3IGXA

1.85 angstrom resolution crystal structure of transaldolase b (tala) from francisella tularensis.
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
322
structure length
322
Chain Sequence
AMQKSVLEQLKQVTMVVADTGDFELIKKYKPVDATTNPSLILKAVKEQKYSNLVAETISKVKANNPDLNSDDLVKEIAIEILVSFGIKILDVIEGKVSSEVDARVSFNSATTIDYAKRIIARYESNGIPKDRVLIKIAATWEGIKAAKLLQKEGINCNLTLIFDKAQAKACAEAGVYLVSPFVGRITDWQMQQNNLKTFPAIADDDGVNSVKAIYKLYKSHGFKTIVMGASFRNVEQVIALAGCDALTISPVLLEELKNRDEHLEVKLTKNDDVVTQSPQISEADFRWLMNENAMATHKLAEGIRLFTKDTIELENIIKQNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transaldolase
publication title 1.85 Angstrom Resolution Crystal Structure of Transaldolase B (talA) from Francisella tularensis.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Transferase
total genus 131
structure length 322
sequence length 322
chains with identical sequence B
ec nomenclature ec 2.2.1.2: Transaldolase.
pdb deposition date 2009-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00923 TAL_FSA Transaldolase/Fructose-6-phosphate aldolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3igxA00
3FKRA 3M16A 3W22A 3B8DA 1XCFA 3L65A 2ZZ2A 3BGGA 4MLRA 2VEMA 4AAJA 1JRCA 3MP5A 1Z48A 2UV8G 3PSVA 4ZMGA 3QJAA 3TV8A 3TW7A 3LHTA 3TROA 3EX3A 1TV8A 1ZALA 1TIMA 3W7QA 3EWYA 3FYPA 1YXYA 3CTLA 4KFNA 3R2GA 1QOQA 3FOKA 1SW0A 2Z6JA 5KZEA 3W74A 1NF7A 4PC8A 4S2BA 5BMXA 1XBXA 5F2MA 2ZCGA 5GVJA 2Q3OA 4P61A 4OV4A 1EIXA 4A2RA 3C6CA 4QIUA 4O53A 2G5WA 3DGRA 3ZWSA 2Y62A 3A22A 3BG3A 2FLIA 1VH7A 5K4ZA 1QFEA 2X1UA 1DJQA 4POCA 2VFFA 2A4AA 3CB8A 3NA8A 3C3NA 5DY2A 4GUJA 3TSDA 5EA9A 2ZRVA 3KAOA 2JKPA 3TC7A 4LUIA 4N9EA 3TIMA 3NPVA 3QC3A 1KM1A 3FJ6A 3TJXA 1KM0A 3LCGA 3IVTA 3I65A 4L4MA 4UTUA 4HPJA 3GNNA 3WK1A 1FDJA 2Z6IA 4UFLA 4LS1A 1XXXA 2EAWA 5CPMA 1M5WA 2Q8ZA 3NQFA 3W23A 2YFOA 5EMUA 4Z0SA 4AHOA 4DBEA 2GVGA 2C13A 3P80A 4PEKA 3M44A 3CM4A 3E9AA 4I9AA 3UPBA 4RZ4A 1IGSA 3G1FA 3A5FA 4XBKA 4ORMA 2C18A 2PRMA 2PC4A 4ZQPA 5G2HA 1DVJA 3L0KA 2H90A 4YLWA 2ABBA 1DHPA 1JUEA 1TMHA 3E0IA 2RHGA 5HMSA 3TSBA 5F2GA 1D3HA 1ZENA 2OJPA 3BGJA 3V75A 3SJ3A 2J88A 1IXNA 1V5XA 5F2IA 5AHEA 1DQWA 4XUGA 1TPWA 2FB2A 5HINA 3VFLA 2FPYA 4PCFA 3Q58A 4ADSA 1YDOA 3TFCA 3LRLA 4IUOA 4UXDA 4UMCA 3P62A 1VQTA 5I3HA 5LNSA 4GJ1A 1AW2A 5LGXA 3PUDA 2QEZA 4MY9A 1OYAA 5CKSA 1AW5A 3F03K 3NQ7A 4LVGA 2PRHA 1L6WA 1TREA 4MYXA 1ZJIA 3BW2A 2DZVA 1ZHAA 1I4NA 2YSWA 2ATMA 2QDHA 1GPWA 5L6UA 4JTHA 2NWRA 1SZEA 2FB3A 1W5NA 2TMDA 4EF9A 3M1ZA 4I7WA 4IMFA 1GTHA 4R33A 4GRSA 2HS8A 2CLIA 3P74A 4IJBA 4H3DA 1MO0A 2YYUA 3D0CA 5CSRA 4O8RA 2VENA 1H7XA 1VCGA 1PVNA 3NXFA 3STFA 3QMRA 3GIYA 1LTDA 1ZFJA 1XDMA 2A2IA 3NQ2A 2BLEA 3G3MA 5U7SA 3W07A 1GYNA 2QCLA 3R5EA 3LCIA 1XL9A 4NNCA 3SFKA 4JXCA 4J9JA 4YL2A 5I3GA 3L0NA 2QDGA 3O1NA 3FJLA 2QCMA 3W2NA 1IXOA 4HN4A 5F2LA 4KFOA 2A21A 1XM3A 3KX6A 3STCA 3TK7A 4DF0A 1OVDA 1LBFA 1FCQA 1S3HA 2WOQA 4JYFA 2EPHA 5C2XA 4ZQMA 3WJSA 3TCEA 3I7SA 2ZBTA 5G4WA 3LRKA 4QJ1A 4TIMA 1K7EA 4M7SA 1IXPA 4IMDA 3L21A 2H8XA 5AHMA 4O11A 2NLIA 1KA9F 3C0JA 4FNUA 3WK0A 3W7HA 3H55A 1Q6OA 2IQTA 2GVLA 2ZZ4A 3PR2A 1K7XA 1ME9A 3BG9A 4E0CA 1HG3A 3G24A 4O16A 1M7OA 3O15A 3TR2A 3W84A 5KZMA 1O5KA 3LOTA 1QPOA 1ZY9A 4AWUA 1A50A 2CFFA 3PBWA 1NEYA 3GLCA 5FEZA 2V81A 2QUUA 1VCFA 1N55A 3W1PA 2B0MA 4A29A 1HO1A 2C3ZA 2E6DA 4JTTA 1FX6A 3TAOA 1Y0EA 2VELA 3UWVA 4DEFA 1TRDA 3TQVA 2ATSA 1F2JA 1YTDA 3KVJA 2YCEA 5HULA 1TO3A 5HUOA 2QAPA 2B7OA 4AXKA 1JCYA 4WXYA 3DFOA 3QM3A 3N73A 5DCEA 3GDTA 3PG9A 3B0PA 2H3BA 4GE8A 1LOSA 1DJNA 1RQBA 1H51A 1GVFA 3ABOA 1TTQA 1KTCA 1JUKA 3I6RA 4MZYA 3BPWA 5CPNA 2Y85A 3HPZA 3O6CA 4IMGA 1H50A 4MJMA 2R8WA 4RJEA 3T4CA 5CZJA 1QO5A 3W1LA 3L5LA 2RDWA 5ABTA 5LZLA 1Q6RA 4HNUA 4RZ5A 1Q6LA 4HNNA 2GVJA 2CZFA 4MFDA 1FDYA 2DZXA 3HO8A 3W6YA 3PS7A 2ZRZA 1YADA 2NXGA 5CGQA 4O50A 5D09A 1SSGA 5F4XA 1P5BA 3LLFA 3QQ0A 3W72A 5EL1A 3O07A 1R30A 3FS2A 3IIVA 1R47A 1Z41A 4WY0A 3HGJA 4QNEA 5BOOA 3ZR4A 1GZGA 4WY0F 2WNZA 4Y96A 1P0KA 5DY3A 1TQXA 2JK2A 2H6RA 4Y90A 3H54A 4H4IA 4N4QA 3PULA 3VKJA 3G0XA 5D2VA 4FXSA 3RLVA 4EVZA 5D03A 1G4EA 5H91A 1H60A 2NZLA 4QNWA 1UB3A 2VEKA 3E02A 3G1VA 4LWWA 4FX8A 4BI7A 1ZAHA 1TYGA 2E1DA 2NV2A 3UWYA 1JCLA 5D32A 2PE4A 5EYWA 2V2HA 1X8FA 4CQ9A 4GXMA 1X6UA 1OFEA 4OGZA 3EWWA 4K38A 3N9RA 3UPWA 3NL5A 3LV6A 3O6YX 2NXIA 3F1QA 3KVKA 2ZZ1A 1Z42A 3EWBX 3GXTA 2ZQ0A 3PF3A 3L9CA 3UWWA 3G1DA 3G1XA 3LXBA 3DKJA 3NZ1A 1FCBA 3SZ8A 3TUUA 2OT0A 1ZCOA 1G69A 5U4NA 2DJLA 1KTBA 2YYTA 3M7WA 2R94A 2VC6A 1K3UA 4DXVA 2X30A 5A8GA 1G7VA 1W8SA 4M5PA 3W70A 2W79A 2WNNA 2VOMA 3CPRA 1OF6A 1AL8A 2WQPA 3G0UA 4UTTA 3DENA 4OE7A 3S1WA 2E77A 4NZJA 1ICQA 3VCRA 4O15A 2CZEA 5DBTA 5DXYA 1ML1A 3S5YA 1RR2A 3HBLA 4JTEA 3GVGA 5AC8A 3LI0A 4NUWA 2FJKA 3G1AA 5AHFA 1TV7A 1ALDA 1YPIA 4HKPA 1OFAA 1LBMA 2EKCA 3GXPA 5D38A 1XDLA 4Z1CA 1B4EA 3QEZA 1EWEA 1T99A 1F6KA 3ABSA 3LTYA 1ME7A 3QQ1A 3UWZA 2YX0A 3R13A 1I2QA 1BKSA 4FNTA 3SY5A 3TXVA 1VRDA 1I2PA 5I3FA 4UC5A 1VS1A 1SFLA 3MUXA 3VNDA 3W75A 4XTIA 3W7KA 3WK2A 3LXCA 3IIXA 2V5LA 4HPXA 4LVAA 3M5ZA 2OCZA 2V0TA 1TTPA 1V7YA 2R14A 1QCWA 5AHIA 4LC8A 3NVTA 4O12A 1JCMP 3M47A 4B5NA 4GWEA 3DHDA 3UXDA 1EUAA 4ORIA 2FPVA 3W2KA 3PM6A 4JNMA 2C15A 