3IH2A

Tm1030 crystallized at 323k
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
b'HMLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title 'Hot' macromolecular crystals.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 70
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2009-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ih2A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ih2A02
4FISA 1LE8A 1TWFJ 1X2MA 1MH4A 1IUFA 5F04A 4RDUA 2NVYJ 4G12A 5EZHA 3G7RA 5BNGA 2N8GA 4I6ZA 5IP9J 4A3GJ 1IJWC 4FE4A 4A3KJ 1ZQ3P 1H8AC 1SANA 4A3FJ 1MBEA 3S14J 3IUVA 1BW5A 3FRQA 4QTRA 5FMPA 2X9DA 3CCYA 2FJ1A 1I6HJ 3HTJA 1DU6A 2L7ZA 2XPWA 2OI8A 4FCYA 3VUQA 2REKA 2L9RA 1D5YA 3BTLA 2QWTA 4L62A 3PM1A 3HGGA 2Y9YA 5IOZA 3JRIA 1JUSA 1JJ8C 2ID6A 1AU7A 4KWAA 3VW2A 5EEAA 3K2AA 3BTJA 3ZQFA 3MVPA 1FIPA 1HLVA 1VFCA 1EF4A 3DCFA 3JRCA 3B6AA 4M3DA 2XPVA 3BTIA 3RQIA 2B63J 3KKDA 2L0KA 3W6VA 5HSZA 1WH5A 4DYCA 4AF5A 1B72A 1ETXA 5DS9A 2YVHA 4X6AJ 2K9NA 4A3BJ 3GTGJ 2GUHA 3LOCA 5M3FJ 2MGQA 5E3NA 4UDSA 2FX0A 5D19A 1K83J 2O9LA 1TWCJ 2EQRA 4UUTA 4XRMA 5C4YA 2CUEA 5EDNA 2R0QC 2G0EA 4BXXJ 4NN1A 3HM5A 3IV5A 1SFOJ 5DAJA 2DA5A 2P81A 2H8RA 4JL3A 4Y7NJ 2M2EA 4UUSB 2DA1A 3T6NA 4J19A 2YUSA 2DG7A 1ORKA 2M34A 1BJZA 3FK7A 5M3MJ 2Y9ZA 3ON4A 5F0FA 2XB5A 1S7EA 4ABZA 2L7FP 3NI7A 2QF7A 1FIAA 1MBFA 5IP7J 3Q0VA 2IBDA 4BY7J 1DU0A 4GCTA 1PUFB 3LWJA 1U9OA 1ZGWA 1PUFA 3QKXA 2HDDA 3OIOA 3COLA 4MXMA 3HTIA 2Q24A 3HOXJ 3AQTA 3BR2A 3K7AJ 1QPIA 3G56A 5F27A 3RD3A 1TWGJ 1MBGA 1F36A 2G7SA 5K7ZA 1IRZA 1FEXA 1RKWA 4DZPA 4BY1J 2MW8A 1MSEC 3HE0A 2UXPA 4D5CA 3GZIA 4IHVA 2NS7A 3LSRA 2G7GA 2VI6A 1HCRA 4CYCA 9ANTA 2E2IJ 2AO9A 3QBMA 2R5ZA 3I4MJ 1MBKA 3OSGA 5DTDA 2ZOYA 1JGGA 3ON2A 4C3IJ 3BTCA 5FKLA 2ECBA 4JYKA 5EF6A 3LSJA 4D7NA 5H9TA 2LR8A 3JRAA 2OF7A 3LNQA 4IHXA 1JKPC 2PBXA 1MBHA 2VUMJ 1GUUA 2QOPA 2VKEA 2G3BA 1P7IA 5CW8A 5HBUA 2NVXJ 3DPJA 3B81A 1FJLA 2M8GX 2X48A 1RESA 1LFBA 3RKQA 3MN2A 5F0CA 4DW6A 1W0UA 3V6GA 1NTCA 5IYCJ 2E2HJ 2D6YA 3D1NI 3JSJA 3WHCA 3HIMA 1UHSA 2DA3A 3Q0WA 3BHQA 4B3AA 5EFYA 1IGNA 5GP9A 4A3JJ 1GV5A 4EEFG 3S17J 2WAQN 3BQYA 4AUXA 4A93J 1A6IA 3HGYA 3BNIA 1WPKA 4GCLA 3BR1A 4HKUA 2WGBA 3A01B 2L7MP 5FKKA 2RHAA 1LFUP 3S1QJ 2OERA 1HDPA 3F1BA 4JX5A 3Q3SA 3JRHA 4XRSG 2HOAA 5FKNA 1G2HA 1ETQA 1IG7A 2ZOZA 3G1OA 4M3GA 4QSHA 3NXCA 5C44J 1TWHJ 1IC8A 3V78A 1ENHA 2ECCA 3L1PA 1GDTA 2K9QA 4ME9A 1FTTA 2W48A 2VPRA 1H89C 1MSFC 4MO7A 2YS9A 2OPTA 2JA5J 3DEWA 2DJNA 3BR6A 1VNDA 2Y31A 3HOZJ 4BBSJ 4NDLA 3GEUA 1ETWA 2XB0X 1ETOA 2HXOA 5EZGA 3HOUJ 1T33A 5C3EJ 4V2FA 4XIDA 3TW6A 4XICA 1GV2A 1TC3C 4XK4A 5HAWA 1B8IB 5M5WJ 2AHQA 1BL0A 3S15J 1BA5A 1B8IA 3ZOBA 1TWAJ 2FBQA 4M6VA 3Q0UA 3MNLA 3ZQCA 2ME0A 5FKMA 2GENA 3ANPA 4YZEA 4X1EA 2EZHA 2EZKA 5J1RA 1AKHB 4RBOA 2EZIA 3IH2A 4M3BA 4ACIA 3BG9A 2E2JJ 4D7MA 4UUSA 2ZCMA 1I3QJ 2NP5A 1OFCX 4W1UA 1GVDA 4XRSA 1RKTA 1NK3P 5IYDJ 1UI6A 2R93J 5K58A 3C2BA 3H0GJ 5M5YJ 3HOYJ 2IEKA 4DZJA 1XC5A 3PASA 2E19A 4Y52J 3FIWA 4B4CA 4QIWN 2O8KA 3O60A 2PMZN 4JX6A 3VPRA 4LOCA 1O4XA 2UXOA 3EGQA 2LFBA 4C2MJ 3LJLA 3NAUA 4L5EA 1XS9A 2JK3A 5E3LA 2ID3A 4A3CJ 2YU9J 1JJ6C 3CRJA 5FJ8J 1R9TJ 1K61A 2JA8J 3NPIA 3GTQJ 2ELKA 3VVZA 3S5RA 1WGXA 2XRLA 3OSFA 2G7LA 2GFNA 1W0TA 3S2DJ 2CRGA 4IHYA 3BT9A 2EZLA 2ZCXA 2HYJA 1X58A 3HBLA 4V2GA 4BBRJ 3S1RJ 2QCOA 3UKGA 2XGDA 2WUIA 1Z0XA 3IH3A 2QKOA 1RETA 2CQQA 2NS8A 3LSGA 5GPCA 1JKOC 2R7ZJ 3I4NJ 5C4XJ 2XDNA 3BRUA 2ZB9A 3O8HA 2DN0A 5JLXA 3HEFA 1SGMA 5IPAA 3S1NJ 3CJDA 3VW1A 3PO2J 2XGEA 3CMYA 4PXIA 4DYRA 4MLOA 2H1KA 4FTHA 3VOXA 2DMPA 1QRYA 1A5JA 2DA2A 2NVTJ 2IU5A 3SDGA 3ZQLA 2YVEA 2LKXA 1ETYA 4MFDA 3TP0A 3JRDA 5E3OA 2DMNA 2WB1N 1RPWA 2WV1A 5J1UA 1ETVA 5GPAA 2JA6J 1H88C 2GM4A 5CXIA 1UI5A 1IDZA 3PPBA 2LY9A 3QPLA 5IOYA 3GBGA 2X6OA 3LSPA 1YRNB 1POGA 2XPUA 3B6CA 3BG3A 1YRNA 3KZ9A 4NELA 2JWTA 1U9NA 3TEDA 5C4JJ 2UXHA 1BW6A 2Y2ZA 4GFKA 3ANGA 3JR9A 4B1RA 4JNNA 3NRGA 4IEJA 3GTKJ 3C07A 1MH3A 2JJ7A 3WHBA 5D18A 2M0CA 4W97A 2JN6A 3F0CA 5EG0B 1JKQC 3SJMA 2R5YB 4M3EA 3VVXA 2GBYA 2R5YA 4ICHA 3BR3A 4C3HJ 3A01A 4AC6A 1Z77A 1UG2A 2V57A 4A3LJ 1JT0A 1XG1A 2RASA 3KKCA 4MK6A 2DMUA 2NP3A 4A3EJ 2LVSA 3A02A 4A3DJ 2HYTA 3BCGA 4AC0A 4S0HB 1IDYA 2CU7A 2GLOA 3LHQA 3VVYA 2HQ5A 5CXGA 1QVUA 2KT0A 2UXUA 4JP0A 3QPSA 3AQSA 1ZR2A 2RAEA 2FD5A 3HOVJ 3BJBA 1WI3A 4FE7A 1Y1VJ 3A03A 3IH4A 3GTLJ 2LLKA 3QQAA 3S16J 2CQXA 2DA6A 2O7TA 3CQZJ 2K40A 5M5XJ 2DMTA 3TW7A 4AYBN 3JREA 3P9TA 5FLMJ 3BR5A 2FQ4A 2MSYA 1ETKA 1ZR4A 1F43A 3HOWJ 3BR0A 1OJLA 3G1LA 3ZQIA 3E7QA 1AKHA 1ZTRA 2LP0A 1I50J 5EYRA 1OCTC 2KDZA 2DG8A 3EUPA 1JUMA 2LTPA 3E7LA 1B72B 2HOSA 2F07A 1QVTA 1ZKGA 5F0HA 4A3IJ 3FKIJ 3S2HJ 2VKVA 5JLWA 4JKZA 1JTXA 1P7JA 1E3OC 1IV6A 2IAIA 2TRTA 2DA7A 2Y30A 1U78A 2I10A 1Y1WJ 1WH7A 2PZ9A 3RZOJ 3KNWA 2ZCNA 5J1YA 5FLVA 3SFIA 3S1MJ 3VP5A 3HDDA 5FGLA 3NNRA 3ZQHA 5E3MA 3G1MA 1VF9A 3BG5A 1JUPA 2XSDC 4GFBA 5F1JA 5D1RA 1MNMC 4C3JJ 2QIBA 3VIBA 4MFEA 1VI0A 1U8BA 2XGCA 2Y0SN 1AHDP 1ZK8A 1GT0C 2D5VA 3RZDJ 1JT6A 3TP3A 3H3VK 1HDDC 2TCTA 1ITYA 3JRGA 1RR7A 3BQZA 3PO3J 2W53A 5FHPA 2EBIA 5FKOA 3GTJJ 4GFLA 3OOUA 3JRFA 2JMWA 1JTYA 2R92J 1HOMA 4M3FA 1FTZA 2UXIA 2K9SA 4HNVA 2M9HA 2HXIA 3O8GA 4DYQA 5EGOB 1HF0A 5K7FA 2CUFA 5EGOA 2JA7J 2DTZA 3CDLA 4BKXA 4D5FA 3NARA 2HI3A 4CYCB 1APLC 2O7OA 5IYBJ 2R5ZB 3CWRA 4GCKA 3ZQGA 3RH2A 4A69C 3JRBA 5IP6A 1NK2P 5K7HA 1UMQA 3HTAA 3VW0A 5AQCA 2E1OA 4JX4A 3M4OJ 2DA4A 4I76A 5HODA 3VOKA 2LK2A 2LD5A 1Q1VA 5F08A 1JKRC 2COBA 3GTOJ 2CJJA 3HB9A 2NVQJ 2MG4A 3FISA 4CGRA 1X2NA 5EG0A 3HTHA 1MBJA 2NOGA 1WCMJ 1OCPA 1T56A 3HKZN 3GTMJ 2DMQA 3FK6A 5J3LA 2EH3A 2HOTA 1CQTA 2NX4A 2QTQA 3MKLA 4MIMA 2ME6A 4IHWA 4A3MJ 1LE8B 3M3YJ 2HKUA 3GTPJ
chains in the Genus database with same CATH superfamily
4CCLA 5IT3A 1H0MA 3RKXA 3EYYA 3HUGB 4OAZA 4KIFA 5D8KB 3DU6A 5K1YA 2A6HF 5IP9J 2PX9A 3I53A 2QKLB 2A61A 4GXOA 2YR2A 2A69F 1DGRM 2JVHA 2E7XA 3ML6A 1H8AC 1N78A 1G3TA 1TW2A 4RGSA 3VYUB 2QSHX 4PZJA 5FMPA 2P5VA 4ZYAA 3DLLF 3CCYA 3HC7A 2FJ1A 2QLZA 5D5VB 1Y6IA 4HDVA 2KL4A 2L7ZA 1OYWA 1QZZA 4RGUA 1I5ZA 3MQ0A 4FCYA 3K8PC 3VEPA 2EA2A 2L9RA 3BTLA 4L62A 4YELA 2DK5A 1J2XA 2QUFA 2F5DA 2P6TA 3MVPA 4OIOF 1Y8QB 1XDSA 2OBPA 2ZJ2A 3KP7A 3LL7A 1R58A 1HKQA 5FD5A 1NH3A 2H27A 1EF4A 3H5RA 4M3DA 3RQIA 4UHTA 4N4OB 4HG2A 4DYCA 2CG4A 1ETXA 4HA8A 1J75A 2L3DA 1T2KA 2K9NA 4RB0A 1FOWA 3GTGJ 1Q1HA 2JRTA 4UDSA 4U7BA 1U5TC 1TWCJ 4UUTA 1D3YA 4N4NB 2P5KA 5EDNA 2Z99A 2HQAA 2G0EA 4PSWA 3W3CA 3IV5A 1B9MA 2DFEA 3CCQI 1IN7A 1V3FA 3CJRB 5E8IA 2M45A 1VTNC 4ZJZA 5GTIC 4I99C 4EGYA 4LB5A 3NRVA 2YUSA 5LHGA 1BJZA 5M3MJ 1R4MB 4FETA 3QOPA 2ZY9A 2XB5A 3SWHA 1ZG3A 4LIVA 3MWMA 4ABZA 1K4TA 3NI7A 1FIAA 2QA4I 1DU0A 1R1VA 2RQQA 5A2QZ 3H0DA 1J0RA 1U9OA 1QO0D 2OZ6A 3BCBA 3BZ6A 1ZGWA 1S7AA 2CFXA 1PUFA 3QKXA 2LY1A 3OIOA 3LMMA 2HDDA 4AIDA 4MHGA 1MIJA 5ICFA 1JHHA 2VBYA 3D0SA 1VQ9I 2LY2A 4LFUA 3RD3A 1MBGA 5BPDA 1X1AA 4BJ5C 2M0MA 5ILSA 1F36A 2KP6A 2G7SA 5K7ZA 2IJLA 2LG4A 3PQJA 4BY1J 5D5UB 2V9KA 2P8TA 3H35A 3KPHA 2UXPA 4D5CA 3D5LA 3BOQA 3CC2I 5LEKA 2IVMA 4ZZLA 1U5TB 4LK0F 3DTKA 4KICA 4C2TA 2E2IJ 1OCCH 4XLNF 2R5ZA 2ZSIB 2ZOYA 1BC8C 3FMQA 5IT9Z 2ZXIA 3BTCA 4BHBA 1O3RA 4RAYA 1R4NB 3O2PE 1XSVA 2VT3A 5H9TA 2LR8A 1ZELA 4U9NA 2IP2A 3ZXSA 2QBYB 1XCBA 1MBHA 2ZFUA 2X1EA 1IN4A 3R6SA 3WTSC 2DFIA 2FA5A 1P7IA 5CW8A 4WIBA 2P4WA 3B81A 2ZXHA 2M8GX 4I0BA 4MEXF 3BY6A 3LSIA 3RKQA 2IGKA 3MN2A 1T08B 3TMOA 1LB2A 2AXLA 3KYDB 3AG1H 4DBRA 2E2HJ 3PSFA 1XSXA 4BEHB 2EA4A 2Q8KA 2UXNA 1GV5A 1SC7A 2WB1A 3S17J 2WAQN 4IXAA 2LRDA 3BQYA 2R7TA 2FMLA 1YJWI 3HGYA 3TDUC 3BNIA 1WPKA 4BE0A 1MNEA 2WTEA 2BY0A 2RHAA 1LFUP 3K69A 4EM0B 3F1BA 4JX5A 3L2CA 3Q3SA 2ZOZA 4BE1A 2XKOA 1X1BA 2EIJH 3EYIA 3REOA 1JI8A 3PNVA 2ECCA 3VYTB 1IN8A 2EK5A 1FTTA 1ULYA 2XAQA 3KP3A 1TQPA 2K9LA 2YU3A 3HJEA 3Q9VA 4NQWB 4Y4RA 5EEGA 1AWCA 4OIQF 2DJNA 1TW3A 1VNDA 2Y31A 5DCMA 1QPMA 4NDLA 1ETOA 3KFWX 2XROA 5LGTA 3OYKA 4HQEA 3KYLA 3CCUI 1OYYA 3QP6A 2IS2A 3J7AO 1FLIA 2JUGA 2ZJQF 1B8IA 1SD6A 5HNFA 1HA8A 4U0WA 2F5CA 3ZR8X 2ICWG 4DNCA 4X1EA 4EJWA 5J1RA 3DTIA 1T0FC 1FC3A 3CESA 1KZHA 1K6OA 4P55A 3C2GA 4UUSA 3CC7I 2R7UA 2L01A 4XKBA 2NP5A 3F22A 5BS6A 1OMIA 1YJNI 3HOYJ 2H6BA 3CZ6A 3N05A 1MNDA 1STZA 2VBXA 4Y52J 4QPOA 2R7RA 2EPFA 3O60A 5GADJ 4BL0B 3SFZA 1Z67A 2L7KA 1YX5A 2PJRB 3NAUA 1XDUA 3VSLA 1O57A 4IJAA 3T8TA 1R9TJ 3E97A 1YLFA 4HF0A 1ZG5A 2JA8J 3S5RA 1WGXA 2G7LA 1T98A 4IHYA 1R1UA 3BPVA 3K4JA 2W85A 2HYJA 3HBLA 4V2GA 5DD8A 5E18F 4WWCA 3UKGA 2XGDA 2CV0A 2IPQX 3Q9SA 2VONA 2O3FA 3LSGA 5GPCA 2GWRA 5C4XJ 3KZYA 2MLKA 2A5YB 3W2WA 2W4SA 2IA1A 1P4WA 2K02A 3JTHA 2XGEA 3CMYA 1TQIA 3CF2A 2EIMH 4Q48A 4ZC3A 2G7UA 5J4YA 4FTHA 2GXAA 1QRYA 3ZPLA 2DA2A 1A5JA 2LDUA 2YVEA 1MW7A 4E7LA 3JRDA 2HWVA 3HOTA 2EFQA 4LIUA 4RLQA 2DMNA 1SFXA 2WV1A 1YG2A 1LEBA 4BDYA 5GPAA 2JA6J 1OCZH 3CP2A 4YFXF 2LY9A 3QPLA 2BHYA 1G3SA 1MMAA 3OYLA 2CMPA 3OYGA 3PPBA 3S3OA 1POGA 2RKHA 1K79A 1I1GA 3QODA 3B6CA 2VJ5A 1HW2A 2UXHA 1BW6A 2IXSA 4JBAA 2ZJRF 3ANGA 1OQYA 3SQNA 3M9AA 4IEJA 2AQFA 4OMYA 2A5WA 2E35A 3WHBA 1IV8A 3F0CA 3OYEA 4BQQA 3DFGA 3SJMA 4BE2A 2PMHA 1X4OA 3K70C 2K86A 3GZ5A 4M3EA 2R5YB 3ECHA 2KKOA 2CV2A 3RPUD 4L0ZB 3BR3A 2UWMA 3HSRA 2JPCA 5JVTA 1VQPI 2VB6A 1K6YA 3E5XA 4B8XA 2HTJA 1I1SA 1Z77A 2EINH 1T6SA 3K4NA 2V57A 3V4GA 4A3LJ 1XG1A 2MC3A 4ESJA 3W6KB 2E1MC 3A02A 3DBHB 1CF7A 5LEJA 2GLOA 4X0GA 2CH0A 3WU0A 1QHGA 5TRDA 2GXGA 2UXUA 1R71A 3P9KA 4I01A 2DXIA 1VQ7I 3AQSA 2KRCA 1ZR2A 2RAEA 1U8RA 1ZLKA 1EV7A 3GMEA 5FFZA 1FSEA 2NS0A 5E8GA 3WTWC 3BJBA 1J5YA 3TQNA 2PJPA 3A03A 1EH6A 3R61A 2CW7A 3S16J 2CQXA 5AIPA 2DA6A 5CYVA 2K40A 2QQ9A 1FX7A 4R79A 1IN6A 4KA4A 3P9TA 3K2ZA 3DKXA 2JT1A 5FRMA 1WWXA 2DT7B 4G6QA 2P7CB 2LC2A 1OPCA 1UJ8A 4I0AA 3LWFA 4O5VA 1AKHA 1W7PA 3ASOH 4HV5A 2KDZA 3U9GA 2QKMB 3ZMTA 5F0HA 4ZDPA 1S8NA 