3IH2A

Tm1030 crystallized at 323k
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
HMLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator, TetR family
publication title 'Hot' macromolecular crystals.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
total genus 70
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2009-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ih2A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ih2A02
1XS9A 1I3QJ 3KKDA 2CRGA 2I10A 2LKXA 1JGGA 3CCYA 2R5ZB 2M0CA 1LFUP 2X9DA 3A03A 4BY1J 4Y52J 1LE8A 2JA5J 1P7IA 3IH3A 5JLWA 5FMPA 2R93J 1WCMJ 5HODA 2WB1N 3L1PA 4W1UA 4DYQA 3HOUJ 4MFEA 2GLOA 5F04A 5F0CA 5D18A 1RKWA 4IHXA 3AQTA 3BTIA 5FJ8J 2DMPA 1JTYA 4LOCA 3VIBA 4JYKA 1XC5A 3LHQA 3ZQGA 3RKQA 3RQIA 1MSEC 1ZQ3P 2EBIA 2DMTA 4L5EA 2K40A 1MH4A 4M3EA 5FLVA 1JT6A 2JA6J 1IDZA 4W97A 2KT0A 5JLXA 5M3FJ 3VVYA 1YRNB 3K7AJ 4XICA 2FX0A 1A6IA 4B4CA 4XIDA 2UXHA 2R0QC 3BG9A 3NPIA 1HDPA 3BTJA 1ZTRA 2DJNA 1XG1A 4EEFG 1X2NA 4ME9A 3PPBA 2K9SA 2LLKA 2ECBA 5IP6A 2GBYA 4M3FA 4NELA 1SGMA 4AUXA 2MG4A 3QQAA 2L9RA 3S16J 1ENHA 3FISA 1R9TJ 2QIBA 2FBQA 1P7JA 3LWJA 3C2BA 2L0KA 4A3CJ 2XRLA 4DYCA 2LFBA 1EF4A 5K58A 1GT0C 2K9NA 2DMQA 3QPLA 1WH7A 3B6AA 3JRIA 3O8HA 4GCLA 3Q0UA 3HTAA 5GPCA 3I4MJ 3PO3J 2JK3A 5C3EJ 2XGCA 3G56A 3JREA 1IRZA 4S0HB 3IUVA 3TP3A 4JKZA 3GTLJ 5M3MJ 3S1RJ 1U8BA 3I4NJ 5HAWA 4BBRJ 3S17J 2LD5A 1ETQA 1FTTA 1Y1WJ 1D5YA 2M9HA 2ZOYA 2VI6A 2E19A 1MBEA 5CXIA 2XPVA 3BCGA 5HBUA 5K7ZA 2M2EA 2OI8A 2LR8A 1E3OC 1QRYA 4UUTA 2DA4A 2R5YA 2HKUA 3CRJA 1GUUA 2ZCMA 3S1NJ 4XRSG 2DMUA 2ME6A 1QVTA 4I76A 2Y9YA 2ME0A 1VNDA 2LTPA 3WHBA 3H3VK 2GENA 4JNNA 4MIMA 1A5JA 2M8GX 4AC0A 2ECCA 2UXPA 3BR2A 3GTOJ 3ZQLA 2ID3A 3BR5A 2RAEA 3G1LA 3LSRA 2DA1A 3F0CA 3ON2A 3VP5A 3G1OA 3RZOJ 3BNIA 2JWTA 3CMYA 5FKMA 3BR0A 2R5YB 4A3GJ 2CUFA 4I6ZA 2HQ5A 2YUSA 2NVXJ 4CYCA 1BL0A 2OPTA 2Y9ZA 3GZIA 2MW8A 5IYBJ 3BR6A 3COLA 3QBMA 1GVDA 5EDNA 3JR9A 1HF0A 2NX4A 2ID6A 1HLVA 5E3OA 2E1OA 1B8IA 3A02A 1WH5A 2HI3A 3MKLA 3KKCA 1FIAA 5M5YJ 2AHQA 5IYCJ 5EYRA 2E2HJ 2XDNA 1MH3A 4MK6A 1YRNA 3ANPA 3CWRA 3RD3A 3CDLA 5EG0A 2YU9J 2R7ZJ 5F0HA 4L62A 2HOAA 2YS9A 4ACIA 2ZCXA 4G12A 5F1JA 1JTXA 2QCOA 3HDDA 1IUFA 4CYCB 3B6CA 4A3IJ 1MBFA 3ZOBA 4C3HJ 1ZR4A 2GUHA 1ETYA 3IV5A 3HGYA 5E3NA 4BKXA 1TWCJ 1B8IB 4A3FJ 2JN6A 4IEJA 5GPAA 3BG5A 4AF5A 3WHCA 1BW6A 2LK2A 1JUPA 1JT0A 3KNWA 4AC6A 3LJLA 3DPJA 3VVXA 2EH3A 5EG0B 3PASA 2M34A 1LFBA 3EGQA 1GV2A 1MBGA 2EZIA 2V57A 5HSZA 3DCFA 1IJWC 4A3DJ 2DG8A 2RASA 5D19A 4YZEA 1UI6A 2DG7A 5CW8A 2IU5A 3Q3SA 3JRGA 3FK6A 4A3EJ 2HDDA 2NP3A 4DYRA 3S2DJ 3EUPA 4A93J 3PM1A 3IH2A 2PBXA 4NN1A 2G0EA 2ELKA 1APLC 5E3MA 2H8RA 2LP0A 1ORKA 2L7FP 4FE4A 5E3LA 3HOWJ 1BW5A 5C4YA 2JA8J 2FQ4A 3HTIA 3S15J 5IP9J 4QTRA 3BG3A 3O60A 4XRSA 4Y7NJ 5GP9A 5M5XJ 3HOVJ 3VW0A 1OCPA 1I50J 4JX4A 4C3JJ 4UUSA 2JMWA 1VI0A 1JKQC 3LSJA 3HOZJ 2G7GA 1UG2A 5EEAA 1MBKA 4XRMA 2EZKA 1QPIA 3BR3A 5FKLA 1MBJA 5H9TA 1AKHA 2HYTA 3VUQA 4JP0A 2EQRA 3FRQA 4MLOA 3HTJA 2NVYJ 2CUEA 5C44J 2XPUA 2QF7A 5FKOA 2E2JJ 3NAUA 5J3LA 4JL3A 2OERA 5C4JJ 2HOSA 1OCTC 5K7HA 3RZDJ 1UI5A 2X48A 5C4XJ 1FEXA 1GV5A 3JRCA 1I6HJ 1DU6A 2COBA 4UUSB 1JKOC 3HM5A 2QOPA 9ANTA 1FJLA 2EZHA 3O8GA 3B81A 1IDYA 4MFDA 5IYDJ 2B63J 2PZ9A 4B3AA 4BY7J 2D5VA 2Y0SN 2EZLA 5M5WJ 1OFCX 1AKHB 1MNMC 3DEWA 2XSDC 1Q1VA 2UXOA 2RHAA 3D1NI 3G1MA 1TWFJ 3TW6A 1U9OA 3TEDA 2VUMJ 1ETKA 3KZ9A 2L7MP 3ZQIA 3A01B 1CQTA 2MSYA 2GFNA 3ZQFA 5J1YA 3OSFA 4D7NA 1JJ6C 3HTHA 5CXGA 1RR7A 2XGEA 1IG7A 2LY9A 2E2IJ 3E7QA 4CGRA 