4TX9A 5KSWA 3T40A 5E0KA 2Y70A 4K39A 4AWSA 3UQNA 4OT7A 3MI2A 4LS0A 3W86A 2GJLA 2CLEA 1H63A 4O52A 1TRIA 1VYRA 1J4EA 1PCWA 2ZA3A 5DXXA 5T26A 4ADTA 3WJZA 2ZZ7A 1VHCA 2VFGA 4K37A 1SW3A 3A23A 4O57A 4MIMA 2BWGA 2E09A 2V8ZA 1TPVA 1Q3NA 2V5BA 2V2CA 3DI0A 4M19A 3C2RA 3I7QA 3DFNA 5HNRA 1H7NA 3P61A 4OV9A 1HO4A 3QF0A 1W1ZA 2QCFA 2R91A 1JR1A 2D73A 1KM4A 3GB6A 3G1HA 2DP3A 4GUHA 3AO0A 4A3UA 1LORA 3BK0A 1SR9A 1OHLA 3QRHA 5K9DA 3NR0A 1W5PA 4DPPA 3UWUA 2B7QA 1SQ7A 3JR2A 4UR8A 2C19A 5KZDA 3G3DA 4W9TA 5HWMA 2WV8A 3B03A 5BNKA 1A5SA 1VYSX 2W0UA 1BWKA 3B0VC 3NEVA 3HG2A 3QMSA 4IX2A 4HHPA 4PL2A 4WOZA 5F1UA 3EXTA 4LTSA 5C55A 1OABA 3MBDA 1EP1A 1I2RA 3OIXA 2NUWA 5AC7A 1K7FA 4X9SA 4O1AA 4JEQA 3CT7A 2ZZ6A 3WFAA 1C9DA 2NWSA 1U83A 2B7PA 4BI6A 5G2WA 2DORA 3DBPA 1FWTA 1LCOA 3RFAA 5D02A 1O4UA 3S6DA 1F73A 3W7IA 3ABRA 3BW3A 2E68A 3TU9A 4M7TA 2G96A 3W7PA 2OMAA 1H61A 4DPQA 4NU7A 3TQ0A 1QMLA 2TYSA 3MP4A 5AYYA 2QJHA 2B4GA 3W1NA 1XFBA 5L9FA 3W1UA 1GJPA 4H6KA 5EY5A 1UJPA 1XUUA 3L67A 3PAJA 1OFDA 1N8FA 4AWTA 1H1ZA 2GOUA 3HF3A 4XKYA 1JQXA 4XQ6A 1B3OA 2F7FA 4MZ1A 5EKYA 2C1HA 1GVRA 3CU2A 4IGHA 1GT8A 3KVMA 3FLUA 4N6FA 3EWUA 3GXNA 1WQ5A 3CEUA 1QWGA 3MBFA 4O13A 2ZDRA 4O1DA 4MLJA 6ALDA 4ZQRA 1X1OA 1GTEA 2O7SA 4FHAA 4GUGA 5G1TA 2ZZ3A 4WUIA 1J5TA 2CLHA 3NGJA 3RU6A 5LHFA 1I8JA 5D30A 3VI2A 1YTKA 1SZNA 2CWNA 3M6YA 1A5BA 1PCKA 1W31A 2QCNA 4GBUA 1GQNA 3P8JA 3GYEA 3SGUA 3OBKA 1KM6A 1RQHA 4WD0A 3N14A 1KFCA 3O8AA 2X16A 3LDVA 4K6AA 1KFBA 5DCDA 3M5YA 1Q6QA 1CX9A 4HNVA 2NX9A 1EUNA 4O4WA 4O4VA 4AEOA 5E1QA 1ICPA 1O94A 1B57A 1Z44A 1PL9A 1R46A 4S2CA 1O95A 1LRQA 4K7VA 2A6LA 3BLIA 3S0CA 3KVLA 4JTFA 3IIPA 1H1YA 3MI6A 1R2RA 4LY8A 3TMLA 3GX9A 1DQXA 4QITA 5LNRA 4DF1A 1VHNA 1OX4B 4LS2A 2I1OA 3LI1A 5KTLA 2BX7A 3R8RA 1AK5A 2RDTA 3W2LA 1KM5A 2OZ0A 2E6AA 3SI9A 1JQVA 2I9EA 4EWND 1TPH1 3G1YA 3TH6A 4DO6A 4YMZA 1XBZA 3DHFA 3PVFA 4ZQCA 4JY9A 1TCDA 5D2YA 4A22A 3THAA 2Y88A 2RFGA 3L66A 2YR1A 1YTEA 4LW7A 3MMTA 3P81A 1WOBA 2FQIA 2H3DA 2XFWA 3DAQA 1L6SA 2Y89A 2X1TA 4OHQA 3TX9A 2E5DA 2WNQA 3CIXA 5HJLA 4JX6A 3S8HA 1B9BA 2BTMA 7TIMA 1WX0A 3SECA 3VE9A 2WSRA 2NXHA 4CCCA 1S5WA 2YGYA 4ML9A 4NJIA 5F4SA 3UXAA 4JN6A 2NV1A 2ZA2A 1JCXA 2RKXA 4IPJA 3CIWA 3GR8A 2DZUA 1FWSA 4A21A 3Q94A 4JTGA 3TQKA 2C14A 4IWWA 1OYCA 3NPXA 3NO5A 2BSLA 4N4PA 3C2FA 3PC0A 1KLYA 5TIMA 4RXGA 3EWZA 2A7NA 4Q33A 2WPBA 3P8IA 4ADUA 2QCDB 3LB0A 2KZHA 3LHVA 5IM51 3EX1A 3C2VA 1W5OA 1JUBA 5IBXC 4RR4A 3BLFA 5CZTA 1QPRA 5FF4A 1T0OA 2GJNA 5K9CA 1L2UA 3IVUA 4LVFA 2FFCA 3EEGA 2A7PA 2RDUA 2CU0A 4PH6A 3PUOA 5HR6A 3UNDA 3HMJG 5I3IA 3EXSA 4TU1A 2A5HA 1TPFA 3ATZA 3NQMA 4DF2A 4Q4KA 2G95A 2X1RA 1TPC1 3GDMA 1AW1A 4PL1A 3MHGA 3QZEA 4A2SA 2CLOA 5CG7A 3QMTA 1NVMA 3W1QA 2XN2A 3C52A 4G1KA 1VPXA 3P84A 3W1MA 1MEHA 4I7VA 5DCBA 1D3GA 1G7UA 3STGA 3EKZA 4X22A 4O28A 1KLZA 3IGUA 3WK3A 1KV5A 3Q2DA 3TJLA 1LYXA 4ICNA 2A6NA 3A5VA 5CPLA 4UFKA 2V82A 3LTSA 3EXRA 2NX3A 2V30A 1W56A 1HTIA 4OQVA 4WJEA 3I68A 1I2OA 1THFD 3S5ZA 4RX0A 3LERA 1VR6A 1WOAA 5D2XA 4DELA 2VEPA 2Y7FA 3GDLA 3DXIA 3PG8A 1A53A 1W5MA 2ALDA 3GNDA 1YXCA 2YW4A 3N19B 4JTKA 3WJXA 4N02A 5AHLA 1G67A 1FWRA 4CNPA 1DV7A 3ZS4A 4Y9AA 3OVPA 1T8XA 3IEBA 4WX2A 3GKAA 3LLDA 1PS9A 4E2DA 4GUIA 1W3IA 3KHJA 2ZFAA 2DZSA 4LOCA 3NDOA 4N9DA 2EF9A 3TMQA 4CQ8A 3G1SA 3HOJA 3L0GA 4UTMA 4MVAA 4UMBA 4NX0A 1LDCA 4LRTA 1DBTA 4NJGA 2ZRWA 3KFTA 4CNOA 3UD6A 3FIGA 3PWAA 4ZL1A 3IV3A 5AFDA 1PHWA 4NJJA 3GR7A 4FX6M 2ISSA 2DZWA 4UFHA 3PBUA 3SR7A 1UCWA 1SO4A 4JTIA 3IVSA 1F05A 4TR9A 5I3JA 1EP2A 4I7UA 4NT0A 1B4KA 4HIBA 2XN0A 4N9CA 5MHBA 2C16A 5BMWA 3LGEA 2AAMA 5G5IA 1P1XA 2FIQA 3OVRA 4LUJA 4O14A 1ZAJA 1PIIA 1ME8A 3EKLA 4UFIA 4ZQNA 5IBXA 5LHEA 1HL2A 3MW7A 1H7PA 2DU2A 2ZRUA 2GQAA 2GQ8A 4MY1A 4CCDA 1KFJA 1TTJA 1IIHA 3BLEA 2ABAA 3NQGA 1SO5A 4ZZ9A 2ZZ5A 2HTMA 5D33A 2VFIA 3NQDA 1VLWA 2BXVA 3HGOA 3OEXA 1OFRA 1MSSA 4EIVA 3A21A 5AB3A 5LKYA 2BZNA 1LBLA 1JVNA 2DJXA 4D2JA 2WSQA 4IQLA 4M6VA 4BWLC 3W71A 1H7WA 2VFDA 4WXZA 4JIPA 3RLUA 1N7KA 1I2NA 5C54A 4PA8A 1NF0A 3W83A 1LLWA 4MZ8A 1PV8A 1TTIA 5LNVA 4NQ1A 2QCHA 3NQVA 5FEWA 2XN1A 4JTSA 1FXPA 4BFAA 4GC4A 1WA3A 3QSTA 4AVFA 5E93A 3ZWTA 1F7BA 2J9ZA 3FYOA 4YCPA 3M9YA 3NQAA 1SSDA 3T55A 3W76A 2CLFA 4XZ9A 4UFMA 3P7YA 1OK6A 3P60A 4DQWA 1MEWA 1P0NA 3B05A 3NQ8A 5BW6A 3PB2A 1FY6A 4KFPA 3W3OA 3E96A 1TPEA 4FO4A 3TFXA 1WYIA 4FX7A 1YDNA 3DZ1A 1IXQA 3TW6A 1G6CA 2ISWA 5J5DA 1DOSA 5C6MA 3UY8A 4WOQA 1SZFA 1J2WA 3ABQA 3B06A 3CHVA 3HG5A 3JS3A 1YXDA 5D2TA 2Y63A 4C1KA 3QW3A 3F4NA 1XUZA 4UNLA 1EP3A 3W7RA 4C1LA 1TJPA 2J9YA 2FTPA 2PURA 3P67A 3EX2A 5FEPA 1E51A 3L5AA 1W3NA 1KW1A 2ZYFA 1SO6A 3LX9A 4N9BA 4UUIA 4Z08A 3IGSA 8TIMA 1TPDA 2Y61A 4QSHA 4X3ZA 3LBMA 1O5XA 1DKWA 4DBDA 2RH9A 3I7RA 3P82A 4ALDA 5EBUA 5CZ0A 2PCQA 3KRZA 3L2IA 1F74A 3STEA 3PB0A 4S1FA 1EX5A 1F6PA 1WDWA 2CZDA 1X1ZA 5EPDA 1GG0A 3N2XA 3BV4A 5D2WA 1WXJA 2CLMA 2O7QA 4Z1DA 2NUXA 3W7NA 2P0OA 1G4SA 4U4MA 4RLIA 3BW4A 3LBCA 1WBHA 2ZTKA 1LLZA 4KKXA 4KWWA 3NQ6A 3RK8A 1X7FA 3RMJA 3NG3A 1W5QA 3TDFA 5KINA 5HR7A 3KRSA 4NXKA 4AH7A 3T7VA 3BVJA 4O0KA 1OFQA 3OHIA 4UCGA 4BWLA 3INPA 1BTMA 3MWAA 2AQWA 4QAIA 5I3KA 4UTWC 1F76A 3W7OA 1R2TA 5CZSA 5FF2A 3UWQA 3SSJA 1NSJA 2A1YA 3LCFA 3MO7A 4TMCA 3CEPA 2I14A 