1TV2A 5A94A 4MHBA 1EXPA 4UUIA 3UWVA 3WJWA 4D6CA 4Z1YA 2UZ9A 1K9FA 1QCWA 2X1SA 2PD9A 4A6GA 3ZR4A 4CD4A 5CLWA 1UH2A 1NF0A 3MKVA 1KXHA 1JCXA 5DMMA 2Z28A 4M24A 5BWAA 4CVUA 1QPOA 1KFKA 3CHVA 8XIMA 1XLDA 1VH7A 2YBVA 4NNCA 3WLTA 1EA0A 1PKNA 4CD5A 2QCNA 3L7RA 3SUSA 2F2HA 2DSZA 4X0NA 4JHZA 3MZ2A 1TMQA 2VYOA 3FAXA 5AVHA 1UIOA 3QZ6A 1HNYA 5LA2A 2RDUA 4PCPA 1HQTA 2NLYA 2RJGA 4XO7A 4UFKA 3DC8A 1NFBA 1FXQA 3M7WA 4PRTA 3TTSA 1B4EA 1MQRA 4Q8NA 4Y9PA 3MANA 3FHAA 2NXHA 3UGVA 3I3EA 1NFGA 3GTHA 2OKTA 5AHLA 3CL8A 1JFXA 3TYAA 2IXUA 1V0LA 4C7FA 3P81A 7REQB 4HHMA 1Z89A 3K4DA 1J0IA 3MP4A 1VKFA 2AL2B 4GYPC 2YDSA 3I4KA 2VQTA 1XSKA 4Q4PA 1Q6OA 1KRCC 3AFBA 3EWXA 2DT3A 3VGEA 2BG5A 3EMCA 3TYEA 4ZO8A 2VURA 4US5D 2VEIA 1A3WA 4KPLA 2PDWA 1J0KA 2R91A 1QXLA 2D3NA 2D23A 1SYTA 4ML4A 1JYNA 2O55A 1UUOA 4CD6A 3OZPA 5DCDA 4GY0A 1YHTA 4GZEA 2B4GA 3URAA 3CHFA 5I3DA 3R0KA 2NUYA 4F48A 1E70M 1RVKA 2VNCA 4DF0A 3NM1A 4J5NA 1G1YA 2V5JA 3C52A 3W1QA 3FV9A 3VDCA 1WXYA 3WUGA 1M01A 4C6NA 4J40A 3MMDA 2DZWA 3SEPA 2QQ6A 4LQ1A 1Q4WA 3W7CA 3TDFA 2XH7A 3E74A 3TEVA 3E2SA 1DXEA 3DH7A 3EKZA 5C70A 5A8PA 1X39A 2CLHA 2WPGA 3W25A 1XFBA 1S2TA 4O1CA 3T4WA 1U30A 2QCCA 5CAHA 2X7WA 5HQMA 1JD7A 3BQ5A 3SN4A 2X40A 3ITYA 5C6MA 5K2ZA 4QR6A 1XI3A 2O9OA 2HZGA 5A8GA 3VOFA 1KRBC 5M03A 5D03A 4N6EA 3TW7A 4OV9A 3ABSA 4CNSA 5CZJA 3DGRA 5FEPA 3SY5A 5FF4A 3TMLA 2XIJA 2WPBA 4DBEA 2CZEA 1SMAA 4FF7A 2QUUA 4KF1A 4MB1A 3VUPA 3UR2A 4UTWC 1XIBA 3F5JA 3GUWA 1W9DM 3B8IA 2ZKMX 3W29A 4PE8A 4I7VA 5BXPA 4B4FA 2P10A 1DQXA 2AMXA 1Z8AA 2OWXA 4I9TA 1EDTA 1L8PA 3A64A 2IKHA 2YR1A 1LWJA 3L0GA 4JS3A 4DI8A 4NF7A 4IICA 1SFSA 4XISA 1SJDA 1WYIA 4ERGA 4ASTA 4JIIX 1DHPA 1RR2A 3L2IA 3S9YA 1NELA 1EHNA 3PUEA 2FH8A 1KLYA 