1VFCA 4M3BA 1X58A 5F27A 3FKIJ 1QVUA 1RKTA 4FISA 4HNVA 1ETWA 3OIOA 3TP0A 3S1QJ 2YVEA 3W6VA 3OOUA 1O4XA 1WPKA 3NRGA 2IEKA 5FKNA 5AQCA 2CQXA 5F08A 4IHYA 1FTZA 2DA7A 4ABZA 1ZK8A 3FK7A 4M3DA 5IOYA 3GTGJ 2VKVA 2LVSA 2CU7A 3HGGA 3SFIA 4RBOA 3NI7A 4PXIA 3JSJA 3LSPA 1JKPC 1AU7A 2XB0X 1BA5A 2CJJA 3TW7A 3Q0WA 3G7RA 4GFBA 3HE0A 2XPWA 4J19A 2X6OA 2IAIA 5EZHA 5D1RA 3BR1A 4M6VA 1ETXA 1JJ8C 3HEFA 4X1EA 2FJ1A 1B72A 3VOKA 3CJDA 4BBSJ 1RPWA 4GFKA 3HBLA 5EFYA 2UXUA 2DMNA 3GEUA 2DTZA 3S5RA 5DAJA 2ZCNA 2WAQN 4DZPA 4UDSA 4A3KJ 4QIWN 3BT9A 3V78A 2P81A 3NARA 2REKA 4MO7A 5K7FA 2HOTA 3ZQHA 3HKZN 1Z0XA 1Y1VJ 4GFLA 1NK3P 2QWTA 1S7EA 1K61A 2XB5A 1K83J 2QKOA 1TWAJ 1TWGJ 2WV1A 1FIPA 3E7LA 2Y2ZA 3VW1A 2DA5A 3S2HJ 3BHQA 5F0FA 5DTDA 1NTCA 5J1UA 1NK2P 1U78A 4FCYA 1B72B 3GTQJ 2JJ7A 4X6AJ 2K9QA 2ZB9A 3NNRA 1ITYA 1AHDP 3H0GJ 3MN2A 2HXOA 1LE8B 2NVTJ 2VPRA 3HB9A 4D5FA 4KWAA 3GTMJ 5IP7J 3SDGA 1ZKGA 1MSFC 4HKUA 3VVZA 2TRTA 2VKEA 4XK4A 2KDZA 4V2FA 5J1RA 4JX6A 1JKRC 3GTKJ 4A3BJ 5IOZA 3HIMA 2L7ZA 3K2AA 3P9TA 4A3MJ 1BJZA 4IHVA 5FHPA 4C2MJ 3LNQA 1U9NA 3BTCA 1HOMA 3T6NA 1ETVA 1WGXA 4FE7A 5EGOA 2ZOZA 3SJMA 1W0TA 4GCKA 2G7SA 2H1KA 3GBGA 2JA7J 2G7LA 3VPRA 1IC8A 1H88C 1VF9A 4A3JJ 4IHWA 2NOGA 1IV6A 1RESA 3M3YJ 3OSGA 3M4OJ 3PO2J 3GTJJ 4M3GA 1RETA 2Q24A 4B1RA 2WGBA 3BQYA 2Y30A 3Q0VA 2D6YA 1T56A 3QPSA 3A01A 4V2GA 5FKKA 5IPAA 1JUMA 3BQZA 2WUIA 3VOXA 3V6GA 1OJLA 3JRAA 4DW6A 4NDLA 5BNGA 1POGA 1TWHJ 1MBHA 5EGOB 4BXXJ 1ZGWA 1F36A 2DN0A 2NVQJ 2R92J 4C3IJ 4FTHA 3S14J 1UHSA 3RH2A 3CQZJ 2HYJA 3JRBA 2F07A 5FGLA 3VW2A 3JRHA 4DZJA 2DA2A 1GDTA 2HXIA 1JUSA 3BRUA 1G2HA 1SFOJ 1HDDC 3JRFA 2N8GA 1WI3A 3S1MJ 3QKXA 1X2MA 4D7MA 1W0UA 3LOCA 3BJBA 4A69C 2UXIA 5EF6A 4A3LJ 2PMZN 2AO9A 1PUFA 1F43A 2W53A 2YVHA 3HOXJ 2Y31A 3ZQCA 4RDUA 2O7TA 2O8KA 2FD5A 4D5CA 3IH4A 2DA6A 1IGNA 3AQSA 2NS7A 2OF7A 4JX5A 2XGDA 3F1BA 1SANA 2R5ZA 2O7OA 1DU0A 4QSHA 3ON4A 1ZR2A 2CQQA 5EZGA 3MNLA 1H8AC 4ICHA 3MVPA 2O9LA 5FLMJ 3LSGA 2QTQA 3HOYJ 3C07A 1T33A 1HCRA 1TC3C 2DA3A 3FIWA 1UMQA 1ETOA 3BTLA 2NS8A 1H89C 2G3BA 1Z77A 2TCTA 3UKGA 3GTPJ 2NP5A 3ANGA 2MGQA 2IBDA 3JRDA 4AYBN 5DS9A 1PUFB 3NXCA 2W48A 4MXMA 4GCTA 2GM4A
chains in the Genus database with same CATH superfamily
5ICFA 2MC4A 1HXDA 2GXAA 2O6GE 2A05A 3KKDA 3CCYA 4F7ZA 5J40A 2PFVA 5AIPA 3A03A 1F1ZA 3R4KA 4Y52J 1EH7A 1KZHA 5FMPA 1WCMJ 3ABUA 3L1PA 4W1UA 3DKWA 2M87A 3CC7I 5F04A 3F22A 1E2XA 3DFGA 3AQTA 3BTIA 4XL9A 2ZJPF 2DMPA 4E7HA 3VIBA 4RLFA 1M1EB 2RVCA 3M9AA 3RKQA 3HKZA 4GXOA 1MSEC 3O2PE 2EBIA 3IC7A 4NNJA 2DMTA 1BIAA 2K40A 4M3EA 4MTEA 2PLYA 5FLVA 3F8FA 2X85A 1IDZA 1TQMA 1BIBA 3F8MA 4W97A 1D0XA 2FE3A 3VEPA 4AU7A 2Y75A 2B9SA 3FF5A 4CCNA 2MD0A 2K86A 3FXQA 5IT9Z 1A6IA 1WJEA 4B4CA 4YRVA 2KLOA 3NPIA 3BTJA 4LD5A 2NVUB 1TT5B 4EEFG 2PJRB 1MD0A 1TL8A 3SFZA 2K9SA 2DK8A 2OZUA 4YELA 1K4TA 4IX7A 4G7OF 1DQUA 1LJ9A 1SGMA 3OV8A 4AUXA 2XAQA 3ZMTA 3ASOH 3S16J 3U1DA 2P8TA 1LVAA 3FISA 1IZ1A 2GQQA 3S3MA 2A61A 3ZMUA 2KJCA 2L0KA 1UHMA 3BJOA 3RIRA 4E7KA 2CWEA 2UUZA 2K5CA 2K9NA 4HA8A 3BC8A 3BZCA 4IZZA 4GCLA 4U0YA 3O8HA 4L18B 5HLGA 3C7JA 3VYRB 2DXIA 1X3ZB 5C3EJ 2ZSIB 2IJLA 4XOPA 3JREA 4HLYA 5TGTA 3CDIA 5DCMA 1TZLA 2EILH 5E18F 2F4IA 2LKSA 4MTDA 5B66C 2Q8KA 4BBRJ 3AKZA 1MDMA 1FTTA 4LB5A 3H5NA 2FBHA 2L02A 2B0LA 4BYYA 2VI6A 4WF2A 1ZRCA 2B1EA 1MBEA 3A0BC 3DPUA 1W7PD 1O3TA 4IF4A 2EV6A 2RQQA 1LVKA 3OYLA 5H2FC 2LR8A 2IPQX 2MABA 2BEOA 5DCFA 1E3OC 2DA4A 2R5YA 3I54A 1SVOA 3IP4B 5GAEJ 1TW3A 1VQOI 4XRSG 2VLAA 3IHUA 1WWXA 2DFEA 1VQNI 1OQYA 3E6MA 3LSIA 2GENA 2LRDA 