3IGXA

1.85 angstrom resolution crystal structure of transaldolase b (tala) from francisella tularensis.
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
322
structure length
322
Chain Sequence
AMQKSVLEQLKQVTMVVADTGDFELIKKYKPVDATTNPSLILKAVKEQKYSNLVAETISKVKANNPDLNSDDLVKEIAIEILVSFGIKILDVIEGKVSSEVDARVSFNSATTIDYAKRIIARYESNGIPKDRVLIKIAATWEGIKAAKLLQKEGINCNLTLIFDKAQAKACAEAGVYLVSPFVGRITDWQMQQNNLKTFPAIADDDGVNSVKAIYKLYKSHGFKTIVMGASFRNVEQVIALAGCDALTISPVLLEELKNRDEHLEVKLTKNDDVVTQSPQISEADFRWLMNENAMATHKLAEGIRLFTKDTIELENIIKQNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 1.85 Angstrom Resolution Crystal Structure of Transaldolase B (talA) from Francisella tularensis.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Transferase
molecule keywords Transaldolase
total genus 131
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2009-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3igxA00
2KZHA 2CLKA 3G1XA 4O57A 3KRZA 3OVRA 2CLHA 2DP3A 3CIXA 4JGDA 4UFKA 2ZRVA 3ZFHA 4HSOA 4LC8A 3TNOA 3EX4A 4IX2A 4E2DA 3YPIA 1J4EA 4HNVA 2ISSA 2DU2A 2JGQA 1AL7A 2A7PA 4JTJA 4JDYA 1UUMA 3K30A 1TPC1 2H8XA 5E93A 3QPZA 2OX1A 1NAL1 2H3DA 2ABBA 3W76A 4FNUA 3U6WA 1XUUA 1TSIA 1PV8A 3LB0A 1WBJA 3O15A 4A21A 4UTMA 4AF0A 3O8AA 2BSLA 2V8ZA 3SGUA 4AWSA 1G6CA 4O28A 4WOZA 5FEPA 3EWBX 1AL8A 1TPB1 3PB2A 3WJYA 2V82A 2NXGA 3HB9A 1VCFA 5DCBA 4NNAA 4IQLA 3LTSA 4IPJA 4PC8A 4GXMA 3PUEA 3IGUA 5EY5A 4M6VA 3THQA 4FO4A 1W31A 4FNPA 3FEMA 3PG9A 3W7NA 1I2QA 4CNOA 3B8DA 1DV7A 1GVQA 1DJQA 1W5OA 1KM4A 2H3BA 1R47A 1FUYA 2ZFAA 3NQEA 3NQAA 3BG9A 5C54A 1KW1A 2PE4A 4LVAA 4OQVA 3N2XA 3IIPA 1G4PA 4PFMA 1NF7A 3GNDA 3P74A 1TV7A 2YPIA 3HGSA 4BK9A 3OVQA 1ZFJA 3TW7A 4UTHA 1KM1A 2FIQA 3TSDA 4Y90A 4DXVA 2X2GA 2CWNA 3G18A 3LXBA 4UTJA 2A7NA 5KITA 4UNLA 1JR1A 4O17A 3HG5A 3P5YA 4H3DA 1F5ZA 2X16A 4LRSA 4Q33A 3HO8A 3B0VC 2J9XA 3G22A 4LV9A 3L67A 3PY2A 3NOEA 3TU9A 1SFJA 1G67A 4I7UA 1W37A 3ABOA 3CHVA 1YTKA 4IGHA 4NJIA 5G2HA 2F7FA 1IGSA 3DFPA 3QJAA 3PC0A 1GVFA 2C13A 4IXXA 1ZAIA 2QDHA 5KTLA 1OFEA 3UWQA 2ZA1A 1KM6A 3VNDA 4UCGA 3TK7A 1KM2A 3LCLA 3H55A 4KWVA 1I2PA 3MP5A 3MO7A 4UTUA 8TIMA 3ZWSA 1PVNA 5CPNA 2XN1A 4MZ8A 4IJBA 3DXIA 2RFGA 5AHMA 1W3NA 2QKFA 4HSNA 4BI6A 2QCEA 1KFJA 3CEPA 3MBFA 1RR2A 1QWGA 3WK1A 4YXGA 5IBXC 4XQ6A 4FB7A 5LHEA 4E38A 1FCUA 4M7SA 1JUBA 4NNCA 4L4LA 3SR7A 3FIGA 1CI1A 5AHNA 4W9TA 1WV2A 4R53A 5GVJA 1H7PA 1I45A 3I7QA 2ZZ5A 4PL2A 3R8RA 5BRBA 4FX6M 3WK0A 1RPXA 3GIYA 1KM5A 4PODA 1MSSA 1UB3A 3MHFA 1SW7A 1YXDA 3W07A 4U28A 3BGJA 5FI8A 2V2CA 5CSRA 4TR9A 3C52A 4JR5A 3IIVA 2XFWA 5C5YA 4TX9A 4RZ6A 4JNMA 4LRTA 2WKJA 1MEHA 4NVTA 4O12A 3PUOA 1K8XA 3P81A 3PB0A 1KBJA 3W3OA 1TPFA 3SSJA 3VKJA 1THFD 2OMAA 3OG3A 1D3GA 2ZZ1A 3GZ3A 3TW6A 2GVJA 3ELFA 2A4AA 4OV4A 4N6EA 5K9CA 4FXSA 3TSMA 3TDFA 2OZ0A 3CLMA 3W1TA 4AHQA 5K7JA 3HGOA 1FDYA 3DGRA 4O4VA 4S1FA 3INPA 3UZJA 1TV5A 3QPYA 1KA9F 3QF0A 1SR9A 3W1XA 2Q8LA 1Q3NA 1XXXA 4WXZA 4A2RA 3CPRA 5J5RA 1QO5A 4GRSA 2E1DA 1Q6RA 4NJKA 5I3JA 3O63A 2D73A 2W0UA 2GJNA 3IIXA 4DPPA 1TTJA 1KV8A 3G8RA 3GR8A 1Q6OA 3GR7A 3GXTA 5D2XA 4DF1A 5TIMA 5D2YA 3T7VA 3Q94A 3W1AA 1YLVA 2G5WA 4DELA 3TFXA 1GEQA 1W1ZA 2OT0A 1LYXA 1VHCA 3ANYA 4LC6A 4M5PA 3P8JA 2CZEA 5D38A 1GTEA 4AWUA 3W88A 4GFSA 4O15A 3DKLA 2NLIA 3OVPA 5DCEA 2BTMA 3M44A 1WQ5A 3S8HA 1LOQA 3PBWA 2DJLA 3FJ6A 3WJXA 4IMFA 5D05A 3G0UA 3W83A 1B3OA 2VFDA 4FX7A 3QW4B 4N9CA 5D2VA 5G4EA 2FFCA 2QR6A 1P0KA 5FF3A 4JY9A 1PS9A 5D04C 1O5XA 1SQ7A 3DENA 4NJGA 3QYQA 5AC8A 2CZ5A 1VCGA 3GDMA 3E12A 3LBMA 1A53A 3F03K 2Z2UA 4FIQA 4OBTA 4ZQCA 1EIXA 3WK3A 3GDLA 2VEMA 4JS3A 4ALDA 3MYOA 4FEZA 4ZL1A 1BWKA 1TQXA 2QCLA 3NDOA 1YDOA 4CNNA 1NF0A 3DI0A 2YGYA 2NUYA 3W7EA 1EP1A 1P0NA 3C2OA 4UTLA 3JR2A 2NX1A 2GPTA 2C19A 1EEPA 5DBTA 3CQ0A 4K7YA 3HJZA 5F2MA 3S5ZA 2TPSA 5CZJA 4EF8A 1TV8A 3NQ7A 4S2CA 3L66A 2ZQ0A 2DZVA 4IUOA 4LU0A 1W3IA 5BW6A 2ZTJA 4ADTA 1JUKA 4XKYA 2G97A 3TJXA 4N4QA 1OX5A 2QCDB 2Y63A 1Z48A 3QMRA 4ZZ9A 4DBEA 3NQGA 3NQMA 3UWUA 4AVFA 4CNPA 4JYDA 2Y88A 3CC1A 1ZENA 1JCJA 1OX4A 2QCFA 5AYZA 3PBYA 4XKYB 3W2MA 5AC7A 1L9WA 4WXYA 5LNRA 2R94A 4EF9A 2EKCA 2Y89A 2VC6A 4ZMGA 3AO0A 3TV8A 3S1XA 2CZDA 4X22A 4IOTA 2EGZA 3W1PA 2G95A 3HG3A 4WY0A 5CKSA 4EVZA 2CU0A 2NX3A 3CU2A 4IPIA 1VR6A 4HKPA 2R8WA 4CCEA 3LHWA 2J9YA 1PE1A 1OG0A 2B7OA 2V81A 4UMBA 4O53A 4RK8A 4RZ5A 2X1RA 2RDUA 3JS3A 1DJNA 1N8FA 1VGAA 1ICSA 4JX4A 5L9FA 3Q58A 4AAJA 4BF9A 5HWNA 5LNUA 1P5BA 4JDBA 1H63A 3EX3A 4DO4A 4UIOA 4N2YA 3VE7A 3O07A 2RHGA 5HR7A 2B0MA 4I7WA 2WSYA 1EP2A 3NA8A 1GZGA 3WFAA 2J6XA 1IIHA 2X1UA 2PURA 1MO0A 1TPWA 4MFDA 5MHBA 5EKYA 3NQDA 3W75A 1EWDA 3TROA 3PWAA 2E5DA 2RDWA 3NYZA 3TXVA 2PRMA 1LRQA 3TKFA 5A5WA 3MMTA 4XBKA 2WSQA 1R2RA 2TMDA 4NNBA 1QNVA 4K39A 4IWWA 3TIMA 3S6DA 1PCKA 2C16A 4GUGA 3A9IA 4O1AA 3FJLA 1H61A 4PA8A 5D2WA 3KFTA 5EA9A 4XTIA 5D2TA 3NEVA 2AAMA 4AHOA 3NL5A 4Y9AA 3KXQA 1LTDA 3W73A 5T26A 3VCRA 3VI2A 1GT8A 4KFOA 4JTIA 2EF9A 1KFKA 1LRNA 3BV4A 2OCZA 4GJ1A 4Z08A 2NXHA 4ZQRA 1O95A 2Y7EA 4JTSA 4CQ8A 4N9BA 4DEFA 4N02A 1OFDA 3KVLA 3JRKA 1VPXA 4N9EA 5K2ZA 1KM3A 3FYPA 3BPWA 3TSBA 4TO8A 3RLUA 2NX9A 4NJHA 1A5BA 2QUVA 2CLOA 3EKZA 4DPQA 2GJLA 3QH2A 3W7LA 