4NJHA 2Z0IA 3FA5A 1SUXA 3UZ5A 3RF9A 5AYXA 3QPZA 1WV2A 2YXGA 1OFPA 1ICSA 1TV5A 1RQEA 3W7GA 4AHQA 4UTIA 5FI8A 4NXSA 4LVBA 4Z1BA 3W7LA 1OYBA 4HSOA 3W85A 5DLCA 5LNUA 4ZVJA 3M41A 2Y7DA 1XKYA 1FQ0A 1O60A 1UUOA 3R89A 1UBSA 1ONRA 5K7JA 5SWUA 3LXAA 1QDSA 4K8HA 3EX6A 3M5XA 4CLMA 3PSWA 2Y6ZA 4QQ3A 1LRNA 2CZ5A 5K4XA 3EX4A 3TC6A 2F84A 4IXHA 4CQAA 5DN1A 1SPQA 2Z2UA 4O19A 2E5BA 1OFOA 3NYZA 2WJZA 3WJWA 3NPWA 4LT9A 4NNBA 3IIZA 3GAYA 4FNSA 4AF0A 2C0AA 5D05A 1XBVA 2V2DA 1KFEA 3KOFA 3DH7A 3GKFA 5HUPA 3RNDA 3R12A 2DZPA 4O1CA 1OF8A 3O06A 3ATYA 3W1AA 3GK0A 3U8GA 3CWOX 2Z1BA 1Q45A 4JD4A 3QH2A 1LZOA 1DORA 2E5CA 4TMBA 1MXSA 3LHWA 3U6WA 2YW3A 4N2YA 3DFSA 3S9YA 2YDAA 4OU1A 4JIQA 4LV9A 1M7PA 3N2MA 1YPFA 2QCEA 5J5RA 4MKNA 3IGXA 3TAKA 4AB4A 2VEIA 2JGQA 3L68A 4K36A 3HPXA 3T44A 3TA6A 3UY7A 1LOQA 1S5VA 1KBIA 1ZNNA 1FCVA 3HG4A 4JTUA 1RPXA 4ZQOA 3O63A 1FWNA 4ONVA 3C2OA 3W2MA 5AHNA 1TPUA 3W7CA 1GYLA 3JRKA 4LVDA 3G0SA 1UASA 3T78A 3GAKA 2FPTA 3PUEA 4IMCA 4LC6A 1R2SA 3HQ1A 4WQ6A 3W7EA 2DZTA 1H7OA 4R7JA 4NVTA 3DFQA 1K02A 1OK4A 3QFEA 1FDZA 2AGKA 4JGDA 2QCCA 3W73A 5KITA 1G4PA 1QAPA 4O1BA 1QOPA 3B4UA 4OWGA 4HNTA 4UTWA 3S5OA 5LNWA 3QPYA 3W7JA 3W1RA 3MHFA 1GEQA 5LSMA 3O05A 2JBMA 5FF3A 2QUVA 1EEPA 3LV5A 3M43A 4LU0A 5AOUA 1QPNA 1KV8A 1VGAA 3HGRA 4Y8FA 3B04A 1SW7A 3G18A 1K8ZA 3C61A 2TSYA 2Q8LA 2B7NA 3MP3A 1YYAA 3NL6A 1VYPX 3LCXA 2WSYA 4MYAA 4IX0A 1JRBA 4NJKA 4JR5A 4FNQA 5FF7A 3NQEA 3NL3A 1TJRA 3CC1A 1W0MA 2QJGA 3LCLA 4UR7A 3GDKA 2E6FA 3S42A 4UTLA 5HWNA 2J24A 3W9ZA 3U2OA 1VZWA 1VC4A 4O10A 2EHHA 4UTJA 2YPIA 1S5TA 3MHUA 4Z1AA 3C2EA 3HPSA 2GUUA 3P5ZA 3V1PA 2G97A 4JTLA 1IIGA 1M6JA 2X1SA 3W7MA 1EB3A 3OVQA 4K7YA 3A9IA 2J6XA 4FB7A 4JDBA 3UZJA 2JGYA 3EWXA 4UNKA 3SIZA 4RV8A 1PE1A 3E12A 3L5MA 3NM3A 4BI5A 4L4LA 1FWWA 4MPQA 3DFPA 4JX4A 1FCUA 4CCEA 1W3TA 4RZ6A 2E6YA 1UUMA 4X2RA 5K3VA 1GVQA 4FEZA 4WY0B 2QAFA 4BR1A 4MUZA 2JKEA 3NZRA 1OX6A 3TKFA 3GZ3A 2VFEA 1TQJA 2X2GA 3KXQA 1OX4A 5F1VA 1KM3A 2NUYA 4QISA 1A5CA 1G4TA 3G22A 3MI3A 1LRTA 5HQEA 4TO8A 5G1YA 1BEUA 3N3MA 4IMEA 1QR7A 1XI3A 3CWNA 2Y7EA 2EGZA 3HB9A 2J9XA 2QUTA 3PY2A 1SU5A 2TRSA 3HJZA 2GQ9A 3UYCA 3OA3A 3NL2A 1QPQA 4FXRA 3QSRA 2QCGA 3M5VA 4E2BA 2QKFA 1IF2A 3BARA 1BWLA 1FBAA 1JJKA 4JS3A 4JX5A 4UMAA 1RV8A 3MJYA 4MOZA 4UTTC 1NFBA 4AMAA 3NQCA 4QM1A 5AYZA 4JTJA 1KBJA 3EB2A 2HMCA 5D37A 4GUFA 2Y7GA 4GNJA 5K2ZA 1GVOA 2W6RA 3LHUA 2P10A 4EF8A 1RZMA 1W54A 4JYEA 3W1TA 3ELFA 2PRLA 1I45A 5TBOA 1H62A 1KTNA 3NAVA 4O0ZA 5FEXA 1K8XA 4UFJA 1HFBA 1VLIA 3S1XA 1D9EA 3N34A 3FKKA 1HUVA 4HSNA 1P4CA 4N6EA 1AL7A 2QCDA 3FFSA 4FNRA 3BG5A 1JCJA 5FF0A 4UTHA 3QYQA 4FIRA 3S1UA 1VJIA 3NOEA 3K30A 1TSIA 4K8EA 3LCWA 2ZA1A 1C29A 4JY8A 4U28A 3M0ZA 1FXQA 1KM2A 4KWVA 4M6PA 5D04C 1T96A 3P5YA 5KMYA 1RD5A 3G8RA 1GWJA 1OG0A 4Y6GA 1OFBA 2QR6A 1PHQA 1TPB1 3S1VA 2ZTJA 5F4WA 4IOTA 1OJXA 4NZFA 2YFNA 4UTKA 1LP6A 1U5JA 3W1XA 3B0UX 2A7RA 2ISVA 2JKAA 4P2VA 3E49A 2HS6A 4O18A 5H2ZA 4PODA 4JDYA 3F4WA 2H8ZA 3NPUA 3TXZA 2VXNA 1FUYA 4LNYA 5G2IA 5G4EA 1SO3A 4O54A 3G8EA 1ADOA 1ZAIA 1GVSA 4HT3A 1LOLA 2GPTA 1KFKA 4GFSA 4Q32A 2QF7A 3LRMA 3QW4B 4BF9A 4JYDA 1LM1A 3W7DA 3DFTA 1YLVA 4DO4A 3KRUA 3C56A 1GOXA 1QO2A 1RVGA 2CLLA 3ANYA 3AJXA 5C5YA 3ZFHA 1H7RA 3W88A 4R53A 3NNTA 1CI1A 1L6YA 5TQLA 4MY8A 1A5AA 3W2JA 3DU0A 5BRBA 4YCOA 1DL3A 5A5WA 3W87A 2LLEA 3IRDA 4XBSA 3HIJA 3S5NA 1AMKA 5CSSA 5K9XA 3VE7A 4XWUA 1CW2A 4FIQA 3A24A 1H5YA 3DI1A 1VCVA 3PBVA 1SFJA 4YWIA 3TE9A 4O17A 4CNNA 1K8YA 4FF7A 5DBUA 4EOUA 1W37A 3YPIA 3HG3A 1MZHA 4YXGA 1EWDA 2YZRA 1XC4A 1L9WA 4MJZA 1C8VA 3NM1A 4RKAA 1K03A 1OX5A 3SGZA 3MYOA 4AHPA 1JCNA 1GG1A 4UIOA 1KFLA 3O6DA 1LROA 1F5ZA 3TSMA 5AC6A 1XBYA 4NNAA 3BO9A 3TNOA 1WBJA 3WJYA 3CLMA 3SW6A 3USBA 4Z0JA 3PBYA 2P1FA 5AN7A 3THQA 4JICA 2QJIA 4BK9A 4LRSA 1WAUA 5LGZA 4DO5A 2ZRYA 2C6QA 4OBTA 3LHYA 1JULA 5CPOA 1AG1O 2VFHA 2FDSA 3GDRA 4PTNA 2OT1A 3C4UA 2A0NA 3N9SA 4XTDA 1TB3A 2NX1A 2HSAA 4IXXA 1YDVA 4MFEA 2CW6A 3LHZA 1NAL1 1QNVA 3CQ0A 4LV4A 2J27A 2WKJA 4NX5A 4FNPA 3OG3A 3C8FA 2WO5A 4RXFA 3H53A 2TPSA 4IPIA 3Q37A 1SZGA 2ZRXA 4RCXA 5FESA 3MYPA 2V9DA 3IIOA 2VKZG 2A85A 5DELA 2CLKA 1EPXA 3W2UA 4XKYB 1MEIA 4AF0B 1EA0A 4RK8A 4R34A 4WZHA 3O16A 3LTPA 3FEMA 2Q3RA 3LCHA 4E38A 6TIMA 4M6QA 4PFMA 3DKLA 5HWJA 3LM7A 3HGSA 2OX1A
chains in the Genus database with same CATH superfamily
3FKRA 1YBQB 2VJXA 4PMDA 3PSVA 3OPSA 3BAKA 1KRBC 2AOSA 1TV8A 1TIMA 1MNSA 3O3RA 3FYPA 1D3CA 2OB3A 3V5FA 1F6YA 1OIMA 3GTXA 1SW0A 4DB7A 5KZEA 3P93A 4PC8A 4DX3A 4F0MA 5BMXA 3F2DA 5F2MA 2ZCGA 3EOOA 2Q3OA 4P61A 3RO6A 1UP2A 3UVIA 2G5WA 3DGRA 3ZWSA 2NQJA 2Y62A 5GNYA 4IGSA 2CXGA 4GBDA 2VFFA 3CB8A 3NA8A 3C3NA 3LD5A 1BG9A 1PWMA 1AD4A 2VOTA 3LCGA 3UG5A 3IUIA 3GNNA 3WK1A 2XIMA 1A5OC 1G0CA 3DGBA 1XXXA 2EAWA 4QRNA 3NQFA 5EMUA 1QHPA 4D6HA 3CM4A 3E9AA 4RZ4A 1JPMA 3LU2A 3G1FA 3A5FA 4A3HA 3FV9A 2C18A 1PYMA 4ZQPA 7REQB 2H90A 3HQOA 2ABBA 3QZAA 3RR4A 3N2TA 5CGMA 5HMSA 1YRRA 2XPKA 1D3HA 1B54A 4W85A 1UA7A 2DFAA 3LZ3A 2I16A 4J4KA 1EGZA 5JMUA 3BUVA 5AHEA 3PNZA 1TPWA 4M51A 5HINA 3IS4A 3L12A 4OOUA 4GYKA 4AVOA 1SVDA 4G9PA 1F8MA 5DX7A 1DWAM 3V0SA 1WKEA 4S3CA 2PRHA 1EZ2A 5FACA 2WAGA 2GSEA 2BHZA 5KETA 1ZJIA 3GZAA 1I4NA 4I9MA 4L56A 5E0CA 5HDRA 