5IT3A 3OMYA 1D0YA 1HW1A 4AC0A 5JR3A 2LF8A 3BR2A 1D1CA 3ZQLA 1J7KA 4KA4A 3RJPA 2E1MC 1A6QA 3F8NA 3OR2C 3LSRA 4CYDA 2OAZA 5JHFA 1K6OA 1D8KA 2V79A 3Q9VA 2XVCA 1V3FA 5LBQA 3PUBA 3SZTA 3KP2A 4AYBA 3C1DA 5ICCA 4YG2F 4CYCA 1IRGA 1XCBA 3H9QA 5H6RA 2MW8A 1RUNA 1G3SA 1PVEA 1WJ5A 1HF0A 5LRRA 4XKVA 4BQAA 1U2WA 1T2KA 2YVXA 3FZVA 3MZHA 4XOTA 1WH5A 3KKCA 3K70D 4HDUA 3RPUA 1HA8A 1Y0UA 2PN6A 1MH3A 3MZYA 3G71I 4U7BA 3DKYA 3P9IA 3QOEA 4LITA 3ZRGA 4QWQA 4P9FA 2YU9J 2WB1A 4Y15A 5J6XA 3JTGA 1ACIA 2MH2A 2HOAA 1UAAA 3BCAA 2YS9A 3SQNA 3RQ4A 3CUOA 1MBFA 3IV5A 4QLCU 6PAXA 3J7ZI 1T95A 1Y8QB 1TWCJ 2A5WA 3BWGA 3CMMA 4IEJA 4A3FJ 4YFNF 2E1NA 3OOPA 4A2UA 1YE9A 3K4LA 3IRQA 1JUPA 4K2EA 3GFIA 4AC6A 4UV9A 3CLQA 4EJUA 3GZ5A 2M34A 2WAFA 3CC4I 4I02A 3EGQA 1MBGA 2EZIA 1IJWC 1XGNA 1GXPA 1F5TA 3WG7H 2BBYA 2RASA 4YZEA 2DG7A 5D19A 4HNTA 4WX9A 1DP3A 3WTUC 3FK6A 4A3EJ 3HPHA 2HDDA 1HKQA 3S2DJ 2IS1A 1VZ0A 2R7RA 3EUPA 1Z9CA 2PBXA 2G0EA 4FX4A 1APLC 2H8RA 4PCQA 2LP0A 2L7FP 1MMDA 3R0JA 2UZKA 1ZG5A 2IGOA 5E3LA 2XAFA 2V1NA 1BW5A 5L3GA 2WWYA 3F8CA 1BR4A 3O60A 3HOVJ 4A3GJ 4RM2A 2KZVA 4HX4A 4JX4A 3TO6A 4L9JA 4C3JJ 5ILVA 4UUSA 2Z99A 4ESJA 2ZFUA 2EZKA 2JSPA 3CP2A 1HQCA 1QPIA 1X1BA 1I39A 3BOQA 4CUGA 3E6DA 1FOWA 1MBJA 2ZCWA 4L5IA 2FRHA 2HYTA 4JP0A 4MLOA 4HQMA 2NVYJ 4HRIA 5J8CA 1REPC 2QF7A 2GA2A 3MFKA 3PFIA 2VIXA 5HOOA 1KU7A 2OERA 3E0JB 2HOSA 1OCTC 2XKPA 5K7HA 4HYEA 3RZDJ 1HW2A 2HU9A 3KP3A 1RNLA 3K4MA 3M8JA 1FOXA 2HZDA 3B02A 1QZYA 2BZTA 1OLTA 2G7HA 1SFEA 2VQGA 2WC2A 1YFHA 2COBA 1DU6A 4G94A 1FEXA 3ABLH 3S2WA 3DV8A 1FJLA 2EZHA 4MFDA 1SD4A 5FRNA 2PZ9A 4N4NB 4BY7J 1WKMA 4BQNA 2ISZA 2EZLA 2OCCH 3AFHA 5LEKA 2ZMEB 3N05A 3SHFA 1Q1VA 1MJ9A 4IRHA 2XUBA 3G1MA 4XORA 4S04A 1ZELA 4EM0B 3REOA 1AOYA 4F93B 2F5FA 1W7PB 2IW5A 1G6NA 2FXAA 4KIFA 4PJJA 3ZQFA 3FKJA 3OSFA 2MYSA 4D7NA 2NXNB 5JFRA 1O3SA 1IG7A 3I5UA 3DBRB 3HTHA 1T0FA 2A5YB 3LMMA 3ROUA 3I64A 2E2IJ 3E7QA 2R7OA 3W2AA 4O6JA 1X58A 3FKIJ 2XF6A 2R4GA 4E7LA 1QPMA 3WGHA 4R79A 3K0LA 1ETWA 3S1QJ 2HNHA 1X4OA 2YVEA 3W6VA 3PQKA 1FC3A 1WPKA 3NRGA 2IEKA 4IHYA 1KA8A 2DA7A 4ZC3A 2V4JC 2QQ8A 4ABZA 1X19A 3GTGJ 4J00A 2LVSA 4BEHB 3OS1A 4PXIA 5E8GA 4RB3C 2I5UA 3T8RA 1BA5A 3M07A 3OYHA 2R7SA 3TW7A 4LK1F 3QODA 4LFUA 4RGSA 4U88A 3EYYA 1QO0D 3IKVA 2NNNA 4H4KC 2A6HF 2EA4A 1ETXA 3BR1A 4AIDA 1YJWI 4A5MA 2DLLA 1R23A 3FXJA 1B72A 2STWA 4EJOA 1QA6A 4BBSJ 3GCMA 3U1KA 3JSOA 1U3EM 4EM2A 1TQPA 3TL4X 2UXUA 2BOLA 4I0AA 1HSJA 4IQJA 4F55A 2KQRA 2LSOA 5B5EC 1OCRH 4KN7X 1I1GA 1X3WB 4WXDA 2V7FA 1NH3A 3DPLC 3PNVA 4GFLA 2KP6A 1S7EA 1KONA 2QKOA 3VW1A 3E7LA 1FIPA 1Z91A 2DA5A 4HV5A 5F0FA 1NTCA 5J1UA 3IAM2 4CO8A 2PMHA 4IL6C 2ZB9A 4XKCA 3NNRA 3SZPA 3CC2I 2NYXA 2AQEA 3TKYA 2NVTJ 1DGRM 1XDUA 3WU1B 4DVYP 3GTMJ 1MSFC 2OTLI 5EEGA 3KYLA 2WY8Q 2YSRA 4MQ9F 4V2FA 4C30A 5J1RA 4A12A 1V5GA 3KLNA 3V4GA 2CFXA 3ERMA 3UR3C 2CQNA 3V8KA 2CSOA 2D2WA 3LNQA 1OCCH 3CD6I 1TP4A 1JHFA 4U7DA 4LK0F 3T6NA 5LHIA 4FE7A 3CP8A 4P9UA 3H3UA 1B9NA 2H1KA 3GBGA 3WU2C 5CQGA 2LOOA 1W1WE 3HJEA 4UY8I 1VF9A 2NOGA 5BMZA 1L3LA 3I55I 3WTTC 3EYIA 1RZ4A 5LHHA 2Y30A 4MEXF 2D6YA 3KETA 2CFOA 2P0WA 1I6XA 2WUIA 3SDBA 5LLQA 3LSKA 2JPBA 3FM3A 5TJJA 4BU2A 3V6GA 3JRAA 4NDLA 2X4HA 1WI9A 3F8BA 2E34A 4HSRA 1ZGWA 4E7ZA 4N9HA 2NVQJ 4OWRB 3S14J 2CW7A 1UHSA 2W85A 3RH2A 2CV2A 3TDZC 2IXSA 1XCVA 3K4CA 3JRHA 3GO5A 4M73A 1JUSA 3ZP5A 2K02A 2W25A 3SYTA 4XLAA 3OWTA 1U5TC 1SFOJ 1WI3A 3QKXA 1MMAA 1X2MA 3TOAA 4NC6A 3BJBA 1I27A 2JUGA 4A3LJ 2PMZN 2EIJH 3O6BB 1D8JA 3MKYB 1D3YA 2O8KA 2FD5A 3D5RC 2QM3A 4FX0A 2BGCA 