3TE9A 3R12A 3LRLA 1GVSA 1HO4A 1FCVA 2BXVA 2P0OA 4O1CA 4HN4A 1YADA 3L65A 2GVLA 3B03A 5DCDA 1W54A 1XDMA 3W2UA 4XZ9A 4ZVJA 4JICA 1ZY9A 5D02A 1JUEA 4O18A 1UJPA 2YW4A 3R5EA 1H60A 3QMTA 3GK0A 4O14A 4OGZA 5G1TA 4YLWA 4EOUA 3AJXA 2QCMA 1FBAA 2VFHA 1GG1A 1ZCOA 1OABA 2RH9A 2PCQA 1OF6A 2CLMA 1H1ZA 2BX7A 2H8ZA 3NQ6A 4GE8A 1V7YA 3T4CA 4QQ3A 2A0NA 2W79A 4HPJA 3M5YA 4JEQA 3W7OA 2NXIA 3PSVA 4QIUA 3V1PA 1KLZA 5I3IA 4ZQPA 3C61A 4C1KA 1HFBA 2AQWA 2E5CA 2V2HA 2HS8A 5C6MA 1H50A 2V2DA 1G4SA 3EXSA 1VJIA 2J9ZA 4POCA 2YFNA 6TIMA 1WDWA 4Y6GA 2QEZA 2NWSA 4RXFA 5EL1A 1LBLA 1TPH1 3N19B 3C2RA 3N3MA 1QO2A 1YXCA 5G4WA 1HL2A 3KHJA 5HULA 3TMLA 4YCOA 5AN7A 3W85A 2E6AA 3N9SA 5FESA 2ZZ7A 1QOQA 4QNEA 3GYEA 1K7XA 1OYBA 5D32A 1YYAA 2A1YA 3IRDA 1O94A 1FCBA 3W23A 3UY8A 1LRTA 5DY2A 4Q4KA 4NX0A 1S5WA 1TPVA 3L0NA 2VKZG 4XWUA 4Y96A 1XL9A 5DBUA 4S2BA 1K7EA 5L6UA 4RZ4A 1WA3A 1M7PA 1KFBA 3MUXA 5AOUA 3I7RA 4JY8A 1X1OA 3NPWA 4LT9A 1X1ZA 5CG7A 2YXGA 5HWMA 4GUJA 2NWRA 1JJKA 2VOMA 3C56A 2GOUA 4LVDA 2P10A 3BLEA 3EEGA 1RQEA 2ZRXA 2A2IA 3LLDA 2FPTA 3MP4A 3P62A 1T8XA 1J2WA 3TA6A 5AHIA 5E1QA 3BG5A 3MYPA 1SO3A 3GVGA 3EX1A 2NUXA 1QFEA 1BWLA 4K8EA 1FDZA 5E0KA 1X6UA 3I68A 3M7WA 4TIMA 3W7HA 1LZOA 1JCXA 2QJHA 3L0KA 4IMCA 3W84A 1R2TA 3ATZA 3GDKA 1SW0A 2ZDRA 1C8VA 1E51A 1YDVA 2AGKA 3EXTA 3LHUA 1V5XA 2R14A 4Y8FA 3U2OA 2GQ8A 4LOCA 1NFBA 3MWAA 2C3ZA 5D09A 1PHWA 1TPEA 3LCWA 1RV8A 4GNJA 1R30A 1H7OA 3NZ1A 5U4NA 4CQAA 1BTMA 4ORIA 1L6WA 2B7QA 3PBUA 3W70A 3L9CA 4P2VA 4O4WA 5CPLA 4MVAA 4HNTA 3CTLA 3S1UA 1D3HA 2WOQA 3EB2A 5G5IA 5AB3A 3L2IA 4YWIA 4LS2A 1W5NA 3M5XA 2ZZ4A 3PS7A 1UUOA 1M7OA 2Y7GA 4K37A 4UTWA 4WOQA 4FNRA 3RF9A 5LNWA 4YCPA 3QSRA 4ZQNA 4D2JA 3QC3A 3HPSA 4NX5A 1N7KA 2BLEA 1MXSA 1W3TA 4JD4A 2WNNA 1FY6A 1OVDA 1VH7A 3FS2A 4O8RA 4A3UA 2LLEA 3LHTA 2FDSA 1ZHAA 1YTEA 4NT0A 3TH6A 3N2MA 4GBUA 2V9DA 2A5HA 3EKLA 1K02A 3M43A 1VYSX 2V0TA 2GUUA 4UC5A 1TTIA 1QPOA 3HG4A 3G0SA 4K6AA 3W6YA 4GWEA 5AYXA 1K3UA 4HNNA 5U7SA 4RCXA 4H6KA 4BWLC 1SZGA 1HG3A 3GB6A 4M6PA 2YX0A 3G1DA 2ABAA 3BW2A 2Z6IA 4LWWA 1KV5A 1VC4A 3O6CA 5G2IA 5EBUA 3DKJA 1ADOA 3RLVA 4UFJA 4R7JA 1OYCA 5CGQA 4PEKA 2JGYA 3LTYA 5LGXA 1XFBA 3LI1A 1LM1A 4JX6A 5I3HA 2E6DA 3NQVA 3KAOA 3S9YA 4NQ1A 1F05A 5IM51 1GVOA 1Z41A 3P60A 4WY0F 2NZLA 5KINA 2WQPA 4NXKA 3L5LA 4O19A 4FIRA 3QZEA 1EUAA 3UYCA 3PF3A 4HNUA 2PC4A 1L2UA 1LLZA 1XI3A 3MHGA 2A85A 1FWRA 3W1QA 1YTDA 3LHVA 3NQCA 1SSDA 2WJZA 1AMKA 1B57A 2CZFA 3PAJA 1YPFA 2EAWA 1EX5A 3TQVA 3TXZA 4K36A 1ZAHA 3SGZA 3V75A 2E77A 4OT7A 4AMAA 5KSWA 3G1FA 1QPNA 1XKYA 4LY8A 1M5WA 4MYXA 1DOSA 2VFGA 1KFCA 3ABSA 5FF7A 1TPUA 4NZJA 2C0AA 1Z42A 2O7QA 2ZRYA 1PIIA 1JULA 2A21A 4R34A 4LTSA 1I2OA 2OT1A 1LROA 3BGGA 3LHYA 4ADUA 4OHQA 2HTMA 1VS1A 1MEWA 5LNSA 3C2FA 1VHNA 3LXCA 5FF2A 3E0IA 1R2SA 3BO9A 5DELA 3WJSA 1WBHA 3IVTA 4DQWA 4E0CA 2VELA 4GC4A 3SI9A 4UFLA 5LHFA 3STEA 5AHLA 3E9AA 1OFRA 3IVUA 1GG0A 1RQHA 5F4XA 3E02A 1ME7A 3W2LA 2YDAA 4O0KA 3NM3A 5HMSA 3E49A 1XDLA 1TMHA 1H5YA 4DF2A 2Q3OA 1XCFA 4RKAA 4WUIA 1TQJA 3CIWA 3LHZA 2QUUA 2C1HA 5AYYA 3MI6A 1LOLA 3UPBA 2QDGA 1RZMA 1WX0A 3W86A 5DLCA 1ICPA 3C4UA 5ABTA 3S1WA 3G1SA 4DO5A 3W7IA 1Q45A 4G1KA 3P80A 5DY3A 4AXKA 3GDRA 1TJPA 4O11A 1NSJA 1SZNA 3C2EA 3W9ZA 3GNNA 1P1XA 5EYWA 5K4XA 5IBXA 1TIMA 5A8GA 1OFQA 5CPOA 2ZTKA 2PRHA 3FA5A 2I1OA 5BMXA 2X30A 1SO6A 2JKPA 3ZWTA 1P4CA 2ZZ2A 3EWXA 5LKYA 1FXQA 1QPQA 3N34A 7TIMA 1SU5A 1EUNA 1H7WA 1S3HA 2JKEA 3NPXA 4K7VA 2TYSA 3M0ZA 3H53A 4NZFA 1BEUA 3OHIA 4LVGA 5HINA 3W87A 4FNTA 4BR1A 1T0OA 4K38A 3TJLA 1OJXA 3SIZA 4HHPA 2QCCA 3W72A 2XN0A 3A24A 1SFLA 3I65A 1H1YA 2C18A 3G3MA 3BG3A 3QQ0A 3S42A 1OFPA 1VQTA 3MJYA 2FB2A 3W7GA 3EWZA 4KFNA 4JTUA 4FHAA 3W7PA 4LVBA 3C0JA 5FEXA 2I14A 3FLUA 5K4ZA 4NXSA 3C2VA 1H7NA 1QAPA 3LCXA 2A6NA 3G1YA 5LZLA 1TO3A 3TC7A 3FKKA 3IV3A 3KVJA 2VENA 5K3VA 3MHUA 3OA3A 1NEYA 4UUIA 3B05A 1GYNA 4UTIA 5AHFA 3Q37A 2A7RA 5F2GA 4LS1A 3WK2A 1Z44A 3PR2A 2E5BA 2BWGA 3TCEA 2TRSA 4ORMA 3CWNA 3RNDA 2GQ9A 4DBDA 4GUHA 2QAFA 1G7UA 3W7RA 3P8IA 2J88A 2YYTA 2UV8G 2E6FA 4LVFA 3TX9A 4DO6A 1SSGA 2YFOA 4FNSA 3TQKA 5LSMA 3NZRA 1ZNNA 5DXYA 3VFLA 4KKXA 4HT3A 3P82A 1O5KA 1XBYA 3LV5A 4LS0A 5AHEA 1F74A 4Z1AA 5TQLA 3QM3A 1LP6A 1OFBA 2VFFA 3GLCA 3UXDA 3PSWA 4M19A 1ZALA 4JTKA 2CLFA 1CW2A 3BW4A 4GUIA 4J9JA 4UR7A 2GQAA 1RD5A 4MYAA 3P67A 1KFEA 3MI2A 1IXPA 1I8JA 4JTLA 5BMWA 2Y61A 3UXAA 3LDVA 1YXYA 2I9EA 4FX8A 2QAPA 1JVNA 1HO1A 2YCEA 3R89A 4OV9A 1TTPA 1WOAA 3C8FA 3L21A 1KFLA 3CM4A 3NXFA 3W2JA 3ZS4A 2DZUA 3PM6A 2X1TA 3KRUA 1ZAJA 4TMBA 1SPQA 4MY8A 2V5LA 2Y7FA 2V5BA 2H6RA 3W1RA 1J5TA 2RKXA 3LOTA 1VLWA 3LI0A 2Z0IA 1W56A 3A23A 3NM1A 4JN6A 4O1DA 4O13A 1L6YA 3S5YA 3CB8A 1ML1A 1JRCA 2QCGA 4N9DA 1KTBA 2NV1A 2CLLA 1VYPX 4OWGA 2QCNA 2QJGA 1LDCA 1AK5A 4AB4A 3W22A 5KZDA 2QJIA 3M41A 1TTQA 3B04A 1NVMA 1UCWA 4MOZA 1FXPA 3GAKA 1ALDA 1GJPA 3G0XA 3UWYA 2H90A 3G3DA 3L5MA 2ISWA 2WNZA 3DU0A 3NNTA 2CW6A 1OK6A 2C15A 2ALDA 3A5FA 1SW3A 2Y70A 5FF4A 4JX5A 3IIZA 3W7JA 1FDJA 5FEZA 2ZZ6A 3WJWA 3UZ5A 1GTHA 3VE9A 3SZ8A 3NO5A 2DZPA 4ML9A 3TQ0A 4EIVA 4RR4A 4Z1BA 5HWJA 4ADSA 3LXAA 1FWNA 3LCGA 2ATMA 1WOBA 1LLWA 1AW2A 1F7BA 4AHPA 5CPMA 1TRIA 5AFDA 2FPVA 4JYEA 1XM3A 2B4GA 