3KBVA 5LXEA 5AC5A 1EJ7L 5L6UA 3AI0A 2VD8A 4QXIA 4Z2IA 3KL0A 5LIYX 4R33A 3EMQA 5I06A 4MGGA 2X0YA 5DRIA 2CLIA 1S2TA 2YYUA 4EWJA 4WF7A 4O8RA 1H7XA 5JUVA 3AROA 1VCGA 1OCNA 3NXFA 3WD1A 3WDJA 4I9JA 3H2NA 3VXGA 3WY1A 3M7SA 3E3HA 1V6VA 1GYNA 1QNQA 4MNLA 2X09A 4JXCA 4DNHA 3N6HA 3FJLA 4LXFA 4JKKA 4QQUA 4IISA 1AQHA 1SMAA 3BZJA 3CQIA 2VNCA 4LFYA 3KX6A 2FGBA 2CKSA 3STCA 3AU6A 1EQCA 3W6LA 5BXPA 2EPHA 1JPIA 1RCOB 1D8CA 2MANA 2FZBA 3GC5A 5B7YA 3LY0A 1TELA 4RNFA 4IL2A 4XV0A 4J7RA 1F9CA 3OHMB 4QJ1A 3AFBA 5I7GA 1G5AA 1AMYA 4PTVA 4M7SA 4IMDA 2PB1A 4BF7A 1EJSC 2D0GA 4LCRA 3H55A 4PBEA 3AICA 2IQTA 1W1A1 4GI6A 3OIHA 1RP8A 3EZ4A 3TZFA 1A80A 4CKQA 2VZVA 1YNPA 3BZGA 1HG3A 3G24A 3W84A 5KZMA 3F4CA 2W63A 1QVBA 3AYTA 2WHKA 5CC3A 4CN1A 5CCZA 1TR9A 4AWUA 2XGZA 2VDIA 2DH3A 2FHCA 1NEYA 3GLCA 4JHMA 1N55A 3W1PA 4A29A 4B2DD 5DRCA 1M04A 1HKWA 1GZ1A 4LX4A 2J25A 2R24A 1E1CA 1FX6A 1Y0EA 2VELA 3TQVA 2VX4A 4JFUA 3UCCA 1XLFA 4G1NA 4C6OA 5HUOA 2BGQA 1KD0A 1KKOA 1XH1A 3T4WA 2WQDA 1H51A 1HVQA 4ZTYA 4RUBA 1XLDA 1K9DA 2R8WA 5CZJA 1QO5A 3TTSA 1PZ3A 3L5LA 1C3FA 2RDWA 2J7EA 1JI2A 1A5MC 1O7AA 4P7OA 1O6IA 4HNUA 2FDMA 1Q6LA 4F8XA 1RXOB 3WQVA 1S38A 3K46A 2CZFA 4MFDA 4R5EA 1IZCA 1R9YA 3N15A 1XYFA 1YADA 4OBRA 5F4XA 2F6KA 3QQ0A 1S2CA 1GQIA 3PN8A 4URIA 2P76A 3FS2A 4PRTA 3HGJA 3TA9A 3EEZA 3ZR4A 6PTDA 4YTQA 2ZIDA 2WNZA 2BXZA 3RM9A 3EOSA 2WZTA 1ZCCA 3WLLA 1L8PA 2EG7A 1PDZA 3H54A 4H4IA 2RGLA 2O0TA 4N4QA 3G0XA 5D2VA 1CDGA 1DXIA 3RLVA 4EVZA 1V0KA 1H60A 1D2KA 2VDGA 3TN6A 3E02A 4OUEA 3G1VA 1RA0A 4BI7A 2NV2A 4YPJA 2V69A 5C7HA 3ID7A 4M24A 1HP5A 1GOOA 3ABZA 4OBSA 3UVAA 1CLKA 4ATDA 3N9RA 3LV6A 4J3XA 3GHRA 5ABFB 2NXIA 3KVKA 1OT1A 2ZZ1A 3JVAA 2D22A 3VDCA 1CTNA 3PF3A 3B8IA 4B5SA 2D2GA 2HBXA 2QMJA 3GUGA 3NZ1A 2J7FA 3N6QA 1DHKA 3EA2A 4AW7A 2DH2A 3M7WA 2R94A 3EWCA 2ICSA 2VC6A 2V5DA 4DXVA 5HXMA 3FSUA 3F2CA 3IK2A 1W8SA 1XRFA 2DZAA 3H7RA 2ZADA 2VOMA 3CPRA 1DJZA 1OF6A 3G0UA 1DTNA 4ATWA 3DG7A 3VGFA 2OQYA 2P53A 5A94A 1ICQA 3RR1A 2ZXAA 5DXYA 1ML1A 3S5YA 3KOWA 4JTEA 3GVGA 3WQFA 4QLLA 4NASA 4LCQA 1EHNA 2ZXBA 3PFMA 5AHFA 3M0YA 3MA8A 1LBMA 4U31A 4ZCWA 1B4EA 1K6WA 3GTNA 3RILA 1F6KA 5A8QA 2XVNA 4JQ4A 4GHRA 1TX0A 4G56A 2REQB 5BU9A 3VDAA 3A3WA 2IKGA 1SFLA 1R38A 1QHOA 4N0RA 5T9BG 4DBUA 5M1TA 2V5LA 3GNXA 4HPXA 3M5ZA 1UD3A 3FGCA 1TTPA 3MVIA 1DEDA 3NVTA 1HQTA 4AD2A 2GSJA 1AJ2A 4GVFA 4HMDA 1P7TA 3QBUA 4GCAA 2C15A 2GYIA 5KSWA 5E0KA 5J04A 4QTGA 2GGGA 2JEPA 4OT7A 1LL4A 3W86A 1PCWA 2HPMA 1X6NA 2ZXQA 3V4BA 4H19A 4E8DA 2ANUA 2OEJA 1VHCA 3A23A 4MADA 4MIMA 1WKFA 4JTAA 3KHDA 3N1AA 2V2CA 5TF0A 1XFCA 5E9AA 3R94A 3I10A 3FCPA 2ALRA 5FAJA 1HO4A 1JDDA 4YVXA 3KUMA 3S83A 4GUHA 3M46A 2O9TA 5ECVA 2ACRA 3U7VA 3BSHA 4Y8EA 1SR9A 3WO8A 4B91A 4Z1YA 3QRHA 5K9DA 3NR0A 4F79A 1SQ7A 3JR2A 4UR8A 3GSMA 5DMLA 4HOXA 5F7UA 2W0UA 1BWKA 4WJXA 4IX2A 4JPGA 5M2FX 3KCOA 4HHPA 3TLQA 1I2RA 2BY1A 1K7FA 4O1AA 2XZ9A 4JEQA 3SRKA 3WFAA 4J35A 2YCIX 2E7FA 1PSCA 4BI6A 3VUSA 2DORA 3DBPA 1E3XA 1OCJA 2WZEA 1VEMA 2DIJA 2HVOA 4LAMA 2E68A 1ZPTA 4TTGA 2PZNA 6REQB 3W38A 3MP4A 5AYYA 4ZFCA 5IXEA 3OA5A 2XIJA 1A3WA 2XJ7A 5EY5A 1ZL1A 1NU5A 1UJPA 1XUUA 2NVCA 3AHZA 3FX4A 4A3RA 3VNMA 3AS0A 2GOUA 4DY1A 4EX4A 1JQXA 5EKYA 3E0WA 4IGHA 1R6WA 3GYCA 4N6FA 1FWDC 5LA1A 4DXXA 3GG1A 1QWGA 3MBFA 4O13A 4IGNA 1JNDA 1CZ1A 4GUGA 4M6UA 1R3VA 2CBVA 3NGJA 4NRRA 1I8JA 1YTKA 1W31A 4I3GA 3P8JA 1Q63A 1TV3A 1H2JA 1FA2A 4WD0A 1FWHC 3O8AA 4K6AA 4L61A 2VZUA 1VBHA 4H8VA 4J2MA 3QZ6A 2OFJA 1Q6QA 1MUCA 1SYTA 2NX9A 2R1MA 3AMKA 5E1QA 2WYSA 4XB3A 3L4WA 4F3HA 5I77A 1XYZA 2GVEA 1PL9A 3GU1A 1O95A 3WNLA 1P6CA 3BLIA 3S0CA 3MI6A 3WBWA 1VB9A 2R1PA 3GX9A 2J7BA 1DWJM 3WUBA 1OX4B 4LS2A 2I1OA 3LI1A 1EYEA 3U3HA 2D0HA 1LT8A 1AK5A 4HJFA 3WH9A 1V08A 1WUEA 1FHLA 3D47A 5HMDA 3G1YA 2HQAA 2JIWA 5HA7A 4U2YA 4EKJA 1TZ7A 2KX9A 2GJRA 4RE2A 3KWXA 5D2YA 2Y88A 2YR1A 1NWRA 1E1CB 1YTEA 2Q71A 4XAYA 1UD5A 3S47A 1EGMA 5M3WA 1E0VA 4F9DA 3L2LA 3DAQA 2VRJA 2Y89A 1ITXA 3N04A 1B3XA 2WNQA 1B9BA 3ARQA 3RRAA 4QJ5B 3CUXA 2XSAA 4JN6A 2ZA2A 1TFVA 3WBXA 1FWSA 3Q94A 3QHNA 3S5SA 3WMCA 4MJ2A 3NO5A 2BSLA 3C2FA 4D71A 4E4FA 2VHLA 3EWZA 4Q33A 3P8IA 3WCZA 5IM51 4LANA 2EBNA 3PPHA 3C2VA 1OQFA 2QIWA 1L2QA 4HCHA 5A2CA 1IT0A 5CZTA 3IJ6A 1FKXA 5G4HC 1GK8A 2RDUA 2CU0A 6A3HA 2C79A 1UYQA 3ZYZA 4Q4QA 2FTWA 1XR2A 4JFSA 3B8TA 2BFGA 2J8TA 5M03A 3K4DA 4DVOA 4AC7C 4DF2A 3OZMA 1UOKA 1TPC1 5D4YA 4BJHA 3ZVHA 3MHGA 4U3AA 2ZXDA 4A2SA 2HCVA 4PTXA 3WQPA 2XN2A 4G1KA 3KTCA 3RPTA 3ERPA 1J8VA 1MEHA 1D3GA 3EKZA 3SRHA 4GMEA 3APGA 3IGUA 5REQA 3T2OA 1KV5A 1A5NC 3TJLA 4AWEA 5CPLA 3LTSA 3EXRA 4WJEA 4RX0A 4WGHA 1VR6A 3H2MA 3W37A 2WZIA 4QCFA 7PTDA 4LUSB 5D2XA 4GYFA 1TVLA 4DELA 3DXIA 4JTKA 3WF3A 2AKZA 1FWRA 4CNPA 2IXUA 3WENA 1T8XA 3LLDA 3NURA 4UOZA 1PS9A 4HHMA 2EO7A 4GUIA 1W3IA 2BBFA 4AZIA 3LGDA 2OU4A 3NDOA 1BWVA 3TMQA 2EPKX 4JZ5A 2BY2A 4UTMA 4NX0A 2F61A 1V51A 1DBTA 1WDSA 3FIGA 3IV3A 2R6OA 4UQBA 3TOYA 2Y8UA 2XIOA 2DZWA 1A4LA 4XVDA 3AOFA 4PB5A 3V36A 4F2BA 3ZSSA 5BXSA 2PP0A 1B4KA 1OGSA 4N9CA 2DT0A 1UQZA 2I5IA 2GUBA 4WK9A 2AAMA 1PIFA 3UT0A 5FJJA 5XINA 4O14A 1PIIA 2OLSA 5DMNA 4EK7A 3MW7A 1H7PA 4MY1A 3F5JA 3NQGA 5XIMA 3MVTA 3FVDA 2ZZ5A 1ZQ5A 2HTMA 3ABXA 1VLWA 4FR1A 3KEHA 3OEXA 