2ESHA 2NS7A 4JX5A 5GADJ 2XGDA 1WSUA 1XD7A 2R5ZA 4ZYGA 2MD5A 1W36D 1IF1A 2BY0A 5D8KB 1B6AA 3JSPA 2CQQA 3MNLA 1H8AC 1FY7A 2O9LA 3LSGA 2QTQA 2QUFA 1U6GA 4WXHA 3C07A 2XRNA 2M8EA 3MAJA 3PL8A 2VQLA 3ZPLA 4HF1A 1ETOA 4F91B 2NS8A 3ANGA 1Z77A 4ANJA 3UKGA 2PQ8A 2MGQA 4XKWA 1YW7A 2IGMA 2IBDA 2VJIA 1PUFB 4CZZA 1XS9A 2UWMA 1FPQA 2EFPA 4XLNF 1I3QJ 4P1WA 2I10A 1JGGA 1UB9A 1LFUP 3FXKA 4KMFA 2NOJB 4BY1J 1LKXA 3CZ6A 5D4RA 5JLWA 3FX3A 2X1DA 2M30A 3RPUD 5H20A 3FDYA 5DD8A 3HOUJ 2PEXA 4MFEA 2CW8A 3FHZA 5JI6A 5F0CA 5D18A 3BROA 3LAJA 2F4MB 3CO7C 3IRRA 3AG4H 4KIBA 1KQ0A 1KQ8A 4EJTA 3KZYA 4JYKA 1T39A 3LHQA 1QZZA 1UG0A 4HDVA 4L5EA 2E36A 4IHTA 4KYWA 2E1CA 2Z1DA 4FT8A 2V9PA 3E6CC 5D6FA 1Z05A 4LJZF 4DQ2A 5ICGA 1XN7A 2JA6J 4TV7A 3CCSI 4HEA2 4DBRA 1FBSA 5M3FJ 2XIGA 3OYIA 2X1EA 2FOWA 1O3RA 2DJNA 2IA2A 2O03A 1G59A 2ZXIA 1BOBA 1OYYA 2DDAA 3K1MA 3LSTA 4CCJA 2VJ4A 2KIQA 4RAFA 4LMYA 5HLIA 3QQAA 1XMKA 2QA4I 3N4MA 4II3A 2HS5A 4E7JA 1LB2A 1B9MA 2X51A 3VYSB 2P7VB 2COMA 2STTA 4I09A 4M74A 3AL0C 1TW2A 1P4AA 3M1EA 5LD2C 2M4KA 4G7ZF 5K58A 4WXCA 3EETA 4PJMA 3Q0UA 4XLHA 1YS6A 3H5RA 2QQBA 5GPCA 3PO3J 1YOVB 2JK3A 2A68F 4CDGA 3HOSA 2XGCA 3WGGA 3ZR8X 3G56A 3W6KB 3FWEA 2VBWA 1T8IA 2QKMB 3A0HC 2G9WA 1N78A 3BPVA 4RS8A 2K3PA 5M3MJ 2YU3A 2P6TA 3A2KA 1OR7A 5HAWA 4BQOA 2LD5A 4UUVA 3KCCA 5D5XB 2E19A 2ZXHA 2Z16A 1ZYRF 3E5UA 4OD5A 3VTIA 3I58A 2OI8A 4S05A 2HPIA 3BP8A 3TQNA 4AVPA 4XRFA 1PP7U 2CV1A 4KIGA 1QRYA 3CRJA 1GUUA 4HG2A 1YITI 1J75A 2ZCMA 2EV0A 1HBXG 3COAC 2DMUA 2HZTA 2E7WA 2ME6A 4B43A 2VONA 3P7NA 2H1LA 4B48A 4FASD 5DCMB 5FFZA 3ZQQA 4IRVA 2ME0A 3QPHA 1N77A 1IUYA 2V9VA 2KMUA 1NG7A 2VE8A 1TTYA 3CJNA 3HSEA 2ID3A 2DA1A 4GYGA 5HNFA 3VP5A 4PDKA 3M8EA 2JA2A 2KIUA 4M9XA 2KFDA 5FKMA 1TBXA 5KCMA 3BR0A 1MNDA 2R5YB 2LH9A 1FYMA 2CUFA 2RKHA 4HX8A 4I6ZA 2HQ5A 2YUSA 4UVCA 2NVXJ 2KHMA 1IRFA 2Y9ZA 4JOMA 2BW3B 2R7DA 5D5VB 4DOZA 2JTVA 5E3OA 5FO5A 1FIAA 1OMIA 2ZY9A 5IYCJ 3F21A 4XONA 3QP5A 2XDNA 2WAEA 5DDGA 4MK6A 3CMEI 4EATA 1YYVA 3ANPA 2EFOA 5EG0A 4CICA 1YIJI 3ZN0A 2EV5A 5HS8A 4N9IA 2CGPA 2VBYA 3OYCA 1PJRA 2YX4A 1P4XA 1ULYA 2ZNZA 4G12A 2DBBA 2QCOA 2D45A 4CYCB 4A3IJ 3ZOBA 3IWZA 1KGSA 3ZMZA 4BGDA 1ODDA 4ZYDA 3CCRI 3CCJI 2I8DA 3OL3A 3CDHA 5E79C 1S7AA 2D1VA 5LFAA 1S6LA 4BKXA 4AF5A 1P4WA 1BW6A 2HQNA 2LK2A 2MFZA 4EMSA 4KISA 2H6CA 4A5NA 4I01A 3DPJA 2DQRA 3E97A 1LFBA 2ZBKA 5HSZA 1XGMA 2BY2A 5DYMA 4A3DJ 3G4SI 2FSWA 1UI6A 4P96A 2LY1A 2XF7A 3L00A 3G73A 2NP3A 3DLAA 5LRSA 4PFPA 4CCLA 4NHJA 3LL7A 2RC4A 1YS7A 2HEOA 1O57A 1K79A 3GW2A 1EJ9A 3KZIC 3HOWJ 2GWRA 4R8HA 5FROA 3DWLE 2XV4S 1X1DA 1BR2A 4QTRA 3KPHA 2VBZA 1R58A 3HC7A 4XRSA 4Y7NJ 1RC9A 3VW0A 4RGRA 4XR6A 3V7SA 2WV0A 1PUEE 2K7LA 1S8NA 5BPDA 3LSJA 2PI0A 3GEZA 3HOZJ 1UG2A 2AQFA 5EEAA 2E60A 3E5QA 4GDFA 3Q9SA 2ZKZA 4AIJA 3V42A 2B7EA 3DBHB 2WBMA 3BZKA 4M6XA 2NS0A 5FKOA 4ZTFA 3NAUA 5J3LA 4JL3A 1R1TA 2DO7A 2JT1A 5L3FA 4IRIA 1R36A 2DFFA 1BI1A 3ABKH 1I6HJ 4LGWA 4BXUA 4UUSB 1JKOC 9ANTA 3CF5F 4M6YA 2OA4A 4KJZA 1ON1A 1IDYA 1EH6A 2O0YA 3B73A 2B63J 1HKSA 3UNGC 4B3AA 2KIFA 2D5VA 4Q4ZF 2Y0SN 2BW3A 3C18A 2GA1A 2VQHA 4GCVA 1QBJA 4IKFA 3F72A 2O5RA 5E1XA 3DEWA 2UV1A 3JTHA 4LLNA 4ZDOA 1S9HA 1SD6A 1LEAA 1V5EA 3CLOA 4CH7A 1DUXC 1JXSA 1U9OA 4PZJA 1CQTA 3A01B 5FFXA 5J8FA 1IXCA 2DQLA 3ONQA 1RR7A 1WZ2A 2X0LA 3DTKA 4IO9F 1H9TA 2IS2A 3P9CA 3OYEA 4M3BA 3BCBA 4G8XA 5F27A 4ZYEA 3KYDB 3K4JA 1RKTA 1YQAA 5JHUA 1FYLA 3D5LA 1XMXA 2VT2A 2JUCA 3WTYC 3CCMI 2LBFA 4GRIA 5CVIA 4ZYHA 3N97A 5F08A 2HVQA 2XF5A 5IOYA 3PSFA 4AWXB 5E20A 2QSGX 4RBOA 3HGGA 