2DZXA 4EWND 5CSSA 3NG3A 4JIPA 1ME8A 3NR0A 1KLYA 3QEZA 1HUVA 1QR7A 2YYUA 4CCDA 3W74A 1KM0A 3QRHA 1JQVA 3O6DA 3NL6A 3STCA 1WXJA 3F4WA 4YL2A 1OF8A 2ZA2A 3B4UA 4O1BA 4CCCA 4GUFA 4MPQA 3CEUA 4M6QA 1CX9A 5G1YA 3P7YA 3BLFA 1TJRA 1R46A 2Z6JA 4B5NA 1XBXA 4MUZA 4PL1A 1GQNA 3LCFA 1K8YA 2CFFA 3IVSA 1DORA 4AF0B 4LNYA 3BW3A 1O60A 3HGJA 1W5PA 4OU1A 1IIGA 2VEPA 4NJJA 3USBA 3NQ8A 2WSRA 2WPBA 3HGRA 4RX0A 2J24A 2ZRWA 1JCNA 1H7XA 4Z1CA 5C2XA 1M6JA 2NV2A 1VYRA 5EPDA 3LCHA 3OIXA 3DFTA 4BWLA 1X7FA 3GKFA 3B0PA 3H54A 3IGSA 5I3FA 2DZWA 3O05A 4MZYA 3L5AA 4N6FA 5KZEA 1FX6A 1K7FA 2R91A 4N4PA 4X9SA 1KBIA 5LGZA 4R33A 5F4SA 3PVFA 1B4KA 1TB3A 3HMJG 4KWWA 3W2NA 1N55A 3O06A 1G7VA 5AC6A 3LTPA 5D33A 2FPYA 1OX6A 1A5SA 4OE7A 1FQ0A 3PULA 3EXRA 3W7DA 4UXDA 4ZQOA 1I4NA 1YPIA 3DFOA 1TCDA 1GWJA 1I2RA 1XUZA 2E6YA 1X8FA 1DHPA 2QUTA 3G1VA 1A5CA 1U83A 4M7TA 3DFSA 4UR8A 3PUDA 4BI5A 1SZFA 3KOFA 4PH6A 1VZWA 4WX2A 3LX9A 3O1NA 1DVJA 1RQBA 1SO4A 5HUOA 2QCDA 4HPXA 1IXNA 2O7SA 3S5NA 5H91A 3B06A 1XBVA 1F2JA 2B7NA 1GPWA 5TBOA 4O50A 4MZ1A 3N14A 1JCYA 3T78A 1ICQA 2YZRA 4WQ6A 3W7CA 1H7RA 1LOSA 1UASA 3BK0A 5CZ0A 3SW6A 4X3ZA 3RFAA 5CZSA 3LM7A 3W1MA 2B7PA 1L6SA 4UTTA 3M1ZA 4A22A 1MZHA 3PBVA 3W1UA 1SZEA 1DQXA 2W6RA 3EWYA 5SWUA 3DHDA 6ALDA 1MEIA 4UFIA 2FB3A 2P1FA 3TR2A 3GDTA 5F4WA 3O16A 5J5DA 4LUJA 4YMZA 3G8EA 3STGA 3QFEA 3KRSA 3U8GA 1QMLA 3MW7A 2ZA3A 3G1HA 3OBKA 1VLIA 1IF2A 3WJZA 4QJ1A 2Z1BA 1PHQA 3M5ZA 4MLRA 2GVGA 4O10A 1C9DA 4FNQA 3B0UX 2PRLA 3HPXA 3G1AA 4O16A 2DORA 4RLIA 5C55A 5KMYA 3W7QA 3IEBA 2QF7A 5HNRA 1TREA 3STFA 1JCLA 4O0ZA 4XTDA 1OHLA 1QDSA 2ZRUA 3UNDA 3W7MA 2QCHA 4A29A 4MY9A 3UWVA 3NQ2A 3M6YA 3MBDA 2WV8A 1YDNA 5D37A 3F1QA 4WZHA 5FEWA 1W5MA 1LORA 2Q3RA 3M16A 1EPXA 4RJEA 2YW3A 5G2WA 5BNKA 1KTNA 1LBFA 3LERA 1A5AA 4AWTA 2DZSA 2ZCGA 4MJZA 1W0MA 2EHHA 1G4EA 3EWUA 4IX0A 5F1VA 4JTFA 3IIOA 3MI3A 3SFKA 3ABRA 4CLMA 3UWZA 2CLIA 3HQ1A 4QAIA 1TRDA 1EWEA 3CWOX 2NUWA 3GX9A 2FJKA 2A6LA 1T99A 3TUUA 3QQ1A 1OYAA 3TAOA 3KVMA 2E09A 3P61A 1PCWA 2ZZ3A 5LNVA 5K9DA 3NL2A 4P61A 1D9EA 1OFAA 3M5VA 1JRBA 4I7VA 2IQTA 4MIMA 2JBMA 4FF7A 5DXXA 3NL3A 4Z0SA 4WD0A 1IXQA 1Q6LA 3A5VA 3RU6A 3CT7A 4JTTA 4QSHA 5I3GA 3S1VA 1ONRA 3Q2DA 3MP3A 4IXHA 4QISA 4MY1A 1A50A 4IMGA 2YR1A 4BFAA 2ATSA 4FXRA 1VRDA 3NGJA 1T96A 1G4TA 4JTHA 2ZBTA 3LBCA 3M47A 2ISVA 1Q6QA 5F2LA 3UD6A 1FWTA 5EMUA 2RDTA 3EWWA 1B4EA 1EP3A 3UQNA 3W2KA 3DFQA 4H4IA 5F2IA 3T44A 1LBMA 1GYLA 3ZR4A 3SJ3A 4MJMA 1GVRA 3N73A 2VEKA 3T55A 1F76A 4MLJA 3QSTA 4DF0A 1UBSA 3GXPA 2JK2A 3QMSA 3E96A 4IMDA 2HMCA 2C14A 4LV4A 3L0GA 2DJXA 2JKAA 4JTEA 4LW7A 4ZQMA 1G69A 2XN2A 3LLFA 4UTKA 1WYIA 3UWWA 5FF0A 5I3KA 1KTCA 1FCQA 4UMCA 1ME9A 3ATYA 1LCOA 4JTGA 1K8ZA 3BVJA 4JXCA 3HPZA 4UTWC 3FKRA 1K03A 4UFHA 3GXNA 3HG2A 2X1SA 3N9RA 3P5ZA 3D0CA 3UY7A 1EB3A 1S5TA 5DN1A 1WAUA 3F4NA 1O4UA 1GOXA 2BZNA 4QITA 1OK4A 5HJLA 3HBLA 3I6RA 1SUXA 3SY5A 1QCWA 1PL9A 2E68A 4HIBA 3RMJA 3DZ1A 4L4MA 2ZRZA 3THAA 4O52A 4X2RA 2Y85A 3UPWA 4QM1A 4IMEA 1DBTA 3KVKA 2VXNA 1QPRA 4A2SA 2DZTA 2Y6ZA 4KFPA 3EX6A 2TSYA 3HOJA 3P84A 2VEIA 4UTTC 2VFIA 5HUPA 1AW5A 1EA0A 1DL3A 3HF3A 1ZJIA 3NPUA 1B9BA 4MFEA 3A21A 1QOPA 3L68A 4UMAA 4JYFA 3W7KA 1XC4A 3QW3A 4Z1DA 4WY0B 4QNWA 3R13A 3BLIA 2VFEA 3G24A 1F6KA 4Q32A 3C6CA 3S5OA 3DHFA 4XUGA 3LRKA 3W71A 3HIJA 1OFOA 4TU1A 5CZTA 3O6YX 1VCVA 1RVGA 5HR6A 1S5VA 3FFSA 2F84A 1TYGA 3LGEA 2EPHA 3GAYA 4NUWA 3DH7A 2FTPA 4E2BA 1I2NA 4WJEA 2V30A 2HSAA 3A22A 3NVTA 4Z0JA 3W1NA 3TAKA 1HTIA 2C6QA 2OJPA 2WO5A 2YSWA 2G96A 3W1LA 3TFCA 3SECA 3C3NA 4ICNA 1FWSA 4MKNA 1FWWA 5D30A 3IGXA 4LUIA 3M9YA 1SO5A 3R2GA 1F6PA 3DFNA 1H62A 3TC6A 4I9AA 4NU7A 4ONVA 3S0CA 1TPDA 3ABQA 2WNQA 3NAVA 1W8SA 3OEXA 1IXOA 5F1UA 4O54A 3KX6A 1W5QA 5H2ZA 5BOOA 2FQIA 2HS6A 3LCIA 4AEOA 4UFMA 1Y0EA 4PCFA 1JCMP 1H51A 1JQXA 4K8HA 2CLEA 5KZMA 4U4MA 4UNKA 3BARA 3LRMA 1AW1A 3DI1A 4PTNA 3NPVA 1DKWA 4CQ9A 3DAQA 1U5JA 3FYOA 1F73A 3T40A 4RXGA 4C1LA 3PG8A 5D03A 4TMCA 3GKAA 2J27A 1C29A 3I7SA 4RV8A 1OX4B 5K9XA 3TMQA 5HQEA 1DQWA 4AH7A 1AG1O 4JIQA 3DBPA 2Y62A 4BI7A 2Q8ZA 3NQFA 3RK8A 3EX2A 1XBZA 2ZYFA 2FLIA 3FOKA 4XBSA 1BKSA 2Y7DA 3LV6A
chains in the Genus database with same CATH superfamily
1ITCA 2VEGA 5EMKA 4O57A 4H7ZA 2AMGA 4D6DA 3OVRA 3G2GA 4UFKA 1B3WA 1BQCA 3IS4A 3ZFHA 3FDKA 3WUEA 3SDOA 1DWFM 2DUAA 4LC8A 1FHDA 4IX2A 1XGDA 2I7GA 3BSGA 4M56A 4IFKB 3RO6A 1MUWA 1ZQ5A 3MUIA 2A7PA 3LGGA 4L80A 3N17A 4J4KA 4D6JA 4YTRA 1EJUC 2H3DA 3W76A 1EO5A 4FNUA 1EL3A 1BF2A 1U2YA 4RUBA 3C86A 2VX6A 3U6WA 4GXWA 1U5HA 1TSIA 2JE8A 4Q22A 2G41A 4E4FA 4HNOA 1C9WA 3O8AA 1DE5A 3TZFA 5E09A 4WOZA 3EMCA 1AL8A 3CZ8A 1Z32X 2ICSA 3HB9A 2D0FA 3UU0A 2INFA 3CV1A 3WDHA 4GXMA 4KWUA 5EY5A 4QEHA 3THQA 3ORWA 4FO4A 1X38A 4WSHA 3BQ6A 3PG9A 3DYMA 2ZWZA 3J7HA 3DHPA 3ZSTA 4Q8UA 3Q4DA 4J40A 2PTYA 4HVXA 4GLEA 3WBEA 1YE6A 3HPFA 1XH2A 1FUYA 1J2BA 3UJFA 5C54A 2PE4A 5D4YA 3IIPA 3W01A 3RX2A 4Q3MA 4PFMA 1NF7A 2IPGA 2YPIA 2Y8VA 1QNPA 4GK8A 1ECEA 2FIQA 2ZUTA 4AG0A 3B97A 2VYOA 3F5KA 2VC7A 3BCJA 3VABA 4UTJA 1GUVA 3EPOA 3U9IA 1IWBA 1B1YA 1VEPA 3B0VC 3ITYA 2J9XA 5D9NA 3NOEA 1QI2A 3PZTA 1QWKA 1POJA 1YTKA 4IGHA 4NJIA 3AXHA 3AXMA 3P0WA 4PB4A 5KTLA 1HKMA 3UWQA 3BC9A 4DJDD 4LH8A 