2PI0A 4A3IJ 3NWSA 3S2HJ 2DYRH 2VKVA 4JKZA 1JTXA 1KGSA 1P7JA 3R4KA 4M73A 3QPTA 2IAIA 1R36A 2DA7A 2K4JA 3OL3A 2E1MB 1Y1WJ 4OIPF 1HBXG 3WGIA 2E1CA 3RZOJ 3KNWA 3OYMA 4M9ZA 1VQ8I 4YIFA 5FLVA 3SFIA 3FX3A 4BHPA 3DEUA 5FGLA 3VODA 4CXFA 4HX4A 5E3MA 1ZAOA 1YHQI 3BG5A 1IRGA 2KJCA 1JUPA 5J6XA 3WODF 3WG7H 1WSUA 4C3JJ 1YE9A 4GGGA 4TV7A 2QIBA 4CZZA 3VIBA 1VI0A 4ZDLA 1LJ9A 4A0YA 4BYYA 1MMDA 3OL4A 2CQKA 3JSOA 4YG2F 1S72I 2FNPA 4LG0A 5FD6A 3I0TA 2DT5A 3GTJJ 2JMWA 1IXSB 2UXIA 2J5PA 2HXIA 1WJEA 3OYAA 2F48A 2X85A 2CYYA 2FMYA 5EGOA 4OWRB 2JA7J 1XGMA 3N4MA 4BKXA 3PUFA 3F6VA 2M8EA 1P2FA 4U7DA 3GWZA 3NARA 4R8HA 2HI3A 1APLC 2E5NA 1NHAA 5IYBJ 4PCQA 2R5ZB 4BAYA 5F1RA 4OAYA 2BZTA 3CWRA 3T0YA 3ZQGA 2NNYA 3JRBA 5K7HA 3OYJA 1QQIA 4HAMA 5GAEJ 1HSTA 3U1DA 1TL8A 3OYBA 3OY9A 5JHFA 1LEAA 4CHUA 3HHGA 2DA4A 2LK2A 2X0LA 2FE3A 3FXJA 5F08A 2LD5A 1O3TA 1JKRC 3RSNA 2COBA 3GTOJ 1P4XA 2JUCA 2VQHA 3QPHA 1VQ4I 3FISA 3GYHX 1Y0UA 5CLSA 3L2UA 1YITI 1D0XA 3HTHA 1MBJA 2NOGA 1WCMJ 3GTMJ 4CCKA 2A2FX 2DMQA 5J3LA 2NX4A 1CQTA 4AM3A 2F4IA 1A35A 3DPUA 1LE8B 4IHXA 2HKUA 3VYRB 1RC9A 4P96A 1MH4A 3BJOA 2NVYJ 4L9VA 4G12A 3FBIB 1A04A 1HXDA 2TDXA 3F72A 5BNGA 2O5RA 3LQQA 2MD0A 1WVRA 3ZCOA 4UB8C 4BGDA 4FE4A 1IJWC 1ZQ3P 4BDZA 2CUJA 4I98B 3A0HC 5B5EC 1SANA 3HSEA 1X3WB 3EPZA 2CUZA 1W5SA 5DEQA 3IWZA 4G7HF 2XASA 3R0AA 3I3LA 2JZYA 5J8FA 3FF5A 1J09A 4Q47A 2LOOA 3VUQA 1P9QC 1UHWA 2AXTC 4PJ0C 1LQ1A 2QWTA 3HGGA 2Y9YA 5IOZA 1PDNC 2KJBA 3KLOA 2ID6A 1AU7A 3LSHA 2DQLA 2PFVA 5DCMB 3K2AA 1FIPA 3RKYA 3KP6A 1ZN2A 3PNYA 2NRAC 2IGMA 3OYFA 4GDFA 3CUOA 3LA7A 3B6AA 4I7HA 4RAFA 2W57A 3BWGA 2OZUA 3H9QA 2B63J 1I39A 4PJNA 1L3LA 3W6VA 2F2EA 3FXLA 1OR7A 2CFOA 2FBIA 4LLNA 4MQ9F 4HSTA 1UFMA 1FMVA 1W5CC 3DWLE 3J7YJ 2G9WA 1YW7A 4XRMA 2BEOA 1ON2A 2QQAA 3K4CA 3CCVI 3CMMA 2K3FA 4BXXJ 4RA2A 4QPQA 4NB5A 4Z2YA 3B73A 3ABTA 2FQ3A 1PYVA 2XAUA 2M2EA 4IOAF 3QYFA 4UUSB 1MKMA 4J19A 4GYGA 1D0YA 2DG7A 2W7NA 4XKCA 4XLHA 2IS4A 1SD7A 3ON4A 1S7EA 1ACIA 2MH2A 2QF7A 4J00A 5CKTA 3PUBA 2IBDA 2H1LA 3LSMA 2QGUA 4BY7J 4D1QA 3LWJA 3J80Z 2ZXWH 4MEYF 2GQQA 2KIMA 4BQAA 4JQFA 1FMWA 1TZLA 1MJ9A 3BDDA 2LSOA 4N0BA 4BUPA 1WJDA 3HPGA 4BHCA 2KIUA 3HOXJ 1QPIA 4V19K 5F27A 3S32A 1MJAA 2KPMA 3L2RA 2VXDA 1WJFA 2VE8A 1FP1D 2JQ7A 2O0YA 1FOYA 3OIQA 2BVLA 5IY5H 3GZIA 3I59A 5FB2A 1QU3A 2FRHA 2ZKZA 4IKFA 2XAGA 2G7GA 1HCRA 1WJBA 2B7EA 1Z6TA 2PMZA 3ABUA 4NBQA 2AO9A 3UR3C 4CYCA 1VQNI 9ANTA 3QBMA 3I4MJ 1QNTA 1JGGA 1TBXA 1W1WE 4C3IJ 4AIKA 3VSKA 1H9GA 2ECBA 4JYKA 3JCUC 4U87A 3LSJA 1T95A 3SZPA 3OYIA 3CCJI 1QBJA 2OTLI 4F7ZA 4RGXA 3LNQA 4LB6B 5HS9A 4E6KG 1GUUA 1MMSA 3S8PA 5L3GA 4IRGA 2G3BA 2FBKA 3ISPA 4AIJA 2MC4A 3HRSA 5HDNA 5AONA 4XLEA 2L9NA 1RNLA 1LFBA 3TGNA 4ENMA 5F0CA 4MTDA 2HU9A 1O3QA 3BPXA 1NTCA 5IYCJ 2V9VA 1OISA 2QWWA 2I8DA 2O03A 4NC7A 3V8LA 4IO9F 3HIMA 2DA3A 3Q0WA 1K7AA 3QAHA 1IGNA 1W5TA 2X51A 3DBRB 2M7BA 4IX7A 3HHHA 4QLCU 1PP8F 4CUGA 1EH8A 3RPUA 1WHUA 3EETA 5GTHC 2OQGA 3Q5FA 4EJVA 2OCEA 3BR1A 4EQQA 4HNUA 4M6YA 2OAZA 3C3WA 4CCOA 2LNBA 1Z05A 4E7SA 3DEEA 2ELJA 1OLTA 2CGPA 4BJTA 3JRHA 1G2HA 5FKNA 1YI2I 1ETQA 1SFKA 4A12A 4S05A 5DM7F 3G1OA 5J4VA 2CS3A 5HNHA 1K4SA 1ZREA 1U6GA 4CCMA 2BY1A 1IC8A 3AG2H 1WRJA 3PIOF 1CF7B 2MYSA 1AOYA 3FHNA 2A3SA 4BJ6C 3IAM2 1S5LC 3HPHA 1BOBA 2QQBA 3P5JA 1SFEA 4H4KC 2D1VA 1W36D 3BR6A 3HOZJ 4RB1A 4HZFA 2Y75A 5EZGA 1T33A 5LFAA 2WBMA 2JTVA 2PN6A 2VASA 5F64A 4XK4A 4YIRX 1YO5C 5HAWA 2KRHA 4PJLA 2AHQA 5JR3A 1TNTA 3ZOBA 3WTYC 1LUJB 2FBQA 4M6VA 3CC4I 3MNLA 2GIZA 1MMNA 4DOZA 2ME0A 3WTZA 1V55H 4YZEA 3ANPA 1BR4A 2DW4A 4L0YB 1AKHB 1YOVB 1W7PB 2RC4A 4U0VA 1YIJI 3WTTC 4RBOA 4KIGA 2LYCA 2ESHA 3IH2A 1IAWA 3J7ZI 3CDHA 1HC8A 5H20A 1YTYA 2E2JJ 1ZRCA 1IF1A 3PSIA 2ZCMA 1I3QJ 2KFDA 2M30A 3I58A 1GVDA 1XCVA 1RKTA 3OS0A 1XD7A 1UI6A 3KZZA 5M5YJ 2IEKA 2MBFA 1E3HA 3MFKA 1XC5A 3PASA 2BY3A 3CTAA 1SMYF 1Y0NA 3F8BA 2FEZA 2B0LA 2X6WA 4Y3OA 2PG4A 4IQ4A 1SAXA 4LOCA 2UXOA 4FX0A 2CQ7A 4C2MJ 1Y8RB 2X6YA 1XS9A 1D1BA 2UV1A 4O6JA 4WK8F 5D8LB 5FJ8J 2DFFA 3E3VA 5KAIC 2BV6A 2H09A 2WADA 1F9NA 4HX8A 3S2DJ 3M1CA 2CRGA 3OYDA 5D6FA 2DFHA 2EZLA 3H5NA 2ZCXA 3S1RJ 2MA3A 3W2AA 2VC0A 1NG6A 1FBSA 4LMYA 4ITVA 5LRRA 2VJJA 2R7ZJ 3HXLA 4IZZA 3FWEA 2LBFA 2Z3YA 4A5NA 1ZRDA 2R7OA 2X1CA 2Y0SA 1KONA 3BRUA 1KYZA 3ZMDA 2ZC2A 2XV4S 2A6EF 2X1DA 3PO2J 1N25A 4DYRA 4E7JA 2H1KA 3GCMA 1IW7F 1QHHD 2IU5A 3ZQLA 5JVGF 5K5OA 1ETYA 3KEOA 3MZHA 5GAGJ 5E3OA 4NHJA 2WB1N 1RPWA 5J1UA 3IL2A 5LHIA 5ERIA 2GA2A 1H88C 2DOFA 1TLHB 4I02A 1Z7UA 1E0EA 1ON1A 3GBGA 3LSPA 4CDGA 2RQPA 2XPUA 2EWNA 1YRNA 4BXFA 5C4JJ 4EJUA 4GFKA 2PQ8A 2Y69H 2KLOA 1VQ5I 3NRGA 4JNNA 3C07A 2DCEA 4FHTA 4KITB 4RAZA 2M0CA 2JN6A 1O7FA 4HV6A 3C7JA 4YFNF 1WI9A 3GO5A 1USSA 3VVXA 3ZMVA 2L54A 5KVRA 3TL4X 2E34A 4C3HJ 5IT9K 1OR7C 1FPQA 3V7RA 2ISYA 2M4KA 4AC6A 1BI3A 1UG2A 1Z91A 2VODA 2RASA 3KKCA 4U0YA 5ICCA 1R00A 3SZGA 4A3DJ 4P9FA 5D4SA 4ZDOA 2HYTA 3IKVA 2HR3A 1IDYA 2CU7A 2DT6A 3VVYA 5B1AH 3I5UA 5DM6F 2P5LC 3OYCA 4JP0A 2FUG2 2JPBA 1XX5A 2HGCA 1TP4A 2VN2A 3CUQA 1SEUA 2A07F 4HRIA 3HL2A 2DK8A 1OYIA 3G2BA 2Y48A 2ETHA 2RV8A 2OQRA 1Y56A 3QQAA 4KDPA 1XGOA 3CQZJ 2GIVA 1PVEA 3HRMA 5ICEA 5M5XJ 3TW7A 4GO1A 5KK1A 2R7WA 1SVOA 2FQ4A 2NVUB 1X1PA 1ETKA 1UG0A 2VQCA 4KT5C 3BCAA 1ZR4A 2XIGA 2UZKA 1F43A 3A1YA 3P9CA 3BR0A 2FU4A 4FQGA 2B9SA 5FRNA 3E7QA 3ZRGA 2IW5A 4UUVA 3TDZC 1I50J 5EYRA 3EUPA 2LTPA 3E7LA 2DU9A 2KZVA 1JHFA 5ILVA 1RR8C 3BC8A 1GXPA 1IZ1A 1G3YA 3FKIJ 5TGTA 5JLWA 2HYFA 3W2VA 1O3SA 1E3OC 4AD9A 3DLAA 1IV6A 1HW5A 2TRTA 2Y30A 2IGNA 3BZKA 4HDUA 1BI0A 2JSPA 1DDNA 2E1NA 2HKXA 4ZYEA 2M5WA 1JGSA 3L9FA 5E20A 3VP5A 2E71A 3HDDA 2L02A 3NNRA 3QWLA 4EMSA 3ZQHA 2XGXA 3I4PA 4M9SA 1GVJA 3ABMH 3I54A 2EV0A 3C1DA 2K4BA 2WAFA 3KP5A 1YFHA 2VQGA 1QGPA 2HVQA 1ZGAA 1ITYA 1RR7A 2A6TA 3PO3J 2LF7A 2Q0OA 2EBIA 4XBFA 1G3WA 5FKOA 4RM2A 3OOUA 1TT0A 3JRFA 2R92J 1JTYA 1HOMA 4M3FA 1FTZA 4C2MA 1VQMI 2M9HA 2LKPA 3AQTA 2J5OA 4DYQA 3J81Z 3H3UA 1HF0A 2M3AA 3BG6A 4M71A 3CLOA 2BBYA 3WG9A 4D5FA 2VOPA 3J7AY 4CYCB 3LA3A 2O7OA 2QVOA 3H92A 1LVKA 1FZPB 4EATA 4GCKA 3AAFA 1YIOA 2Q1ZB 3K9TA 3RH2A 1XGNA 5IP6A 4NC6A 4DVYP 1UMQA 1J59A 2O61A 1QZEA 3R60A 3FXUA 3HTAA 2A68F 2K5CA 1XB4A 2W24A 4C30A 1K78A 5L3FA 4BS9A 4XN3A 1YX3A 4E7KA 3P9IA 3DXJF 4UV8A 3M4OJ 2WAEA 4R1HA 1REPC 3A4CA 2Z16A 3HIFA 3L09A 4KN7X 5HODA 1Q1VA 5FLXZ 2W84A 1WJAA 2WC2A 2CJJA 3HB9A 1VQLI 3IP4B 1FOXA 2GAUA 4CA0A 2MG4A 3RCOA 4KNYA 5EG0A 3TKYA 1KQ9A 2HTSA 5DUIA 3H3ZA 2EH3A 4GRIA 3MKLA 3MKYB 2HOEA 4IHWA 1FSHA 3M3YJ 3OS2A 3GTPJ 3R0JA 1NG7A 1TWFJ 2QZ8A 4A5MA 4C2UA 3FKJA 4PFOA 3HUGA 5EZHA 2DAOA 4IRHA 5CVJA 3RJPA 5LBQA 3GFMA 3KEQA 5BMZA 4I6ZA 3ZGKA 2IGOA 1TTYA 2XRNA 2V6CA 3FZVA 2EJRA 2B3WA 2XDVA 4A3KJ 1FY7A 4PK4A 4UVBA 1MD0A 2UXXA 4A3FJ 1MBEA 3S14J 1J7KA 3VWBA 1BW5A 3OOPA 3OWTA 4QTRA 2X9DA 3HRTA 2HEOA 2STWA 4CICA 1I6HJ 2K85A 1P6RA 1XTAA 2HS5A 2ACJA 4DQ2A 1ZRFA 2NNNA 3GVAA 1D5YA 3M8FA 3WTXC 3M1EA 5K5QA 3JRIA 1WKMA 4PJMA 4KWAA 1VZ0A 2XF6A 1IXRC 4A0ZA 2ZBKA 5CVUA 4PGGA 4IHTA 1VFCA 3DCFA 3JRCA 3BJ6A 2XPVA 5EJCA 2L0KA 3H9JA 5HSZA 2VL8A 4HPQA 4WX9A 4AF5A 2KRFA 4XSXF 3K1MA 3HOSA 3K70D 4A3BJ 2NYXA 5D19A 1K83J 3F8MA 3WTUC 2Z33A 2HVRA 1I6XA 2EQRA 3QYEA 1MGTA 2CUEA 2R0QC 1G59A 3KX2A 3IKTA 2DLLA 3FMRA 3HM5A 1FOKA 3MEXA 1D8KA 4Y13A 4MTEA 3G71I 5DAJA 4M74A 1R5GA 3DU5A 4XLAA 1GLNA 3QU6A 4JOMA 2H8RA 4JL3A 1ZG1A 1R5ID 2DA1A 2GXBA 4BNCA 3EUHA 5D6EA 4ESBA 1ORKA 4MGRA 1R49A 2H8WA 1BIBA 2Y9ZA 3FXOA 4KJZA 3BLYA 3ZQQA 3H5AA 2OU2A 1MBFA 3Q0VA 3GZ6A 2KQRA 4GCTA 1PUFB 4XQFA 1Z9CA 4AVZA 2HYGD 1LVAA 4EJOA 3COLA 3HTIA 2MH9A 3BR2A 3G56A 4H0EA 4HOBA 1TWGJ 3V7CA 2HFHA 2BHZA 2FF4A 2DPUA 2DDAA 3CJNA 3BROA 2F6CA 2JA2A 4DZPA 2MW8A 1MSEC 2ISZA 4OD4A 2NS7A 5KHDA 4HNTA 3LSRA 1DPRA 3H9GA 2BGCA 2XUBA 3CP8A 1UAAA 3DPLC 3JAMZ 1RIOH 3M8JA 3SEQA 3KE2A 1R5HA 2W00A 3F3XA 1YW9A 2XC7A 5BOXA 5FKLA 2LBFB 3ASNH 3EUAA 1ZGJA 4G6TB 1Z6RA 4L18B 2FSWA 2OF7A 1JKPC 3DF8A 2Y0MA 4PSXA 2VQLA 2QOPA 5HBUA 5ILUA 2NVXJ 3AL0C 3DPJA 3F8FA 3F21A 3CMEI 3GX4X 3S3NA 1XMAA 3V42A 1W0UA 1JE8A 2VPLA 1ERDA 1ZLJA 3M8EA 2D6YA 3KP4A 2DTRA 2VXZA 4DBQA 2PBIA 2K7LA 3BHQA 4IVNA 4ZYDA 2L4AA 1Z3XA 2XF5A 2HPMA 5GP9A 5ICGA 2R7QA 2BVMA 3T8RA 2OC6A 4EEFG 5ED4A 3SYTA 2LH9A 4A93J 2R7SA 1A6IA 5FGMA 1SVMA 2WGBA 2HZTA 1X19A 3AKZA 2IS6A 5TJJA 3S1QJ 3ABKH 1HDPA 2WY8Q 3K4KA 3KETA 2YPRA 2XF7A 2XAHA 3TO7A 4U88A 2HOAA 4LJZF 4XRSG 3CO7C 2E5ZA 2IT0A 1IN5A 1U0JA 1IG7A 5GAHJ 1U3EM 3V7SA 3FXQA 4QSHA 3RDIA 3NXCA 1TWHJ 3FBNB 3V78A 4ENJA 1ENHA 3CJQB 2V6EA 3ERED 1GDTA 2K9QA 2ZCWA 4ME9A 2MFZA 2VPRA 1H89C 5CJ9A 4MO7A 2EIKH 2WY7Q 2OPTA 1KYWA 3L2WA 2JA5J 1MDMA 2RDPA 1F1ZA 3AL0B 3DEWA 4JK1X 3GEUA 1LFPA 2XB0X 3HOUJ 3KYCB 5C3EJ 4V2FA 4IRIA 1EA3A 4XICA 2JSCA 4F92B 4RB2C 4N9IA 4M9XA 2PFBA 4G7ZF 1B8IB 1BL0A 3K4MA 4RLFA 4O3MA 2I5UA 1TWAJ 3BJAA 3Q0UA 3CLQA 4HF1A 3FDYA 2GENA 2EZHA 2EZKA 1ONVA 1HW1A 1X3UA 2BYVE 3DP7A 2CW0F 3NQOA 2EZIA 1RRJA 2D45A 4ACIA 3BG9A 4D9JA 3MAJA 4AYBA 4YRVA 2OD5A 3HSFA 3HZJA 4D7MA 1YS6A 4FT8A 1LDKB 4EV0A 1NK3P 1FT9A 2R93J 3H0GJ 2EFNA 4NNJA 5DD4A 1USTA 3L2QA 4DZJA 1WQ2A 2E19A 4E7HA 2DPDA 1KQ0A 1U2WA 1FWZA 4UNOA 4B4CA 2O8KA 2JVGA 2LREA 2PMZN 5DCFA 5J47A 2LFBA 3GF2A 3GZNB 3RQ4A 3E5UA 4L5EA 5H2FC 5E3LA 3K6GA 2ID3A 4E7IA 1JJ6C 3CRJA 3TOAA 3ECOA 1K61A 3NPIA 1P92A 2ELKA 2Q2EA 2XRLA 1R1TA 1W0TA 2GFNA 2G7HA 4MQVA 1BN5A 1X58A 2V7FA 4B47A 2WUIA 3IH3A 3TO6A 3F8CA 1XPXA 2QKOA 2NS8A 2CQQA 1JKOC 1IUYA 2XDNA 3I4NJ 5CQGA 2ZB9A 3O8HA 5JLXA 2CSOA 1RUOA 2FBHA 3CJDA 3HG9A 4PXIA 3COAC 2R4GA 1B9NA 4OU0A 4A6DA 5BQTA 2DMPA 2QSFX 1A31A 2XKPA 2NVTJ 3EUKL 2EV5A 2LKXA 1SVLA 3LFKA 1HKSA 3F8NA 2OUMA 3J80K 3S3MA 3RYRA 3ERMA 2GM4A 5CXIA 2HNHA 3LSTA 1DQUA 1BM9A 4LD5A 1BC7C 4LITA 1K78B 2H6CA 5IOYA 2X6OA 1KU3A 4F52A 1LDDA 2OJED 3BG3A 1LKXA 4I2OA 3KZ9A 1W36C 1U9NA 