3SFIA 1IN8A 3JSJA 3HZJA 2VASA 4I0BA 1WRJA 2QGUA 4FETA 2DCEA 1UCRA 2F5VA 2K3FA 2YPRA 4GFBA 4MNUA 4J19A 4BJ6C 2ZC2A 2VN2A 3L9FA 4BHBA 5EZHA 2W53A 2R7WA 1SFUA 3RYRA 1SC7A 1Y56A 1OPCA 2EJRA 4E7SA 2A2FX 3CJDA 3K1PA 4GFKA 3BY6A 1QQIA 3TGNA 4IJAA 4CXFA 2MH9A 5CLSA 2HR3A 4DZPA 4A6DA 4RGUA 4A3KJ 5A2QK 1CF7A 4NC8A 1VQ8I 3NARA 5KVRA 2REKA 4GO1A 4MO7A 5HS9A 1C0WA 2E5ZA 1VQ7I 4HF0A 1QU3A 3HKZN 1NK3P 5K5RA 1JGSA 2XKOA 2XB5A 3ZCOA 1ZHFA 2K27A 3TMOA 3S32A 3BHQA 4C2MA 1NK2P 1A35A 2FNAA 1U78A 1B72B 1R7JA 3NWTA 3GTQJ 4E4HA 4NC7A 1U0JA 2K9QA 2P5KA 1IN5A 5HVQC 1AHDP 4KWAA 2VPRA 4D5FA 5D4SA 3VVZA 4HX7A 2VKEA 3C2HA 3HRUA 5F6FA 2QWWA 4JX6A 1JKRC 3GTKJ 5IOZA 3PIOF 4LLLA 3A1YA 3K4KA 4WIBA 3HTUA 4EQQA 5FHPA 4MEYF 4C2MJ 2V6CA 4KFCA 2OTJI 1IRXA 2CH0A 1V5FA 2G7SA 3VPRA 4F52A 1R00A 2EINH 2HPMA 1H88C 1ZARA 3HIFA 1RESA 4FQGA 4I98B 3M4OJ 2IA0A 3CMAI 3HUGA 4M3GA 2FU4A 3MZ8A 4WWCA 3ERED 2Q24A 2WGBA 3GYHX 1T56A 1ZH5A 2ZXWH 3A01A 2HYFA 5FKKA 4F3QA 2V26A 3I9V2 3K9TA 5CVVA 4B09A 1DDNA 2DU9A 3J81K 4M71A 1OJLA 4DW6A 1TNSA 5BNGA 1TWHJ 2XAUA 5E1ZB 3W2VA 5FRMA 4Y13A 3LWFA 2R92J 4FTHA 2H94A 2FOKA 3CQZJ 3JRBA 2ZMEC 1PP8F 3QU3A 3VW2A 3LA2A 3WE3A 1GDTA 3F3XA 2L9VA 3BRUA 3CUQC 2LY2A 4WK8F 3QYBA 4V19K 3GFLA 2VC1A 1S29A 3RCOA 1W4MA 2AO9A 2EFNA 1W5CC 3F23A 4BACA 4HZFA 3DQVC 1SFXA 3GZ6A 2YVHA 3ZQCA 2O7TA 2CW0F 2OD5A 1BC8C 5HDGA 3F1BA 1OKRA 1SANA 2ELJA 4F92B 1DU0A 3ON4A 4PGHA 4XBFA 1ZR2A 3BLYA 1P92A 3LA7A 5EZGA 2K9LA 4NB5A 4OAYA 3SEZA 4ICHA 2KIMA 1LQ1A 3HOYJ 1T33A 2HKXA 1TC3C 3OYJA 3E3VA 2DA3A 5B1AH 3PIPF 2DOFA 1R71A 3FXRA 2TCTA 1V55H 2DOAA 3NXCA 4AYBN 5DS9A 1FBUA 4MXMA 2GM4A 5KAIC 3CCVI 1Z3YA 2WA0A 3DEEA 1FX7A 4Z6YA 1FBQA 2CRGA 2CQKA 2LG4A 2R5ZB 2Z5UA 2X9DA 2ZXJA 1R5GA 4U87A 2ESNA 1F9NA 1FSHA 1IN4A 1KU9A 5E8IA 3WTWC 1EH8A 1A31A 2JA5J 1P7IA 1WHUA 3GFJA 2EFWA 2NRAC 2G7UA 1K78A 3ELKA 5HODA 3E1SA 1Z67A 2QVOA 2WB1N 4II2A 5CPRB 4RB0A 2AXTC 4DYQA 3KFWX 3K70C 2WAQA 1RKWA 2AXLA 3DPTA 3GX4X 4IHXA 1I5ZA 1Y8RB 3F6VA 5FJ8J 3P5JA 2XHKA 4B44A 1S72I 3S8PA 1V4RA 1XC5A 3GUDA 3OYMA 4HV6A 4RMNA 1FNNA 1FZPB 4ZTJA 1R1UA 1Z3XA 3I53A 4N4OB 2FUG2 2O61A 3NRVA 3S3NA 3NWSA 1WJDA 1LPQA 1S3JA 1N75A 1E3HA 2OBPA 1OISA 1T98A 2XROA 2OU2A 5JLXA 4XN3A 5L3CA 2VT3A 2DK5A 2JRMA 2FX0A 4XICA 2UXHA 4XIDA 2R0QC 3V7RA 4KT6A 4KITB 4HOBA 1VQMI 1ZTRA 2QBYA 2X1CA 3OIPA 4EV0A 1X2NA 1GVJA 3PPBA 4ME9A 5IP6A 2LLKA 2ECBA 5A2QZ 1H9GA 2GBYA 5FLXK 4M3FA 3ECHA 4NELA 2K85A 5FGMA 2MG4A 3CCLI 3GF2A 2W7NA 1R9TJ 3FXLA 2MLKA 2QIBA 4OU0A 2GXBA 2FBQA 3LWJA 2F5CA 3ABTA 3C2BA 4A3CJ 2XRLA 4DYCA 3FBNB 1SD5A 2CUZA 1YI2I 2YX7A 2FBIA 4Y4RA 3I56I 3QPLA 4RB2C 3JRIA 2W00A 1ZRFA 5H6QA 3WTSC 4OIOF 1I1SA 2DFIA 2QYOA 2QQAA 3H35A 3HHHA 3WE2A 5E1WA 1IV8A 3QAHA 1FLIA 4S0HB 4HSTA 1WJFA 3J7AO 3IUVA 1VQPI 3ZGKA 2GZWA 2QZ8A 3GTLJ 3S1RJ 1U8BA 1LEBA 2OC6A 3S17J 2VXDA 2Z3YA 2M9HA 5ED4A 2IP2A 2XPVA 2ACJA 5CVUA 1O3QA 3BCGA 1O7FA 2BE5F 1WFXA 3DEUA 2O3FA 2IGNA 4EM1A 4UUTA 4LG3A 4G9YA 2R3SA 2HKUA 3KEOA 4YIIA 5J4YA 2VQCA 3QRFF 1QHGA 2PJPA 3W3CA 3J7YJ 4KT5C 4OOIA 3J81Z 2Y9YA 4P5OA 1VNDA 1LDDA 2H6BA 2LTPA 2W24A 2JRTA 3DLLF 3H3VK 3WGIA 3C2GA 3RI4A 2F4OB 4XLFA 2M8GX 2ECCA 4ENKA 2UXPA 2DYSH 2E7XA 4UB8C 3EUHC 4IHSA 3BR5A 1T6SA 2RAEA 3F0CA 3D5SC 3TO7A 4L9TA 2VL8A 4L9NA 1R4MB 1YHQI 3GMEA 3BNIA 2EK5A 2HQRA 2L01A 4KN4X 4EGZA 2X6WA 3OYNA 4PSWA 2FNPA 3KP5A 1BC7C 1BL0A 2OPTA 3NEUA 5IYBJ 3BR6A 3HL2A 3COLA 1GVDA 1MNEA 2L5QA 5EDNA 3JR9A 1XSXA 3J7AY 2NX4A 3ZMDA 4PJ0C 3MEXA 2E1OA 4UVAA 4ESFA 1B8IA 2H27A 1XB4A 2HI3A 3FM5A 3V8LA 