4PUWA 1KM2A 3LCLA 4KWVA 3NO1A 2DT2A 3ZWSA 1PVNA 5CPNA 4BHYA 1RHCA 4IJBA 1SM9A 1EXBA 2C91A 2P50A 3HQOA 3QFWA 4A8IA 1UMLA 2QCEA 3WQ6A 5E6YA 3CEPA 3MBFA 5C8BB 4M3PA 1Q5MA 1EO7A 3VKCA 1BVWA 4FXJA 2WJEA 4H6QA 1JDEA 4L4LA 2VUYA 3L4TA 2P88A 5LXXA 3WNOA 1CI1A 3A9BA 4W9TA 4DWSA 1H7PA 1I45A 3I7QA 4PL2A 2PD5A 4YTUA 3T0BA 4UOZA 1AQ0A 4D6HA 1HIZA 3W07A 3PANA 1MDRA 2V2CA 1CYGA 5FI8A 5CSRA 3C52A 3UVAA 2A3AA 3IIVA 4TX9A 2OVLA 2WKJA 1BHGA 1EDGA 2V38A 4ASTA 4O12A 3VCNA 1QI4A 3DIPA 2EBNA 3RPMA 2FVKA 3W3OA 5LIUX 3BLOA 5HMEA 2ZICA 2OMAA 2ISFA 4Q8NA 1NJJA 1J12A 3ID7A 3VOIA 4JAWA 3GZ3A 1AODA 2Z27A 5CBJA 4N6EA 5K9CA 2DZBA 3CLMA 5K7JA 1FDYA 3KBWA 3INPA 1K6WA 3WIJA 3UZJA 2BBFA 4IFKA 1JYWA 3QPYA 1KA9F 1YW1A 4IP7A 1WDQA 4ZXOA 4A2RA 5J5RA 2O9TA 1QO5A 2YBTA 2RDXA 3OA5A 2OOGA 3OHMB 3GWQA 2GJNA 3IIXA 2R82A 4ZFCA 4DAFA 1NY1A 3GR7A 5D2XA 1FWAC 4PMYA 4DF1A 3RRAA 4G5DA 4YS1A 3U2ZA 1IHIA 2OT0A 2CZEA 2E1WA 1REQA 1JD7A 1GTEA 4JTAA 3T1GA 3WLRA 1PZ2A 2C1IA 4O15A 4HP5A 3OVPA 1MFVA 5DCEA 2BTMA 5AKQA 3LZ5A 4X0VA 2XDFA 2FMOA 2DJLA 5GJNA 1HGYA 4WJ8A 1T6MA 4OOUA 4RW3A 2HJPA 2V5JA 4A35A 1M65A 5FF3A 5ABEA 1PS9A 5D04C 3WQEA 3ZR6A 4I9TA 4NJGA 1DJYA 1D8CA 4R7WA 1VCGA 3M0XA 3LBMA 3CIVA 4RPQA 4YTSA 4NI8A 4JKMA 3F03K 2PGFA 4H9VA 4FIQA 3ZT5A 4EK7A 1HJVA 5A6SA 1FWEC 4ALDA 4LAMA 4U3CA 1C8YA 4GHRA 3UJ2A 3BE7A 4UTLA 2VNCA 3LMYA 1EEPA 1HL9A 3F7JA 5DBTA 4CNUA 2Q71A 5F2MA 1QOXA 4EF8A 1TV8A 2E7FA 3CZGA 3E0FA 3T0CA 3U4AA 5BW6A 2PDWA 3AIVA 1KXTA 2G97A 3TJXA 2PDMA 1A3XA 2Y63A 3UA3A 1K9EA 4WK9A 4G7EA 1UKTA 3V3WA 3UWUA 4AVFA 4CNPA 3KS5A 4AEFA 4FPSA 4KESA 3WNKA 1JCJA 1OX4A 2DSKA 3CGTA 1NTHA 2GFTA 4EF9A 2Y89A 3S1XA 1LT8A 2X2YA 4GGHA 4X22A 4IOTA 3W1PA 3HG3A 2NX3A 4PGLA 1P7TB 1R0MA 4IPIA 5XIMA 3GO2A 5I5RA 2BV9A 1BXCA 1PE1A 1PXGA 4MNLA 1F9CA 1JI2A 4UMBA 2Y2WA 4HZ7A 2XIQA 3MDWA 7A3HA 2OGJA 1ICSA 2Z7GA 7REQA 1XIDA 3Q58A 1POKA 3CUGA 5HWNA 2GYIA 3MCNA 5JH2A 3GNPA 1OC7A 1ONXA 5HR7A 2Z24A 4AWEA 4IP4A 3WFAA 1ITUA 2Z2AA 4DJDC 2FJUB 2PWUA 1MO0A 2O56A 4J35A 5EKYA 2IUZA 5I77A 1EWDA 3TROA 3NYZA 4H2CA 1R5YA 1T40A 1OCJA 3TKFA 3TN4A 4W87A 2WSQA 1QNVA 4IWWA 1OG6A 4X60A 4S3DA 1PCKA 3S6OA 3KOWA 2C16A 4L9XA 3UXKA 4JCMA 2HK1A 2PA6A 1EC7A 1H61A 1VBGA 2Y4SA 5EA9A 4XTIA 5D2TA 2PDGA 4Y9AA 5D8WA 2VHLA 2AL2A 1FWDC 1W1PA 2J62A 3AHTA 5T26A 3TYUA 3VCRA 3VI2A 3GIPA 4JTIA 5EB8A 6CGTA 1RLDA 1LRNA 1CLKA 4GJ1A 1IZCA 4XAFA 4Z08A 2NXHA 1H49A 4ZQRA 1O95A 1J9YA 3KZSA 1R7AA 1EHNA 1V0NA 3JRKA 4N9EA 4PRTA 1KM3A 2SFPA 1RXOB 1NDYA 1Y5WA 1J0YA 2NX9A 4NJHA 3WEMA 1IZJA 3QH2A 5GPRA 1E9LA 4GA8A 1FCVA 4JZ5A 1TJ0A 4FSAA 2J7EA 2VX5A 5I6SA 4XZ9A 5DX7A 4JICA 3UT0A 1UJPA 1H60A 4O14A 2POTA 3S9ZA 3QKEA 2GGJA 1YDYA 3DG3A 4M1BA 2RH9A 1A3HA 1OF6A 2CLMA 3SCTA 3T4CA 1V93A 3KCLA 3FN9A 5T9CE 1IEXA 3B9NA 3MU7A 1KBKA 2AQVA 4DAIA 3PSVA 1DTUA 5I3IA 1AVAA 1HX0A 2YCKX 2EJ1A 3W26A 5EMLA 1G4SA 3WQ5A 3QV7A 1JZ3A 4XO6A 1VJIA 3WLLA 2QEZA 3N18A 4HOZA 1TPH1 1WZKA 3ZO9A 1V6VA 4GZ7A 1WKFA 1V0MA 1QO2A 5M17A 4XBJA 2XG9A 5M3WA 1HL2A 5HULA 4UTFA 5AN7A 3VMOA 2ZZ7A 1XIEA 1QOQA 4WVXA 2RGLA 3WO8A 1QASA 1Q6FA 1FCBA 2G4JA 3N6QA 1CLVA 3OQ8A 4Q4KA 3FNDA 4HMCA 4NX0A 4RE4A 1S5WA 3LYEA 1J10A 5M1TA 1M7PA 1E9IA 4BQ4A 3NPWA 2VO5A 4CVWA 5CG7A 1TJ1A 4GUJA 4LUTB 4TV5A 2GOUA 4LVDA 3ABXA 3SCUA 4F8XA 5E0FA 1RQEA 2BGQA 2FTWA 3V4BA 2IKGA 3B4YA 3MP4A 1M1BA 3BG5A 3MYPA 5FOOA 3QHOA 2G3MA 3GVGA 3EX1A 2NUXA 1S2UA 3GC2A 5CG0A 3L7RA 2PGWA 2WHKA 2XSAA 4GZEA 1TCMA 1NFGA 5B7YA 1E4LA 4TIMA 4P7RA 3IV8A 2GVEA 1R2TA 4Q7NA 4E8GA 4Q8QA 7REQB 4ZOEA 2AGKA 3C0QA 1XYZA 1V5XA 3U2OA 4Y8FA 3WLIA 4LOCA 1WE5A 3MWAA 4L65A 2J13A 5D09A 1PHWA 4BA0A 3NZ1A 5U4NA 1R30A 2DVXA 3PTDA 4C91A 2OKOA 4ORIA 3EA2A 2B7QA 3W70A 4X9YA 3A3WA 1KWGA 5CPLA 2DFAA 1XIIA 3KM8A 4E6MA 3EB2A 3VKKA 1GGOA 3VCCA 1EGMA 2Z29A 3VNLA 1RBAA 4UTWA 4WOQA 1NFPA 5LNWA 2VX4A 4ZQNA 7XIMA 4F4RA 4JD4A 2WNNA 4PMRA 5FJPA 3LQGA 3NJ3A 2LLEA 3LHTA 2FDSA 6TAAA 3NUKA 3VNZA 2V9DA 1O1ZA 3EKLA 3M43A 4UC5A 1QPOA 3WG6A 3CMGA 1BXNA 4GWEA 3W6YA 1K3UA 5U7SA 4RCXA 1HG3A 1TV2A 4M6PA 3RLHA 3AWNA 2NQHA 2ABAA 5I09A 2DT0A 1H41A 3HA1A 3VGGA 3TTSA 5HPOA 1RJPA 2INZA 1VC4A 4XB3A 3RLVA 4UFJA 4C6FA 5CJMA 4K68A 1X96A 4MNJA 3CUJA 4H9MA 3B9EA 3LI1A 5I3HA 3L4YA 1J0KA 2E6DA 3NQVA 1QI0A 3KAOA 3VZYA 3JUGA 4NQ1A 4AVNA 4PBFA 3PTKA 2NZLA 3RITA 4FIRA 3QZEA 1EUAA 2C7FA 3UYCA 3GUGA 2IPFA 1J6PA 6PTDA 3CPGA 3DESA 4QDWA 1LLZA 1BKHA 2OU4A 3DERA 1ZJAA 1FWRA 2XFRA 4WDUA 4EACA 2XVNA 1VFLA 2E8ZA 2FHBA 3LHVA 3NQCA 4E8CA 6REQA 4H01A 1YPFA 3AIUA 4ZFMA 3TQVA 3TXZA 2OTDA 4IGSA 1UROA 3V75A 2E77A 4OT7A 1GORA 4AMAA 4CD8A 3GH5A 3PZVA 4LY8A 3TYCA 3ABSA 1FHUA 5FF7A 3HTWA 4NZJA 4QCFA 1Q4WA 1K6AA 3RCYA 3LHYA 4ADUA 4NAEB 1VP5A 1VHNA 3K8LA 1JAKA 1R2SA 4WKFA 4J27A 3WJSA 3VNIA 3GC4A 3IVTA 3BV7A 1GOQA 1GG0A 2MNRA 3W2LA 3NM3A 3RRXA 3GTXA 2YBVA 3LNPA 4DF2A 2OB3A 1XCFA 3THDA 1C8QA 3OZYA 1GEHA 3LHZA 5AYYA 2QUNA 3MI6A 4I5UA 1RZMA 3W86A 3HN3A 3IWPA 1RCQA 5ABTA 4G1KA 5DY3A 3LBOA 4P7QA 3RJYA 5C9ZA 1TIMA 5A8GA 3L2MA 4JQAA 2PRHA 2I1OA 4AIEA 4EP8C 2X30A 3T4WA 2FGZA 3ZWTA 3V36A 3DUGA 3EWXA 1BGAA 4A05A 3E6EA 2GJPA 1QPQA 3UZWA 5HOSA 2JKEA 4U5KA 4K7VA 2J8GA 4NZFA 3OHIA 4LVGA 5HINA 4BR1A 1TKKA 