4ADUA 4RNHA 4X9YA 3GSMA 3OP2A 1KTNA 2A3BA 4A4AA 3OG3A 1JZ2A 3F2BA 1QFEA 2J6VA 2DSVA 1X96A 2VI0A 4HB7A 2HE8A 1SZRA 3P93A 3QYSA 2V3GA 5LIUX 4HD5A 4B5SA 3EEZA 2CFFA 3TVAA 2EAWA 4R7JA 3HG2A 4A35A 1OINA 3CH0A 3F2CA 3SBFA 3VNYA 4YNGA 1H50A 4JYFA 3PPFA 3C8NA 2RGMA 3MDUA 3QPEA 1IR2A 4H00A 1OFBA 4R9OA 2J7CA 1S3HA 3MUY1 4TQTA 4JFSA 2ON3A 5I00A 3GX9A 4RCXA 3IGHX 2E7FA 3PZ9A 2HK0A 3ORWA 1GVIA 4S3CA 1VS1A 1YTEA 2YCKX 1K9TA 1TPB1 4IJRA 1RA5A 5TAOA 2D73A 5CH9A 4GNVA 3MMUA 4QBXA 3AWOA 4KWSA 3W84A 1VC4A 2VOMA 3Q2DA 4MADA 2ZZ6A 3WQVA 1XLKA 3TIMA 2OO0A 4Q7NA 3S2MA 3LPFA 4NJHA 5D09A 2DH2A 2OZ8A 1V77A 5HATA 4AYSA 3E6EA 5KZEA 1C7TA 2XVGA 4KH2A 1JDAA 1KRMA 3NPVA 1X7FA 2A4AA 3RM9A 1EYWA 1WZKA 4NG3A 4KWWA 4U2ZA 3LX9A 1OFPA 1KCKA 3COTA 1JF6A 3QV6A 2RGLA 4U3CA 5I3JA 1EXBA 2CLOA 2DZTA 5I06A 3WH7A 1PWLA 1TWDA 2P3EA 3W81A 3AROA 3SSZA 1I2RA 3D3AA 4GPNA 1AUSL 1TZZA 4ZSUA 4JQ1A 1KW1A 3CYJA 4B92A 3WMCA 2Y4SA 3ARTA 3FEQA 1TPEA 2VC5A 1OFAA 3TP4A 4GBUA 3L2MA 3MJYA 2PLMA 2ATMA 2PU0A 3UW6A 3TTEA 1I0DA 1SW0A 2XGIA 5FL1A 3FFSA 3M6DA 2NX1A 4JCMA 3SUUA 3R79A 3OQEA 1BYBA 2PF0A 4B5NA 2OZTA 3UJFA 3V5OA 3NO1A 2XU2A 3VVGA 5E9AA 1DV7A 3GG8A 3TA6A 3WLNA 1J8VA 1UR8A 2I5GA 4XZ9A 3NPWA 3T0CA 4K7VA 1OBAA 1SZNA 2ACUA 1WZAA 3NTYA 4IPIA 4DO7A 1G5AA 4IMFA 4ES4A 1TV5A 3TV8A 3WLQA 3D0CA 2BVWA 5CQ1A 4PL1A 4P7LA 2D1ZA 4O1FA 1E6NA 4EAYA 1PIGA 1Q6FA 2XPKA 3PTQA 3UCCA 2BX7A 3U4AA 2X1RA 4RE3A 3VOIA 3T07A 4R7OA 4PSRA 3ZVIA 1FA2A 4WEVX 2R9RA 2INZA 3STFA 3KBNA 4UQCA 1R0MA 4NX0A 5AZ0A 3PJTA 3QLLA 4YTQA 4N2YA 1BWVA 4IIBA 1DJXA 3VO0A 2PGEA 3MYPA 3LBCA 1CENA 3ZJKA 4WDWA 5HANA 4W8BA 5G4HC 4HIBA 4IL2A 1UA3A 3I6EA 2HDJA 5FF7A 1CX9A 4AD3A 4PR4A 4UTHA 2HK1A 4B90A 3B8VA 2PODA 1PKMA 