5M5YJ 1Z1DA 1HSTA 4ASNA 2LMDA 3CWRA 2W4SA 1BI3A 2K4BA 1KU2A 5KAFC 1QHHD 1B59A 2R7ZJ 2JQ7A 1RI7A 2RV8A 1FP1D 2DT5A 2VKDA 1STZA 4LB6B 2ZCXA 2BXYA 2NP5A 3B6CA 1Z6TA 1EV7A 1OYIA 2QSHX 2V9KA 1ETYA 2TDXA 1R4NB 4RB1A 5E3NA 1AA7A 5JVGF 4R1HA 1MZBA 2OJED 4Y33A 2UXNA 2JN6A 2OUMA 1UZCA 4IQ4A 3BG5A 3V7CA 1ZREA 1JT0A 1BR1A 4OIRF 3HPGA 1P6RA 3ZXSA 3AG1H 5EG0B 5FD5A 3PASA 4RLQA 1GV2A 2V57A 3GLLA 4LG0B 3DCFA 3VYTB 2DG8A 1ZGAA 2FEZA 2V6EA 1J0RA 2A6EF 2W57A 5J47A 2RN7A 2QLZA 3FMSA 4DYRA 3KEQA 2L4MA 4A93J 3IH2A 1TT0A 1J5YA 5DV5A 3HRSA 5KK1A 1ORKA 2RNJA 2R7QA 1YG2A 2F6CA 1J09A 1MKMA 2F5DA 3C3WA 5LEJA 2FQ4A 2H8WA 4EJVA 3HTIA 3S15J 3VFZA 5IP9J 3PNYA 1FT9A 2KZGA 5GP9A 3J80K 3PQJA 2HQAA 4X0GA 1G3TA 4O5VA 1Z7UA 1VI0A 2B3WA 1YW8A 4HW0A 1MBKA 1VQLI 4NBQA 3BR3A 3HOTA 3KEYA 3H9JA 5H9TA 1AKHA 4DNCA 3HTJA 3F6OA 2VKHA 3T0YA 2CUEA 4I2OA 3AL0B 5C44J 4BDZA 2DJIA 1U5TA 2E2JJ 3GVAA 4MQVA 5CQEA 5FLXZ 2QEXI 3M1CA 4XSZF 1VQKI 4KDPA 2W1OA 1BN5A 3LFKA 4BE1A 3IWFA 5KHDA 2X48A 5C4XJ 3JRCA 2VBXA 3HM5A 2C6YA 2QOPA 2LYCA 2FJI1 1YX3A 3O8GA 3B81A 2FMLA 1WJAA 2XC7A 3H36A 4BE2A 4AVZA 5K5OA 2Y69H 4BNCA 3L2RA 1L0OC 3M8FA 1OFCX 1UELB 1SVMA 1XMAA 3EUHA 2XSDC 3ZQ7A 3D1NI 3ZN1A 3G3ZA 3TW6A 3OYGA 4ON0A 3DBLB 3NS4A 1XX5A 4CSWA 1XGOA 2L7MP 3ZQIA 5K5QA 2PFBA 1Y39A 2MSYA 2XGEA 3H1CA 3H92A 2M4GA 2LY9A 4D1QA 4PUSA 4CGRA 1VFCA 2VOOA 1FOKA 2YR2A 2A69F 2HTSA 2K4JA 4I99C 4PGGA 1QVUA 1HC8A 3LSMA 3R61A 3ISPA 1W36C 5AQCA 4QPOA 1KYWA 2CQXA 1VTNC 1FTZA 4U9NA 1LFPA 3LSHA 2F2EA 3CF2A 3DXJF 4OAZA 4JQFA 4RAYA 2CU7A 3NI7A 2KKOA 1HW5A 3K10A 3LSPA 2NNYA 1JKPC 1AU7A 2ADUA 4CCOA 3P9KA 2LKPA 2M5WA 3Q0WA 4XNFA 2XPWA 4LG0A 5J4VA 4A0ZA 2M7BA 1S5LC 4HQEA 2IAIA 5D1RA 4M72A 4LIVA 3SXYA 2A07F 4OD4A 4ZZLA 3K2ZA 3HSFA 1O7LA 2LBFB 1RPWA 4MHGA 4L5JA 2IS6A 2RGVA 3GEUA 3S5RA 2DTZA 2XGXA 1FYKA 5CVRA 1IW7F 5LHGA 4UDSA 5EEHA 3BT9A 2P81A 2Y48A 4HAMA 5CJ9A 2DTRA 4AD9A 2HOTA 1R5ID 3WTXC 2VC0A 3QYFA 1Z0XA 4Y17A 2E5NA 1B4AA 2ZNYA 3F9KA 1K83J 2Q1ZB 2Y2ZA 2CQ7A 2QSFX 1VQ4I 3R6SA 5DTDA 1YO5C 2Q2EA 3SWHA 2XASA 4FCYA 3I59A 3PJRA 1D0ZA 2HDCA 1NHAA 1ITYA 3I0TA 3H0GJ 3MN2A 3MMYB 1LE8B 3HRMA 1LDJA 1RUOA 4CCMA 3CCUI 5IP7J 3SDGA 1ZKGA 2Z9OA 4XK4A 2DPDA 4ETSA 4IOAF 1CF7B 3HRTA 3HIMA 1BBYA 2NAZA 2L7ZA 3K2AA 4NQWB 4ENJA 3P9TA 4CCKA 3O3KA 1BI0A 4IHVA 3GZNB 2QKLB 1U9NA 3BTCA 1HOMA 2JSCA 1RIOH 1USSA 4OMZA 1WGXA 5EGOA 2ZOZA 2LREA 1W0TA 2JA7J 2H09A 1FMWA 2G7LA 1IC8A 1Y0NA 4A3JJ 4IHWA 2HDWA 3ASNH 3K6GA 4BL0B 3M3YJ 3OSGA 2E35A 4OMYA 2V1XA 2JVHA 3Q0VA 3QP6A 4BJ5C 4I7HA 5DM6F 4V2GA 5D5WB 2P5VA 1EKEA 1JUMA 3BQZA 2OQGA 3WU0A 3MKWB 4OIQF 1FOYA 1POGA 2KPMA 3DTIA 3U2RA 4EJWA 1MBHA 1CGPA 1ZG1A 3PUFA 4BXXJ 2OQRA 1ONVA 3R0AA 4ITVA 2CUJA 3J80Z 2DN0A 2HYJA 1OCZH 2X6XA 2DT6A 2Q0OA 2GAUA 5FGLA 3VB2A 2RNGA 4BJTA 3HUGB 4RAZA 1HDDC 3JRFA 3S1MJ 3BG6A 4D7MA 1W0UA 3S3OA 1SVLA 3LOCA 1KU3A 4A69C 1ON2A 5EF6A 2FF4A 2L2OA 5CYVA 3HOXJ 3WTZA 1MGTA 4A6EA 4RDUA 1WQ2A 3IH4A 2DA6A 1P2FA 4D5CA 4ENNA 2GOXB 4UXNA 3AQSA 1X1AA 3RKYA 2EPFA 2O7OA 4QSHA 4ZYAA 3AG3H 4A0YA 5K1YA 4M9SA 2KRHA 3E6BA 4Q47A 5GTHC 2P7CB 3MVPA 5LGNA 3GWZA 3IAS2 5FLMJ 4IOCF 2E1MB 1HCRA 3M7GA 3FIWA 2KRCA 2BHYA 2V1DA 4KUMA 3CJQB 3RKXA 2BXZA 2HWVA 4GCTA 3OR1C 3VWBA 1TNTA 2GIZA 4XSXF 3OS2A 3RDIA 3LA3A 2DI3A 4KICA 3ESWB 1T0FC 2EA2A 3H5AA 1MIJA 2LKXA 4ZDLA 1XTAA 3RSNA 3LFUA 1NG6A 4U9LA 2OZ6A 2M0CA 3BJAA 2IA1A 1MJAA 1ZG3A 2M7AA 1LE8A 2BVMA 3K4NA 3ABMH 3IH3A 1MMGA 3E5XA 3DF8A 1PDNC 1MMSA 5JVTA 2R93J 1D1BA 1A04A 1X1PA 1SFKA 3FXUA 2GLOA 1BI2A 3QPTA 4JBAA 