2NQLA 1T0OA 4IG2A 3H2NA 3Q45A 3DFYA 4JKLA 4TXEA 1OJXA 5ECVA 5BWAA 3A3HA 2ZC1A 1UZ1A 4LF1A 4MUPA 1W6TA 2I17A 2C18A 2XTKA 3H26A 3MJYA 2FB2A 4C6JA 1CXIA 4C6CA 4PBEA 4PCSA 3K8KA 3C2YA 1CTNA 5K4ZA 2VURA 4DWSB 4D6FA 1H7NA 1ITXA 4QS6A 2A6NA 3G1YA 3KE0A 3R4IA 4BZYA 1E4NA 3FGCB 3TC7A 1G1YA 3KVJA 2D2HA 2VENA 1JNDA 4MWAE 3OA3A 1NEYA 4TV6A 1RK5A 3Q37A 2QPXA 4GPNA 5LIYX 1Z44A 2BY2A 3TCEA 2TRSA 4FS9A 3CWNA 4DBDA 2PDXA 4KT2A 1A80A 1GYMA 4YVPA 4DO6A 1R9XA 4R3UA 3THUA 1WZLA 2GDVA 2I9UA 5GQBA 2AKZA 4Z1AA 1ZL1A 2X09A 4R9XA 3SCRA 4H9XA 2XZ7A 2F9RA 1ZALA 4JTKA 4ZTXA 1HKKA 2VGFA 4GUIA 2GQAA 1EIBA 3WF0A 4TX6A 3CB3A 5BMWA 2Y61A 4JFTA 2GUYA 1HJQA 2WMJA 4FX8A 4UZSA 1JVNA 1GNXA 1K70A 5I3DA 5CJ5A 3AS1A 4YPJA 1RA0A 2YCEA 3R89A 3U7VA 1XINA 1Q2SA 1TTPA 2CXEA 4XD4A 3L4ZA 1TE6A 3KRUA 3TTOA 3B40A 2X7WA 3SFWA 1TX2A 1NWRA 4HU8A 1IWPA 2Y7FA 1HW6A 5AC4A 3IGHX 3VIPA 1NQ6A 4LY4A 2X8RA 2Z0IA 2PS2A 1W56A 3NM1A 3ONBA 4H9TA 3S5YA 5M2FX 2CBJA 3CB8A 2FMNA 2WMHA 2QDDA 2CLLA 5A8PA 3LMZA 4IIHA 2QCNA 1AK5A 3HFTA 4P8UA 3GNRA 2QJIA 3TVAA 1NVMA 3BXWA 1GJPA 3G0XA 4G56A 4HA0A 1NDVA 2WNZA 2WVTA 1OK6A 1VAHA 2C15A 4HJWA 3A5FA 1WUFA 2Y70A 5FJTA 1WDDA 4NZ5A 1GOKA 1GTHA 4KEMA 3TONA 1Q13A 2VL4A 1QUMA 1HF6A 5I7GA 4ADSA 1FWNA 1XWYA 4ZO7A 2ATMA 2X40A 4CD5A 1OZMA 3CHDA 4AHPA 2PLJA 3AQUA 1W1B1 5AFDA 3CO8A 4US5A 1H2JA 3QVQA 1XM3A 2DZXA 1PO9A 5CSSA 2Y0FA 3NG3A 4JIPA 4HOXA 1MMFA 2DUZA 1QNQA 1HUVA 2BMBA 4PYSA 4QR6A 2YYUA 2V3FA 2CC0A 2VC9A 4F48A 3K4DA 3IK2A 3QRHA 1JQVA 3VK5A 4YVXA 3XIMA 1J18A 5HANA 1WXJA 5A6LA 2ZA2A 3MMDA 1WZAA 4CCCA 2J75A 3RR4A 3IANA 3B9OA 2YIHA 3VNKA 1CX9A 2PP3A 9CGTA 4B5NA 4JQ1A 1O66A 1XBXA 4MUZA 1ZRQA 1W9DM 1K8YA 3NSNA 1I60A 5REQA 4IPLA 1VEOA 3LG3A 3BW3A 2W92A 3VOCA 3IAPA 1IIGA 4XVDA 2ON3A 2WPBA 1R85A 4GIRA 5C2XA 2Z28A 3EOOA 3ZZ1A 2DZWA 2PDIA 5KZEA 4N6FA 1FX6A 3NQBA 1C3FA 1KBIA 2VC5A 2YZ5A 1TUXA 3KBVA 3TYDA 3FGCA 2GSHA 2JQXA 2BHYA 3HMJG 1VJZA 4HU4A 1W91A 3W2NA 3HZ3A 5AVHA 1Q6CA 4IM4A 3H4WA 1FQ0A 3W7DA 3EXRA 3XISA 3N4FA 4ZQOA 4AIOA 3FY1A 1I4NA 4OIFA 4YHGA 2REQB 4LB4A 1CECA 1TCDA 1GWJA 1I2RA 3VIMA 3G1VA 8XIMA 3ENLA 4UR8A 2XFFA 4UQAA 4BI5A 3CZKA 4XZHA 1VZWA 4LX4A 4UQ9A 4I3GA 2DSZA 1DVJA 1RQBA 2IQ0A 1DXIA 2B81A 1SO4A 5IOBA 1AUSL 1KD0A 1E3XA 3N14A 1L2QA 1M53A 2VQTA 3FYYA 2YZRA 4AC7C 1UASA 5B80A 5DANA 3RCNA 4QE1A 4JKKA 3OBAA 4H19A 3SN1A 3GXFA 1QK2A 5CZSA 5T8GA 5HATA 2B7PA 4TOQA 3M1ZA 2W4XA 1MZHA 3PBVA 1RCXB 5ABFA 3W1UA 3K5XA 2VR4A 4J2MA 4KRZA 1ISXA 5SWUA 3UCQA 5HQLA 1NH6A 1GVEA 1UZDA 4HCLA 3TR2A 3WNMA 3ARSA 5J5DA 4YMZA 4EE9A 1ZJHA 1QMLA 2YLLA 4AC1X 4Q8VA 2HPMA 3C8NA 8XIAA 1JYXA 4UR9A 4DZHA 1IF2A 3WJZA 2PDFA 2Z1BA 1PHQA 2RUSA 4MLRA 2GVGA 3AXXA 1JNEA 4PR4A 3HPXA 3G1AA 3RCMA 1CNVA 2QF7A 4XTDA 4QGCA 1F61A 2HCVA 4A29A 2ZUSA 3U57A 2JEQA 2RGMA 4MY9A 1EJXC 2PLCA 3NQ2A 3MBDA 1YDNA 1TZ9A 2GK1B 5D37A 4LQ1A 1H5VA 5FEWA 1LORA 2O9PA 3GXIA 3PNUA 4PB3A 3TTQA 1PDYA 2ZVRA 2WB5A 3M0MA 1LBFA 4L1GA 4LSBA 2DZSA 1PUDA 4AWTA 2EHHA 3V16A 2VRQA 3GH7A 3LA4A 1BVNP 5HPCA 1ENUA 1ZJBA 3SFKA 3S2LA 1QW7A 4CLMA 2ANUA 4LAOA 3VD7A 3UWZA 2CLIA 4AZBA 3PJUA 1W1VA 2EPOA 3D46A 1ZZMA 2NUWA 3GX9A 2FJKA 3TLQA 1WP6A 5CQ1A 3KVMA 3P61A 4CU6A 1TVNA 3R11A 2ZZ3A 4LJ3A 4ZE5A 3VIJA 1NQKA 1PEZA 4EPKA 1J93A 4Z0SA 3A5VA 3CT7A 4QSHA 6A3HA 4KWSA 5BXSA 4MY1A 3VIKA 3WLHA 1RALA 3CNYA 5GNYA 2D2OA 1EC9A 1G4TA 2R1NA 3MTWA 2ISVA 1Q6QA 3XINA 3UF9A 4ERIA 1B4EA 5DT5A 3KZPA 5F2IA 1UHVA 3T44A 1LBMA 5CLWA 3ZR4A 4NAFA 3E1F1 4DY1A 1O12A 1F4AA 2VEKA 3T55A 4DF0A 4JIIX 1EF2A 3ES8A 4XV0A 2ZVIA 1OIMA 2PODA 3QGVA 3E96A 4NP7A 2HMCA 3WDJA 1KCZA 3EYPA 2R9RA 3AFBA 1BYBA 3LS9A 3WF3A 2JKAA 2XN2A 4KRTA 3LLFA 3TYAA 1ELSA 2OZ3A 3UWWA 5FF0A 1FCQA 4UMCA 3ATYA 3DYOA 4PCTA 4JTGA 2ZXQA 3BVJA 4XG1A 3BJFA 3FKRA 3GXNA 4L6DA 3P5ZA 4AY7A 1E1CA 1U1HA 1S5TA 3CJPA 1O4UA 4NAEA 5HJLA 1R9ZA 5IFPA 3I6RA 1IWAA 4CU8A 2E68A 4L4MA 4O52A 1XIFA 3WQFA 1FWGC 2BGNE 4IMEA 1QPRA 4QG6A 3F4DA 4S39A 2TSYA 3P84A 3WMSA 1VFOA 4UTTC 2DIEA 2CETA 3V0UA 1DL3A 3AIWA 4FALA 1R87A 3AXIA 1YKWA 3OP2A 1AFSA 1DWJM 1CLXA 1B9BA 5E9XA 1QOPA 4JYFA 1VRXA 2OWXA 4XISA 1M04A 3W7KA 3QW3A 3MV11 2BXZA 3DBNA 1EDTA 1YNQA 1BGGA 3R13A 3CAKA 1LT7A 3DOPA 3C6CA 3S5OA 3KOYA 3ZT6A 8A3HA 3LRKA 1OFOA 3BSMA 4TU1A 2YDSA 1UWAA 3WZ0E 1S5VA 4DHGA 2F84A 3PZQA 4AMCA 4GYPC 3WH6A 4WJEA 2V30A 3A22A 3QPEA 4Z0JA 3TAKA 3NWRA 4KGLA 2WBGA 1RAKA 1PTDA 2G96A 1XLMA 2PD9A 1MQQA 5BWFA 1VPQA 3RR1A 5D30A 2I5GA 2WCAA 1F6PA 4B92A 1H62A 1G01A 4I9MA 3HPAA 1XPGA 1W5QA 2WXDM 4JTQA 1AJ2A 3W4RA 3LCIA 4AEOA 4HPGA 4C1NA 4BKNA 4PCFA 1JCMP 4QXIA 3BAYA 3RXZA 4K8HA 1MVYA 3WCZA 2CLEA 2PBOA 4C6OA 4QJ4B 4U4MA 1G94A 1BWVA 1E0VA 4LYRA 4C5ZA 4PTNA 3NPVA 4WF7A 4LCSA 1GONA 2NQZA 4XO7A 3FYOA 1S1RA 4QLJA 4C1LA 2JEPA 3F2CA 3AHYA 3GKAA 1OX4B 3B8SA 5HQEA 3Q65A 1AG1O 3VC6A 2Y62A 2Q8ZA 3AUJA 4DJED 2FLIA 1R6WA 2CLKA 4KEVA 3NSXA 3GVRA 3E0VA 2D22A 3CIXA 1Z8AA 4ZOAA 4NIRA 4PMUA 3WLTA 3EX4A 4Q7BA 3B8WA 4E2DA 1A49A 3YPIA 5JQ9A 1J4EA 1WKYA 4DWDA 2ISSA 4NI3A 1QBBA 2VDGA 2DU2A 5KEZA 1AZ1A 1A5NC 1AL7A 2IKHA 3WDRA 3FXGA 1W2VA 2H8XA 3E0WA 2OX1A 3OVGA 1ISYA 4AU0A 1XUUA 3LB0A 3VNMA 3O15A 2OLHA 2EO7A 1V0KA 4E8DA 1CXKA 4AF0A 3LNMA 2J74A 4ZODA 