4NELA 4KFCA 2Y2ZA 1WJ5A 3JR9A 3MCZA 1D5VA 3K1PA 2JJ7A 4UV9A 3RYPA 4W97A 5D18A 3T1BA 1JKQC 4AIHA 5EG0B 2Z2SB 3MD2A 2ELHA 2GBYA 1A6QA 2R5YA 4FX4A 1Z21A 3A01A 4UY8I 2ZMEA 3IRRA 3NS4A 1IXCA 1S7OA 2VBZA 4PJJA 3VDXA 5LGUA 1YJ9I 3U2RA 4MK6A 2NP3A 3PFYA 2LVSA 4A3EJ 4WXDA 2VKHA 2PEXA 4S0HB 3LAPA 4XORA 2KIQA 1VQOI 4B09A 2HQ5A 3RPQA 1TNSA 4XN0A 2W82A 4XONA 4OIRF 2MLGA 2F5EA 4S04A 3EUHC 2ZO4A 2FD5A 3WGHA 2C6YA 1ZH5A 3HOVJ 1LPQA 2R7XA 2EFPA 3LFUA 5JHUA 3GTLJ 2HQRA 1IRXA 2YX7A 1UHMA 3ESWB 5FLMJ 2RN7A 2MSYA 2KMUA 2XAFA 3G3ZA 3C18A 4CYDA 4Q4ZF 3G6EI 5L3BA 2ADUA 3G1LA 4CGZA 2QSGX 2Z9OA 2LKSA 4ENNA 4LG3A 3MKWB 1JUMA 2HOSA 4CZCA 1QVTA 1ZKGA 4IOCF 5E17F 1W7PD 3L7WA 4PUSA 4XOPA 4BU2A 4ETSA 2Z1DA 1N75A 2W25A 3FHZA 2UUZA 3QP5A 3TBIA 1FYKA 3E0JB 2QQ8A 5HDKA 1V54H 3L00A 1U78A 2I10A 1FBQA 4HBLA 1E2XA 2FNAA 2PZ9A 1X4PA 4K2EA 2ZCNA 1R7JA 3CF5F 1MJBA 4Y15A 5L3CA 2CV1A 2COMA 1P4AA 1VF9A 1FNNA 3IHUA 2XHKA 3D5SC 4XMYA 5E1ZB 5F1JA 1T38A 4KT6A 5HOOA 2EFWA 3CJTB 2JRMA 2XGCA 1EH7A 1TQMA 1X1DA 1ZK8A 2Y0SN 3CCRI 1AHDP 2D5VA 3RZDJ 2STTA 1VQ6I 3K1NA 3TP3A 1HDDC 2TCTA 3VYSB 4LG0B 3BQZA 2IRFG 2W53A 5FHPA 5FROA 3MZ8A 3E6DA 2VJ4A 5CQEA 4HEA2 4OMZA 4IHSA 2K9SA 3SEZA 2HDWA 5EGOB 5K7FA 2CUFA 2K27A 4M72A 2DTZA 3ZQ7A 3CDLA 4EM1A 3E1SA 2MD5A 3QOEA 3WGGA 4BQOA 5A2QK 5H6QA 5E1WA 4AVPA 3MMYB 2V1DA 4A69C 4ZH4F 2BW3A 2V1NA 4RM3A 5AQCA 4AWXB 1BR2A 4JX4A 3DV8A 4Y17A 3VOKA 1FYLA 1DPUA 1S29A 2NVQJ 4E7ZA 4ENKA 1F5TA 1IRFA 1OCPA 2PMUA 1T56A 3HKZN 4HYEA 4HLYA 3GXOA 3ROUA 3U1KA 3CCEI 1X1CA 4MIMA 2M1BA 4A3MJ 5DYMA 1SD4A 4FISA 1E3PA 5DV5A 1LE8A 1X2MA 1IUFA 1I3AA 2DI3A 4L9TA 4KN4X 5F04A 4RDUA 4M6XA 2QM3A 3G7RA 2N8GA 4ZYHA 5KNLA 4A3GJ 1IO2A 3HKZA 3ZMSA 3WU1B 1TT5B 3ABLH 2EV6A 4WF2A 3DKWA 2DBBA 3DBLB 3PQKA 3IUVA 2EB7A 3FRQA 4II3A 2RNJA 2O8XA 3HTJA 1DU6A 3I9V2 2XPWA 2HKOA 3V8KA 2WAQA 4IQJA 2OI8A 2VLAA 4OINF 3GFIA 2REKA 3PM1A 5FFXA 3CD6I 1JUSA 1JJ8C 1V4RA 1MDMB 4PGHA 3VW2A 5EEAA 4IRVA 3VFZA 3JSPA 3BTJA 3ZQFA 3OYNA 1HLVA 4HW0A 3I56I 2OA4A 3BTIA 4YFKF 4E4HA 2VKDA 3KKDA 5LD2C 2VE9A 2K3PA 1WH5A 3NWTA 4RAGA 1B72A 3GFJA 5FO5A 5DS9A 1Z1DA 2YVHA 2KHMA 2L5QA 5AIQA 4X6AJ 2GUHA 1R6RA 3LOCA 5M3FJ 2MGQA 5E3NA 2P6SA 2FX0A 2CO5A 2ZSHB 2V1XA 2O9LA 4CCJA 1D1AA 4UVAA 4BXUA 4LGWA 5C4YA 1BBYA 1SD5A 2HPIA 2QEXI 4NN1A 2VC1A 2K9MA 1SFOJ 5D4RA 2DDBA 4EVIA 2DA5A 2P81A 4G94A 4Y7NJ 1ZARA 2KISA 1WJCA 2DOEA 1DP7P 3T6NA 1S9HA 2V9PA 4RGRA 1BI1A 2M34A 3FK7A 3IUOA 3IRQA 5F0FA 2H94A 2YX4A 4DGWB 3PIPF 1SFUA 2L7FP 4G8XA 4UB6C 1E17A 5IP7J 3PFIA 5HLIA 4XL9A 1RI7A 3RKWA 3CMAI 2DOAA 2XSJC 4MXMA 2Q24A 3K7AJ 2RREA 3O6BB 4B3XA 1Z7LA 2OTJI 2Z5UA 2KZGA 1IRZA 1FEXA 2FJI1 1RKWA 3HE0A 1OCRH 3I59B 4G9YA 4IF4A 4II2A 1BR1A 2Q2EB 4IHVA 3E5QA 4L5IA 2ESNA 2VI6A 3VOXA 1V5EA 4KUMA 2HDCA 1MBKA 4ESFA 3OSGA 2ZMEC 5DTDA 3ON2A 2R7DA 4AU7A 1XGSA 2R7VA 1UB9A 5LHHA 2CWEA 5EF6A 4XR6A 4D7NA 1L0OC 1MZBA 4XKVA 3JRAA 1YYVA 1R22A 3FXKA 3LAJA 2PBXA 1KU7A 4XKWA 2MABA 2F4OB 2VUMJ 4Q5SF 2LF8A 2VKEA 2EFOA 3JTGA 3CCMI 1FJLA 2X48A 5J40A 4XLFA 2NOJB 3HYIA 4LLLA 1RESA 2RGVA 4LLGF 5KCMA 4DW6A 4F55A 2BY2A 1B1BA 2ZFWA 4HF2A 3MKZA 3V6GA 2R3SA 2DQRA 1D1CA 3D1NI 3JSJA 3WHCA 1WFXA 3I64A 1UHSA 5JI6A 3J81K 4B3AA 2WWYA 2IA2A 5EFYA 5F6FA 4YEJA 3OS1A 4A3JJ 2E60A 3N97A 4G6DA 2DJIA 4N9HA 3BG7A 3IC7A 3W6JB 4AUXA 1RUNA 1T39A 3V8JA 3AFHA 4GCLA 5HS8A 1PP7U 4HKUA 1XMKA 3A01B 2BXYA 1I27A 2ZMEB 3K4LA 2L7MP 2RVCA 2L9VA 5FKKA 1W4MA 2OERA 4BACA 3DKYA 3SXYA 1AA7A 5D5WB 1VQKI 5HVQC 3M7GA 2M4GA 4M3GA 2V1UA 2DYSH 3CDIA 4XNFA 5C44J 3EQLF 4RS8A 3L1PA 3OR2C 2W48A 4EJTA 3QU3A 2E7WA 2YSRA 4RMNA 3S2WA 2YS9A 1MSFC 1GXQA 5FLXK 2F4MB 3G4SI 2OV7A 4BBSJ 2VOOA 1ETWA 2HXOA 2GOMA 2AS5F 4P1WA 1A36A 4XIDA 1S6LA 3ULQB 3TW6A 3DQVC 1SMTA 1GV2A 2GA1A 1TC3C 1WZ2A 2BE5F 3BP8A 5TISC 5M5WJ 2DODA 3S15J 1BA5A 4XRFA 1KQ8A 2B1EA 4UXNA 1UCRA 4NUBA 2LMDA 3ZQCA 1DP3A 5FKMA 5HDGA 4L9NA 3F6OA 3WE2A 4OOIA 1G8XA 4EGZA 4J01A 4M3BA 2QYOA 2HQNA 3K10A 3SDBA 5EEHA 1OFCX 2XVCA 4W1UA 4XRSA 2VBWA 3KIOA 5HLHA 3LA2A 4PFPA 5IYDJ 2NXNB 3AG3H 4DJAA 3C2BA 1XSDA 5K58A 2BXZA 3PL8A 1PUEE 3H1CA 3OR1C 3P7NA 4IPAA 2VJIA 3FIWA 4QIWN 5BPIA 3WE3A 4B43A 3F23A 3RIRA 1B6AA 4JX6A 3VPRA 1O4XA 2P0WA 4HLXA 3KCCA 4LK1F 3EGQA 3BZCA 2ZJPF 1EKEA 1ODDA 2F5FA 2V4JC 3K4BA 4L5JA 2JK3A 3ZN1A 3LJLA 4A3CJ 2YU9J 3CO6C 3GUDA 5CVRA 2L9SA 4KMFA 5HLTA 3GTQJ 3VVZA 2R7FA 3OSFA 2W1OA 1O7LA 1U5TA 3BT9A 5LLQA 4BBRJ 4KISA 1SAUA 1T8IA 4NC8A 2QCOA 1Z0XA 3ELKA 4ZTJA 1RETA 4ANJA 1LDJA 2CW8A 2D1HA 4ZTFA 1QA6A 4GYIA 2V79A 1FP2A 2DN0A 3MZYA 2P7VB 3HEFA 3M07A 1SGMA 3GLLA 3NEUA 3ZN0A 1QZYA 2HZDA 3LSKA 5IPAA 3S1NJ 3VW1A 3F9KA 4A0XA 1S3JA 4MLOA 2QBYA 3SDGA 3OV8A 4UVCA 4CCNA 4MFDA 3TP0A 4B44A 3OMYA 3ZMUA 1Y39A 3K0LA 1N77A 3CUQC 4RB3C 1ETVA 1FBUA 1OCOH 2BW3B 3GLXA 1UI5A 1IDZA 3VB2A 3A2KA 1YRNB 1KU9A 2IS1A 1KA8A 4F3QA 3HTUA 2JWTA 1BJAA 3TEDA 3JW4A 4F91B 4B1RA 3D5RC 3I71A 1BOAA 4BEHA 2EILH 3GTKJ 1DGWY 5B3SH 1MH3A 1LNWA 5DDGA 5LGNA 4P9UA 4I09A 2ZXJA 2WV0A 4KMUX 1ZHFA 3JAMK 1G4DA 2F5VA 2NAZA 4ICHA 5JFRA 1C0WA 1J9IA 3QRFF 1M1EB 4D0PA 3DTEA 5B1BH 3X2QH 1JT0A 2DMUA 2A05A 3FXRA 4P5OA 3E6MA 5H6RA 3BCGA 4AC0A 3ZMZA 1B4AA 1PJRA 3OIPA 2FOWA 4GCVA 3LHQA 5E79C 1YQAA 5CXGA 4FASD 1YS7A 1QVUA 2VIXA 2KT0A 3ZP5A 4XOTA 3QPSA 4XLCA 5L3DA 4NQWA 3FM3A 3CUQB 3SHFA 5K5RA 4CO8A 3FM5A 1H9TA 5HLGA 3C2HA 3VTIA 4XSZF 1HSJA 1WI3A 4HX7A 1Y1VJ 4FE7A 3PNTA 3IH4A 1KU2A 4PDKA 2LLKA 4WCGA 2YVXA 4C9YA 3SZTA 2O7TA 2CQNA 2DMTA 4AYBN 3JREA 3BR5A 1V5FA 4ZZDA 1FYMA 1R23A 3HOWJ 5B66C 1OJLA 3ZQIA 1B59A 4G7OF 4QWQA 3DPTA 4IL6C 2M87A 1ZTRA 2LP0A 4B48A 4OD5A 3HRUA 1OCTC 2DG8A 2AQEA 1DUXC 1B72B 2F07A 2XAJA 1MMGA 2FOKA 4BH9A 3U21A 1Z3YA 3KP2A 1GHCA 1X3ZB 3RI4A 3FMSA 4WXCA 4CH7A 3LQRA 1V5GA 1BIAA 3H36A 3E6CC 5DUKA 1WH7A 3S93A 3KLNA 3B02A 2DO7A 4KIBA 5L3EA 5J1YA 5J8CA 3S1MJ 3QYBA 2KIFA 1HKTA 4Z6YA 2L4MA 1XN7A 4L9JA 3G1MA 3CCSI 5CPRB 3AG4H 4XLPF 1CGPA 2XSDC 2QENA 3VOEA 4GFBA 5D1RA 3OYHA 1MNMC 2RNGA 2IA0A 4WXHA 5CVIA 3GFLA 2PJRA 3GEZA 1YW8A 4MFEA 2D2WA 1U8BA 3PJRA 2GZWA 1GT0C 1BI2A 3TO9A 1JT6A 3H3VK 4XM3A 3KEYA 4ZYGA 3JRGA 3WU2C 2M7AA 4MNUA 2VT2A 3RTRA 3T5XA 4GFLA 3HTSB 4CSWA 5CVVA 4BQNA 4HNVA 1T0FA 3IWFA 3O8GA 2HVSA 4HQMA 2GOXB 4KYWA 2E36A 3GW2A 1G6NA 2WA0A 2PLYA 3ONQA 3E6BA 4ON0A 2FXAA 6PAXA 3O3KA 4A6EA 4Y33A 4ASNA 4E70A 1RZ4A 2OCCH 4EM2A 3I55I 1D8JA 3TOBA 4U9LA 1EJ9A 3CCLI 2L2OA 3IAS2 3KZIC 5HS7A 1ZYRF 1NK2P 1OKRA 4YIIA 3G73A 3UNGC 3WTVC 4HSRA 3VW0A 5LRSA 3FXMA 3L2VA 2E1OA 1HQCA 2ZNYA 1UELB 1JXSA 4F93B 4DIQA 3EDPA 4I76A 1UZCA 2X6XA 2KDOA 2ZNZA 5E1XA 5D5XB 2BOLA 5KAFC 1XMXA 2V26A 2X4HA 4CGRA 1X2NA 1D0ZA 2O6GE 3FK6A 2QTQA 2HOTA 1F4KA 2ME6A 3A0BC 4A2UA
chains in the Genus database with same CATH topology
4FISA 1LE8A 1TWFJ 1X2MA 1MH4A 1IUFA 5F04A 4RDUA 2NVYJ 4G12A 5EZHA 3G7RA 5BNGA 2N8GA 4I6ZA 5IP9J 4A3GJ 1IJWC 4FE4A 4A3KJ 1ZQ3P 1H8AC 1SANA 4A3FJ 1MBEA 3S14J 3IUVA 1BW5A 3FRQA 4QTRA 5FMPA 2X9DA 3CCYA 2FJ1A 1I6HJ 3HTJA 1DU6A 2L7ZA 2XPWA 2OI8A 4FCYA 3VUQA 2REKA 2L9RA 1D5YA 3BTLA 2QWTA 4L62A 3PM1A 3HGGA 2Y9YA 5IOZA 3JRIA 1JUSA 1JJ8C 2ID6A 1AU7A 4KWAA 3VW2A 5EEAA 3K2AA 3BTJA 3ZQFA 3MVPA 1FIPA 1HLVA 1VFCA 1EF4A 3DCFA 3JRCA 3B6AA 4M3DA 2XPVA 3BTIA 3RQIA 2B63J 3KKDA 2L0KA 3W6VA 5HSZA 1WH5A 4DYCA 4AF5A 1B72A 1ETXA 5DS9A 2YVHA 4X6AJ 2K9NA 4A3BJ 3GTGJ 2GUHA 3LOCA 5M3FJ 2MGQA 5E3NA 4UDSA 2FX0A 5D19A 1K83J 2O9LA 1TWCJ 2EQRA 4UUTA 4XRMA 5C4YA 2CUEA 5EDNA 2R0QC 2G0EA 4BXXJ 4NN1A 3HM5A 3IV5A 1SFOJ 5DAJA 2DA5A 2P81A 2H8RA 4JL3A 4Y7NJ 2M2EA 4UUSB 2DA1A 3T6NA 4J19A 2YUSA 2DG7A 1ORKA 2M34A 1BJZA 3FK7A 5M3MJ 2Y9ZA 3ON4A 5F0FA 2XB5A 1S7EA 4ABZA 2L7FP 3NI7A 2QF7A 1FIAA 1MBFA 5IP7J 3Q0VA 2IBDA 4BY7J 1DU0A 4GCTA 1PUFB 3LWJA 1U9OA 1ZGWA 1PUFA 3QKXA 2HDDA 3OIOA 3COLA 4MXMA 3HTIA 2Q24A 3HOXJ 3AQTA 3BR2A 3K7AJ 1QPIA 3G56A 5F27A 3RD3A 1TWGJ 1MBGA 1F36A 2G7SA 5K7ZA 1IRZA 1FEXA 1RKWA 4DZPA 4BY1J 2MW8A 1MSEC 3HE0A 2UXPA 4D5CA 3GZIA 4IHVA 2NS7A 3LSRA 2G7GA 2VI6A 1HCRA 4CYCA 9ANTA 2E2IJ 2AO9A 3QBMA 2R5ZA 3I4MJ 1MBKA 3OSGA 5DTDA 2ZOYA 1JGGA 3ON2A 4C3IJ 3BTCA 5FKLA 2ECBA 4JYKA 5EF6A 3LSJA 4D7NA 5H9TA 2LR8A 3JRAA 2OF7A 3LNQA 4IHXA 1JKPC 2PBXA 1MBHA 2VUMJ 1GUUA 2QOPA 2VKEA 2G3BA 1P7IA 5CW8A 5HBUA 2NVXJ 3DPJA 3B81A 1FJLA 2M8GX 2X48A 1RESA 1LFBA 3RKQA 3MN2A 5F0CA 4DW6A 1W0UA 3V6GA 1NTCA 5IYCJ 2E2HJ 2D6YA 3D1NI 3JSJA 3WHCA 3HIMA 1UHSA 2DA3A 3Q0WA 3BHQA 4B3AA 5EFYA 1IGNA 5GP9A 4A3JJ 1GV5A 4EEFG 3S17J 2WAQN 3BQYA 4AUXA 4A93J 1A6IA 3HGYA 3BNIA 1WPKA 4GCLA 3BR1A 4HKUA 2WGBA 3A01B 2L7MP 5FKKA 2RHAA 1LFUP 3S1QJ 2OERA 1HDPA 3F1BA 4JX5A 3Q3SA 3JRHA 4XRSG 2HOAA 5FKNA 1G2HA 1ETQA 1IG7A 2ZOZA 3G1OA 4M3GA 4QSHA 3NXCA 5C44J 1TWHJ 1IC8A 3V78A 1ENHA 2ECCA 3L1PA 1GDTA 2K9QA 4ME9A 1FTTA 2W48A 2VPRA 1H89C 1MSFC 4MO7A 2YS9A 2OPTA 2JA5J 3DEWA 2DJNA 3BR6A 1VNDA 2Y31A 3HOZJ 4BBSJ 4NDLA 3GEUA 1ETWA 2XB0X 1ETOA 2HXOA 5EZGA 3HOUJ 1T33A 5C3EJ 4V2FA 4XIDA 3TW6A 4XICA 1GV2A 1TC3C 4XK4A 5HAWA 1B8IB 5M5WJ 2AHQA 1BL0A 3S15J 1BA5A 1B8IA 3ZOBA 1TWAJ 2FBQA 4M6VA 3Q0UA 3MNLA 3ZQCA 2ME0A 5FKMA 2GENA 3ANPA 4YZEA 4X1EA 2EZHA 2EZKA 5J1RA 1AKHB 4RBOA 2EZIA 3IH2A 4M3BA 4ACIA 3BG9A 2E2JJ 4D7MA 4UUSA 2ZCMA 1I3QJ 2NP5A 1OFCX 4W1UA 1GVDA 4XRSA 1RKTA 1NK3P 5IYDJ 1UI6A 2R93J 5K58A 3C2BA 3H0GJ 5M5YJ 3HOYJ 2IEKA 4DZJA 1XC5A 3PASA 2E19A 4Y52J 3FIWA 4B4CA 4QIWN 2O8KA 3O60A 2PMZN 4JX6A 3VPRA 4LOCA 1O4XA 2UXOA 3EGQA 2LFBA 4C2MJ 3LJLA 3NAUA 4L5EA 1XS9A 2JK3A 5E3LA 2ID3A 4A3CJ 2YU9J 1JJ6C 3CRJA 5FJ8J 1R9TJ 1K61A 2JA8J 3NPIA 3GTQJ 2ELKA 3VVZA 3S5RA 1WGXA 2XRLA 3OSFA 2G7LA 2GFNA 1W0TA 3S2DJ 2CRGA 4IHYA 3BT9A 2EZLA 2ZCXA 2HYJA 1X58A 3HBLA 4V2GA 4BBRJ 3S1RJ 2QCOA 3UKGA 2XGDA 2WUIA 1Z0XA 3IH3A 2QKOA 1RETA 2CQQA 2NS8A 3LSGA 5GPCA 1JKOC 2R7ZJ 3I4NJ 5C4XJ 2XDNA 3BRUA 2ZB9A 3O8HA 2DN0A 5JLXA 3HEFA 1SGMA 