4YIFA 1A36A 4NQWA 3WG9A 1AWCA 3K69A 4C2TA 4HNUA 3U9GA 2PJRA 1JTYA 1R22A 4LOCA 2HGCA 2R7FA 3ZQGA 2MC3A 3RQIA 1ZQ3P 4KNYA 2EWNA 2JZYA 2PMUA 3MD2A 1MH4A 1JT6A 2PX9A 5AIQA 4WCGA 2CYYA 1DPRA 2VPLA 3D0SA 4D9JA 5ILUA 5CVJA 2KT0A 2A3SA 3TOBA 3PFYA 4YFXF 1K78B 3I3LA 3VVYA 1YRNB 2A6TA 3K7AJ 3FBIB 2CO5A 2E71A 3FXMA 2WTEA 4L9VA 4Q48A 5BOXA 1JE8A 5EJCA 3BG9A 1HDPA 3CJTB 3OY9A 2VXZA 5D8LB 3G2BA 1XG1A 4UHTA 3VSKA 2CV0A 5F64A 4GYIA 2IVMA 2XSJC 1ZAOA 1Z6RA 1Q1HA 4YFKF 3CTAA 1J9IA 3HDDA 5D5UB 2L9RA 1BJAA 1ENHA 3WODF 4J01A 2R7TA 5HLHA 1K7AA 2VB6A 1P7JA 3BDDA 2LNBA 1ZLJA 2J5OA 3HYIA 3MQ0A 2LFBA 1EF4A 1J2XA 2L9SA 1GT0C 2GIVA 4HLXA 2M0MA 2CG4A 4KMUX 4BDYA 2DMQA 1MW7A 2BYVE 1WH7A 3B6AA 4H0EA 3HTAA 2QBYB 3I4MJ 1D5VA 3EUKL 3L09A 1TQIA 1K4SA 1G4DA 3CCEI 2ZJQF 4BHCA 1IRZA 4BE0A 2MBFA 3TP3A 1OYWA 4JKZA 3RTRA 4UNOA 4BXFA 5F1RA 3OYBA 3I4NJ 2M45A 4FHTA 4BHPA 1ETQA 1LNWA 1YIOA 1Y1WJ 1D5YA 2ZOYA 1N25A 3HXLA 3BG7A 4BH9A 5CXIA 3BJ6A 3DU5A 5HBUA 5K7ZA 2M2EA 3TDUC 3HTSB 5L3BA 3Q5FA 1GXQA 1E3PA 2PMZA 3DTEA 1IN7A 2HVRA 3S1NJ 4U0WA 2CS3A 2L4AA 1WJCA 2ZJRF 3OS0A 1QVTA 1VQ6I 2VE9A 1SMYF 4OIPF 4DGWB 1XGSA 2MLGA 4I76A 3WHBA 2L9NA 3L2VA 4JNNA 1USTA 3CUQB 4MIMA 3EUAA 1A5JA 2HVSA 1Y6IA 4XMYA 2OV7A 3GTOJ 1YLFA 4BAYA 3K8PC 4BQQA 5DUKA 4OINF 3G1LA 4XM3A 1UJ8A 2CMPA 3KP7A 3ON2A 3G1OA 3RZOJ 2ZSHB 4XLPF 1R49A 2JWTA 3CMYA 1YJ9I 5DEQA 1U8RA 3ECOA 1E0EA 3FHNA 5KNLA 1G3YA 1VQ9I 4E70A 3GZIA 2DODA 2LC2A 3QBMA 4LLGF 3GFMA 1R6RA 2ID6A 1HLVA 4YIRX 2KDOA 4HPQA 2LDUA 3JW4A 3A02A 3T5XA 3MKLA 4RM3A 1RRJA 2M1BA 4DJAA 2AHQA 2E2HJ 5EYRA 1IN6A 3KE2A 2X6YA 4RA2A 1YRNA 1LUJB 3I71A 3RD3A 1V54H 3CDLA 1WVRA 3CESA 5F0HA 4GGGA 4IRGA 4L62A 3TO9A 1QNTA 2LF7A 1SAXA 4ACIA 1G8XA 3JAMK 3VSLA 1JTXA 2WADA 5F1JA 1IUFA 2VJ5A 1ZR4A 1X1CA 2KJBA 4C3HJ 3L2WA 2V1UA 2GUHA 2KRFA 3K4BA 1LDKB 3HGYA 2VJJA 3FMRA 5FB2A 1B8IB 4C9YA 5GPAA 2W84A 3WHCA 3KNWA 3QU6A 3LJLA 3KP6A 4YEJA 2EH3A 5D6EA 2R7VA 3VVXA 4MGRA 2IS4A 1MJBA 2BV6A 4UV8A 2L7KA 2JPCA 5CW8A 2IU5A 2ICWG 3Q3SA 3JRGA 1XSVA 2DW4A 3L7WA 3PM1A 4PJLA 4ENMA 4NN1A 2XAHA 3X2QH 2ELKA 5CKTA 5E3MA 2HFHA 1YTYA 4FE4A 1FMVA 5HNHA 2DDBA 3SZGA 5C4YA 1BM9A 5BQTA 2JA8J 4L0YB 2FQ3A 3KX2A 2QQ9A 3QWLA 1XDSA 3BG3A 2P6SA 5M5XJ 1OCPA 1I50J 3HSRA 1QGPA 4AIHA 3KLOA 2P5LC 2JMWA 1JKQC 3EPZA 2G7GA 4IVNA 4PSXA 1EA3A 5DD4A 4XRMA 1VQ5I 3CO6C 1G3WA 4G6TB 5FKLA 5GTIC 1SMTA 1FWZA 4JK1X 2ZJ2A 2Z33A 2ZMEA 3AAFA 3VUQA 1W5TA 2EQRA 3FRQA 5GAGJ 3I4PA 3CUQA 2DOEA 2XPUA 3A4CA 4M9ZA 2BHZA 5C4JJ 2XAGA 4XLEA 1W7PA 3GLXA 4XQFA 5L3EA 1GHCA 4AM3A 1XPXA 3QOPA 4HBLA 1UI5A 1UFMA 1GV5A 1E17A 1OCOH 3CJRB 3H0DA 5BPIA 5E17F 1IAWA 5BS6A 2P4WA 2DT7B 2O8XA 1H0MA 5IYDJ 2HTJA 3JCUC 4ZH4F 5HS7A 5TISC 5HDKA 4B47A 4EGYA 5M5WJ 3OYDA 1J59A 3QYEA 1AKHB 1MNMC 2UXOA 1SAUA 1ZGJA 3EQLF 4QPQA 2RHAA 1U5TB 3OYAA 1TWFJ 2EIKH 3FMQA 1DGWY 3VODA 3TEDA 1OR7C 2VUMJ 3ZMSA 1ETKA 3KZ9A 4BEHA 2F48A 2GFNA 3K1NA 4E6KG 3HG9A 2WY7Q 1F4KA 1UHWA 5J1YA 2XDVA 3OYKA 3BZ6A 4L0ZB 1JJ6C 5CXGA 2BVLA 4Z2YA 2PG4A 2ETHA 1R1VA 3ULQB 2BY3A 3DKXA 3BPXA 3PNTA 2IRFG 4NUBA 2M3AA 5B1BH 1T38A 4FISA 3KIOA 4HNVA 3OIOA 3TP0A 2F5EA 3GXOA 3OOUA 3IL2A 5TRDA 1O4XA 2R7XA 4BS9A 3WTVC 5FKNA 1FP2A 4XLCA 4G7HF 4C2UA 1ZK8A 3FK7A 4M3DA 2FBKA 2VKVA 2ZO4A 3LQQA 4CHUA 1B1BA 4G6QA 4IPAA 3EDPA 3RKWA 1BOAA 2HKOA 2XB0X 1I3AA 5AONA 1FSEA 2CJJA 3L2CA 3G7RA 3HE0A 1YJNI 3VDXA 2DAOA 2JVGA 3SEQA 4UB6C 2X6OA 1PYVA 4M6VA 1JJ8C 4BUPA 2VOPA 4U0VA 3MWMA 3HEFA 4X1EA 1JI8A 5L3DA 2FJ1A 3VOKA 5IT9K 1S7OA 1IXSB 4P55A 4A0XA 3OL4A 4N0BA 3W6JB 1IXRC 