2V8ZA 3ITVA 1G6CA 2DQWA 4IISA 1UH3A 2WLZA 3KCJA 5FEPA 3EWBX 1TPB1 2NXGA 3ME3A 5CEWA 1Q7ZA 1VCFA 5HMFA 4IQLA 4FLQA 3LTSA 2YA2A 4FXFA 4IGNA 4IPJA 5JUVA 3TZNA 4M6VA 3TWAA 4GCAA 3W7NA 1JD9A 3DEQA 4RE0A 1KR1A 2EXOA 2H3BA 3SUUA 3NQEA 3NQAA 1AH3A 1A0CA 3MANA 2F6XA 4R5EA 1Q6EA 3DGBA 1ZP4A 3OVQA 3TW7A 1KM1A 3WFLA 2E9BA 1PYMA 4Y90A 5AYBA 5JIWA 1GOOA 4DLFA 2VDHA 5G1MA 4UNLA 4O17A 4HHLA 3WLOA 1DTNA 3HG5A 3P5YA 1D2KA 4LRSA 3E5PA 2CNCA 3VINA 1QPKA 4E2OA 1NP0A 2VEFA 1MRQA 3PZIA 3ZLGA 3TU9A 1S3TC 4EPBC 4I7UA 3U4FA 5G2HA 2PTXA 1IGSA 1PX4A 3DFPA 3BURA 2P5NA 4TVDA 4F0MA 2RJGA 3PC0A 2EQDA 2C13A 4IXXA 1ZAIA 1OFEA 2WWCA 2ZA1A 1B9ZA 1CZ1A 1KM6A 5LIWX 3VNDA 5BYWA 3H55A 3SRFA 3MP5A 3MO7A 1QBAA 3GRIA 8TIMA 5CC6A 3IJ6A 2XN1A 4QCEA 2G37A 2RFGA 4WIWA 4HSNA 4BI6A 1KFJA 1UC4A 2DGAA 4XQ6A 3LPFA 5LHEA 4UWMA 4E38A 2GJRA 1E56A 2OSWA 4NNCA 1FFRA 3H7VA 3CH0A 3SR7A 4S3FA 3R8RA 1EF3A 4LUYA 4AYSA 4PODA 4GQ0A 2HROA 1UB3A 1SW7A 1JZ8A 3I4EA 1E0TA 1O7AA 4XD6A 1Q6DA 5CAKA 2XFWA 2E25A 4LRTA 4IIEA 4NVTA 3H2EA 3BTNA 3QTGA 4XKMA 1S2WA 1KBJA 4HYWA 3TTEA 3OG3A 4PTVA 3PAOA 4F2TA 3TW6A 1GJUA 4PCNA 4A8RA 3VIHA 2A4AA 3QZ6A 4OV4A 3UZZA 3AYSA 3TSMA 3W1TA 1LWJA 4AHQA 1KRBC 1VFFA 1K4GA 3BMVA 2NT0A 4FP1A 2J8TA 1TV5A 3MKVA 3QF0A 1SR9A 4J5NA 1J0JA 2Q8LA 1XXXA 2ZUVA 3CPRA 3LZ3A 4KIEA 3OBEA 5CSYA 1Q6RA 4DYKA 2D73A 5JH1A 1UD2A 3GR8A 4Z42C 4LYPA 3GC5A 2IKJA 5D2YA 4WLCA 4V27A 3VNYA 3W0KA 3W1AA 1EHAA 1W3HA 4YU1A 4DELA 1GEQA 1W1ZA 3ANYA 1LYXA 4J3TA 2CIPA 3BL3A 3VIGA 2PP1A 3GNXA 5D38A 5A8NA 1UWSA 4QHRA 1CCWB 1JF5A 1VENA 5AZ0A 3PHAA 3W88A 4GFSA 5AY7A 1TIWA 4JNYA 3URNA 3ZJ7A 4P8XA 3NURA 4A3HA 1WQ5A 4K8GA 3PBWA 3MZ2A 3FJ6A 3W83A 1B3OA 2VFDA 4FX7A 3QW4B 4R27A 4GY1A 5D2VA 1XV8A 5G4EA 5JIPA 4AXNA 3T81A 1P0KA 1E70M 4JY9A 2RJHA 3IJLA 5C9UA 4TTGA 3NGFA 3N13A 3L2LA 1D3CA 3GG0A 1A53A 2Z2UA 2OELA 4ZQCA 1EIXA 4CCZA 5EBAA 3GDLA 4JS3A 4S38A 4ZL1A 1N2VA 3F2BA 3H4GA 1YDOA 3N2BA 3DI0A 3W7EA 3ZMRA 2GPTA 1XLFA 2V3EA 3TYZA 2GK1A 3WD4A 4W5ZA 1ISWA 3S5ZA 2TPSA 5CZJA 3VGEA 3KBSA 4IH3A 4S2CA 3MVIA 2ZQ0A 4LU0A 3R8GA 1OM0A 5BXPA 2ZTJA 3GTHA 1DXFA 4XKYA 2WVVA 1BXBA 4JBRA 1FA2A 3U48A 1Z48A 2WSKA 3KP1A 3AYTA 3UETA 3NQGA 4DBEA 1CDGA 4S3GA 3UG3A 4JFSA 2Y88A 1ZENA 2WWDA 3N29A 2VWTA 2ZOXA 2QCFA 3Q67A 3A47A 5AYZA 2BP1A 3WYZA 4XZIA 2VZSA 3AAMA 5AC7A 5A94A 3QV9A 5LNRA 2R94A 4MHBA 1TG7A 3QC0A 2VC6A 4JHMA 1OQFA 3AO0A 3TV8A 4ZMGA 3K4WA 1UKSA 3OYZA 2CU0A 1LLOA 1XLIA 3CU2A 3IJIA 1U22A 1E55A 3LHWA 2AGTA 2GJXB 4RZ5A 5C2GA 3JS3A 1VGAA 2GGGA 3URBA 2W27A 5L9FA 1UD3A 1TX0A 4AAJA 3E2SA 1NOWA 4QROA 1H63A 3SCQA 3SUTA 2GZXA 3EX3A 3TCSA 1W3JA 1BAGA 3WH7A 3VE7A 3O07A 4K1WA 2WSYA 3H21A 1VFUA 1Q4NX 1KR0A 2X1UA 1NOFA 2PURA 1UD4A 4MFDA 4IF2A 5MHBA 1P48A 3NQDA 1TE1A 3PWAA 3M7SA 3TXVA 1CXFA 3CL8A 5A5WA 3MMTA 1JEZA 3S6DA 3NIYA 1O6IA 3N04A 4GUGA 4Z2LA 2V68A 1W9UA 2Z4GA 4PUNA 3KOZA 1KKOA 4NG3A 3NEVA 1M7XA 4AHOA 3KW3A 3W73A 3PPCA 1UR8A 4KFOA 4S3EA 4CVUA 3BV4A 3CQJA 2PWEA 3VAVA 1S2CA 4DLMA 1PZ1A 2Y7EA 1JDDA 3DCPA 2Z00A 4MTVA 1MDLA 3RIKA 1E73M 4N02A 5CPTA 2NQJA 1A5UA 3KVLA 1SJAA 3OGSA 3W6LA 1K9FA 2VVNA 2G3JA 3BPWA 1XC6A 1OD8A 4GH1A 1A5BA 2PC8A 5DQPA 3EKZA 4DPQA 2WW5A 2GJLA 1XRSA 3U7BA 2BXVA 4O1CA 1DJZA 4HN4A 1YADA 3UPMA 2E3ZA 3REQA 2OZ8A 2XH0A 4HD5A 2GVLA 1W54A 4YYFA 2NV9A 1XDMA 2GLKA 2PTWA 4O18A 3R5EA 3GK0A 4OGZA 4XSMA 5G1TA 4YLWA 4EOUA 2QCMA 1FBAA 3GR4A 3QR3A 1ZCOA 1OABA 2G8ZA 2BX7A 2YB4A 3COTA 3RX3A 4GE8A 3GBEA 4QQ3A 2A0NA 2PWGA 2W79A 4GVIA 3W7OA 2NXIA 1HFBA 2UY3A 2AQWA 2HS8A 1HVQA 3N2TA 2DPEA 4HMEA 3EXSA 2J6VA 3WN6A 1OGGA 2YFNA 4QLLA 2QS8A 4NASA 1E72M 2NWSA 4RXFA 2FZDA 5E70A 1LBLA 3N19B 3C2RA 2VZUA 5A8OA 1L8NA 1YXCA 3OLGA 3KHJA 1UQZA 2QDEA 2IW0A 4ZSUA 3CUFA 3W85A 5FESA 5I03A 4JFWA 1XYCA 3WF4A 1DWGM 3PZGA 4LAKA 5D32A 1O94A 1RK6A 1X7IA 2F8QA 4WR3A 3L0NA 2PWFA 4XWUA 3I4KA 4QJ3B 3WX7A 5JBEA 1KFBA 1XX1A 2DT1A 4JY8A 1X1OA 1MNZA 1QNRA 3IJ8A 1JJKA 3C56A 1S2VA 4GBDA 4CD4A 3M0IA 4WSKA 4GX9A 2CKRA 4KQNA 3LLDA 2VQUA 2VZTA 2KX9A 1A0EA 1SO3A 8RUCA 1D7KA 4HNLA 1BWLA 1XS2A 3H8AA 3GTFA 5A6BA 3M7WA 4M51A 4HHHA 1JCXA 2QJHA 4GQQA 3W84A 5D8ZA 2OWWA 1SW0A 1UD5A 3ARXA 1GZJA 1QXLA 3AU2A 4PUDA 1AJ0A 2R14A 3GHSA 2GQ8A 4WDTA 4Z2GA 4W88A 1TPEA 1TA3B 1RV8A 1XIGA 4XD3A 4GNJA 3A4XA 3PPFA 4PBGA 1ISVA 4LYKA 2CLPA 3PBUA 3L9CA 4ATDA 1US2A 2Q6ZA 5FJIA 3GXDA 4LEQA 4HNTA 3CTLA 5G5IA 4YWIA 1EYEA 4Q8OA 4LS2A 3AS3A 1W5NA 3M5XA 1Z9AA 2ZZ4A 1M7OA 2GOKA 2Y7GA 1E1FA 3SQMA 3QC3A 4AY1A 1W3TA 1OVDA 3S2MA 3FS2A 4O8RA 4GACA 4A3UA 4C1NB 3EGJA 1YTEA 4NT0A 4IMAA 3U5YA 3ARWA 4GBUA 3WUFA 1EJSC 3MUAA 3BOLA 1VYSX 3RAOA 4CNSA 2ZADA 3BCFA 5IFTA 3HG4A 3OGRA 4K6AA 2HBVA 2EPKX 5LYRA 4C6IA 4BWLC 4XD5A 3G1DA 4J7RA 3BW2A 1JYVA 3G1RA 3WLNA 2O4QA 1JGMA 4W85A 5G2IA 1L6GA 2QF8A 3GU9A 4MJ2A 4AX7A 3NDZA 2J77A 3UP8A 4AD4A 2XIMA 1XFBA 3EB3A 3EB4A 1BRLB 4OVXA 2OYKA 1A47A 3S9YA 4ILSA 1Z41A 4GQGA 4WY0F 5KINA 4URIA 4NXKA 2GDUA 3ARUA 2QNEA 4HU0A 1EQPA 3HFYA 3UZYA 4GJIA 1B30A 1L2UA 1W8GA 2GWNA 2A85A 1PKNA 1DIDA 4D9PA 4DX3A 1B57A 4HA3A 3PAJA 4J3WA 4G9PA 2EAWA 1EX5A 1LQ2A 5H6HA 4K36A 3DC8A 3R58A 3SB0A 2XHYA 2GVYA 1JYNA 4GI6A 2QJJA 3G1FA 2WHMA 1M5WA 4MYXA 1DOSA 5JU6A 9XIAA 4BJHA 3TJ4A 