1OFRA 3FGCB 4EIVA 3SUSA 3A21A 3ZJ6A 2PDCA 1JVNA 2DJXA 4REQA 4M6VA 4BWLC 2IPJA 1H7WA 3RIKA 3WFLA 5C54A 1NF0A 3KP1A 1LLWA 1JZ2A 2W91A 1L0PA 4NQ1A 1S46A 4Q8NA 3ZVIA 4ZEPA 3AISA 3OG2A 4PTMA 1XG3A 5E93A 3B8WA 4Q8PA 1DP0A 4ASTA 1SSDA 4XZ9A 3E2SA 3P7YA 3VOHA 1OK6A 5JBDA 3B05A 3CYVA 4MB1A 3QN3A 1FY6A 3UPMA 2O55A 2OR2A 3DFHA 1C7TA 3RPMA 3NCOA 3UJEA 1QNPA 4FX7A 1ISXA 2W4XA 3DZ1A 5C6MA 3UY8A 2E9BA 4WOQA 5CZKA 3B06A 3OZOA 3HG5A 2GVYA 1YXDA 2Y63A 2QUMA 3F4NA 1BFNA 3WLHA 4JCMA 1POJA 4D6DA 3GH4A 3W7RA 4C1LA 1TJPA 3L4YA 5BXTA 1XPYA 2PURA 1UD6A 2UWFA 3RN6A 4DLFA 1HKVA 4ZOEA 2ZYFA 3LX9A 3CUGA 4UUIA 1KXHA 1TPDA 3QGKC 4WCJA 3VKKA 4HZ8A 1E70M 1DKWA 2RH9A 3L2MA 5EBUA 3C2YA 2PCQA 4JCLA 4AG0A 4I6KA 3STEA 4S1FA 2YCLA 3PWGA 1F6PA 1HKMA 2PDIA 2PGRA 4J28A 1XV8A 1E3ZA 3CK5A 4PUDA 4C6QA 2CLMA 1H3GA 3NQBA 2NUXA 4Z1DA 2P0OA 5FKYA 1G4SA 4H8UA 1HXJA 4RLIA 1WBHA 3SDOA 5IRPA 4IH3A 4KKXA 4FPSA 3TDFA 4Z2GA 4F2UA 1E6PA 3KRSA 3T7VA 1Q6CA 3II1A 4UCGA 1ISYA 2AQWA 3WELA 4MDPA 4UTWC 3VIFA 2WVTA 1BGAA 5FF2A 3RX4A 4CU6A 1NSJA 3VCNA 3C3UA 4JQ3A 3AQUA 3VOGA 3NZPA 3NZQA 3CEPA 2I14A 4NJHA 1TMLA 1M03A 1YE4A 1POKA 3UZ5A 2YL8A 3WQGA 1MI3A 1JCTA 3WH7A 1W1YA 1ECEA 2Z28A 4IPLA 3CZGA 3R7MA 5LNUA 3WX7A 3QVQA 3M41A 2HK1A 2DPEA 2VYOA 1UBSA 1ONRA 1XYAA 1B3ZA 3W01A 3KZPA 3W53A 1QDSA 1OADA 2HVMA 3T0AA 4CLMA 2XDFA 3AYRA 3H8AA 2POTA 4W8LA 2F84A 2QGHA 1MUMA 2E8YA 1OFOA 1JZ3A 3GH5A 3XINA 3WJWA 4GQRA 3NPWA 4LUYA 1UZHA 1W91A 4V27A 4ZFMA 1XRVA 4IFKA 3C86A 1KFEA 1KQYA 5HUPA 2QQ6A 2VGIA 4QR6A 3TVAA 2QPSA 3GR4A 1EC7A 2Z1BA 4CGTA 1Q45A 5A95A 5FSEC 3LHWA 1VFUA 3U6WA 2YW3A 2WC3A 4H9ZA 2I5QA 1DJWA 4PCNA 4JIQA 1M7PA 2QCEA 3OGSA 2JGQA 3N18A 3T44A 1EKOA 2O92A 3ITOA 3HG4A 5BWAA 4ZQOA 5JQ9A 5CBJA 2FH6A 1XHGA 3C2OA 3QOKA 5AHNA 3W7CA 1UASA 2Q8XA 3PUEA 1UKPA 1R2SA 3HFYA 4PUKA 4D6CA 4IIGA 1H7OA 4R7JA 1YPXA 4H9UA 3AIRA 1XYLA 2AGKA 2EQDA 1F3XA 1QOPA 3B4UA 3S5OA 3QPYA 3MHFA 5LSMA 1TV4A 4AD5A 1ISWA 1ZBKA 4AIBA 1J96A 5CGTA 5H8UA 1MRAA 1IYXA 1OZMA 3OLDA 4MNKA 4PMJA 4RW3A 1WZAA 3OYXA 2F2HA 1VYPX 1HZYA 1I1XA 1JZ8A 2QJMA 4NJKA 3RM4A 4JR5A 4FNQA 1N8IA 4GIEA 4PCPA 1J9YA 1DWFM 1TJRA 3CC1A 5H8MA 4E2OA 4PUJA 2W27A 3GDKA 2XGIA 5REQB 2E6FA 3KRBA 1HGYA 4A35A 5HWNA 2IUZA 3F7JA 4FXJA 4KMQA 5LXXA 4C6MA 3K8KA 4FMVA 2VWSA 4LYPA 3HPSA 2HROA 3SY8A 3T9PA 2G97A 2P8CA 1IIGA 3B8SA 3EDDA 3HPAA 1EB3A 3SUWA 3A9IA 3TTYA 1A4MA 4JDBA 4Q4RA 4F66A 4IQDA 2FGZA 3CMJA 2JGYA 1YE6A 4ZXOA 3E12A 1VIWA 3NM3A 1GKRA 1Z32X 1JFXA 2F8QA 4L4LA 2CZVA 4RZ6A 4H2HA 2E6YA 4NY2A 1UUMA 5A6AA 4FEZA 4PTWA 2QAFA 4BR1A 2POZA 1OX6A 3APYA 3GZ3A 2VFEA 1TQJA 2X2GA 1GHRA 2VGBA 2NUYA 2VVSA 3BCFA 3E0LA 3QTGA 3VD4A 3TYAA 3NYDA 1LRTA 5HNTA 1BEUA 3N3MA 4IMEA 3H12A 4E6MA 3CWNA 3F5LA 2Y7EA 2EGZA 3NDZA 2J9XA 2WMHA 2QUTA 1CXKA 3RYSA 1WZKA 1ZTVA 4W8BA 2TRSA 2IS7A 1J0KA 2WVSA 4S38A 2OEMA 4RDZA 3QSRA 5EFFA 3T8LA 1GQKA 2A3EA 3HURA 4LEFA 3UG3A 3HM7A 3ITXA 4UMAA 4GY0A 3MJYA 4MOZA 2QYGA 1KCZA 1UD8A 4Q4PA 4BS0A 4R3UA 4QM1A 5HJYA 2HISA 3EB2A 4Z2JA 3AUJA 1A49A 4Z17A 1S1PA 3TJ4A 3THCA 2OZ8A 5K2ZA 4PYSA 4EF8A 1MRQA 2YB1A 4JYEA 2OVLA 4FSAA 1I45A 3SURA 3ZLHA 1AQFA 3VIMA 2J8GA 1ZZMA 1NP2A 2E3ZA 3N34A 3FFSA 3MSRA 4FNRA 1W9UA 5CPQA 1FFQA 1E4LA 3SCVA 4FIRA 3S1UA 1JAKA 4PUNA 3NOEA 3RJXA 1J0YA 3K30A 3NVDA 1ECQA 1BRLA 1VFFA 1ZJHA 4JY8A 4LY4A 4U28A 3M0ZA 1FXQA 4D9PA 3KBSA 1PZ2A 1MUWA 2QXWA 3VMPA 4LBSA 3G8RA 1OG0A 4NZ1A 4Y6GA 2F9RA 1OFBA 5T8GA 4PUEA 3ZLFA 3S1VA 4HU8A 1OJXA 2QLYA 4NZFA 2J74A 1LP6A 1U5JA 3O9NA 3W1XA 2ODOA 4MSSA 3CUIA 1VBUA 4P2VA 1NQKA 2HS6A 2CC0A 3BQ6A 4AUBA 1BSLA 3F4WA 4J2PA 3A64A 4EAYA 1OINA 1W3LA 4IIEA 3TP4A 5G4EA 1SO3A 2F6UA 3PBMA 1GVSA 1NOUA 2GPTA 1EJUC 4JYDA 1ONEA 1QBBA 2D2HA 3PZIA 1F3TA 4TVDA 3HPFA 2EPMX 1CI1A 4L9XA 4MY8A 3UJ2A 4AD0A 1BQCA 4OFCA 1M65A 7A3HA 5A5WA 1HJWA 3RLHA 3W87A 4JQ1A 4XBSA 3HIJA 3S5NA 5FJUA 5K9XA 3VE7A 2PDJA 2AKMA 4FIQA 3A24A 3WDQA 3DI1A 1UA3A 3B0YA 1SFJA 2O4QA 3TE9A 4CNNA 4UZSA 3AMGA 4FF7A 1NP0A 3DG3A 4YXGA 2FH8A 1C8VA 1OX5A 3CV2A 2CHNA 4MG4A 3MYOA 4XKMA 4AHPA 2PLMA 4KWUA 2PMQA 4UIOA 4HGXA 1KFLA 5AC6A 4G5DA 4B2DA 4C6EA 4S3FA 4UCFA 4AZBA 3WUEA 4GPNA 3VX1A 1H1NA 3CLMA 2HNHA 2QF8A 1RALA 3PBYA 2P1FA 1FHDA 3P2VA 4BK9A 2AGTA 3VO0A 1W2PA 3PANA 1JULA 3ICJA 2FDSA 5CJNA 4C6KA 3C0LA 2A0NA 4Z2KA 4IXXA 2E4TA 3LHZA 4KIRA 4QP0A 1NAL1 3CQ0A 4V1XA 2J27A 1ISZA 2X7VA 3S2NA 3V5CA 4HB7A 3VD9A 3WLNA 4MM1A 1EBHA 3OG3A 4J3ZA 3W4RA 4QG8A 2VC5A 4FF5A 3MYPA 1Q7QA 3V5OA 1BVZA 5DELA 5FJPA 1EPXA 2ZX5A 4W5ZA 4MKVA 3W2UA 4LSBA 1EA0A 4IFKB 5FOOA 2QT3A 1CNVA 4R34A 4MB3A 3BGAA 3LTPA 1V3IA 4GOAA 4R7WA 2Q3RA 3N9KA 4U33A 4M6QA 1BYCA 1VENA 4PFMA 3SQLA 3DKLA 5HWJA 1JF5A 4PSPA 3M16A 3B8DA 1XH0A 3ORWA 3LNPA 2ESCA 3E0FA 1OEPA 4QAWA 3L4VA 1E6ZA 3QJAA 4R88A 4S3EA 2WMIA 4E4PA 3LHTA 3KL5A 5GNXA 2CBIA 2WBKA 2VO5A 4ZSUA 2QVHA 3W7QA 3CTLA 4DXKA 3NSXA 3R2GA 2QIIA 3VUPA 3W74A 1NF7A 1E15A 4S2BA 3VIHA 4A2RA 4OV4A 1EL3A 1ZB5A 3C6CA 3S2JA 1LLOA 4JBRA 3K2GA 3MSGA 3T09A 1RLCL 3BG3A 2FLIA 4POCA 2WSPA 1RK6A 5DY2A 5EA9A 3KAOA 1HJSA 4LUIA 3IPWA 2YLLA 3TJXA 1KM0A 3WLPA 1A0EA 3IAQA 3IVTA 4LF2A 1SJAA 2NSOA 3SN4A 4EXBA 4WKAA 5CPMA 4Y9MA 3CMGA 3NUKA 3W23A 2YFOA 3U2CA 3L7RA 2GFTA 4AHOA 3AIVA 3S1GA 3M44A 