5IPAA 3S1NJ 3CJDA 3VW1A 3PO2J 2XGEA 3CMYA 4PXIA 4DYRA 4MLOA 2H1KA 4FTHA 3VOXA 2DMPA 1QRYA 1A5JA 2DA2A 2NVTJ 2IU5A 3SDGA 3ZQLA 2YVEA 2LKXA 1ETYA 4MFDA 3TP0A 3JRDA 5E3OA 2DMNA 2WB1N 1RPWA 2WV1A 5J1UA 1ETVA 5GPAA 2JA6J 1H88C 2GM4A 5CXIA 1UI5A 1IDZA 3PPBA 2LY9A 3QPLA 5IOYA 3GBGA 2X6OA 3LSPA 1YRNB 1POGA 2XPUA 3B6CA 3BG3A 1YRNA 3KZ9A 4NELA 2JWTA 1U9NA 3TEDA 5C4JJ 2UXHA 1BW6A 2Y2ZA 4GFKA 3ANGA 3JR9A 4B1RA 4JNNA 3NRGA 4IEJA 3GTKJ 3C07A 1MH3A 2JJ7A 3WHBA 5D18A 2M0CA 4W97A 2JN6A 3F0CA 5EG0B 1JKQC 3SJMA 2R5YB 4M3EA 3VVXA 2GBYA 2R5YA 4ICHA 3BR3A 4C3HJ 3A01A 4AC6A 1Z77A 1UG2A 2V57A 4A3LJ 1JT0A 1XG1A 2RASA 3KKCA 4MK6A 2DMUA 2NP3A 4A3EJ 2LVSA 3A02A 4A3DJ 2HYTA 3BCGA 4AC0A 4S0HB 1IDYA 2CU7A 2GLOA 3LHQA 3VVYA 2HQ5A 5CXGA 1QVUA 2KT0A 2UXUA 4JP0A 3QPSA 3AQSA 1ZR2A 2RAEA 2FD5A 3HOVJ 3BJBA 1WI3A 4FE7A 1Y1VJ 3A03A 3IH4A 3GTLJ 2LLKA 3QQAA 3S16J 2CQXA 2DA6A 2O7TA 3CQZJ 2K40A 5M5XJ 2DMTA 3TW7A 4AYBN 3JREA 3P9TA 5FLMJ 3BR5A 2FQ4A 2MSYA 1ETKA 1ZR4A 1F43A 3HOWJ 3BR0A 1OJLA 3G1LA 3ZQIA 3E7QA 1AKHA 1ZTRA 2LP0A 1I50J 5EYRA 1OCTC 2KDZA 2DG8A 3EUPA 1JUMA 2LTPA 3E7LA 1B72B 2HOSA 2F07A 1QVTA 1ZKGA 5F0HA 4A3IJ 3FKIJ 3S2HJ 2VKVA 5JLWA 4JKZA 1JTXA 1P7JA 1E3OC 1IV6A 2IAIA 2TRTA 2DA7A 2Y30A 1U78A 2I10A 1Y1WJ 1WH7A 2PZ9A 3RZOJ 3KNWA 2ZCNA 5J1YA 5FLVA 3SFIA 3S1MJ 3VP5A 3HDDA 5FGLA 3NNRA 3ZQHA 5E3MA 3G1MA 1VF9A 3BG5A 1JUPA 2XSDC 4GFBA 5F1JA 5D1RA 1MNMC 4C3JJ 2QIBA 3VIBA 4MFEA 1VI0A 1U8BA 2XGCA 2Y0SN 1AHDP 1ZK8A 1GT0C 2D5VA 3RZDJ 1JT6A 3TP3A 3H3VK 1HDDC 2TCTA 1ITYA 3JRGA 1RR7A 3BQZA 3PO3J 2W53A 5FHPA 2EBIA 5FKOA 3GTJJ 4GFLA 3OOUA 3JRFA 2JMWA 1JTYA 2R92J 1HOMA 4M3FA 1FTZA 2UXIA 2K9SA 4HNVA 2M9HA 2HXIA 3O8GA 4DYQA 5EGOB 1HF0A 5K7FA 2CUFA 5EGOA 2JA7J 2DTZA 3CDLA 4BKXA 4D5FA 3NARA 2HI3A 4CYCB 1APLC 2O7OA 5IYBJ 2R5ZB 3CWRA 4GCKA 3ZQGA 3RH2A 4A69C 3JRBA 5IP6A 1NK2P 5K7HA 1UMQA 3HTAA 3VW0A 5AQCA 2E1OA 4JX4A 3M4OJ 2DA4A 4I76A 5HODA 3VOKA 2LK2A 2LD5A 1Q1VA 5F08A 1JKRC 2COBA 3GTOJ 2CJJA 3HB9A 2NVQJ 2MG4A 3FISA 4CGRA 1X2NA 5EG0A 3HTHA 1MBJA 2NOGA 1WCMJ 1OCPA 1T56A 3HKZN 3GTMJ 2DMQA 3FK6A 5J3LA 2EH3A 2HOTA 1CQTA 2NX4A 2QTQA 3MKLA 4MIMA 2ME6A 4IHWA 4A3MJ 1LE8B 3M3YJ 2HKUA 3GTPJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIS A;  1LE8 A;  1TWF J;  1X2M A;  1MH4 A;  1IUF A;  5F04 A;  4RDU A;  2NVY J;  4G12 A;  5EZH A;  3G7R A;  5BNG A;  2N8G A;  4I6Z A;  5IP9 J;  4A3G J;  1IJW C;  4FE4 A;  4A3K J;  1ZQ3 P;  1H8A C;  1SAN A;  4A3F J;  1MBE A;  3S14 J;  3IUV A;  1BW5 A;  3FRQ A;  4QTR A;  5FMP A;  2X9D A;  3CCY A;  2FJ1 A;  1I6H J;  3HTJ A;  1DU6 A;  2L7Z A;  2XPW A;  2OI8 A;  4FCY A;  3VUQ A;  2REK A;  2L9R A;  1D5Y A;  3BTL A;  2QWT A;  4L62 A;  3PM1 A;  3HGG A;  2Y9Y A;  5IOZ A;  3JRI A;  1JUS A;  1JJ8 C;  2ID6 A;  1AU7 A;  4KWA A;  3VW2 A;  5EEA A;  3K2A A;  3BTJ A;  3ZQF A;  3MVP A;  1FIP A;  1HLV A;  1VFC A;  1EF4 A;  3DCF A;  3JRC A;  3B6A A;  4M3D A;  2XPV A;  3BTI A;  3RQI A;  2B63 J;  3KKD A;  2L0K A;  3W6V A;  5HSZ A;  1WH5 A;  4DYC A;  4AF5 A;  1B72 A;  1ETX A;  5DS9 A;  2YVH A;  4X6A J;  2K9N A;  4A3B J;  3GTG J;  2GUH A;  3LOC A;  5M3F J;  2MGQ A;  5E3N A;  4UDS A;  2FX0 A;  5D19 A;  1K83 J;  2O9L A;  1TWC J;  2EQR A;  4UUT A;  4XRM A;  5C4Y A;  2CUE A;  5EDN A;  2R0Q C;  2G0E A;  4BXX J;  4NN1 A;  3HM5 A;  3IV5 A;  1SFO J;  5DAJ A;  2DA5 A;  2P81 A;  2H8R A;  4JL3 A;  4Y7N J;  2M2E A;  4UUS B;  2DA1 A;  3T6N A;  4J19 A;  2YUS A;  2DG7 A;  1ORK A;  2M34 A;  1BJZ A;  3FK7 A;  5M3M J;  2Y9Z A;  3ON4 A;  5F0F A;  2XB5 A;  1S7E A;  4ABZ A;  2L7F P;  3NI7 A;  2QF7 A;  1FIA A;  1MBF A;  5IP7 J;  3Q0V A;  2IBD A;  4BY7 J;  1DU0 A;  4GCT A;  1PUF B;  3LWJ A;  1U9O A;  1ZGW A;  1PUF A;  3QKX A;  2HDD A;  3OIO A;  3COL A;  4MXM A;  3HTI A;  2Q24 A;  3HOX J;  3AQT A;  3BR2 A;  3K7A J;  1QPI A;  3G56 A;  5F27 A;  3RD3 A;  1TWG J;  1MBG A;  1F36 A;  2G7S A;  5K7Z A;  1IRZ A;  1FEX A;  1RKW A;  4DZP A;  4BY1 J;  2MW8 A;  1MSE C;  3HE0 A;  2UXP A;  4D5C A;  3GZI A;  4IHV A;  2NS7 A;  3LSR A;  2G7G A;  2VI6 A;  1HCR A;  4CYC A;  9ANT A;  2E2I J;  2AO9 A;  3QBM A;  2R5Z A;  3I4M J;  1MBK A;  3OSG A;  5DTD A;  2ZOY A;  1JGG A;  3ON2 A;  4C3I J;  3BTC A;  5FKL A;  2ECB A;  4JYK A;  5EF6 A;  3LSJ A;  4D7N A;  5H9T A;  2LR8 A;  3JRA A;  2OF7 A;  3LNQ A;  4IHX A;  1JKP C;  2PBX A;  1MBH A;  2VUM J;  1GUU A;  2QOP A;  2VKE A;  2G3B A;  1P7I A;  5CW8 A;  5HBU A;  2NVX J;  3DPJ A;  3B81 A;  1FJL A;  2M8G X;  2X48 A;  1RES A;  1LFB A;  3RKQ A;  3MN2 A;  5F0C A;  4DW6 A;  1W0U A;  3V6G A;  1NTC A;  5IYC J;  2E2H J;  2D6Y A;  3D1N I;  3JSJ A;  3WHC A;  3HIM A;  1UHS A;  2DA3 A;  3Q0W A;  3BHQ A;  4B3A A;  5EFY A;  1IGN A;  5GP9 A;  4A3J J;  1GV5 A;  4EEF G;  3S17 J;  2WAQ N;  3BQY A;  4AUX A;  4A93 J;  1A6I A;  3HGY A;  3BNI A;  1WPK A;  4GCL A;  3BR1 A;  4HKU A;  2WGB A;  3A01 B;  2L7M P;  5FKK A;  2RHA A;  1LFU P;  3S1Q J;  2OER A;  1HDP A;  3F1B A;  4JX5 A;  3Q3S A;  3JRH A;  4XRS G;  2HOA A;  5FKN A;  1G2H A;  1ETQ A;  1IG7 A;  2ZOZ A;  3G1O A;  4M3G A;  4QSH A;  3NXC A;  5C44 J;  1TWH J;  1IC8 A;  3V78 A;  1ENH A;  2ECC A;  3L1P A;  1GDT A;  2K9Q A;  4ME9 A;  1FTT A;  2W48 A;  2VPR A;  1H89 C;  1MSF C;  4MO7 A;  2YS9 A;  2OPT A;  2JA5 J;  3DEW A;  2DJN A;  3BR6 A;  1VND A;  2Y31 A;  3HOZ J;  4BBS J;  4NDL A;  3GEU A;  1ETW A;  2XB0 X;  1ETO A;  2HXO A;  5EZG A;  3HOU J;  1T33 A;  5C3E J;  4V2F A;  4XID A;  3TW6 A;  4XIC A;  1GV2 A;  1TC3 C;  4XK4 A;  5HAW A;  1B8I B;  5M5W J;  2AHQ A;  1BL0 A;  3S15 J;  1BA5 A;  1B8I A;  3ZOB A;  1TWA J;  2FBQ A;  4M6V A;  3Q0U A;  3MNL A;  3ZQC A;  2ME0 A;  5FKM A;  2GEN A;  3ANP A;  4YZE A;  4X1E A;  2EZH A;  2EZK A;  5J1R A;  1AKH B;  4RBO A;  2EZI A;  3IH2 A;  4M3B A;  4ACI A;  3BG9 A;  2E2J J;  4D7M A;  4UUS A;  2ZCM A;  1I3Q J;  2NP5 A;  1OFC X;  4W1U A;  1GVD A;  4XRS A;  1RKT A;  1NK3 P;  5IYD J;  1UI6 A;  2R93 J;  5K58 A;  3C2B A;  3H0G J;  5M5Y J;  3HOY J;  2IEK A;  4DZJ A;  1XC5 A;  3PAS A;  2E19 A;  4Y52 J;  3FIW A;  4B4C A;  4QIW N;  2O8K A;  3O60 A;  2PMZ N;  4JX6 A;  3VPR A;  4LOC A;  1O4X A;  2UXO A;  3EGQ A;  2LFB A;  4C2M J;  3LJL A;  3NAU A;  4L5E A;  1XS9 A;  2JK3 A;  5E3L A;  2ID3 A;  4A3C J;  2YU9 J;  1JJ6 C;  3CRJ A;  5FJ8 J;  1R9T J;  1K61 A;  2JA8 J;  3NPI A;  3GTQ J;  2ELK A;  3VVZ A;  3S5R A;  1WGX A;  2XRL A;  3OSF A;  2G7L A;  2GFN A;  1W0T A;  3S2D J;  2CRG A;  4IHY A;  3BT9 A;  2EZL A;  2ZCX A;  2HYJ A;  1X58 A;  3HBL A;  4V2G A;  4BBR J;  3S1R J;  2QCO A;  3UKG A;  2XGD A;  2WUI A;  1Z0X A;  3IH3 A;  2QKO A;  1RET A;  2CQQ A;  2NS8 A;  3LSG A;  5GPC A;  1JKO C;  2R7Z J;  3I4N J;  5C4X J;  2XDN A;  3BRU A;  2ZB9 A;  3O8H A;  2DN0 A;  5JLX A;  3HEF A;  1SGM A;  5IPA A;  3S1N J;  3CJD A;  3VW1 A;  3PO2 J;  2XGE A;  3CMY A;  4PXI A;  4DYR A;  4MLO A;  2H1K A;  4FTH A;  3VOX A;  2DMP A;  1QRY A;  1A5J A;  2DA2 A;  2NVT J;  2IU5 A;  3SDG A;  3ZQL A;  2YVE A;  2LKX A;  1ETY A;  4MFD A;  3TP0 A;  3JRD A;  5E3O A;  2DMN A;  2WB1 N;  1RPW A;  2WV1 A;  5J1U A;  1ETV A;  5GPA A;  2JA6 J;  1H88 C;  2GM4 A;  5CXI A;  1UI5 A;  1IDZ A;  3PPB A;  2LY9 A;  3QPL A;  5IOY A;  3GBG A;  2X6O A;  3LSP A;  1YRN B;  1POG A;  2XPU A;  3B6C A;  3BG3 A;  1YRN A;  3KZ9 A;  4NEL A;  2JWT A;  1U9N A;  3TED A;  5C4J J;  2UXH A;  1BW6 A;  2Y2Z A;  4GFK A;  3ANG A;  3JR9 A;  4B1R A;  4JNN A;  3NRG A;  4IEJ A;  3GTK J;  3C07 A;  1MH3 A;  2JJ7 A;  3WHB A;  5D18 A;  2M0C A;  4W97 A;  2JN6 A;  3F0C A;  5EG0 B;  1JKQ C;  3SJM A;  2R5Y B;  4M3E A;  3VVX A;  2GBY A;  2R5Y A;  4ICH A;  3BR3 A;  4C3H J;  3A01 A;  4AC6 A;  1Z77 A;  1UG2 A;  2V57 A;  4A3L J;  1JT0 A;  1XG1 A;  2RAS A;  3KKC A;  4MK6 A;  2DMU A;  2NP3 A;  4A3E J;  2LVS A;  3A02 A;  4A3D J;  2HYT A;  3BCG A;  4AC0 A;  4S0H B;  1IDY A;  2CU7 A;  2GLO A;  3LHQ A;  3VVY A;  2HQ5 A;  5CXG A;  1QVU A;  2KT0 A;  2UXU A;  4JP0 A;  3QPS A;  3AQS A;  1ZR2 A;  2RAE A;  2FD5 A;  3HOV J;  3BJB A;  1WI3 A;  4FE7 A;  1Y1V J;  3A03 A;  3IH4 A;  3GTL J;  2LLK A;  3QQA A;  3S16 J;  2CQX A;  2DA6 A;  2O7T A;  3CQZ J;  2K40 A;  5M5X J;  2DMT A;  3TW7 A;  4AYB N;  3JRE A;  3P9T A;  5FLM J;  3BR5 A;  2FQ4 A;  2MSY A;  1ETK A;  1ZR4 A;  1F43 A;  3HOW J;  3BR0 A;  1OJL A;  3G1L A;  3ZQI A;  3E7Q A;  1AKH A;  1ZTR A;  2LP0 A;  1I50 J;  5EYR A;  1OCT C;  2KDZ A;  2DG8 A;  3EUP A;  1JUM A;  2LTP A;  3E7L A;  1B72 B;  2HOS A;  2F07 A;  1QVT A;  1ZKG A;  5F0H A;  4A3I J;  3FKI J;  3S2H J;  2VKV A;  5JLW A;  4JKZ A;  1JTX A;  1P7J A;  1E3O C;  1IV6 A;  2IAI A;  2TRT A;  2DA7 A;  2Y30 A;  1U78 A;  2I10 A;  1Y1W J;  1WH7 A;  2PZ9 A;  3RZO J;  3KNW A;  2ZCN A;  5J1Y A;  5FLV A;  3SFI A;  3S1M J;  3VP5 A;  3HDD A;  5FGL A;  3NNR A;  3ZQH A;  5E3M A;  3G1M A;  1VF9 A;  3BG5 A;  1JUP A;  2XSD C;  4GFB A;  5F1J A;  5D1R A;  1MNM C;  4C3J J;  2QIB A;  3VIB A;  4MFE A;  1VI0 A;  1U8B A;  2XGC A;  2Y0S N;  1AHD P;  1ZK8 A;  1GT0 C;  2D5V A;  3RZD J;  1JT6 A;  3TP3 A;  3H3V K;  1HDD C;  2TCT A;  1ITY A;  3JRG A;  1RR7 A;  3BQZ A;  3PO3 J;  2W53 A;  5FHP A;  2EBI A;  5FKO A;  3GTJ J;  4GFL A;  3OOU A;  3JRF A;  2JMW A;  1JTY A;  2R92 J;  1HOM A;  4M3F A;  1FTZ A;  2UXI A;  2K9S A;  4HNV A;  2M9H A;  2HXI A;  3O8G A;  4DYQ A;  5EGO B;  1HF0 A;  5K7F A;  2CUF A;  5EGO A;  2JA7 J;  2DTZ A;  3CDL A;  4BKX A;  4D5F A;  3NAR A;  2HI3 A;  4CYC B;  1APL C;  2O7O A;  5IYB J;  2R5Z B;  3CWR A;  4GCK A;  3ZQG A;  3RH2 A;  4A69 C;  3JRB A;  5IP6 A;  1NK2 P;  5K7H A;  1UMQ A;  3HTA A;  3VW0 A;  5AQC A;  2E1O A;  4JX4 A;  3M4O J;  2DA4 A;  4I76 A;  5HOD A;  3VOK A;  2LK2 A;  2LD5 A;  1Q1V A;  5F08 A;  1JKR C;  2COB A;  3GTO J;  2CJJ A;  3HB9 A;  2NVQ J;  2MG4 A;  3FIS A;  4CGR A;  1X2N A;  5EG0 A;  3HTH A;  1MBJ A;  2NOG A;  1WCM J;  1OCP A;  1T56 A;  3HKZ N;  3GTM J;  2DMQ A;  3FK6 A;  5J3L A;  2EH3 A;  2HOT A;  1CQT A;  2NX4 A;  2QTQ A;  3MKL A;  4MIM A;  2ME6 A;  4IHW A;  4A3M J;  1LE8 B;  3M3Y J;  2HKU A;  3GTP J; 