2E4TA 2O7QA 2ZRYA 3RYSA 1PIIA 1JULA 3RX4A 4LTSA 5A6AA 4YN5A 3BGGA 4OHQA 1VS1A 1MEWA 3GDBA 5A6MA 3C2FA 3TC3A 5FF2A 4F3HA 3BO9A 1QI5A 5DELA 4DUVA 1M68A 4E0CA 1XCWA 2VELA 2R24A 4UFLA 5LHFA 3LPGA 3STEA 1K9DA 5GNXA 2XGBA 3N2OA 1MWOA 3E9AA 1OFRA 1SYTA 3IVUA 3PFMA 1B2YA 3E02A 4O0KA 2PLKA 3R0KA 1TMHA 4BQ3A 4OUIA 1LUCA 4R9OA 2ZKMX 4WUIA 2O92A 4TVCA 3P14A 1LOLA 3UPBA 4LUTA 3UEQA 3GY1A 1TWDA 3C4UA 2EPLX 3S1WA 4DO5A 4AVOA 3W7IA 4AXKA 3KS6A 1SR0A 5TNVA 1UKQA 4H1ZA 3GDRA 1W17A 3W9ZA 5EYWA 4JL1A 5IBXA 2OKTA 3MV01 3W81A 5CPOA 3ICJA 5BU9A 2ZTKA 4HK6A 1JF6A 5BMXA 1YRRA 1KXQA 3BANA 2JKPA 4MM1A 5FCZA 2WPGA 3C0SA 1LL6A 1EUNA 1S3HA 1Z7AA 4KETA 5A2AA 3H53A 3W87A 4CQBA 2F6UA 1LG1A 3RPTA 2XH2A 1A0DA 2J47A 3REQB 4QDMA 2QCCA 3W72A 2XN0A 4I9JA 2W91A 3TOYA 4QBXA 1H1YA 6XIMA 4H7VA 3CH9A 3APYA 3MVTA 3PWIA 3BG3A 5A69A 1BSLA 4IL2A 4CKQA 1IYXA 4KFNA 4FHAA 5H8PA 3NEHA 1A5MC 4M82A 2OODA 3C0JA 3ZIZA 3FLUA 4PSPA 2OO0A 4US5D 5LIXX 3C2VA 4M29A 2AAAA 4M8UA 1MYRA 5AECA 1XYMA 1XGEA 1CGYA 3TN6A 1WAWA 1M7JA 1R8LA 1VIWA 5K3VA 2B31A 3E2QA 3SY1A 4UUIA 2BGSA 3B05A 4UTIA 4M80A 1US0A 5F2GA 3VKDA 3WK2A 1DP0A 3PR2A 2E5BA 2BWGA 1UW9A 2GGEA 1JPDX 1RJQA 3P8IA 2J88A 4LVFA 2E6FA 1OC6A 1TJ2A 2PB1A 4FNSA 3TN3A 1ZNNA 5FSDC 4DM2A 3UXDA 3OO2A 2WMIA 2YL5A 4CN4A 2CLFA 3VUSA 4B5XA 4MYAA 5A2CA 4B90A 3MI2A 3GVQA 1I8JA 4JTLA 3ERPA 2VZVA 3APTA 3I3BA 6REQB 3RG6A 1ZS2A 3L21A 5RUBA 1P6BA 2XU2A 2X1TA 1OWQA 4MY8A 2V5LA 3V5FA 2H6RA 3G6LA 3W1RA 1J5TA 4ZENA 1BYAA 2RKXA 3R10A 1UMYA 1UZ4A 3MSDA 3KBJA 3PNZA 4O13A 5D9OA 4AISA 3LPPA 1VFTA 3P0XA 3CV6A 4D8LA 1T7LA 1OINA 3T09A 3R1ZA 3DDMA 1DIOA 1XLHA 4R7OA 3WELA 3BAWA 2QJGA 1L6FA 1V3LA 2XH7A 4REQA 5EFDA 4C65A 2OYMA 2QV4A 2ZUWA 1UCWA 4GQRA 3GAKA 2ISWA 3NNTA 2WCGA 2ALDA 1PJ9A 1R3TA 4AD1A 5FEZA 2ZZ6A 5JVLA 3UZ5A 3VE9A 2PDPA 1B5TA 2QVNA 3AZRA 3NO5A 5KZ6A 5CGMA 4ML9A 3TQ0A 4EIVA 3QLLA 9RUBA 5I24A 4Z1BA 2D23A 1VBRA 3LCGA 1ZUAX 1LL4A 1WOBA 1AW2A 2IPJA 5CPMA 3WQOA 3T05A 1IR2A 4E3TA 3LEPA 2B4GA 1ME8A 1EBGA 3FSTA 2DIKA 1EDQA 3W74A 1KM0A 2JALA 3STCA 1OF8A 3E5BA 4GZIA 5G1YA 4J3XA 2GGIA 3K13A 1H4PA 3S2JA 2QGYA 3CL7A 3WF1A 1R7OA 3LCFA 5B7ZA 2I56A 5BCAA 1PX3A 2Z25A 3LK6A 1PYFA 4ZO6A 4D6GA 3QY6A 5DT7A 3VGFA 5FJOA 3RM9A 4IIGA 2VRKA 3QTPA 1SMDA 2WSRA 2CKSA 2J24A 2ZRWA 3A13A 1JCNA 1C7TA 1H7XA 1M6JA 1VYRA 5EPDA 1D7FA 1UR1A 3H54A 4MWAB 1K7FA 3UGRA 4YJ5A 3PK7A 1OC5A 5A95A 5LGZA 1R86A 4R33A 1KCKA 3L12A 1P43A 4F9JA 5CJNA 2HDJA 1N55A 2EG8A 2HWGA 5AC6A 3LTPA 3OGVA 4Q4RA 2PDCA 3PJWA 4LPCA 4OE7A 2FTYA 3PULA 2OR2A 4RPPA 4ZO8A 3U0HA 1YPIA 2E6YA 1DHPA 2QUTA 4M7TA 3DFSA 2FZMA 3R94A 3EMZA 4RNIA 1H3GA 1DWIM 3WY1A 3LX9A 3FX4A 1X97A 2QCDA 2VZOA 1IXNA 5H91A 1XBVA 1SJCA 1T41A 2B7NA 5FSEC 4O50A 2XZ9A 3KTSA 4U3AA 1KCXA 3F4VA 4IUGA 4WQ6A 1H7RA 2W61A 2F6KA 4GO9A 4S3KA 3VZZA 4X3ZA 4FLOA 4JPGA 2A3EA 3LM7A 2AKMA 3W1MA 2A3CA 1JZ7A 4A22A 1U1UA 4B3KA 1BQGA 3RUBL 3VU2A 1MXGA 4TUFA 1P0BA 1MQPA 3DHDA 3UYIA 2P1FA 5LIKX 3GDTA 4MGGA 3MCMA 4W7UA 1ZB5A 3WL0A 3BZJA 2PBGA 3H70A 3CXOA 1F8MA 1W1IE 3MW7A 5MF5A 3WLMA 2V67A 1XYLA 2P8BA 4QG9A 3IPWA 3OBKA 1VLIA 4QJ1A 4QJ5B 3BLDA 4O10A 1S39A 4NZ1A 4ERGA 4NILA 3JU2A 1KO0A 3PN8A 3STFA 2XSXA 2ZRUA 3LPOA 5EMJA 3T0DA 3O9NA 4LUSB 3M6YA 3R6IA 1JG9A 2PDHA 2X05A 4WZHA 1F8IA 4H8UA 4MB5A 2FVLA 4L7ZA 4H9YA 5BNKA 3JZEA 1A5AA 1W0MA 1R3QA 3CO4A 3ABRA 3RILA 3CWHA 4UOJA 4B9ZA 3HQ1A 4QAIA 3CWOX 4AZ5A 1PSCA 3SGGA 2A6LA 3TUUA 4E2VA 2QQ6A 4H9ZA 5IDZA 1N8IA 2D0HA 2VCCA 1F3WA 3OLEA 2WZTA 3SBFA 1OFAA 3ANUA 1JRBA 5I06A 4I7VA 4FF7A 1XQKA 4WD0A 2WVUA 4WDWA 4W5UA 2QXWA 2NSXA 1BG9A 1JGIA 1Y5XA 5I3GA 3S1VA 3MP3A 3NDYA 4IXHA 3FSUA 1LF1A 3FEQA 4H04A 1A50A 4IMGA 1Q63A 2HNHA 4D1IA 1XIJA 3GHTA 3NGJA 5E9AA 1T96A 1UYQA 4JTHA 1B3XA 3S83A 3M47A 3NFUA 2R1LA 3UD6A 5EMUA 4L4OA 4Q7IA 1WDPA 1EP3A 4RZBA 3W2KA 2DH2A 2P3ZA 2A3HA 3D5HA 3UG4A 3DFQA 2PTZA 3ZXWA 3NZQA 4MJMA 2XYLA 5A1AA 4MLJA 4RDZA 3GXPA 3QMSA 2Z1KA 3CAQA 4IMDA 1IR1A 1UR9A 3PZ9A 2ZUNA 1QTWA 4LV4A 3I6EA 4ZQMA 4DBWA 3UCCA 4MAVA 4XAPA 1WYIA 3RN6A 1YIXA 1ME9A 1Q8AA 3N1AA 1NWTA 1YMYA 2PGRA 3ONCA 1K03A 2NSOA 2HBXA 3HG2A 3CYJA 2X1SA 4PTWA 5LA1A 3NO3A 1Y5VA 2J7BA 1GOXA 1O5QA 1VEMA 3ARQA 1OK4A 4REQB 4E4UA 3BAXA 3LLXA 3IAQA 4CD6A 1E43A 2VXNA 1ZCCA 3II1A 4LBSA 1QJWA 2WZIA 2CCRA 5TF0A 3VGHA 3WUBA 4OBSA 1GKRA 1ZJIA 1EJTC 2NT1A 2OQHA 1IT7A 4RL3A 3NZPA 4UMAA 1ZBVA 3AISA 2PWHA 4G1NA 5FL0A 3HU7A 1W3KA 3RGTA 2PDQA 1QW9A 3H4XA 3O6YX 1VCVA 2E8YA 3UNTA 5BRQA 3FFSA 1FP8A 4RE2A 2EPHA 2FTPA 1JZ5A 3MUY1 3S47A 4KIRA 1CGVA 1CT5A 4KEZA 3M0LA 1QI3A 2OWCA 4GI8A 2OJPA 2C6QA 2WO5A 1DJWA 1SFSA 4ICNA 2PTDA 4MKNA 3TJIA 3M9YA 1SO5A 3EWCA 3TC6A 3A4AA 4I9AA 3W53A 1OB0A 2G3FA 4LBRA 3ABQA 3OEXA 3KX6A 5IXEA 1XISA 3T0AA 3WLSA 2Z26A 4K1GA 4MAZA 1FP9A 2QZRA 3E38A 4GXPA 3ZVIA 4RDWA 1JQXA 3FW6A 4GKLA 3RM4A 1HN1A 1KXVA 4C7GA 1AW1A 4MB3A 1RD6A 5LXEA 3SCWA 2VCAA 3ITCA 3VZXA 3QV6A 3UR5A 1UD8A 1U5JA 1B31A 1ECQA 2Y8UA 3I7SA 3VM7A 3IJ9A 3TMQA 5EMYA 4AH7A 4JIQA 4HMDA 5DMYA 5DMMA 3NQFA 3RK8A 1DJHA 1Y8BA 2ZYFA 1CXEA 4DVOA 2XFYA 2KZHA 5CCZA 1I6NA 3G1XA 1RA5A 3KRZA 2CLHA 2DP3A 5H8MA 1J6OA 1Z6KA 2OQYA 5F7UA 1M41A 3TNOA 1PKLA 6ENLA 3ZT7A 4MMWA 1V08A 3AU6A 1LG2A 