1HJQA 1SJCA 3UPBA 1IGSA 4XBKA 1CXEA 4KPLA 3ALFA 2PRMA 2PC4A 1DVJA 3WH6A 1CGWA 2DSKA 4YLWA 3NTYA 1XGDA 1CXLA 4H9XA 3AALA 4WGXA 3LSCA 1TMHA 2RHGA 4S3GA 2PODA 3TSBA 4M81A 5F2GA 5I07A 2OJPA 3BGJA 1UWUA 5CSYA 4L6OA 4PTDA 3QKEA 4AFYA 1DQWA 4PMUA 5C9UA 4H9MA 5MF5A 2YCJA 3Q58A 3E5PA 2OYLA 3TFCA 3P62A 4Q7IA 3Q65A 3PZTA 1UWRA 4GJ1A 5CKSA 1OYAA 1KO0A 2JEQA 4DBWA 3TWBA 3U4AA 4Q22A 2E67A 1L6WA 5A6JA 4MYXA 1JPHA 4ATLA 3BW2A 2DZVA 3SCNA 1KWGA 4L9YA 1OCQA 1B31A 4CU7A 2NWRA 1SZEA 4AZHA 2FB3A 2HS8A 2CLPA 1MO0A 2ZICA 3LSBA 3HV8A 1XQLA 2DUXA 2VGGA 2OODA 1GEHA 4C7DA 4KCTA 3STFA 1W1IE 3GIYA 1LTDA 3G2GA 4OOZA 1ZFJA 1TWZA 3NQ2A 3GTHA 4MWAC 3SBFA 2BLEA 3BLDA 3G3MA 2QCLA 4GJJA 3I4KA 4NNCA 2V63A 3CIVA 1QPKA 3W2NA 3UXIA 1XGZA 3ITTA 1MFUA 4LNCA 4EPDC 4KFOA 2PTYA 4ERGA 1XM3A 2CESA 1UWAA 1W9XA 1OVDA 4E3TA 1LBFA 1AZ1A 2XYLA 4TVCA 3XISA 4HCDA 2P5NA 1QI3A 2ZBTA 1YNQA 1UC5A 4C1NB 5I03A 3O2LA 3VA8A 3FDGA 1K7EA 4GZIA 5CPSA 1RBAA 5AHMA 4QJ4B 1OM0A 2PDFA 2NLIA 1KA9F 4C6CA 3WK0A 4MWAE 3VNLA 3B8VA 1Q6OA 1XIIA 2PU0A 1E73M 4IMAA 2DQXA 5EMKA 1K7XA 1Z69A 4PMVA 1BRLB 3LM3A 3TR2A 4C6IA 1FH9A 4B5WA 3URQA 3S9ZA 3CAVA 4RNJA 4W7WA 1A50A 2CFFA 3PBWA 5FEZA 2V81A 2B0MA 1HO1A 3SQMA 3VK5A 4D6JA 2C3ZA 3IJ9A 2E6DA 3DHUA 3L23A 1F4HA 2GL5A 2ATSA 3WLTA 3KVJA 2YCEA 2G3IA 1EDGA 1TO3A 4WXYA 3H4GA 4HYWA 3B0PA 1QI0A 4FLRA 1RQBA 4DWSD 2YA0A 2WLYA 1GVFA 2PTXA 2QS8A 1TTQA 4MZYA 1BGGA 4DJDD 4B5UA 1H50A 4MJMA 4D8ZA 3F5KA 2XFYA 2Q09A 3H23A 3VD7A 2X1IA 4JN7A 1BF2A 4GI9A 1MVYA 2GVJA 1KRAC 1FDYA 2DZXA 3HO8A 3W6YA 5I24A 3AS2A 1B0IA 2NXGA 1R3TA 1Y5WA 4MB4A 4S39A 4DJED 5AECA 1C93A 1P5BA 5EL1A 3RPDA 1R30A 3O07A 3IIVA 1R47A 4HTYA 4WY0A 2R1LA 3VDGA 4WY0F 1HT6A 3ZMRA 4Y96A 3UJRA 3VGDA 1CB7B 3SUTA 4Z2LA 2CKRA 2JK2A 2H6RA 2EPLX 3PULA 3USZA 2WPGA 1KB3A 1VFTA 1PXGA 2XFRA 3ARWA 4QNWA 1QJWA 4FX8A 1TYGA 1QI4A 5EYWA 1X8FA 4CQ9A 4GXMA 3ZQ9A 4K38A 2VCBA 3RITA 3O6YX 1Z42A 2VCCA 3NIYA 4W8AA 2V3EA 4UNIA 4H83A 3CQKA 3UWWA 3LXBA 3DKJA 1W2VA 1HKJA 3TUUA 2HE8A 3SCUA 4V15A 3GW3A 1G69A 5HBFA 3WBYA 4ERAA 3V1HA 2DJLA 2YYTA 1CYGA 3DC0A 2JF7A 1K3UA 1XINA 3LK6A 5BYWA 1DJXA 1JZ4A 1T6MA 1EOMA 4M5PA 3W70A 1LWIA 2W79A 4TX8A 2WNNA 3IAPA 2WQPA 4ICCX 4PMQA 3DENA 4OE7A 2E77A 5BU6A 3S3GA 1E6QM 4NRSA 4Q4OA 5I79A 3HBLA 4GKLA 5A6LA 3I4EA 2FJKA 4B4FA 5BRQA 4XD4A 2YXOA 3AMLA 1OFAA 2EKCA 3GXPA 2UBPC 3EA3A 2OLHA 4NI8A 3CUZA 4C91A 1NJJA 3N4AA 3ONCA 1GHSA 3L4TA 3ABSA 4S3BA 2FYMA 2EXOA 1T7LA 4YYFA 4DHGA 1I2QA 4HN8A 2INEA 4W88A 2BMBA 1CXFA 2J77A 4FNTA 3SY5A 1FWBC 4JTQA 3TXVA 1UIPA 1I2PA 3VC5A 5I3FA 1CGVA 4PCTA 3MUXA 3VNDA 1JEZA 3GNPA 2XINA 3WK2A 3SM0A 8CGTA 1V93A 3L4ZA 1RD6A 1U1HA 2RJHA 4UQDA 1QCWA 1NWUA 3VGBA 1E9IA 1J10A 1JCMP 2DUAA 4B5NA 5AKQA 3IANA 2VZOA 5C2GA 3Q4DA 3UXDA 1KGUA 1S1RA 2FPVA 4GVIA 3W2KA 3GU2A 4AD3A 2WXDM 3VNJA 3GFYA 4UR9A 4FOUA 2BV9A 4A4AA 2CLEA 5C0QA 1TRIA 1VYRA 1WDDA 2C0HA 1XYCA 4C6BA 3PTMA 5T26A 5D8WA 4BEUA 2O9PA 2VFGA 4K37A 2CERA 2E09A 2V8ZA 4TQTA 1TPVA 3DI0A 3C2RA 2XH7A 3DFNA 1E71M 3MUY1 3P61A 4OV9A 5EMMA 4Y9OA 5PTDA 5FJIA 1W1ZA 1UD2A 1P0EA 4GCXA 4LH8A 4M8UA 1KM4A 4WDWA 1SFSA 5BCAA 3G1HA 1MFVA 4WSKA 4A3UA 1OHLA 3OODA 2VP8A 1W5PA 2RDXA 1TE1A 3UWUA 2B7QA 5KZDA 4W9TA 5HWMA 4A8IA 2WV8A 1A5SA 1VYSX 3DYMA 3VOJA 5HOSA 3B0VC 3QMSA 3MV01 2I57A 4CNUA 4WOZA 1DXFA 4LTSA 1VKFA 1HGWA 4GC3A 1OABA 3E6EA 1EP1A 3OIXA 3KLKA 2NUWA 1R7OA 3U4FA 4X9SA 3OP2A 3CT7A 3B9AA 2ZZ6A 4F9JA 3CNYA 4DYKA 1UKSA 1U83A 1B30A 3LQLA 1FWTA 3NFUA 4H1ZA 3T0CA 3RFAA 1O4UA 1NWTA 3RX3A 4M7TA 5G1MA 1E5JA 4NZ3A 5DQPA 4B5TA 3SAZA 4PEEA 1W9BM 1UR1A 1V6XA 2QW5A 2QJHA 4LBRA 3OW1A 3W1NA 1XFBA 5L9FA 1UPMB 1JPKA 2P8BA 1EJRC 2WJEA 4ACYA 3ARRA 3L67A 4FLOA 2WHLA 3THUA 2OKOA 3HF3A 3OYZA 2VZTA 1GW1A 4XZBA 3FLUA 1WQ5A 3CEUA 3WNOA 2ZDRA 4O1DA 1S2VA 1ITQA 4ZQRA 2O7SA 3MT1A 1YBQA 3AHVA 2ASHA 4P5UA 2CLHA 5D30A 3VI2A 2PWVA 3FN9A 2GWGA 3DYOA 3M6YA 5HMEA 3MKCA 1PCKA 4DZ5A 1BPLB 1GQNA 3SGUA 3TTQA 1KM6A 1EJXC 3N14A 2X16A 3QYSA 4F4RA 3LN3A 2W3ZA 2X8RA 1BXBA 5BOFA 1CX9A 4KCVA 1QI2A 4O4VA 2J75A 2NSXA 1B57A 4RW5A 1R46A 1VFSA 1B1YA 1LRQA 4K7VA 2A6LA 4C6FA 1V03A 3W28A 4JTFA 4MJ4A 1R2RA 4LY8A 3L4XA 2WM0A 3VC6A 1RLDA 1FP9A 1HW6A 3D3AA 5KTLA 1RA5A 4QDPA 3UERA 3EBVA 1O66A 3AWNA 4LUTA 5B7ZA 3PUGA 1MXDA 2YA1A 2W61A 1TE6A 1XBZA 2PSNA 1NQ6A 3PVFA 1Q4WA 3UZXA 3UCQA 3THAA 1JI1A 3L66A 3QY8A 4A8LA 3OOQA 2XVGA 5JIWA 3MMTA 3P81A 3QV9A 2ZX6A 1TUFA 2H3DA 1W9DM 2XFWA 5KEZA 2X1TA 1IEQA 3VIPA 4OHQA 2WCAA 2AMGA 2HPIA 2O4MA 3AIQA 2E5DA 5JIPA 4WIWA 4ZO6A 1WX0A 1UR2A 3GHTA 2JE8A 2NXHA 4CCCA 2YGYA 4ML9A 4NJIA 3SRFA 3UXAA 2ZC1A 5CH9A 3CIWA 2RJGA 4A21A 4M0XA 2EJ1A 2WANA 4JIHA 2G3NA 3TQKA 1LWHA 1P0DA 2C14A 3VILA 4IWWA 1DWHM 1OYCA 3NPXA 4AIEA 4DZHA 4ROQA 3LS9A 1US2A 2JQXA 3RLGA 4RXGA 2WPBA 4ADUA 2QCDB 3LB0A 1FWCC 2GSHA 1W5OA 3A6OA 3PK7A 1I75A 4BCEA 4KGJA 5MKGB 5FF4A 1T0OA 2OX4A 5K9CA 1L2UA 1G01A 3IVUA 4LVFA 2FFCA 3EEGA 5GJMA 3GU9A 1VAHA 4GXPA 4XD3A 4GYJA 1XYBA 3QC0A 1XLLA 4LAOA 1W1B1 2BHUA 3H21A 4H2CA 1PX8A 3RCYA 2VR5A 3UNDA 2PI6A 5I3IA 3HMJG 4TU1A 3IARA 3NQMA 2F2KA 3R11A 4UZUA 2X1RA 3CLWA 1XCWA 4TTUA 2VR4A 5A6TC 4CN6A 5CG7A 3QMTA 3W1QA 3P84A 5CLWA 4C6JA 5DCBA 3STGA 5FCZA 1TJ1A 2EG6A 4G7FA 1KLZA 