#chains in the Genus database with same CATH topology
 4CCL A;  5IT3 A;  1H0M A;  3RKX A;  3EYY A;  3HUG B;  4OAZ A;  4KIF A;  5D8K B;  3DU6 A;  5K1Y A;  2A6H F;  5IP9 J;  2PX9 A;  3I53 A;  2QKL B;  2A61 A;  4GXO A;  2YR2 A;  2A69 F;  1DGR M;  2JVH A;  2E7X A;  3ML6 A;  1H8A C;  1N78 A;  1G3T A;  1TW2 A;  4RGS A;  3VYU B;  2QSH X;  4PZJ A;  5FMP A;  2P5V A;  4ZYA A;  3DLL F;  3CCY A;  3HC7 A;  2FJ1 A;  2QLZ A;  5D5V B;  1Y6I A;  4HDV A;  2KL4 A;  2L7Z A;  1OYW A;  1QZZ A;  4RGU A;  1I5Z A;  3MQ0 A;  4FCY A;  3K8P C;  3VEP A;  2EA2 A;  2L9R A;  3BTL A;  4L62 A;  4YEL A;  2DK5 A;  1J2X A;  2QUF A;  2F5D A;  2P6T A;  3MVP A;  4OIO F;  1Y8Q B;  1XDS A;  2OBP A;  2ZJ2 A;  3KP7 A;  3LL7 A;  1R58 A;  1HKQ A;  5FD5 A;  1NH3 A;  2H27 A;  1EF4 A;  3H5R A;  4M3D A;  3RQI A;  4UHT A;  4N4O B;  4HG2 A;  4DYC A;  2CG4 A;  1ETX A;  4HA8 A;  1J75 A;  2L3D A;  1T2K A;  2K9N A;  4RB0 A;  1FOW A;  3GTG J;  1Q1H A;  2JRT A;  4UDS A;  4U7B A;  1U5T C;  1TWC J;  4UUT A;  1D3Y A;  4N4N B;  2P5K A;  5EDN A;  2Z99 A;  2HQA A;  2G0E A;  4PSW A;  3W3C A;  3IV5 A;  1B9M A;  2DFE A;  3CCQ I;  1IN7 A;  1V3F A;  3CJR B;  5E8I A;  2M45 A;  1VTN C;  4ZJZ A;  5GTI C;  4I99 C;  4EGY A;  4LB5 A;  3NRV A;  2YUS A;  5LHG A;  1BJZ A;  5M3M J;  1R4M B;  4FET A;  3QOP A;  2ZY9 A;  2XB5 A;  3SWH A;  1ZG3 A;  4LIV A;  3MWM A;  4ABZ A;  1K4T A;  3NI7 A;  1FIA A;  2QA4 I;  1DU0 A;  1R1V A;  2RQQ A;  5A2Q Z;  3H0D A;  1J0R A;  1U9O A;  1QO0 D;  2OZ6 A;  3BCB A;  3BZ6 A;  1ZGW A;  1S7A A;  2CFX A;  1PUF A;  3QKX A;  2LY1 A;  3OIO A;  3LMM A;  2HDD A;  4AID A;  4MHG A;  1MIJ A;  5ICF A;  1JHH A;  2VBY A;  3D0S A;  1VQ9 I;  2LY2 A;  4LFU A;  3RD3 A;  1MBG A;  5BPD A;  1X1A A;  4BJ5 C;  2M0M A;  5ILS A;  1F36 A;  2KP6 A;  2G7S A;  5K7Z A;  2IJL A;  2LG4 A;  3PQJ A;  4BY1 J;  5D5U B;  2V9K A;  2P8T A;  3H35 A;  3KPH A;  2UXP A;  4D5C A;  3D5L A;  3BOQ A;  3CC2 I;  5LEK A;  2IVM A;  4ZZL A;  1U5T B;  4LK0 F;  3DTK A;  4KIC A;  4C2T A;  2E2I J;  1OCC H;  4XLN F;  2R5Z A;  2ZSI B;  2ZOY A;  1BC8 C;  3FMQ A;  5IT9 Z;  2ZXI A;  3BTC A;  4BHB A;  1O3R A;  4RAY A;  1R4N B;  3O2P E;  1XSV A;  2VT3 A;  5H9T A;  2LR8 A;  1ZEL A;  4U9N A;  2IP2 A;  3ZXS A;  2QBY B;  1XCB A;  1MBH A;  2ZFU A;  2X1E A;  1IN4 A;  3R6S A;  3WTS C;  2DFI A;  2FA5 A;  1P7I A;  5CW8 A;  4WIB A;  2P4W A;  3B81 A;  2ZXH A;  2M8G X;  4I0B A;  4MEX F;  3BY6 A;  3LSI A;  3RKQ A;  2IGK A;  3MN2 A;  1T08 B;  3TMO A;  1LB2 A;  2AXL A;  3KYD B;  3AG1 H;  4DBR A;  2E2H J;  3PSF A;  1XSX A;  4BEH B;  2EA4 A;  2Q8K A;  2UXN A;  1GV5 A;  1SC7 A;  2WB1 A;  3S17 J;  2WAQ N;  4IXA A;  2LRD A;  3BQY A;  2R7T A;  2FML A;  1YJW I;  3HGY A;  3TDU C;  3BNI A;  1WPK A;  4BE0 A;  1MNE A;  2WTE A;  2BY0 A;  2RHA A;  1LFU P;  3K69 A;  4EM0 B;  3F1B A;  4JX5 A;  3L2C A;  3Q3S A;  2ZOZ A;  4BE1 A;  2XKO A;  1X1B A;  2EIJ H;  3EYI A;  3REO A;  1JI8 A;  3PNV A;  2ECC A;  3VYT B;  1IN8 A;  2EK5 A;  1FTT A;  1ULY A;  2XAQ A;  3KP3 A;  1TQP A;  2K9L A;  2YU3 A;  3HJE A;  3Q9V A;  4NQW B;  4Y4R A;  5EEG A;  1AWC A;  4OIQ F;  2DJN A;  1TW3 A;  1VND A;  2Y31 A;  5DCM A;  1QPM A;  4NDL A;  1ETO A;  3KFW X;  2XRO A;  5LGT A;  3OYK A;  4HQE A;  3KYL A;  3CCU I;  1OYY A;  3QP6 A;  2IS2 A;  3J7A O;  1FLI A;  2JUG A;  2ZJQ F;  1B8I A;  1SD6 A;  5HNF A;  1HA8 A;  4U0W A;  2F5C A;  3ZR8 X;  2ICW G;  4DNC A;  4X1E A;  4EJW A;  5J1R A;  3DTI A;  1T0F C;  1FC3 A;  3CES A;  1KZH A;  1K6O A;  4P55 A;  3C2G A;  4UUS A;  3CC7 I;  2R7U A;  2L01 A;  4XKB A;  2NP5 A;  3F22 A;  5BS6 A;  1OMI A;  1YJN I;  3HOY J;  2H6B A;  3CZ6 A;  3N05 A;  1MND A;  1STZ A;  2VBX A;  4Y52 J;  4QPO A;  2R7R A;  2EPF A;  3O60 A;  5GAD J;  4BL0 B;  3SFZ A;  1Z67 A;  2L7K A;  1YX5 A;  2PJR B;  3NAU A;  1XDU A;  3VSL A;  1O57 A;  4IJA A;  3T8T A;  1R9T J;  3E97 A;  1YLF A;  4HF0 A;  1ZG5 A;  2JA8 J;  3S5R A;  1WGX A;  2G7L A;  1T98 A;  4IHY A;  1R1U A;  3BPV A;  3K4J A;  2W85 A;  2HYJ A;  3HBL A;  4V2G A;  5DD8 A;  5E18 F;  4WWC A;  3UKG A;  2XGD A;  2CV0 A;  2IPQ X;  3Q9S A;  2VON A;  2O3F A;  3LSG A;  5GPC A;  2GWR A;  5C4X J;  3KZY A;  2MLK A;  2A5Y B;  3W2W A;  2W4S A;  2IA1 A;  1P4W A;  2K02 A;  3JTH A;  2XGE A;  3CMY A;  1TQI A;  3CF2 A;  2EIM H;  4Q48 A;  4ZC3 A;  2G7U A;  5J4Y A;  4FTH A;  2GXA A;  1QRY A;  3ZPL A;  2DA2 A;  1A5J A;  2LDU A;  2YVE A;  1MW7 A;  4E7L A;  3JRD A;  2HWV A;  3HOT A;  2EFQ A;  4LIU A;  4RLQ A;  2DMN A;  1SFX A;  2WV1 A;  1YG2 A;  1LEB A;  4BDY A;  5GPA A;  2JA6 J;  1OCZ H;  3CP2 A;  4YFX F;  2LY9 A;  3QPL A;  2BHY A;  1G3S A;  1MMA A;  3OYL A;  2CMP A;  3OYG A;  3PPB A;  3S3O A;  1POG A;  2RKH A;  1K79 A;  1I1G A;  3QOD A;  3B6C A;  2VJ5 A;  1HW2 A;  2UXH A;  1BW6 A;  2IXS A;  4JBA A;  2ZJR F;  3ANG A;  1OQY A;  3SQN A;  3M9A A;  4IEJ A;  2AQF A;  4OMY A;  2A5W A;  2E35 A;  3WHB A;  1IV8 A;  3F0C A;  3OYE A;  4BQQ A;  3DFG A;  3SJM A;  4BE2 A;  2PMH A;  1X4O A;  3K70 C;  2K86 A;  3GZ5 A;  4M3E A;  2R5Y B;  3ECH A;  2KKO A;  2CV2 A;  3RPU D;  4L0Z B;  3BR3 A;  2UWM A;  3HSR A;  2JPC A;  5JVT A;  1VQP I;  2VB6 A;  1K6Y A;  3E5X A;  4B8X A;  2HTJ A;  1I1S A;  1Z77 A;  2EIN H;  1T6S A;  3K4N A;  2V57 A;  3V4G A;  4A3L J;  1XG1 A;  2MC3 A;  4ESJ A;  3W6K B;  2E1M C;  3A02 A;  3DBH B;  1CF7 A;  5LEJ A;  2GLO A;  4X0G A;  2CH0 A;  3WU0 A;  1QHG A;  5TRD A;  2GXG A;  2UXU A;  1R71 A;  3P9K A;  4I01 A;  2DXI A;  1VQ7 I;  3AQS A;  2KRC A;  1ZR2 A;  2RAE A;  1U8R A;  1ZLK A;  1EV7 A;  3GME A;  5FFZ A;  1FSE A;  2NS0 A;  5E8G A;  3WTW C;  3BJB A;  1J5Y A;  3TQN A;  2PJP A;  3A03 A;  1EH6 A;  3R61 A;  2CW7 A;  3S16 J;  2CQX A;  5AIP A;  2DA6 A;  5CYV A;  2K40 A;  2QQ9 A;  1FX7 A;  4R79 A;  1IN6 A;  4KA4 A;  3P9T A;  3K2Z A;  3DKX A;  2JT1 A;  5FRM A;  1WWX A;  2DT7 B;  4G6Q A;  2P7C B;  2LC2 A;  1OPC A;  1UJ8 A;  4I0A A;  3LWF A;  4O5V A;  1AKH A;  1W7P A;  3ASO H;  4HV5 A;  2KDZ A;  3U9G A;  2QKM B;  3ZMT A;  5F0H A;  4ZDP A;  1S8N A;  2PI0 A;  4A3I J;  3NWS A;  3S2H J;  2DYR H;  2VKV A;  4JKZ A;  1JTX A;  1KGS A;  1P7J A;  3R4K A;  4M73 A;  3QPT A;  2IAI A;  1R36 A;  2DA7 A;  2K4J A;  3OL3 A;  2E1M B;  1Y1W J;  4OIP F;  1HBX G;  3WGI A;  2E1C A;  3RZO J;  3KNW A;  3OYM A;  4M9Z A;  1VQ8 I;  4YIF A;  5FLV A;  3SFI A;  3FX3 A;  4BHP A;  3DEU A;  5FGL A;  3VOD A;  4CXF A;  4HX4 A;  5E3M A;  1ZAO A;  1YHQ I;  3BG5 A;  1IRG A;  2KJC A;  1JUP A;  5J6X A;  3WOD F;  3WG7 H;  1WSU A;  4C3J J;  1YE9 A;  4GGG A;  4TV7 A;  2QIB A;  4CZZ A;  3VIB A;  1VI0 A;  4ZDL A;  1LJ9 A;  4A0Y A;  4BYY A;  1MMD A;  3OL4 A;  2CQK A;  3JSO A;  4YG2 F;  1S72 I;  2FNP A;  4LG0 A;  5FD6 A;  3I0T A;  2DT5 A;  3GTJ J;  2JMW A;  1IXS B;  2UXI A;  2J5P A;  2HXI A;  1WJE A;  3OYA A;  2F48 A;  2X85 A;  2CYY A;  2FMY A;  5EGO A;  4OWR B;  2JA7 J;  1XGM A;  3N4M A;  4BKX A;  3PUF A;  3F6V A;  2M8E A;  1P2F A;  4U7D A;  3GWZ A;  3NAR A;  4R8H A;  2HI3 A;  1APL C;  2E5N A;  1NHA A;  5IYB J;  4PCQ A;  2R5Z B;  4BAY A;  5F1R A;  4OAY A;  2BZT A;  3CWR A;  3T0Y A;  3ZQG A;  2NNY A;  3JRB A;  5K7H A;  3OYJ A;  1QQI A;  4HAM A;  5GAE J;  1HST A;  3U1D A;  1TL8 A;  3OYB A;  3OY9 A;  5JHF A;  1LEA A;  4CHU A;  3HHG A;  2DA4 A;  2LK2 A;  2X0L A;  2FE3 A;  3FXJ A;  5F08 A;  2LD5 A;  1O3T A;  1JKR C;  3RSN A;  2COB A;  3GTO J;  1P4X A;  2JUC A;  2VQH A;  3QPH A;  1VQ4 I;  3FIS A;  3GYH X;  1Y0U A;  5CLS A;  3L2U A;  1YIT I;  1D0X A;  3HTH A;  1MBJ A;  2NOG A;  1WCM J;  3GTM J;  4CCK A;  2A2F X;  2DMQ A;  5J3L A;  2NX4 A;  1CQT A;  4AM3 A;  2F4I A;  1A35 A;  3DPU A;  1LE8 B;  4IHX A;  2HKU A;  3VYR B;  1RC9 A;  4P96 A;  1MH4 A;  3BJO A;  2NVY J;  4L9V A;  4G12 A;  3FBI B;  1A04 A;  1HXD A;  2TDX A;  3F72 A;  5BNG A;  2O5R A;  3LQQ A;  2MD0 A;  1WVR A;  3ZCO A;  4UB8 C;  4BGD A;  4FE4 A;  1IJW C;  1ZQ3 P;  4BDZ A;  2CUJ A;  4I98 B;  3A0H C;  5B5E C;  1SAN A;  3HSE A;  1X3W B;  3EPZ A;  2CUZ A;  1W5S A;  5DEQ A;  3IWZ A;  4G7H F;  2XAS A;  3R0A A;  3I3L A;  2JZY A;  5J8F A;  3FF5 A;  1J09 A;  4Q47 A;  2LOO A;  3VUQ A;  1P9Q C;  1UHW A;  2AXT C;  4PJ0 C;  1LQ1 A;  2QWT A;  3HGG A;  2Y9Y A;  5IOZ A;  1PDN C;  2KJB A;  3KLO A;  2ID6 A;  1AU7 A;  3LSH A;  2DQL A;  2PFV A;  5DCM B;  3K2A A;  1FIP A;  3RKY A;  3KP6 A;  1ZN2 A;  3PNY A;  2NRA C;  2IGM A;  3OYF A;  4GDF A;  3CUO A;  3LA7 A;  3B6A A;  4I7H A;  4RAF A;  2W57 A;  3BWG A;  2OZU A;  3H9Q A;  2B63 J;  1I39 A;  4PJN A;  1L3L A;  3W6V A;  2F2E A;  3FXL A;  1OR7 A;  2CFO A;  2FBI A;  4LLN A;  4MQ9 F;  4HST A;  1UFM A;  1FMV A;  1W5C C;  3DWL E;  3J7Y J;  2G9W A;  1YW7 A;  4XRM A;  2BEO A;  1ON2 A;  2QQA A;  3K4C A;  3CCV I;  3CMM A;  2K3F A;  4BXX J;  4RA2 A;  4QPQ A;  4NB5 A;  4Z2Y A;  3B73 A;  3ABT A;  2FQ3 A;  1PYV A;  2XAU A;  2M2E A;  4IOA F;  3QYF A;  4UUS B;  1MKM A;  4J19 A;  4GYG A;  1D0Y A;  2DG7 A;  2W7N A;  4XKC A;  4XLH A;  2IS4 A;  1SD7 A;  3ON4 A;  1S7E A;  1ACI A;  2MH2 A;  2QF7 A;  4J00 A;  5CKT A;  3PUB A;  2IBD A;  2H1L A;  3LSM A;  2QGU A;  4BY7 J;  4D1Q A;  3LWJ A;  3J80 Z;  2ZXW H;  4MEY F;  2GQQ A;  2KIM A;  4BQA A;  4JQF A;  1FMW A;  1TZL A;  1MJ9 A;  3BDD A;  2LSO A;  4N0B A;  4BUP A;  1WJD A;  3HPG A;  4BHC A;  2KIU A;  3HOX J;  1QPI A;  4V19 K;  5F27 A;  3S32 A;  