1MVYA 4L4OA 3Q67A 5FF3A 1W1TA 3SSJA 4HNOA 2Z4GA 2PLJA 1UR0A 3N6JA 2V0TA 2KZHA 5HULA 2CZDA 4WF7A 2O9TA 4L9YA 2A6NA 3ZJ6A 2FZ9A 3DDMA 3UETA 2OR2A 1DIEA 1OCJA 4KBXA 1K4GA 1E51A 1UWQA 2VFHA 2JGYA 3K8LA 2CYGA 1KBIA 3S6DA 4E8GA 3S2LA 5DXYA 1ADOA 2WMIA 5U4NA 2WC3A 2ZWYA 1E72M 2X1TA 1MUCA 2J7GA 3HQNA 3V4BA 3QPYA 4K1WA 1H1ZA 1F8IA 2RHGA 4O13A 5K9XA 1VYPX 1WOBA 1US2A 5L6UA 1L9WA 1XGZA 3H4GA 3ZLGA 3TJ4A 3UFYA 2WSKA 3SQMA 4QJ1A 1FQ0A 1B30A 1OFDA 3O6YX 4PMJA 1Z44A 3E9AA 1E3ZA 3GLCA 3UXDA 2CITA 3WJYA 3NG3A 3AJXA 3M0HA 2EEXA 2BVTA 4JTFA 4HZ8A 3LSCA 4JBRA 4TVUA 1UQYA 3T7VA 2OKOA 2ZZ4A 3M0VA 1P1XA 4HPNA 3C0JA 4DO5A 5GVJA 3C86A 4FX7A 3LMZA 1KBLA 1AVAA 3BK0A 3DAQA 1A47A 2VJXA 1FY6A 4DYEA 4NZJA 4H7ZA 4J3XA 3BMVA 1WX0A 4G9PA 1J0HA 2GDQA 4H6RA 1B9ZA 2PUZA 3LENA 4GYPA 1V4YA 2ZX6A 3AMCA 4GC4A 4JCLA 4LUSA 1JXJA 3TWBA 2BV9A 2X42A 2X16A 1E71M 5FA5A 3WMLA 2E67A 2WKGA 4PFHA 2PF8A 2Y7DA 1TCMA 3WEMA 4Q8PA 3DFPA 3T2OA 4YJ5A 2DP3A 3OJGA 4QS6A 2XJ7A 2A1YA 3QQ0A 3TYCA 4ILSA 3GTXA 1XH2A 3NA8A 1LBLA 2BASA 1ZZMA 1EC8A 4ZB5A 2HISA 1DWJM 3WLJA 2X30A 2YB4A 4HA4A 4K8GA 4ZQNA 1IEWA 2NVCA 4HCLA 1F7BA 3WDJA 1VF8A 1QK2A 3OGVA 2J8GA 2G4FA 1VCFA 4KRZA 4EK7A 2PD5A 2V2DA 3KP0A 1KFCA 3T8LA 1LF1A 4JHOA 4JTDA 3MW7A 3WQDA 4DM1A 1ITXA 4ZOAA 1VLIA 3FSTA 2G41A 4QNWA 3RR1A 1SO4A 4J3UA 3ZVHB 3T05A 2C71A 3KRSA 3QJAA 1M68A 1P0KA 3NYZA 4E8CA 3KVMA 3RIKA 1TMHA 1XWYA 4Q8TA 1EX1A 4CQ9A 3BOFA 4IFRA 1UR1A 3W7KA 3W7LA 4ZSTA 1K77A 2VR4A 1BWLA 3IK4A 4XZBA 1TVPA 1OYAA 5HNRA 4D9PA 3TZFA 4QP0A 1G01A 2RAGA 3B8DA 1K8CA 2V5DA 1F2JA 1IIHA 3B0XA 3NQGA 5M1TA 4GZJA 1K1DA 2X2YA 4DWSC 3N2CA 3KS6A 3WLOA 1PE1A 1PEZA 4LF1A 2LLEA 1DOSA 2V5CA 2X2GA 1AQHA 1Q2SA 4Z2KA 4O1EA 3EWCA 4EVZA 1LOSA