2P3EA 3H7RA 3K30A 1TPC1 5E93A 3I3DA 4LNCA 3FCPA 2ABBA 2IQDA 4ZTYA 1HKVA 4NRSA 1PV8A 4GIEA 3UW6A 3TNBA 3T9PA 4EAMA 3BGAA 4A21A 1XLCA 1UD6A 3SGUA 4AWSA 4JIRA 1Q65A 3WMBA 3L4VA 4O28A 4LGXA 4MSSA 1XYAA 3A12A 5AVNA 3PB2A 2V82A 3W27A 3R25A 5DCBA 1DWHM 2JFEX 3CK5A 5EU9A 2YBUA 2I57A 3WBYA 1ONWA 3PUEA 3IGUA 1W31A 4FNPA 3E2VA 4ZCWA 3FEMA 3B8VA 2X0SA 1I2QA 4CNOA 5C9RA 4PEEA 1GVQA 2WC4A 1DJQA 4Q6JA 1JDFA 5LA2A 5CAHA 1TWZA 4LYQA 1W5OA 3KUMA 3BG9A 3H2AA 4GISA 2ZXBA 3AS0A 4LVAA 4OQVA 3UJRA 2DV0A 2OPJA 1GJWA 1G4PA 3GNDA 5CBBA 1HP4A 3RJXA 3RDKA 1RP9A 5HBFA 3IRSA 1ZFJA 2YOCA 4UTHA 1SFTA 1ADDA 3TSDA 4DXVA 1IEQA 4IJRA 2X2GA 2WMFA 3G18A 3LXBA 2INEA 1J11A 2A7NA 1HP5A 3ALFA 3MC5A 4L1WA 5HJXA 1MZRA 1I0BA 4H3DA 2V69A 3POHA 2VRJA 4Q33A 2OEMA 2VTFA 2G0WA 3GHRA 3PY2A 4WKHA 3LY0A 1WUEA 1W37A 3ABOA 3CHVA 3PUGA 4OZOA 3AMDA 3D6NA 3DX5A 1VBUA 3N12A 1IEIA 2CZVA 1GVFA 3WBAA 3AXKA 3GUWA 1EJVC 3SUSA 4A4AA 1T5AA 3S46A 3TK7A 4GO8A 4Z1YA 3VD3A 4H9UA 4L64A 3GFZA 4JEJA 3WFZA 3VOJA 2ZC8A 4UTUA 1RVKA 5T9BG 5BOFA 5XIAA 4PRWA 3DXIA 1AH0A 2QKFA 2YCJA 3K2GA 1QK0A 3WQDA 2X1IA 1QWGA 3WK1A 5IBXC 4IZGA 2GJXA 4AIUA 4M7SA 2OG9A 2HRWA 4PUEA 3EOEA 3VIFA 3WNPA 2VGGA 1OZQA 3GG7A 1NWSA 1WV2A 4R53A 2ZZ5A 4YTTA 5BRBA 3VX1A 2OEKA 1RPXA 3WK0A 1JAEA 2HE8A 1NELA 1MSSA 4GJJA 2ZX8A 3BGJA 3AHVA 4JR5A 2XWDA 4OFCA 4JNMA 4W89A 4ACZB 4F79A 5D9MA 4GI9A 2C71A 4ES4A 1EZ2A 3PZNA 3PUOA 3PB0A 3SSJA 2D20A 1NM9A 4AZ7A 2W66A 3IUDA 1THFD 2E9LA 2OO6A 3VXGA 2ZZ1A 1YE4A 3ELFA 2WVSA 4EPDC 2W5FA 1X6NA 3SAZA 2WMIB 3GIQA 4O4VA 4S1FA 1FVPA 5A8MA 2OLSA 1VFMA 2ISDA 4X2PA 1J0HA 4Q8MA 4TQTA 2XWEA 4HTBA 1B3ZA 3CZLA 4WXZA 4JFVA 3CLWA 5FJJA 4GRSA 3V0TA 3IJDA 2HV5A 4QLKA 3OOQA 4NJKA 5I3JA 3W00A 3VDAA 3AZTA 3WNLA 4KCUA 4GD0A 5DMNA 1KV8A 2BOFX 1XQLA 3GXTA 1OEPA 3I3EA 5C9XA 5TIMA 3T7VA 2WAGA 3ZVHA 3P6LA 2XM2A 4LC6A 3ZM8A 2JIWA 3WENA 1GZ1A 3BH4A 4DJDA 1JDCA 2XVLA 4AWUA 1UH2A 1Y65A 2X0YA 4ATLA 4UQBA 3M44A 2IPWA 4D6CA 2DSWA 3WJXA 4IMFA 4KMQA 4XX6A 4HQVA 1QNOA 2QR6A 1AD1A 1IE7C 2PPGA 4KRUA 1O5XA 1SQ7A 3DENA 3VNJA 2P0IA 4C7FA 5AC8A 4CN1A 2Q02A 3GDMA 5BROA 3SCOA 4YIWA 4OBTA 4C60A 3WK3A 2VEMA 3UGVA 4MKSA 5GNZA 5A6JA 3MYOA 4FEZA 1TMQA 1PWMA 1BWKA 1TQXA 3LD5A 2QCLA 2A3LA 1AQFA 3NDOA 4CNNA 5AC5A 4HA1A 2YGYA 2NUYA 2ZE0A 3C2OA 3STPA 3JR2A 4W84A 2C19A 4ROQA 4EPEC 3CQ0A 3LSBA 3HJZA 3NQ7A 3L66A 3SCNA 4MF4A 4C6EA 4BS0A 4ADTA 2C79A 4N4QA 2OLAA 1OX5A 1MFUA 2AMXA 2QCDB 2PGEA 1Q7MA 3LUTA 4ZZ9A 4B5UA 2D2GA 2P8CA 3H2CA 2FFIA 3AWOA 4UBPC 3AZSA 4HZMA 4GVFA 4XK2A 2D0GA 3VA8A 3W2MA 1L9WA 4WXYA 2EKCA 2CESA 3CASA 5D9PA 5AYIA 4FR6A 4AEEA 2WM1A 2EGZA 2G95A 4WY0A 2EJAA 4EVZA 2PWDA 1VR6A 4HKPA 4RE3A 4C6QA 2J9YA 2QHAA 3A6OA 4IG2B 1OG0A 1S38A 1IEWA 2X1RA 2RDUA 4GIYA 3QHNA 2FKPA 3ZJ8A 3AC0A 4ERAA 5HAOA 4HK7A 4PULA 5LNUA 4OBRA 1VFHA 4QFUA 2BASA 1OCQA 3OZOA 3OB8A 4DO4A 1CENA 4UIOA 1O68A 2XIOA 3AROA 2B0MA 1EP2A 3NA8A 4PMNA 4KCVA 3SSZA 1GZGA 1W1TA 2J6XA 4B16A 1KWKA 1IIHA 4ZB5A 4OECA 2G3IA 2WKGA 1UP0A 3DFHA 4ZO9A 3W75A 5HA7A 2E5DA 2RDWA 1FWIC 2XH4A 1LRQA 3HQNA 4XBKA 4LF2A 5IRPA 4L5ZA 2BDQA 4Y9OA 1R2RA 2TMDA 4NNBA 4FA3A 4GC3A 1UOZA 1E40A 4Z2HA 4K39A 3TIMA 3FHAA 2C0HA 3VD5A 1UWRA 4HMNA 3A9IA 4NZCA 2FGBA 3V5OA 1EJRC 4AIBA 5D2WA 1TWIA 3KFTA 4QTGA 4S23A 1A4MA 3KBNA 1XICA 2AAMA 3KXQA 3VIOA 4Y2WA 4DUWA 2VWSA 2CWXA 4I5XA 3EWDA 3I6TA 1KFKA 3FJ4A 2GSEA 2OCZA 3ZJKA 1E6NA 4DJFA 2J25A 4JTSA 4CQ8A 4OOZA 4WHBA 4N9BA 4DEFA 5PTDA 3G77A 4M0XA 2ODOA 1FTXA 3KLLA 1VPXA 3TW9A 3SO7A 3TSBA 3RLUA 1X98A 2DVUA 3FVDA 2GL5A 3TE9A 3R12A 3LRLA 1GVSA 3VYLA 1HO4A 1B3YA 2PWVA 1E9YB 3L65A 5ECUA 2VI0A 3U3HA 3B03A 1GVYA 1JUEA 2YW4A 3W28A 2DH3A 1MW3A 4H8HA 1I75A 3AJXA 2VFHA 3MMWA 1GG1A 1QW8A 2PCQA 4ZGYA 3NQ6A 1DYSA 3OODA 4HPJA 4KWOA 1WXYA 3M5YA 4JEQA 5I07A 3V1PA 1KLZA 3C61A 4KCWA 2E5CA 2V2HA 1H50A 1S2AA 3BOFA 3BICA 3B0XA 3JZUA 4UOQA 3OJGA 2J9ZA 6TIMA 2BVTA 1GPFA 4AY8A 3POCA 5EL1A 4BQ2A 4F66A 1TWSA 5I79A 3EBVA 3ARYA 3BLKA 4HB7A 2PZNA 2BHUA 1OBAA 2PDUA 1O5RA 4AFYA 1IT8A 4QNEA 1W1YA 3N6JA 2E0PA 1OYBA 2A1YA 3IRDA 2MANA 1C90A 5JBFA 1LRTA 1FKXA 1UC5A 5C7VA 2YCIX 4Y96A 4US6A 3AMKA 5DBUA 4DIAA 3VKBA 1RJRA 3R79A 4RZ4A 1KXHA 3WUGA 3I7RA 2YB1A 1BFNA 4LT9A 1EEXA 1X1ZA 3OPSA 4CN6A 5HWMA 4ZA0A 2P10A 3EEGA 2PF8A 4XZWA 1RSCA 4UQEA 3SN4A 2ZRXA 1V6UA 2A2IA 1GCYA 3M0KA 2CHNA 1FOBA 1T8XA 1J2WA 1Q7QA 3TA6A 5AHIA 1JXJA 3TOPA 4RNHA 1UUQA 2BB0A 1EH9A 1TVLA 3QHMA 1R3RA 1X6UA 3I68A 1V77A 2J66A 2E28A 2XINA 1C7SA 1LZOA 4IMCA 1PX8A 3MSYA 2ZDRA 1ITQA 1C8VA 1E51A 1YDVA 3EXTA 4GIAA 2WKLA 1NFBA 4OJYA 3VMNA 3LCWA 1GQLA 4KERA 4CQAA 1L6WA 3T07A 2C1GA 5HNNA 4P2VA 3T08A 1FHVA 1FFQA 1FWHC 1D3HA 1SGJA 1NU5A 3L2IA 4Y9NA 5A3HA 1H11A 3CHCA 3PS7A 1UUOA 3SUVA 4K37A 3RF9A 4IHCA 4D2JA 1LWHA 3HPSA 4NX5A 2BLEA 1GVIA 1FY6A 1VH7A 3QLDA 4F2BA 1WPCA 3TH6A 4DBUA 3N2MA 2A5HA 2HPIA 3VD4A 4MNKA 2BOGX 1TTIA 3G0SA 4JCLA 2BNJA 4V1XA 4DYJA 4HNNA 4H41A 2J7GA 3TN5A 5I2UA 3SQLA 4H8VA 3WD3A 3R7MA 4HU3A 1UBPC 3W6MA 3V5CA 1KRMA 5E5CA 4Q8WA 3EMQA 4LWWA 1J5SA 1KV5A 3O6CA 4ZOBA 5EBUA 4C6DA 2NVDA 1Q2RA 1ADOA 3QGAC 4R7JA 1OYCA 4JN7A 4PEKA 5CGQA 2JGYA 3LTYA 5FD0A 5LGXA 1LM1A 1XLDA 4X63A 1HNYA 1A5OC 1WNOA 4FMVA 5J04A 2EG6A