1MJA A;  2KPM A;  3L2R A;  2VXD A;  1WJF A;  2VE8 A;  1FP1 D;  2JQ7 A;  2O0Y A;  1FOY A;  3OIQ A;  2BVL A;  5IY5 H;  3GZI A;  3I59 A;  5FB2 A;  1QU3 A;  2FRH A;  2ZKZ A;  4IKF A;  2XAG A;  2G7G A;  1HCR A;  1WJB A;  2B7E A;  1Z6T A;  2PMZ A;  3ABU A;  4NBQ A;  2AO9 A;  3UR3 C;  4CYC A;  1VQN I;  9ANT A;  3QBM A;  3I4M J;  1QNT A;  1JGG A;  1TBX A;  1W1W E;  4C3I J;  4AIK A;  3VSK A;  1H9G A;  2ECB A;  4JYK A;  3JCU C;  4U87 A;  3LSJ A;  1T95 A;  3SZP A;  3OYI A;  3CCJ I;  1QBJ A;  2OTL I;  4F7Z A;  4RGX A;  3LNQ A;  4LB6 B;  5HS9 A;  4E6K G;  1GUU A;  1MMS A;  3S8P A;  5L3G A;  4IRG A;  2G3B A;  2FBK A;  3ISP A;  4AIJ A;  2MC4 A;  3HRS A;  5HDN A;  5AON A;  4XLE A;  2L9N A;  1RNL A;  1LFB A;  3TGN A;  4ENM A;  5F0C A;  4MTD A;  2HU9 A;  1O3Q A;  3BPX A;  1NTC A;  5IYC J;  2V9V A;  1OIS A;  2QWW A;  2I8D A;  2O03 A;  4NC7 A;  3V8L A;  4IO9 F;  3HIM A;  2DA3 A;  3Q0W A;  1K7A A;  3QAH A;  1IGN A;  1W5T A;  2X51 A;  3DBR B;  2M7B A;  4IX7 A;  3HHH A;  4QLC U;  1PP8 F;  4CUG A;  1EH8 A;  3RPU A;  1WHU A;  3EET A;  5GTH C;  2OQG A;  3Q5F A;  4EJV A;  2OCE A;  3BR1 A;  4EQQ A;  4HNU A;  4M6Y A;  2OAZ A;  3C3W A;  4CCO A;  2LNB A;  1Z05 A;  4E7S A;  3DEE A;  2ELJ A;  1OLT A;  2CGP A;  4BJT A;  3JRH A;  1G2H A;  5FKN A;  1YI2 I;  1ETQ A;  1SFK A;  4A12 A;  4S05 A;  5DM7 F;  3G1O A;  5J4V A;  2CS3 A;  5HNH A;  1K4S A;  1ZRE A;  1U6G A;  4CCM A;  2BY1 A;  1IC8 A;  3AG2 H;  1WRJ A;  3PIO F;  1CF7 B;  2MYS A;  1AOY A;  3FHN A;  2A3S A;  4BJ6 C;  3IAM 2;  1S5L C;  3HPH A;  1BOB A;  2QQB A;  3P5J A;  1SFE A;  4H4K C;  2D1V A;  1W36 D;  3BR6 A;  3HOZ J;  4RB1 A;  4HZF A;  2Y75 A;  5EZG A;  1T33 A;  5LFA A;  2WBM A;  2JTV A;  2PN6 A;  2VAS A;  5F64 A;  4XK4 A;  4YIR X;  1YO5 C;  5HAW A;  2KRH A;  4PJL A;  2AHQ A;  5JR3 A;  1TNT A;  3ZOB A;  3WTY C;  1LUJ B;  2FBQ A;  4M6V A;  3CC4 I;  3MNL A;  2GIZ A;  1MMN A;  4DOZ A;  2ME0 A;  3WTZ A;  1V55 H;  4YZE A;  3ANP A;  1BR4 A;  2DW4 A;  4L0Y B;  1AKH B;  1YOV B;  1W7P B;  2RC4 A;  4U0V A;  1YIJ I;  3WTT C;  4RBO A;  4KIG A;  2LYC A;  2ESH A;  3IH2 A;  1IAW A;  3J7Z I;  3CDH A;  1HC8 A;  5H20 A;  1YTY A;  2E2J J;  1ZRC A;  1IF1 A;  3PSI A;  2ZCM A;  1I3Q J;  2KFD A;  2M30 A;  3I58 A;  1GVD A;  1XCV A;  1RKT A;  3OS0 A;  1XD7 A;  1UI6 A;  3KZZ A;  5M5Y J;  2IEK A;  2MBF A;  1E3H A;  3MFK A;  1XC5 A;  3PAS A;  2BY3 A;  3CTA A;  1SMY F;  1Y0N A;  3F8B A;  2FEZ A;  2B0L A;  2X6W A;  4Y3O A;  2PG4 A;  4IQ4 A;  1SAX A;  4LOC A;  2UXO A;  4FX0 A;  2CQ7 A;  4C2M J;  1Y8R B;  2X6Y A;  1XS9 A;  1D1B A;  2UV1 A;  4O6J A;  4WK8 F;  5D8L B;  5FJ8 J;  2DFF A;  3E3V A;  5KAI C;  2BV6 A;  2H09 A;  2WAD A;  1F9N A;  4HX8 A;  3S2D J;  3M1C A;  2CRG A;  3OYD A;  5D6F A;  2DFH A;  2EZL A;  3H5N A;  2ZCX A;  3S1R J;  2MA3 A;  3W2A A;  2VC0 A;  1NG6 A;  1FBS A;  4LMY A;  4ITV A;  5LRR A;  2VJJ A;  2R7Z J;  3HXL A;  4IZZ A;  3FWE A;  2LBF A;  2Z3Y A;  4A5N A;  1ZRD A;  2R7O A;  2X1C A;  2Y0S A;  1KON A;  3BRU A;  1KYZ A;  3ZMD A;  2ZC2 A;  2XV4 S;  2A6E F;  2X1D A;  3PO2 J;  1N25 A;  4DYR A;  4E7J A;  2H1K A;  3GCM A;  1IW7 F;  1QHH D;  2IU5 A;  3ZQL A;  5JVG F;  5K5O A;  1ETY A;  3KEO A;  3MZH A;  5GAG J;  5E3O A;  4NHJ A;  2WB1 N;  1RPW A;  5J1U A;  3IL2 A;  5LHI A;  5ERI A;  2GA2 A;  1H88 C;  2DOF A;  1TLH B;  4I02 A;  1Z7U A;  1E0E A;  1ON1 A;  3GBG A;  3LSP A;  4CDG A;  2RQP A;  2XPU A;  2EWN A;  1YRN A;  4BXF A;  5C4J J;  4EJU A;  4GFK A;  2PQ8 A;  2Y69 H;  2KLO A;  1VQ5 I;  3NRG A;  4JNN A;  3C07 A;  2DCE A;  4FHT A;  4KIT B;  4RAZ A;  2M0C A;  2JN6 A;  1O7F A;  4HV6 A;  3C7J A;  4YFN F;  1WI9 A;  3GO5 A;  1USS A;  3VVX A;  3ZMV A;  2L54 A;  5KVR A;  3TL4 X;  2E34 A;  4C3H J;  5IT9 K;  1OR7 C;  1FPQ A;  3V7R A;  2ISY A;  2M4K A;  4AC6 A;  1BI3 A;  1UG2 A;  1Z91 A;  2VOD A;  2RAS A;  3KKC A;  4U0Y A;  5ICC A;  1R00 A;  3SZG A;  4A3D J;  4P9F A;  5D4S A;  4ZDO A;  2HYT A;  3IKV A;  2HR3 A;  1IDY A;  2CU7 A;  2DT6 A;  3VVY A;  5B1A H;  3I5U A;  5DM6 F;  2P5L C;  3OYC A;  4JP0 A;  2FUG 2;  2JPB A;  1XX5 A;  2HGC A;  1TP4 A;  2VN2 A;  3CUQ A;  1SEU A;  2A07 F;  4HRI A;  3HL2 A;  2DK8 A;  1OYI A;  3G2B A;  2Y48 A;  2ETH A;  2RV8 A;  2OQR A;  1Y56 A;  3QQA A;  4KDP A;  1XGO A;  3CQZ J;  2GIV A;  1PVE A;  3HRM A;  5ICE A;  5M5X J;  3TW7 A;  4GO1 A;  5KK1 A;  2R7W A;  1SVO A;  2FQ4 A;  2NVU B;  1X1P A;  1ETK A;  1UG0 A;  2VQC A;  4KT5 C;  3BCA A;  1ZR4 A;  2XIG A;  2UZK A;  1F43 A;  3A1Y A;  3P9C A;  3BR0 A;  2FU4 A;  4FQG A;  2B9S A;  5FRN A;  3E7Q A;  3ZRG A;  2IW5 A;  4UUV A;  3TDZ C;  1I50 J;  5EYR A;  3EUP A;  2LTP A;  3E7L A;  2DU9 A;  2KZV A;  1JHF A;  5ILV A;  1RR8 C;  3BC8 A;  1GXP A;  1IZ1 A;  1G3Y A;  3FKI J;  5TGT A;  5JLW A;  2HYF A;  3W2V A;  1O3S A;  1E3O C;  4AD9 A;  3DLA A;  1IV6 A;  1HW5 A;  2TRT A;  2Y30 A;  2IGN A;  3BZK A;  4HDU A;  1BI0 A;  2JSP A;  1DDN A;  2E1N A;  2HKX A;  4ZYE A;  2M5W A;  1JGS A;  3L9F A;  5E20 A;  3VP5 A;  2E71 A;  3HDD A;  2L02 A;  3NNR A;  3QWL A;  4EMS A;  3ZQH A;  2XGX A;  3I4P A;  4M9S A;  1GVJ A;  3ABM H;  3I54 A;  2EV0 A;  3C1D A;  2K4B A;  2WAF A;  3KP5 A;  1YFH A;  2VQG A;  1QGP A;  2HVQ A;  1ZGA A;  1ITY A;  1RR7 A;  2A6T A;  3PO3 J;  2LF7 A;  2Q0O A;  2EBI A;  4XBF A;  1G3W A;  5FKO A;  4RM2 A;  3OOU A;  1TT0 A;  3JRF A;  2R92 J;  1JTY A;  1HOM A;  4M3F A;  1FTZ A;  4C2M A;  1VQM I;  2M9H A;  2LKP A;  3AQT A;  2J5O A;  4DYQ A;  3J81 Z;  3H3U A;  1HF0 A;  2M3A A;  3BG6 A;  4M71 A;  3CLO A;  2BBY A;  3WG9 A;  4D5F A;  2VOP A;  3J7A Y;  4CYC B;  3LA3 A;  2O7O A;  2QVO A;  3H92 A;  1LVK A;  1FZP B;  4EAT A;  4GCK A;  3AAF A;  1YIO A;  2Q1Z B;  3K9T A;  3RH2 A;  1XGN A;  5IP6 A;  4NC6 A;  4DVY P;  1UMQ A;  1J59 A;  2O61 A;  1QZE A;  3R60 A;  3FXU A;  3HTA A;  2A68 F;  2K5C A;  1XB4 A;  2W24 A;  4C30 A;  1K78 A;  5L3F A;  4BS9 A;  4XN3 A;  1YX3 A;  4E7K A;  3P9I A;  3DXJ F;  4UV8 A;  3M4O J;  2WAE A;  4R1H A;  1REP C;  3A4C A;  2Z16 A;  3HIF A;  3L09 A;  4KN7 X;  5HOD A;  1Q1V A;  5FLX Z;  2W84 A;  1WJA A;  2WC2 A;  2CJJ A;  3HB9 A;  1VQL I;  3IP4 B;  1FOX A;  2GAU A;  4CA0 A;  2MG4 A;  3RCO A;  4KNY A;  5EG0 A;  3TKY A;  1KQ9 A;  2HTS A;  5DUI A;  3H3Z A;  2EH3 A;  4GRI A;  3MKL A;  3MKY B;  2HOE A;  4IHW A;  1FSH A;  3M3Y J;  3OS2 A;  3GTP J;  3R0J A;  1NG7 A;  1TWF J;  2QZ8 A;  4A5M A;  4C2U A;  3FKJ A;  4PFO A;  3HUG A;  5EZH A;  2DAO A;  4IRH A;  5CVJ A;  3RJP A;  5LBQ A;  3GFM A;  3KEQ A;  5BMZ A;  4I6Z A;  3ZGK A;  2IGO A;  1TTY A;  2XRN A;  2V6C A;  3FZV A;  2EJR A;  2B3W A;  2XDV A;  4A3K J;  1FY7 A;  4PK4 A;  4UVB A;  1MD0 A;  2UXX A;  4A3F J;  1MBE A;  3S14 J;  1J7K A;  3VWB A;  1BW5 A;  3OOP A;  3OWT A;  4QTR A;  2X9D A;  3HRT A;  2HEO A;  2STW A;  4CIC A;  1I6H J;  2K85 A;  1P6R A;  1XTA A;  2HS5 A;  2ACJ A;  4DQ2 A;  1ZRF A;  2NNN A;  3GVA A;  1D5Y A;  3M8F A;  3WTX C;  3M1E A;  5K5Q A;  3JRI A;  1WKM A;  4PJM A;  4KWA A;  1VZ0 A;  2XF6 A;  1IXR C;  4A0Z A;  2ZBK A;  5CVU A;  4PGG A;  4IHT A;  1VFC A;  3DCF A;  3JRC A;  3BJ6 A;  2XPV A;  5EJC A;  2L0K A;  3H9J A;  5HSZ A;  2VL8 A;  4HPQ A;  4WX9 A;  4AF5 A;  2KRF A;  4XSX F;  3K1M A;  3HOS A;  3K70 D;  4A3B J;  2NYX A;  5D19 A;  1K83 J;  3F8M A;  3WTU C;  2Z33 A;  2HVR A;  1I6X A;  2EQR A;  3QYE A;  1MGT A;  2CUE A;  2R0Q C;  1G59 A;  3KX2 A;  3IKT A;  2DLL A;  3FMR A;  3HM5 A;  1FOK A;  3MEX A;  1D8K A;  4Y13 A;  4MTE A;  3G71 I;  5DAJ A;  4M74 A;  1R5G A;  3DU5 A;  4XLA A;  1GLN A;  3QU6 A;  4JOM A;  2H8R A;  4JL3 A;  1ZG1 A;  1R5I D;  2DA1 A;  2GXB A;  4BNC A;  3EUH A;  5D6E A;  4ESB A;  1ORK A;  4MGR A;  1R49 A;  2H8W A;  1BIB A;  2Y9Z A;  3FXO A;  4KJZ A;  3BLY A;  3ZQQ A;  3H5A A;  2OU2 A;  1MBF A;  3Q0V A;  3GZ6 A;  2KQR A;  4GCT A;  1PUF B;  4XQF A;  1Z9C A;  4AVZ A;  2HYG D;  1LVA A;  4EJO A;  3COL A;  3HTI A;  2MH9 A;  3BR2 A;  3G56 A;  4H0E A;  4HOB A;  1TWG J;  3V7C A;  2HFH A;  2BHZ A;  2FF4 A;  2DPU A;  2DDA A;  3CJN A;  3BRO A;  2F6C A;  2JA2 A;  4DZP A;  2MW8 A;  1MSE C;  2ISZ A;  4OD4 A;  2NS7 A;  5KHD A;  4HNT A;  3LSR A;  1DPR A;  3H9G A;  2BGC A;  2XUB A;  3CP8 A;  1UAA A;  3DPL C;  3JAM Z;  1RIO H;  3M8J A;  3SEQ A;  3KE2 A;  1R5H A;  2W00 A;  3F3X A;  1YW9 A;  2XC7 A;  5BOX A;  5FKL A;  2LBF B;  3ASN H;  3EUA A;  1ZGJ A;  4G6T B;  1Z6R A;  4L18 B;  2FSW A;  2OF7 A;  1JKP C;  3DF8 A;  2Y0M A;  4PSX A;  2VQL A;  2QOP A;  5HBU A;  5ILU A;  2NVX J;  3AL0 C;  3DPJ A;  3F8F A;  3F21 A;  3CME I;  3GX4 X;  3S3N A;  1XMA A;  3V42 A;  1W0U A;  1JE8 A;  2VPL A;  1ERD A;  1ZLJ A;  3M8E A;  2D6Y A;  3KP4 A;  2DTR A;  2VXZ A;  4DBQ A;  2PBI A;  2K7L A;  3BHQ A;  4IVN A;  4ZYD A;  2L4A A;  1Z3X A;  2XF5 A;  2HPM A;  5GP9 A;  5ICG A;  2R7Q A;  2BVM A;  3T8R A;  2OC6 A;  4EEF G;  5ED4 A;  3SYT A;  2LH9 A;  4A93 J;  2R7S A;  1A6I A;  5FGM A;  1SVM A;  2WGB A;  2HZT A;  1X19 A;  3AKZ A;  2IS6 A;  5TJJ A;  3S1Q J;  3ABK H;  1HDP A;  2WY8 Q;  3K4K A;  3KET A;  2YPR A;  2XF7 A;  2XAH A;  3TO7 A;  4U88 A;  2HOA A;  4LJZ F;  4XRS G;  3CO7 C;  2E5Z A;  2IT0 A;  1IN5 A;  1U0J A;  1IG7 A;  5GAH J;  1U3E M;  3V7S A;  3FXQ A;  4QSH A;  3RDI A;  3NXC A;  1TWH J;  3FBN B;  3V78 A;  4ENJ A;  1ENH A;  3CJQ B;  2V6E A;  3ERE D;  1GDT A;  2K9Q A;  2ZCW A;  4ME9 A;  2MFZ A;  2VPR A;  1H89 C;  5CJ9 A;  4MO7 A;  2EIK H;  2WY7 Q;  2OPT A;  1KYW A;  3L2W A;  2JA5 J;  1MDM A;  2RDP A;  1F1Z A;  3AL0 B;  3DEW A;  4JK1 X;  3GEU A;  1LFP A;  2XB0 X;  3HOU J;  3KYC B;  5C3E J;  4V2F A;  4IRI A;  1EA3 A;  4XIC A;  2JSC A;  4F92 B;  4RB2 C;  4N9I A;  4M9X A;  2PFB A;  4G7Z F;  1B8I