3EA1A 2OO0A 4QE1A 2A6NA 3AU2A 4UFKA 4Q8VA 2ZOXA 3WLRA 4G2DA 2NX3A 2V30A 4OQVA 1I2OA 1THFD 3N11A 4M80A 4GIAA 3CUHA 5H8PA 3LUTA 2WB5A 1UD4A 1MWOA 3R8HA 2VD9A 1OGGA 2YDQA 3PG8A 2PDUA 1A53A 2ALDA 1XWYA 1YXCA 3WJXA 1PTGA 5AHLA 1G67A 3ZS4A 2HVNA 4L64A 4IG2B 3KHJA 4LOCA 2DZSA 2IQDA 3WF2A 1ZBWA 5A8NA 5C70A 3HOJA 1UWSA 4XSLA 4D8LA 4UMBA 1F3WA 4HJWA 1LDCA 3VKBA 1EDTA 4NJGA 2ZRWA 3KFTA 4CNOA 1OGBA 2CEQA 3AHXA 3WD4A 4F0HA 3BCDA 3GR7A 5I0DA 4UFHA 2VC7A 1JGIA 1UCWA 4JTIA 1UMLA 4TR9A 4S3JA 3AZRA 3SGGA 3MDWA 4DWSC 3G6LA 4X9YA 1P6BA 1RAKA 4WKFA 5MHBA 4DJDC 4HPHA 3ZT7A 5BMWA 1GUVA 3OVRA 1ZAJA 5DO8A 3EKLA 4CNSA 4XAGA 1R9ZA 4L1XA 3GBDA 5IBXA 5LHEA 1HL2A 4EPEC 2DU2A 2ZRUA 4JOMA 2GQ8A 4CCDA 1IIHA 3B9NA 2W92A 1SO5A 4ZZ9A 1AH3A 1F8IA 3VU2A 4NHVA 3NQDA 1Y5VA 2BXVA 4M3PA 4DO7A 1BAGA 3E2QA 1LBLA 1JG9A 4IQLA 3D3FA 3W71A 1AQ0A 2VFDA 4JIPA 3RLUA 1UWQA 1N7KA 2GGIA 5GJPA 4D6IA 4GGBA 1R3YA 3WQ5A 4IM4A 2A3AA 1R86A 2WVUA 3NQVA 1ADSA 2YBTA 2XN1A 4JTSA 2D2OA 3QSTA 3ZWTA 3TNBA 1WDQA 1GGOA 1V6YA 3CAWA 3M9YA 4DUOA 3GC2A 1PIGA 4KWOA 4GLEA 3V35A 5IDIA 3RRXA 1Q8AA 3PB2A 4FLQA 1VFOA 4W87A 1K9EA 3E96A 4LF1A 3WUFA 3TFXA 3LYEA 3KCLA 1F3EA 3TW6A 1G6CA 3PZUA 3PTDA 1DOSA 3BAYA 1AH0A 1SZFA 1J2WA 3ABQA 3CHVA 4OKDA 4GI8A 1UROA 4C1KA 4PB4A 2HXTA 4UNLA 4R7OA 3J7HA 3RCMA 3EX2A 3N12A 1E0WA 1V0NA 1TWDA 3H2AA 4O1EA 3H6OA 4Z08A 3S9IA 8TIMA 2R82A 2Y61A 4X3ZA 3NEHA 1F4AA 3MANA 3VM7A 1SJDA 5LA0A 3I7RA 3P82A 4KWSA 3AJ7A 4E8GA 3TLLA 2IPWA 1WDWA 1XRTA 1X1ZA 4BKNA 3UGRA 2PAJA 2XVKA 3CH0A 3N2XA 5D2WA 3RG6A 3U48A 3AHYA 4QLKA 3UZYA 4U4MA 1JL8A 1E0UA 2YDSA 3BW4A 4CD5A 3RK8A 4W93A 1X7FA 1JZ5A 1UOZA 5HR7A 3PTQA 4NXKA 4J3UA 4O0KA 1OFQA 2VCAA 2GZXA 3M0LA 3OHIA 3AC0A 1X96A 1BTCA 4JN8A 4JKMA 4XZHA 4JFTA 1CT5A 5CZSA 3S46A 2YL6A 3UWQA 2EJAA 1WZLA 4AZCB 3MO7A 1XLKA 4TMCA 2GDUA 2REQA 3FA5A 3JU2A 3U0HA 3CXOA 3DERA 3GQYA 3QPZA 1OD0A 3BOLA 3GTIA 1TUXA 3UA4A 3UXLA 5DMYA 3GVQA 1P6WA 3W7GA 4AHQA 4UTIA 3SY1A 4NXSA 1XF0A 2V5CA 4HP5A 4LVBA 2QZRA 4Z1BA 3S2LA 1OYBA 4TV5A 4HSOA 5DLCA 4P7QA 4CQCA 3C8NA 1RCQA 1UUOA 5HNUA 1HL9A 1Q7MA 5K7JA 1NTHA 1S2UA 5I00A 4K8HA 3EX6A 3M5XA 4G6CA 4WDUA 3ITYA 2GGHA 3U7BA 1LRNA 3RJYA 2WMJA 2CZ5A 5CPTA 5I23A 4GY1A 2VUYA 2VUNA 5K4XA 1EJWC 3QHMA 4FP1A 4IXHA 4CQAA 2PDPA 1W8GA 4LUTB 2E5BA 4IFOA 4Q8UA 4NNBA 1TR1A 3GAYA 4HNCA 5CC7A 4P8WA 1V02E 2V2DA 3GKFA 1NIUA 1WXYA 4AY7A 2DZPA 4O1CA 1OF8A 3FA3A 3O06A 3QV6A 3STPA 3GK0A 3U8GA 3CWOX 1OBAA 1CENA 2E5CA 1MXSA 1K70A 1P0BA 2NW0A 4OU1A 4LV9A 1K9TA 1JDAA 3N2MA 3TAKA 2RGMA 1C91A 1S5VA 4RNHA 3SB0A 3U2EA 1KBIA 1ZNNA 4JTUA 2ZC8A 1IEWA 3CZLA 3UGVA 2PWDA 1PZ1A 3O63A 3APTA 3A4XA 3W2MA 2DVXA 3WYZA 1V3LA 4AZ6A 2OWXA 1TZZA 2G4FA 1CGXA 3GAKA 4IMCA 4LC6A 4L4PA 3W7EA 4ROPA 4XISA 3BV7A 1OIFA 4NVTA 3DFQA 3GE7A 2I5GA 1OK4A 3QFEA 1FDZA 4TVUA 4GIYA 1J6OA 2QCCA 4DAIA 3VGEA 4HNTA 4QX4A 5E70A 3SQSA 5LNWA 3A3HA 3N6JA 1GEQA 2QV4A 3O05A 6REQA 4LU0A 5CJMA 4F0SA 1WB0A 1X38A 4Q8QA 1VGAA 1TJ2A 4I5UA 3HGRA 4ZO9A 5TNVA 3G18A 3OO2A 2W67A 3MP3A 1W1TA 3LCXA 4QE5A 7ODCA 4V28A 4MYAA 1V0LA 1RVKA 5H6HA 2IW0A 4H9TA 5HQMA 3GC4A 3NL3A 1C92A 2HXUA 2QJGA 3VIJA 3S42A 4UTLA 3PZQA 3N2CA 2HWGA 1VZWA 1DPMA 3EOLA 4PFHA 1KR0A 2YLAA 3SUUA 6ENLA 1Q13A 2EHHA 1CPUA 2PGEA 1S5MA 4Z1AA 2ZDSA 3P5ZA 3V1PA 4GYPC 2CCRA 3MWCA 4HMCA 2X1SA 3W7MA 1GQLA 3OVQA 1YQ2A 2UY3A 4US5D 3SIZA 4RV8A 1PE1A 1BLIA 3W81A 3KW3A 2GK1A 1FWWA 4MPQA 4WSHA 4CCEA 1W3TA 3AIUA 4XD5A 2B31A 1I0DA 4NP7A 1H0GA 4V1YA 4DJFD 2OTDA 5K3VA 1GVQA 1O5QA 2A79A 1XG4A 1E1EA 3NZRA 3TKFA 3KXQA 3AXKA 1MNZA 1OX4A 2FFIA 5F1VA 1KM3A 1PAMA 4QISA 2Z27A 4AYSA 1QW8A 3VOIA 2ZUVA 3ARYA 2WK2A 4TO8A 4ZOAA 5G1YA 1QR7A 3QXBA 2OOFA 3BAJA 4AY1A 3HB9A 2BS9A 3PY2A 3H22A 7ENLA 2C7FA 2GQ9A 1PKYA 3D5HA 4B90A 2QV5A 3M5VA 4M82A 2QKFA 1IF2A 1JJKA 2PS2A 4JX5A 2O9OA 4IPNB 5BROA 1A3XA 4DM2A 4AMAA 1CGUA 3NQCA 1KBJA 4ZGYA 1Z9AA 1EGVA 4EACA 4AC1X 4GG9A 1ESWA 4PE8A 4GNJA 1GVOA 3E5BA 1W54A 3UA3A 2PRLA 2VX6A 3GW0A 4UQAA 3WLIA 4O0ZA 1IR1A 1VLIA 2J8FA 4BQ3A 3S1XA 1D9EA 4ZENA 3FKKA 1HUVA 4N6EA 1N82A 1JCJA 5FF0A 4NF7A 3T2QA 2FZ8A 2OSYA 2PTZA 4K8EA 4J27A 1PYFA 3EYPA 3R0DA 1VJZA 4ZO7A 1DJHA 4M6PA 5D04C 1XICA 2FVMA 3T1GA 1IE7C 3OU8A 2MNRA 3FHAA 3SCSA 2WWDA 2CXEA 1GWJA 3ZIZA 5F4WA 1FVPA 5JVLA 2QHAA 4XZMX 3R43A 4XZIA 5IHSA 3B0UX 2GUYA 5EMLA 1AZ2A 2A7RA 2JKAA 1ZRQA 4XZNX 5LIXX 4JDYA 3ITCA 3KOZA 2Z00A 4E2VA 2G50A 1XISA 5FJOA 4NAEA 2VXNA 3TXZA 4LNYA 3OLIA 4O54A 3G8EA 4JTRA 2PTWA 1ZAIA 1LOLA 2WHMA 3VX0A 1EJVC 1KFKA 1JNEA 3REQA 2BOGX 1QK2A 3MUCA 1R87A 4EXQA 1ZU8A 3QW4B 3W7DA 2YBUA 2FVKA 4LUSA 1YLVA 2GDQA 4FZIA 4DO4A 1E43A 3T8QA 3TZNA 1GOXA 3K1GA 3GO2A 1H7RA 4C65A 4U3CA 2X0HA 1DWIM 4QS6A 3W2JA 4YCOA 1US3A 1DL3A 5CSSA 3VYLA 1FFRA 5TD4A 5IOBA 1IV8A 2IKHA 3QV7A 4O17A 1K8YA 5DBUA 2X40A 2VQTA 1XC4A 3OQEA 4YTUA 1X39A 4RKAA 2Y5SA 1P1MA 2XIIA 1QTWA 4WKHA 3TYEA 1JCNA 2Y5JA 1SJBA 3ARSA 2D3LA 3BO9A 3GRIA 2P3ZA 1WBJA 3BLPX 1FRBA 3WJYA 4Q6XA 3USBA 4Z0JA 1K1DA 4AZ5A 2XIBA 4ERIA 4LRSA 2HZGA 1WAUA 5A2BA 4P7LA 4GFIA 1ZJBA 2VFHA 3SN0A 7TAAA 1ZP4A 3C4UA 1SGJA 1UR4A 3ZJ8A 2HSAA 1YDVA 3EOUA 4DWSA 4MMWA 1B9ZA 1ZS2A 3E2VA 1XLAA 2WKJA 4DJDA 4ZE4A 1YKWA 4JHZA 4FNPA 1IEVA 4LJ3A 3C8FA 3V0TA 2WO5A 4RXFA 3H53A 2TPSA 4IPIA 3CQHA 4RCXA 1E0TA 3RXZA 3WDIA 4L6HA 3FEQA 4XKYB 2Z1WA 6XIAA 1MEIA 4LGXA 1ODUA 4RK8A 2V38A 4DJEA 4P7NA 3AXXA 5I02A 3LCHA 3WMSA 3LZ5A 1DYSA 3JZUA 3R10A 3HGSA 2OX1A 2WMGA 3H2CA 4H04A 1XCFA 3L65A 2ZZ2A 4MLRA 4AAJA 5FA5A 1JRCA 2DGAA 3MP5A 4Q7NA 3RO8A 2KAUC 3TV8A 4B3LA 5DFAA 2PWEA 3TROA 2CHOA 2VEFA 3OBEA 3W25A 1ZALA 2PEVA 1GOQA 1YXYA 3ZJKA 3IK4A 1J11A 2BG5A 1KCLA 1GKQA 1ZJAA 3ZZ1A 2ISDA 2Z6JA 2XISA 3T2PA 4L9ZA 1MDRA 2D0FA 4QIUA 3CL8A 4O53A 2PFHA 4ZB0A 3A22A 2OGJA 5AYBA 1BQGA 1VH7A 3TTOA 4DI8A 1DJQA 4HZMA 3DUGA 2A4AA 4IHCA 3Q45A 4GUJA 3WQ8A 2ACSA 2ZRVA 1Q65A 3TC7A 8A3HA 3NPVA 3QC3A 2YL9A 5T91A 1KM1A 3FJ6A 4LB3A 1WKDA 4G7EA 3I6EA 4K8GA 3I65A 4UTUA 2V68A 1FDJA 4UFLA 1M5WA 3H2OA 4JTCA 1QXLA 4DBEA 2GVGA 3CPUA 2QULA 3P80A 1QNRA 3K13A 3EPNA 4I9AA 3WNMA 4ORMA 3AIBA 2VI0A 5G2HA 2UY4A 5A8OA 2A3CA 9XIAA 1I1WA 2GJXB 3FHQA 2PD9A 1DHPA 5CBIA 1JUEA 3E0IA 3CAQA 3I6TA 1ZENA 3UEQA 3V75A 1B3YA 3V16A 3GIQA 3UXKA 4JEJA 1IXNA 2UZ9A 3NJ3A 2HE5A 4KRUA 4XUGA 2FB2A 3VFLA 3N4EA 2WJDA 2FPYA 4PCFA 5H1WA 1WDPA 4ADSA 3LRLA 4IUOA 4XIAA 3HTWA 2OWCA 1VQTA 5A8PA 1CCWB 5I3HA 5LNSA 3PUDA 2PDMA 2HDJA 3SFWA 3F03K 3GS6A 3UP8A 3UU0A 2XH0A 3AMCA 2BGSA 3V7PA 4AD1A 3SCWA 4E3VA 2QMKA 4A6GA 3DDMA 1U5HA 1ZHAA 2YSWA 2GK1B 4YHGA 2ATMA 1HNYA 5HATA 1EH9A 3KZSA 4JTHA 2D20A 1R3QA 4GH1A 1V6UA 2TMDA 4EF9A 1VPYA 2Z1XA 3F4VA 1NWSA 4IMFA 3CV7A 2MUCA 3BWWA 2Z2AA 3P74A 4IJBA 4H3DA 2NQ9A 4MNJA 2CYGA 3D46A 5HNNA 3D0CA 1B5TA 1XDMA 4U10A 1IQ8A 2A2IA 3BLOA 2X05A 8XIAA 5U7SA 3W07A 3R5EA 1JIBA 3V18A 2TODA 2EKGA 4QEEA 3F4DA 5I3GA 3L0NA 3W6MA 3O1NA 2QCMA 1IXOA 1FH8A 4HN4A 4J3VA 5F2LA 4GQBA 2D69A 3W82A 3WD2A 2DY3A 1W1VA 1DE5A 5JH2A 4DF0A 4CD7A 4HU3A 1V3KA 1WPCA 3BOFA 1FCQA 1S3HA 2WOQA 4JYFA 1TKKA 3WSUA 4ZQMA 3KM8A 3WJSA 3TCEA 2ZUWA 4C5YA 2IMRA 4C60A 1J6PA 3ZJ7A 1IXPA 3MDUA 1WE5A 3FSTA 1JXKA 4FNUA 3T07A 1UH2A 3BANA 2J78A 4KEUA 1I9CB 2ZZ4A 3IV8A 3PR2A 4ECLA 3WDHA 4PR4A 3K4WA 1ME9A 3BG9A 2G3JA 3O15A 1QPOA 1WP6A 3M0IA 1EZWA 1ZY9A 4X0VA 2AQVA 2QUUA 3BOXA 3KL3A 4A8NA 3SRDA 2VGFA 4JTTA 2E40A 3TAOA 4YVPA 4LCSA 4DEFA 1TZ9A 1Q66A 1GZJA 3T05A 1RBLA 1F2JA 1YTDA 3K4AA 5HULA 1GONA 2OGYA 4HU4A 2XFFA 3EGJA 2EG8A 4GNVA 4RV3A 4AXKA 3DFOA 5EU9A 4NAEB 4HK6A 3GDTA 3PG9A 2NV9A 3WG6A 4K3ZA 4IICA 1LOSA 1DJNA 4L6DA 4NYUA 1KTCA 1JUKA 3REQB 4DJFC 5CPNA 2Y85A 3HPZA 3O6CA 3T4CA 2HJPA 2G37A 5ABTA 1CEOA 1JYXA 2WC7A 4RDVA 5HAOA 4GZ7A 2W9MA 1GJUA 4RZ5A 4DAFA 5CLTA 4HNNA 4OECA 5E6ZA 1ITCA 3ZLGA 1BVWA 1DE6A 1E1FA 3PS7A 2ZRZA 1LG1A 1HN1A 5CGQA 2Y0FA 4HMEA 1K8CA 5D09A 2DIEA 3R4IA 3LLFA 3W72A 1QUMA 1LQ2A 1A5KC 3GG0A 5DY3A 4H9YA 3IWPA 4GYPA 4HNLA 1A0CA 4PB3A 4XO6A 8XIMA 1J18A 1QASA 3WQCA 4FXSA 3MMDA 2NZLA 3CHDA 4PMNA 2VEKA 4K2SA 1NDVA 1RCXB 4LWWA 4DRSA 3M6DA 1HJXA 1JCLA 2V2HA 5ABEA 2XSXA 1X6UA 5CQ1A 1OFEA 2PA6A 1SM9A 1XLIA 3EWWA 2IKJA 3LMYA 3NL5A 1A3HA 4FAMA 3VIOA 3MU7A 2XH4A 1CLXA 3GIPA 4XAPA 3EWBX 3EWDA 1EXPA 3G1XA 1UPPA 3A47A 4MNMA 4DWSB 3ARZA 1FCBA 3SZ8A 1XIHA 5JBFA 1ZCOA 1V6WA 5U4NA 2VDHA 1KTBA 2DSWA 5E6YA 3T08A 3SCOA 1G7VA 4GVHA 4DBSA 1SMDA 3KP0A 1X97A 3R58A 4FS9A 1AL8A 3UZWA 5ENLA 2VT0A 1RJPA 4RDYA 1B3VA 3PZOA 4GGHA 3KTSA 1VEOA 5DBTA 2PF0A 2ZX7A 3KDNA 1BD0A 4IQEA 5AC8A 3LI0A 1GNXA 4NUWA 1J0IA 2HNEA 1EF3A 2NLYA 1I6NA 1TV7A 4XVEA 5CAKA 4J3TA 3ECQA 4Q4SA 4JL2A 4HKPA 1JDFA 4W7VA 5D38A 2NT1A 2FZ9A 3QEZA 2OLAA 1T99A 2YIHA 3QQ1A 3UWZA 2XUCA 3UZZA 3BXWA 1J5SA 1CBGA 1BKSA 3GDBA 2BOEX 1NDYA 1VS1A 1R7AA 3H7VA 2YA2A 3LXCA 1EQPA 1XGEA 4EAMA 3PJTA 2OCZA 1XLJA 1V7YA 2PWHA 2R14A 1FHVA 4LC8A 4YNGA 1UG6A 3PHAA 3H24A 4GWEA 2B81A 5LYRA 4ORIA 3WD0A 3PM6A 4JNMA 2PDNA 4TX9A 4D6GA 4G7EB 2Y70A 4WJ8A 4K39A 2E9MA 4Q8TA 1XIJA 2E28A 4LS0A 4XG1A 2GJLA 1DJYA 1H63A 4QE4A 1J4EA 2CHRA 4F48A 4I8YA 2ZA3A 1EA9C 5DXXA 1ITUA 1KKRA 1K9FA 4ADTA 3WJZA 2ZZ7A 1XSKA 3UFYA 1SW3A 3LPGA 4JNYA 1MW0A 2V5BA 1Q3NA 4M19A 5HNRA 5FIPA 4HZ7A 2QDEA 3N4FA 3QF0A 3H4WA 1EDQA 1E6SM 2R91A 2D73A 1JAEA 2P50A 3RGTA 3CZ8A 3GB6A 4GISA 4BEQA 1ZBCA 1UC4A 2DP3A 1KXTA 2PDWA 1LORA 1JD7A 5D9NA 3BLKA 3BK0A 1ZBVA 2XG9A 2C19A 3FW6A 3A3XA 3B03A 5BNKA 3URAA 3B9OA 1D8WA 4PL2A 3EXTA 1HF6A 2DW6A 3SCQA 5C55A 1US0A 2XWDA 3ITGA 4B3KA 5AC7A 4XSMA 3VNZA 1C9DA 2NWSA 1JYVA 2PGWA 5G2WA 4DNMA 1AA1B 3SEPA 3MUZ1 4FOJA 1FWJC 2CPUA 3PP7A 3S6DA 5T9CE 3W7IA 3ABRA 2XWEA 1U1UA 4AIOA 3AHTA 4PMRA 3W7PA 2OMAA 4DPQA 4NU7A 5A69A 1QMLA 2TYSA 1ZLPA 3EDJA 1GJWA 2B4GA 1GJPA 4H6KA 5EB8A 2RUSA 1M7XA 1IEIA 1OFDA 4AWTA 3N17A 1H1ZA 1IT7A 5C71A 2OSXA 3ARVA 4IPPA 4DN1A 4XQ6A 1B3OA 4HPGA 4I5RA 4DYEA 2C1HA 1GVRA 2PDHA 1GT8A 3G1RA 3UR5A 1GVYA 2X42A 3EWUA 4WVXA 1RY8A 3WUGA 3O7UA 1GOWA 2PCEA 1W1PA 4MLJA 3M0KA 2XVLA 1X1OA 3CQJA 1GTEA 4IP5A 2OYKA 3C0QA 4FHAA 5I78A 5G1TA 2ZZ3A 5LHFA 3JUGA 4HMNA 3W24A 1SZNA 4HYVA 3BCJA 1A5BA 2YL5A 2QCNA 1DQUA 4X0NA 3P0WA 1RQHA 4J3SA 1JD9A 4KBXA 2A3HA 1KFCA 1KFBA 4GX8A 4MWAD 3GG8A 3OLGA 2WMFA 3M5YA 1V3JA 3WF4A 3JW7A 1TA3B 4O4WA 1O94A 3MMWA 1P43A 1Z44A 1Q85A 1VFHA 4S2CA 1OD8A 4KW2A 3KVLA 3VOCA 5LNRA 1VHNA 3SJNA 1ONXA 2ON3A 3W2LA 2ZX8A 1KM5A 2OZ0A 3ZOAA 3SI9A 3DFYA 1M68A 4JHOA 5HPOA 4YMZA 3B3DA 2QDDA 2FHFA 4L1GA 4ZQCA 1AUSL 4S3DA 1Z7AA 4KCUA 1GW9A 2RFGA 3P0XA 7CGTA 5RUBA