B;  1BL0 A;  3K4M A;  4RLF A;  4O3M A;  2I5U A;  1TWA J;  3BJA A;  3Q0U A;  3CLQ A;  4HF1 A;  3FDY A;  2GEN A;  2EZH A;  2EZK A;  1ONV A;  1HW1 A;  1X3U A;  2BYV E;  3DP7 A;  2CW0 F;  3NQO A;  2EZI A;  1RRJ A;  2D45 A;  4ACI A;  3BG9 A;  4D9J A;  3MAJ A;  4AYB A;  4YRV A;  2OD5 A;  3HSF A;  3HZJ A;  4D7M A;  1YS6 A;  4FT8 A;  1LDK B;  4EV0 A;  1NK3 P;  1FT9 A;  2R93 J;  3H0G J;  2EFN A;  4NNJ A;  5DD4 A;  1UST A;  3L2Q A;  4DZJ A;  1WQ2 A;  2E19 A;  4E7H A;  2DPD A;  1KQ0 A;  1U2W A;  1FWZ A;  4UNO A;  4B4C A;  2O8K A;  2JVG A;  2LRE A;  2PMZ N;  5DCF A;  5J47 A;  2LFB A;  3GF2 A;  3GZN B;  3RQ4 A;  3E5U A;  4L5E A;  5H2F C;  5E3L A;  3K6G A;  2ID3 A;  4E7I A;  1JJ6 C;  3CRJ A;  3TOA A;  3ECO A;  1K61 A;  3NPI A;  1P92 A;  2ELK A;  2Q2E A;  2XRL A;  1R1T A;  1W0T A;  2GFN A;  2G7H A;  4MQV A;  1BN5 A;  1X58 A;  2V7F A;  4B47 A;  2WUI A;  3IH3 A;  3TO6 A;  3F8C A;  1XPX A;  2QKO A;  2NS8 A;  2CQQ A;  1JKO C;  1IUY A;  2XDN A;  3I4N J;  5CQG A;  2ZB9 A;  3O8H A;  5JLX A;  2CSO A;  1RUO A;  2FBH A;  3CJD A;  3HG9 A;  4PXI A;  3COA C;  2R4G A;  1B9N A;  4OU0 A;  4A6D A;  5BQT A;  2DMP A;  2QSF X;  1A31 A;  2XKP A;  2NVT J;  3EUK L;  2EV5 A;  2LKX A;  1SVL A;  3LFK A;  1HKS A;  3F8N A;  2OUM A;  3J80 K;  3S3M A;  3RYR A;  3ERM A;  2GM4 A;  5CXI A;  2HNH A;  3LST A;  1DQU A;  1BM9 A;  4LD5 A;  1BC7 C;  4LIT A;  1K78 B;  2H6C A;  5IOY A;  2X6O A;  1KU3 A;  4F52 A;  1LDD A;  2OJE D;  3BG3 A;  1LKX A;  4I2O A;  3KZ9 A;  1W36 C;  1U9N A;  4NEL A;  4KFC A;  2Y2Z A;  1WJ5 A;  3JR9 A;  3MCZ A;  1D5V A;  3K1P A;  2JJ7 A;  4UV9 A;  3RYP A;  4W97 A;  5D18 A;  3T1B A;  1JKQ C;  4AIH A;  5EG0 B;  2Z2S B;  3MD2 A;  2ELH A;  2GBY A;  1A6Q A;  2R5Y A;  4FX4 A;  1Z21 A;  3A01 A;  4UY8 I;  2ZME A;  3IRR A;  3NS4 A;  1IXC A;  1S7O A;  2VBZ A;  4PJJ A;  3VDX A;  5LGU A;  1YJ9 I;  3U2R A;  4MK6 A;  2NP3 A;  3PFY A;  2LVS A;  4A3E J;  4WXD A;  2VKH A;  2PEX A;  4S0H B;  3LAP A;  4XOR A;  2KIQ A;  1VQO I;  4B09 A;  2HQ5 A;  3RPQ A;  1TNS A;  4XN0 A;  2W82 A;  4XON A;  4OIR F;  2MLG A;  2F5E A;  4S04 A;  3EUH C;  2ZO4 A;  2FD5 A;  3WGH A;  2C6Y A;  1ZH5 A;  3HOV J;  1LPQ A;  2R7X A;  2EFP A;  3LFU A;  5JHU A;  3GTL J;  2HQR A;  1IRX A;  2YX7 A;  1UHM A;  3ESW B;  5FLM J;  2RN7 A;  2MSY A;  2KMU A;  2XAF A;  3G3Z A;  3C18 A;  4CYD A;  4Q4Z F;  3G6E I;  5L3B A;  2ADU A;  3G1L A;  4CGZ A;  2QSG X;  2Z9O A;  2LKS A;  4ENN A;  4LG3 A;  3MKW B;  1JUM A;  2HOS A;  4CZC A;  1QVT A;  1ZKG A;  4IOC F;  5E17 F;  1W7P D;  3L7W A;  4PUS A;  4XOP A;  4BU2 A;  4ETS A;  2Z1D A;  1N75 A;  2W25 A;  3FHZ A;  2UUZ A;  3QP5 A;  3TBI A;  1FYK A;  3E0J B;  2QQ8 A;  5HDK A;  1V54 H;  3L00 A;  1U78 A;  2I10 A;  1FBQ A;  4HBL A;  1E2X A;  2FNA A;  2PZ9 A;  1X4P A;  4K2E A;  2ZCN A;  1R7J A;  3CF5 F;  1MJB A;  4Y15 A;  5L3C A;  2CV1 A;  2COM A;  1P4A A;  1VF9 A;  1FNN A;  3IHU A;  2XHK A;  3D5S C;  4XMY A;  5E1Z B;  5F1J A;  1T38 A;  4KT6 A;  5HOO A;  2EFW A;  3CJT B;  2JRM A;  2XGC A;  1EH7 A;  1TQM A;  1X1D A;  1ZK8 A;  2Y0S N;  3CCR I;  1AHD P;  2D5V A;  3RZD J;  2STT A;  1VQ6 I;  3K1N A;  3TP3 A;  1HDD C;  2TCT A;  3VYS B;  4LG0 B;  3BQZ A;  2IRF G;  2W53 A;  5FHP A;  5FRO A;  3MZ8 A;  3E6D A;  2VJ4 A;  5CQE A;  4HEA 2;  4OMZ A;  4IHS A;  2K9S A;  3SEZ A;  2HDW A;  5EGO B;  5K7F A;  2CUF A;  2K27 A;  4M72 A;  2DTZ A;  3ZQ7 A;  3CDL A;  4EM1 A;  3E1S A;  2MD5 A;  3QOE A;  3WGG A;  4BQO A;  5A2Q K;  5H6Q A;  5E1W A;  4AVP A;  3MMY B;  2V1D A;  4A69 C;  4ZH4 F;  2BW3 A;  2V1N A;  4RM3 A;  5AQC A;  4AWX B;  1BR2 A;  4JX4 A;  3DV8 A;  4Y17 A;  3VOK A;  1FYL A;  1DPU A;  1S29 A;  2NVQ J;  4E7Z A;  4ENK A;  1F5T A;  1IRF A;  1OCP A;  2PMU A;  1T56 A;  3HKZ N;  4HYE A;  4HLY A;  3GXO A;  3ROU A;  3U1K A;  3CCE I;  1X1C A;  4MIM A;  2M1B A;  4A3M J;  5DYM A;  1SD4 A;  4FIS A;  1E3P A;  5DV5 A;  1LE8 A;  1X2M A;  1IUF A;  1I3A A;  2DI3 A;  4L9T A;  4KN4 X;  5F04 A;  4RDU A;  4M6X A;  2QM3 A;  3G7R A;  2N8G A;  4ZYH A;  5KNL A;  4A3G J;  1IO2 A;  3HKZ A;  3ZMS A;  3WU1 B;  1TT5 B;  3ABL H;  2EV6 A;  4WF2 A;  3DKW A;  2DBB A;  3DBL B;  3PQK A;  3IUV A;  2EB7 A;  3FRQ A;  4II3 A;  2RNJ A;  2O8X A;  3HTJ A;  1DU6 A;  3I9V 2;  2XPW A;  2HKO A;  3V8K A;  2WAQ A;  4IQJ A;  2OI8 A;  2VLA A;  4OIN F;  3GFI A;  2REK A;  3PM1 A;  5FFX A;  3CD6 I;  1JUS A;  1JJ8 C;  1V4R A;  1MDM B;  4PGH A;  3VW2 A;  5EEA A;  4IRV A;  3VFZ A;  3JSP A;  3BTJ A;  3ZQF A;  3OYN A;  1HLV A;  4HW0 A;  3I56 I;  2OA4 A;  3BTI A;  4YFK F;  4E4H A;  2VKD A;  3KKD A;  5LD2 C;  2VE9 A;  2K3P A;  1WH5 A;  3NWT A;  4RAG A;  1B72 A;  3GFJ A;  5FO5 A;  5DS9 A;  1Z1D A;  2YVH A;  2KHM A;  2L5Q A;  5AIQ A;  4X6A J;  2GUH A;  1R6R A;  3LOC A;  5M3F J;  2MGQ A;  5E3N A;  2P6S A;  2FX0 A;  2CO5 A;  2ZSH B;  2V1X A;  2O9L A;  4CCJ A;  1D1A A;  4UVA A;  4BXU A;  4LGW A;  5C4Y A;  1BBY A;  1SD5 A;  2HPI A;  2QEX I;  4NN1 A;  2VC1 A;  2K9M A;  1SFO J;  5D4R A;  2DDB A;  4EVI A;  2DA5 A;  2P81 A;  4G94 A;  4Y7N J;  1ZAR A;  2KIS A;  1WJC A;  2DOE A;  1DP7 P;  3T6N A;  1S9H A;  2V9P A;  4RGR A;  1BI1 A;  2M34 A;  3FK7 A;  3IUO A;  3IRQ A;  5F0F A;  2H94 A;  2YX4 A;  4DGW B;  3PIP F;  1SFU A;  2L7F P;  4G8X A;  4UB6 C;  1E17 A;  5IP7 J;  3PFI A;  5HLI A;  4XL9 A;  1RI7 A;  3RKW A;  3CMA I;  2DOA A;  2XSJ C;  4MXM A;  2Q24 A;  3K7A J;  2RRE A;  3O6B B;  4B3X A;  1Z7L A;  2OTJ I;  2Z5U A;  2KZG A;  1IRZ A;  1FEX A;  2FJI 1;  1RKW A;  3HE0 A;  1OCR H;  3I59 B;  4G9Y A;  4IF4 A;  4II2 A;  1BR1 A;  2Q2E B;  4IHV A;  3E5Q A;  4L5I A;  2ESN A;  2VI6 A;  3VOX A;  1V5E A;  4KUM A;  2HDC A;  1MBK A;  4ESF A;  3OSG A;  2ZME C;  5DTD A;  3ON2 A;  2R7D A;  4AU7 A;  1XGS A;  2R7V A;  1UB9 A;  5LHH A;  2CWE A;  5EF6 A;  4XR6 A;  4D7N A;  1L0O C;  1MZB A;  4XKV A;  3JRA A;  1YYV A;  1R22 A;  3FXK A;  3LAJ A;  2PBX A;  1KU7 A;  4XKW A;  2MAB A;  2F4O B;  2VUM J;  4Q5S F;  2LF8 A;  2VKE A;  2EFO A;  3JTG A;  3CCM I;  1FJL A;  2X48 A;  5J40 A;  4XLF A;  2NOJ B;  3HYI A;  4LLL A;  1RES A;  2RGV A;  4LLG F;  5KCM A;  4DW6 A;  4F55 A;  2BY2 A;  1B1B A;  2ZFW A;  4HF2 A;  3MKZ A;  3V6G A;  2R3S A;  2DQR A;  1D1C A;  3D1N I;  3JSJ A;  3WHC A;  1WFX A;  3I64 A;  1UHS A;  5JI6 A;  3J81 K;  4B3A A;  2WWY A;  2IA2 A;  5EFY A;  5F6F A;  4YEJ A;  3OS1 A;  4A3J J;  2E60 A;  3N97 A;  4G6D A;  2DJI A;  4N9H A;  3BG7 A;  3IC7 A;  3W6J B;  4AUX A;  1RUN A;  1T39 A;  3V8J A;  3AFH A;  4GCL A;  5HS8 A;  1PP7 U;  4HKU A;  1XMK A;  3A01 B;  2BXY A;  1I27 A;  2ZME B;  3K4L A;  2L7M P;  2RVC A;  2L9V A;  5FKK A;  1W4M A;  2OER A;  4BAC A;  3DKY A;  3SXY A;  1AA7 A;  5D5W B;  1VQK I;  5HVQ C;  3M7G A;  2M4G A;  4M3G A;  2V1U A;  2DYS H;  3CDI A;  4XNF A;  5C44 J;  3EQL F;  4RS8 A;  3L1P A;  3OR2 C;  2W48 A;  4EJT A;  3QU3 A;  2E7W A;  2YSR A;  4RMN A;  3S2W A;  2YS9 A;  1MSF C;  1GXQ A;  5FLX K;  2F4M B;  3G4S I;  2OV7 A;  4BBS J;  2VOO A;  1ETW A;  2HXO A;  2GOM A;  2AS5 F;  4P1W A;  1A36 A;  4XID A;  1S6L A;  3ULQ B;  3TW6 A;  3DQV C;  1SMT A;  1GV2 A;  2GA1 A;  1TC3 C;  1WZ2 A;  2BE5 F;  3BP8 A;  5TIS C;  5M5W J;  2DOD A;  3S15 J;  1BA5 A;  4XRF A;  1KQ8 A;  2B1E A;  4UXN A;  1UCR A;  4NUB A;  2LMD A;  3ZQC A;  1DP3 A;  5FKM A;  5HDG A;  4L9N A;  3F6O A;  3WE2 A;  4OOI A;  1G8X A;  4EGZ A;  4J01 A;  4M3B A;  2QYO A;  2HQN A;  3K10 A;  3SDB A;  5EEH A;  1OFC X;  2XVC A;  4W1U A;  4XRS A;  2VBW A;  3KIO A;  5HLH A;  3LA2 A;  4PFP A;  5IYD J;  2NXN B;  3AG3 H;  4DJA A;  3C2B A;  1XSD A;  5K58 A;  2BXZ A;  3PL8 A;  1PUE E;  3H1C A;  3OR1 C;  3P7N A;  4IPA A;  2VJI A;  3FIW A;  4QIW N;  5BPI A;  3WE3 A;  4B43 A;  3F23 A;  3RIR A;  1B6A A;  4JX6 A;  3VPR A;  1O4X A;  2P0W A;  4HLX A;  3KCC A;  4LK1 F;  3EGQ A;  3BZC A;  2ZJP F;  1EKE A;  1ODD A;  2F5F A;  2V4J C;  3K4B A;  4L5J A;  2JK3 A;  3ZN1 A;  3LJL A;  4A3C J;  2YU9 J;  3CO6 C;  3GUD A;  5CVR A;  2L9S A;  4KMF A;  5HLT A;  3GTQ J;  3VVZ A;  2R7F A;  3OSF A;  2W1O A;  1O7L A;  1U5T A;  3BT9 A;  5LLQ A;  4BBR J;  4KIS A;  1SAU A;  1T8I A;  4NC8 A;  2QCO A;  1Z0X A;  3ELK A;  4ZTJ A;  1RET A;  4ANJ A;  1LDJ A;  2CW8 A;  2D1H A;  4ZTF A;  1QA6 A;  4GYI A;  2V79 A;  1FP2 A;  2DN0 A;  3MZY A;  2P7V B;  3HEF A;  3M07 A;  1SGM A;  3GLL A;  3NEU A;  3ZN0 A;  1QZY A;  2HZD A;  3LSK A;  5IPA A;  3S1N J;  3VW1 A;  3F9K A;  4A0X A;  1S3J A;  4MLO A;  2QBY A;  3SDG A;  3OV8 A;  4UVC A;  4CCN A;  4MFD A;  3TP0 A;  4B44 A;  3OMY A;  3ZMU A;  1Y39 A;  3K0L A;  1N77 A;  3CUQ C;  4RB3 C;  1ETV A;  1FBU A;  1OCO H;  2BW3 B;  3GLX A;  1UI5 A;  1IDZ A;  3VB2 A;  3A2K A;  1YRN B;  1KU9 A;  2IS1 A;  1KA8 A;  4F3Q A;  3HTU A;  2JWT A;  1BJA A;  3TED A;  3JW4 A;  4F91 B;  4B1R A;  3D5R C;  3I71 A;  1BOA A;  4BEH A;  2EIL H;  3GTK J;  1DGW Y;  5B3S H;  1MH3 A;  1LNW A;  5DDG A;  5LGN A;  4P9U A;  4I09 A;  2ZXJ A;  2WV0 A;  4KMU X;  1ZHF A;  3JAM K;  1G4D A;  2F5V A;  2NAZ A;  4ICH A;  5JFR A;  1C0W A;  1J9I A;  3QRF F;  1M1E B;  4D0P A;  3DTE A;  5B1B H;  3X2Q H;  1JT0 A;  2DMU A;  2A05 A;  3FXR A;  4P5O A;  3E6M A;  5H6R A;  3BCG A;  4AC0 A;  3ZMZ A;  1B4A A;  1PJR A;  3OIP A;  2FOW A;  4GCV A;  3LHQ A;  5E79 C;  1YQA A;  5CXG A;  4FAS D;  1YS7 A;  1QVU A;  2VIX A;  2KT0 A;  3ZP5 A;  4XOT A;  3QPS A;  4XLC A;  5L3D A;  4NQW A;  3FM3 A;  3CUQ B;  3SHF A;  5K5R A;  4CO8 A;  3FM5 A;  1H9T A;  5HLG A;  3C2H A;  3VTI A;  4XSZ F;  1HSJ A;  1WI3 A;  4HX7 A;  1Y1V J;  4FE7 A;  3PNT A;  3IH4 A;  1KU2 A;  4PDK A;  2LLK A;  4WCG A;  2YVX A;  4C9Y A;  3SZT A;  2O7T A;  2CQN A;  2DMT A;  4AYB N;  3JRE A;  3BR5 A;  1V5F A;  4ZZD A;  1FYM A;  1R23 A;  3HOW J;  5B66 C;  1OJL A;  3ZQI A;  1B59 A;  4G7O F;  4QWQ A;  3DPT A;  4IL6 C;  2M87 A;  1ZTR A;  2LP0 A;  4B48 A;  4OD5 A;  3HRU A;  1OCT C;  2DG8 A;  2AQE A;  1DUX C;  1B72 B;  2F07 A;  2XAJ A;  1MMG A;  2FOK A;  4BH9 A;  3U21 A;  1Z3Y A;  3KP2 A;  1GHC A;  1X3Z B;  3RI4 A;  3FMS A;  4WXC A;  4CH7 A;  3LQR A;  1V5G A;  1BIA A;  3H36 A;  3E6C C;  5DUK A;  1WH7 A;  3S93 A;  3KLN A;  3B02 A;  2DO7 A;  4KIB A;  5L3E A;  5J1Y A;  5J8C A;  3S1M J;  3QYB A;  2KIF A;  1HKT A;  4Z6Y A;  2L4M A;  1XN7 A;  4L9J A;  3G1M A;  3CCS I;  5CPR B;  3AG4 H;  4XLP F;  1CGP A;  2XSD C;  2QEN A;  3VOE A;  4GFB A;  5D1R A;  3OYH A;  1MNM C;  2RNG A;  2IA0 A;  4WXH A;  5CVI A;  3GFL A;  2PJR A;  3GEZ A;  1YW8 A;  4MFE A;  2D2W A;  1U8B A;  3PJR A;  2GZW A;  1GT0 C;  1BI2 A;  3TO9 A;  1JT6 A;  3H3V K;  4XM3 A;  3KEY A;  4ZYG A;  3JRG A;  3WU2 C;  2M7A A;  4MNU A;  2VT2 A;  3RTR A;  3T5X A;  4GFL A;  3HTS B;  4CSW A;  5CVV A;  4BQN A;  4HNV A;  1T0F A;  3IWF A;  3O8G A;  2HVS A;  4HQM A;  2GOX B;  4KYW A;  2E36 A;  3GW2 A;  1G6N A;  2WA0 A;  2PLY A;  3ONQ A;  3E6B A;  4ON0 A;  2FXA A;  6PAX A;  3O3K A;  4A6E A;  4Y33 A;  4ASN A;  4E70 A;  1RZ4 A;  2OCC H;  4EM2 A;  3I55 I;  1D8J A;  3TOB A;  4U9L A;  1EJ9 A;  3CCL I;  2L2O A;  3IAS 2;  3KZI C;  5HS7 A;  1ZYR F;  1NK2 P;  1OKR A;  4YII A;  3G73 A;  3UNG C;  3WTV C;  4HSR A;  3VW0 A;  5LRS A;  3FXM A;  3L2V A;  2E1O A;  1HQC A;  2ZNY A;  1UEL B;  1JXS A;  4F93 B;  4DIQ A;  3EDP A;  4I76 A;  1UZC A;  2X6X A;  2KDO A;  2ZNZ A;  5E1X A;  5D5X B;  2BOL A;  5KAF C;  1XMX A;  2V26 A;  2X4H A;  4CGR A;  1X2N A;  1D0Z A;  2O6G E;  3FK6 A;  2QTQ A;  2HOT A;  1F4K A;  2ME6 A;  3A0B C;  4A2U A; 
#chains in the Genus database with same CATH homology
 4FIS A;  1LE8 A;  1TWF J;  1X2M A;  1MH4 A;  1IUF A;  5F04 A;  4RDU A;  2NVY J;  4G12 A;  5EZH A;  3G7R A;  5BNG A;  2N8G A;  4I6Z A;  5IP9 J;  4A3G J;  1IJW C;  4FE4 A;  4A3K J;  1ZQ3 P;  1H8A C;  1SAN A;  4A3F J;  1MBE A;  3S14 J;  3IUV A;  1BW5 A;  3FRQ A;  4QTR A;  5FMP A;  2X9D A;  3CCY A;  2FJ1 A;  1I6H J;  3HTJ A;  1DU6 A;  2L7Z A;  2XPW A;  2OI8 A;  4FCY A;  3VUQ A;  2REK A;  2L9R A;  1D5Y A;  3BTL A;  2QWT A;  4L62 A;  3PM1 A;  3HGG A;  2Y9Y A;  5IOZ A;  3JRI A;  1JUS A;  1JJ8 C;  2ID6 A;  1AU7 A;  4KWA A;  3VW2 A;  5EEA A;  3K2A A;  3BTJ A;  3ZQF A;  3MVP A;  1FIP A;  1HLV A;  1VFC A;  1EF4 A;  3DCF A;  3JRC A;  3B6A A;  4M3D A;  2XPV A;  3BTI A;  3RQI A;  2B63 J;  3KKD A;  2L0K A;  3W6V A;  5HSZ A;  1WH5 A;  4DYC A;  4AF5 A;  1B72 A;  1ETX A;  5DS9 A;  2YVH A;  4X6A J;  2K9N A;  4A3B J;  3GTG J;  2GUH A;  3LOC A;  5M3F J;  2MGQ A;  5E3N A;  4UDS A;  2FX0 A;  5D19 A;  1K83 J;  2O9L A;  1TWC J;  2EQR A;  4UUT A;  4XRM A;  5C4Y A;  2CUE A;  5EDN A;  2R0Q C;  2G0E A;  4BXX J;  4NN1 A;  3HM5 A;  3IV5 A;  1SFO J;  5DAJ A;  2DA5 A;  2P81 A;  2H8R A;  4JL3 A;  4Y7N J;  2M2E A;  4UUS B;  2DA1 A;  3T6N A;  4J19 A;  2YUS A;  2DG7 A;  1ORK A;  2M34 A;  1BJZ A;  3FK7 A;  5M3M J;  2Y9Z A;  3ON4 A;  5F0F A;  2XB5 A;  1S7E A;  4ABZ A;  2L7F P;  3NI7 A;  2QF7 A;  1FIA A;  1MBF A;  5IP7 J;  3Q0V A;  2IBD A;  4BY7 J;  1DU0 A;  4GCT A;  1PUF B;  3LWJ A;  1U9O A;  1ZGW A;  1PUF A;  3QKX A;  2HDD A;  3OIO A;  3COL A;  4MXM A;  3HTI A;  2Q24 A;  3HOX J;  3AQT A;  3BR2 A;  3K7A J;  1QPI A;  3G56 A;  5F27 A;  3RD3 A;  1TWG J;  1MBG A;  1F36 A;  2G7S A;  5K7Z A;  1IRZ A;  1FEX A;  1RKW A;  4DZP A;  4BY1 J;  2MW8 A;  1MSE C;  3HE0 A;  2UXP A;  4D5C A;  3GZI A;  4IHV A;  2NS7 A;  3LSR A;  2G7G A;  2VI6 A;  1HCR A;  4CYC A;  9ANT A;  2E2I J;  2AO9 A;  3QBM A;  2R5Z A;  3I4M J;  1MBK A;  3OSG A;  5DTD A;  2ZOY A;  1JGG A;  3ON2 A;  4C3I J;  3BTC A;  5FKL A;  2ECB A;  4JYK A;  5EF6 A;  3LSJ A;  4D7N A;  5H9T A;  2LR8 A;  3JRA A;  2OF7 A;  3LNQ A;  4IHX A;  1JKP C;  2PBX A;  1MBH A;  2VUM J;  1GUU A;  2QOP A;  2VKE A;  2G3B A;  1P7I A;  5CW8 A;  5HBU A;  2NVX J;  3DPJ A;  3B81 A;  1FJL A;  2M8G X;  2X48 A;  1RES A;  1LFB A;  3RKQ A;  3MN2 A;  5F0C A;  4DW6 A;  1W0U A;  3V6G A;  1NTC A;  5IYC J;  2E2H J;  2D6Y A;  3D1N I;  3JSJ A;  3WHC A;  3HIM A;  1UHS A;  2DA3 A;  3Q0W A;  3BHQ A;  4B3A A;  5EFY A;  1IGN A;  5GP9 A;  4A3J J;  1GV5 A;  4EEF G;  3S17 J;  2WAQ N;  3BQY A;  4AUX A;  4A93 J;  1A6I A;  3HGY A;  3BNI A;  1WPK A;  4GCL A;  3BR1 A;  4HKU A;  2WGB A;  3A01 B;  2L7M P;  5FKK A;  2RHA A;  1LFU P;  3S1Q J;  2OER A;  1HDP A;  3F1B A;  4JX5 A;  3Q3S A;  3JRH A;  4XRS G;  2HOA A;  5FKN A;  1G2H A;  1ETQ A;  1IG7 A;  2ZOZ A;  3G1O A;  4M3G A;  4QSH A;  3NXC A;  5C44 J;  1TWH J;  1IC8 A;  3V78 A;  1ENH A;  2ECC A;  3L1P A;  1GDT A;  2K9Q A;  4ME9 A;  1FTT A;  2W48 A;  2VPR A;  1H89 C;  1MSF C;  4MO7 A;  2YS9 A;  2OPT A;  2JA5 J;  3DEW A;  2DJN A;  3BR6 A;  1VND A;  2Y31 A;  3HOZ J;  4BBS J;  4NDL A;  3GEU A;  1ETW A;  2XB0 X;  1ETO A;  2HXO A;  5EZG A;  3HOU J;  1T33 A;  5C3E J;  4V2F A;  4XID A;  3TW6 A;  4XIC A;  1GV2 A;  1TC3 C;  4XK4 A;  5HAW A;  1B8I B;  5M5W J;  2AHQ A;  1BL0 A;  3S15 J;  1BA5 A;  1B8I A;  3ZOB A;  1TWA J;  2FBQ A;  4M6V A;  3Q0U A;  3MNL A;  3ZQC A;  2ME0 A;  5FKM A;  2GEN A;  3ANP A;  4YZE A;  4X1E A;  2EZH A;  2EZK A;  5J1R A;  1AKH B;  4RBO A;  2EZI A;  3IH2 A;  4M3B A;  4ACI A;  3BG9 A;  2E2J J;  4D7M A;  4UUS A;  2ZCM A;  1I3Q J;  2NP5 A;  1OFC X;  4W1U A;  1GVD A;  4XRS A;  1RKT A;  1NK3 P;  5IYD J;  1UI6 A;  2R93 J;  5K58 A;  3C2B A;  3H0G J;  5M5Y J;  3HOY J;  2IEK A;  4DZJ A;  1XC5 A;  3PAS A;  2E19 A;  4Y52 J;  3FIW A;  4B4C A;  4QIW N;  2O8K A;  3O60 A;  2PMZ N;  4JX6 A;  3VPR A;  4LOC A;  1O4X A;  2UXO A;  3EGQ A;  2LFB A;  4C2M J;  3LJL A;  3NAU A;  4L5E A;  1XS9 A;  2JK3 A;  5E3L A;  2ID3 A;  4A3C J;  2YU9 J;  1JJ6 C;  3CRJ A;  5FJ8 J;  1R9T J;  1K61 A;  2JA8 J;  3NPI A;  3GTQ J;  2ELK A;  3VVZ A;  3S5R A;  1WGX A;  2XRL A;  3OSF A;  2G7L A;  2GFN A;  1W0T A;  3S2D J;  2CRG A;  4IHY A;  3BT9 A;  2EZL A;  2ZCX A;  2HYJ A;  1X58 A;  3HBL A;  4V2G A;  4BBR J;  3S1R J;  2QCO A;  3UKG A;  2XGD A;  2WUI A;  1Z0X A;  3IH3 A;  2QKO A;  1RET A;  2CQQ A;  2NS8 A;  3LSG A;  5GPC A;  1JKO C;  2R7Z J;  3I4N J;  5C4X J;  2XDN A;  3BRU A;  2ZB9 A;  3O8H A;  2DN0 A;  5JLX A;  3HEF A;  1SGM A;  5IPA A;  3S1N J;  3CJD A;  3VW1 A;  3PO2 J;  2XGE A;  3CMY A;  4PXI A;  4DYR A;  4MLO A;  2H1K A;  4FTH A;  3VOX A;  2DMP A;  1QRY A;  1A5J A;  2DA2 A;  2NVT J;  2IU5 A;  3SDG A;  3ZQL A;  2YVE A;  2LKX A;  1ETY A;  4MFD A;  3TP0 A;  3JRD A;  5E3O A;  2DMN A;  2WB1 N;  1RPW A;  2WV1 A;  5J1U A;  1ETV A;  5GPA A;  2JA6 J;  1H88 C;  2GM4 A;  5CXI A;  1UI5 A;  1IDZ A;  3PPB A;  2LY9 A;  3QPL A;  5IOY A;  3GBG A;  2X6O A;  3LSP A;  1YRN B;  1POG A;  2XPU A;  3B6C A;  3BG3 A;  1YRN A;  3KZ9 A;  4NEL A;  2JWT A;  1U9N A;  3TED A;  5C4J J;  2UXH A;  1BW6 A;  2Y2Z A;  4GFK A;  3ANG A;  3JR9 A;  4B1R A;  4JNN A;  3NRG A;  4IEJ A;  3GTK J;  3C07 A;  1MH3 A;  2JJ7 A;  3WHB A;  5D18 A;  2M0C A;  4W97 A;  2JN6 A;  3F0C A;  5EG0 B;  1JKQ C;  3SJM A;  2R5Y B;  4M3E A;  3VVX A;  2GBY A;  2R5Y A;  4ICH A;  3BR3 A;  4C3H J;  3A01 A;  4AC6 A;  1Z77 A;  1UG2 A;  2V57 A;  4A3L J;  1JT0 A;  1XG1 A;  2RAS A;  3KKC A;  4MK6 A;  2DMU A;  2NP3 A;  4A3E J;  2LVS A;  3A02 A;  4A3D J;  2HYT A;  3BCG A;  4AC0 A;  4S0H B;  1IDY A;  2CU7 A;  2GLO A;  3LHQ A;  3VVY A;  2HQ5 A;  5CXG A;  1QVU A;  2KT0 A;  2UXU A;  4JP0 A;  3QPS A;  3AQS A;  1ZR2 A;  2RAE A;  2FD5 A;  3HOV J;  3BJB A;  1WI3 A;  4FE7 A;  1Y1V J;  3A03 A;  3IH4 A;  3GTL J;  2LLK A;  3QQA A;  3S16 J;  2CQX A;  2DA6 A;  2O7T A;  3CQZ J;  2K40 A;  5M5X J;  2DMT A;  3TW7 A;  4AYB N;  3JRE A;  3P9T A;  5FLM J;  3BR5 A;  2FQ4 A;  2MSY A;  1ETK A;  1ZR4 A;  1F43 A;  3HOW J;  3BR0 A;  1OJL A;  3G1L A;  3ZQI A;  3E7Q A;  1AKH A;  1ZTR A;  2LP0 A;  1I50 J;  5EYR A;  1OCT C;  2KDZ A;  2DG8 A;  3EUP A;  1JUM A;  2LTP A;  3E7L A;  1B72 B;  2HOS A;  2F07 A;  1QVT A;  1ZKG A;  5F0H A;  4A3I J;  3FKI J;  3S2H J;  2VKV A;  5JLW A;  4JKZ A;  1JTX A;  1P7J A;  1E3O C;  1IV6 A;  2IAI A;  2TRT A;  2DA7 A;  2Y30 A;  1U78 A;  2I10 A;  1Y1W J;  1WH7 A;  2PZ9 A;  3RZO J;  3KNW A;  2ZCN A;  5J1Y A;  5FLV A;  3SFI A;  3S1M J;  3VP5 A;  3HDD A;  5FGL A;  3NNR A;  3ZQH A;  5E3M A;  3G1M A;  1VF9 A;  3BG5 A;  1JUP A;  2XSD C;  4GFB A;  5F1J A;  5D1R A;  1MNM C;  4C3J J;  2QIB A;  3VIB A;  4MFE A;  1VI0 A;  1U8B A;  2XGC A;  2Y0S N;  1AHD P;  1ZK8 A;  1GT0 C;  2D5V A;  3RZD J;  1JT6 A;  3TP3 A;  3H3V K;  1HDD C;  2TCT A;  1ITY A;  3JRG A;  1RR7 A;  3BQZ A;  3PO3 J;  2W53 A;  5FHP A;  2EBI A;  5FKO A;  3GTJ J;  4GFL A;  3OOU A;  3JRF A;  2JMW A;  1JTY A;  2R92 J;  1HOM A;  4M3F A;  1FTZ A;  2UXI A;  2K9S A;  4HNV A;  2M9H A;  2HXI A;  3O8G A;  4DYQ A;  5EGO B;  1HF0 A;  5K7F A;  2CUF A;  5EGO A;  2JA7 J;  2DTZ A;  3CDL A;  4BKX A;  4D5F A;  3NAR A;  2HI3 A;  4CYC B;  1APL C;  2O7O A;  5IYB J;  2R5Z B;  3CWR A;  4GCK A;  3ZQG A;  3RH2 A;  4A69 C;  3JRB A;  5IP6 A;  1NK2 P;  5K7H A;  1UMQ A;  3HTA A;  3VW0 A;  5AQC A;  2E1O A;  4JX4 A;  3M4O J;  2DA4 A;  4I76 A;  5HOD A;  3VOK A;  2LK2 A;  2LD5 A;  1Q1V A;  5F08 A;  1JKR C;  2COB A;  3GTO J;  2CJJ A;  3HB9 A;  2NVQ J;  2MG4 A;  3FIS A;  4CGR A;  1X2N A;  5EG0 A;  3HTH A;  1MBJ A;  2NOG A;  1WCM J;  1OCP A;  1T56 A;  3HKZ N;  3GTM J;  2DMQ A;  3FK6 A;  5J3L A;  2EH3 A;  2HOT A;  1CQT A;  2NX4 A;  2QTQ A;  3MKL A;  4MIM A;  2ME6 A;  4IHW A;  4A3M J;  1LE8 B;  3M3Y J;  2HKU A;  3GTP J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...