5GAHJ 3HBLA 4Y3OA 5DM7F 2DPUA 3T1BA 5EFYA 3W2WA 2DMNA 2OCEA 3IKTA 5DAJA 1ZN2A 1X4PA 4PK4A 2ZCNA 2K9MA 2WAQN 2EFQA 4QIWN 2KL4A 3ZMVA 4IXAA 3V78A 3CCQI 3FXOA 5K7FA 4AIKA 1WJBA 1W5SA 3MKZA 3ZQHA 1T08B 1Y1VJ 2QWTA 1K61A 2KISA 1Z7LA 3VYUB 1TWAJ 1TWGJ 2WV1A 4D0PA 3RPQA 3S2HJ 2ISYA 5ERIA 1X3UA 3KP4A 4CGZA 2JJ7A 4X6AJ 2L54A 4ESBA 1ZRDA 2HXOA 3KYCB 1ERDA 3HB9A 2DYRH 2IT0A 3RYPA 3JAMZ 1IO2A 4HKUA 2TRTA 2KDZA 4LIUA 1P9QC 4E7IA 5IY5H 4A3BJ 5LGUA 2BY1A 2RDPA 1TLHB 4EVIA 4DBQA 5ICEA 4A3MJ 1D1AA 1BJZA 3DP7A 5ILSA 2DFHA 4RGXA 1R5HA 2ELHA 1ETVA 3OIQA 4GCKA 3SJMA 2L3DA 2EB7A 1JHHA 1MMNA 4CZCA 2GXGA 2Q2EB 3KZZA 3LAPA 2RREA 3I59B 3AG2H 3LQRA 1IV6A 3MCZA 1K6YA 2R7UA 3PO2J 3GTJJ 1YX5A 3G6EI 1RETA 4B1RA 3BQYA 2EIMH 3T8TA 3H3ZA 3QPSA 4ZJZA 5IPAA 4HF2A 3VOEA 4UVBA 3DU6A 3VOXA 5B3SH 2FA5A 2Y0MA 3R60A 2W82A 4XN0A 2AS5F 5EGOB 4PJNA 1F36A 1GLNA 2QENA 2HYGD 4C3IJ 1DPUA 2UXXA 5HDNA 2Y0SA 2F07A 2XAJA 3H9GA 3IUOA 4DZJA 2DA2A 3OYFA 1ZLKA 2VODA 2HXIA 2MA3A 1G2HA 1HKTA 2D1HA 2N8GA 5FD6A 3L2QA 1Z21A 1YW9A 4B8XA 2UXIA 1QZEA 3NQOA 2FMYA 1F43A 1PUFA 1KQ9A 2J5PA 2Y31A 4CA0A 4G6DA 2Z2SB 2HOEA 1XSDA 2IGKA 1IGNA 3L2UA 1SD7A 2OF7A 5HLTA 3TBIA 2PBIA 3S93A 4O3MA 1RR8C 1MDMB 3ML6A 1KYZA 1DP7P 5DUIA 4B3XA 4Q5SF 2GOMA 3V8JA 3U21A 4DIQA 4PFOA 1UMQA 1SEUA 2ZFWA 3BTLA 1H89C 2G3BA 3GTPJ 5LGTA 4ZDPA 3JRDA 3PSIA 3HHGA 2W48A 4RAGA 2RQPA 4XKBA 4ZZDA
chains in the Genus database with same CATH topology
1XS9A 1I3QJ 3KKDA 2CRGA 2I10A 2LKXA 1JGGA 3CCYA 2R5ZB 2M0CA 1LFUP 2X9DA 3A03A 4BY1J 4Y52J 1LE8A 2JA5J 1P7IA 3IH3A 5JLWA 5FMPA 2R93J 1WCMJ 5HODA 2WB1N 3L1PA 4W1UA 4DYQA 3HOUJ 4MFEA 2GLOA 5F04A 5F0CA 5D18A 1RKWA 4IHXA 3AQTA 3BTIA 5FJ8J 2DMPA 1JTYA 4LOCA 3VIBA 4JYKA 1XC5A 3LHQA 3ZQGA 3RKQA 3RQIA 1MSEC 1ZQ3P 2EBIA 2DMTA 4L5EA 2K40A 1MH4A 4M3EA 5FLVA 1JT6A 2JA6J 1IDZA 4W97A 2KT0A 5JLXA 5M3FJ 3VVYA 1YRNB 3K7AJ 4XICA 2FX0A 1A6IA 4B4CA 4XIDA 2UXHA 2R0QC 3BG9A 3NPIA 1HDPA 3BTJA 1ZTRA 2DJNA 1XG1A 4EEFG 1X2NA 4ME9A 3PPBA 2K9SA 2LLKA 2ECBA 5IP6A 2GBYA 4M3FA 4NELA 1SGMA 4AUXA 2MG4A 3QQAA 2L9RA 3S16J 1ENHA 3FISA 1R9TJ 2QIBA 2FBQA 1P7JA 3LWJA 3C2BA 2L0KA 4A3CJ 2XRLA 4DYCA 2LFBA 1EF4A 5K58A 1GT0C 2K9NA 2DMQA 3QPLA 1WH7A 3B6AA 3JRIA 3O8HA 4GCLA 3Q0UA 3HTAA 5GPCA 3I4MJ 3PO3J 2JK3A 5C3EJ 2XGCA 3G56A 3JREA 1IRZA 4S0HB 3IUVA 3TP3A 4JKZA 3GTLJ 5M3MJ 3S1RJ 1U8BA 3I4NJ 5HAWA 4BBRJ 3S17J 2LD5A 1ETQA 1FTTA 1Y1WJ 1D5YA 2M9HA 2ZOYA 2VI6A 2E19A 1MBEA 5CXIA 2XPVA 3BCGA 5HBUA 5K7ZA 2M2EA 2OI8A 2LR8A 1E3OC 1QRYA 4UUTA 2DA4A 2R5YA 2HKUA 3CRJA 1GUUA 2ZCMA 3S1NJ 4XRSG 2DMUA 2ME6A 1QVTA 4I76A 2Y9YA 2ME0A 1VNDA 2LTPA 3WHBA 3H3VK 2GENA 4JNNA 4MIMA 1A5JA 2M8GX 4AC0A 2ECCA 2UXPA 3BR2A 3GTOJ 3ZQLA 2ID3A 3BR5A 2RAEA 3G1LA 3LSRA 2DA1A 3F0CA 3ON2A 3VP5A 3G1OA 3RZOJ 3BNIA 2JWTA 3CMYA 5FKMA 3BR0A 2R5YB 4A3GJ 2CUFA 4I6ZA 2HQ5A 2YUSA 2NVXJ 4CYCA 1BL0A 2OPTA 2Y9ZA 3GZIA 2MW8A 5IYBJ 3BR6A 3COLA 3QBMA 1GVDA 5EDNA 3JR9A 1HF0A 2NX4A 2ID6A 1HLVA 5E3OA 2E1OA 1B8IA 3A02A 1WH5A 2HI3A 3MKLA 3KKCA 1FIAA 5M5YJ 2AHQA 5IYCJ 5EYRA 2E2HJ 2XDNA 1MH3A 4MK6A 1YRNA 3ANPA 3CWRA 3RD3A 3CDLA 5EG0A 2YU9J 2R7ZJ 5F0HA 4L62A 2HOAA 2YS9A 4ACIA 2ZCXA 4G12A 5F1JA 1JTXA 2QCOA 3HDDA 1IUFA 4CYCB 3B6CA 4A3IJ 1MBFA 3ZOBA 4C3HJ 1ZR4A 2GUHA 1ETYA 3IV5A 3HGYA 5E3NA 4BKXA 1TWCJ 1B8IB 4A3FJ 2JN6A 4IEJA 5GPAA 3BG5A 4AF5A 3WHCA 1BW6A 2LK2A 1JUPA 1JT0A 3KNWA 4AC6A 3LJLA 3DPJA 3VVXA 2EH3A 5EG0B 3PASA 2M34A 1LFBA 3EGQA 1GV2A 1MBGA 2EZIA 2V57A 5HSZA 3DCFA 1IJWC 4A3DJ 2DG8A 2RASA 5D19A 4YZEA 1UI6A 2DG7A 5CW8A 2IU5A 3Q3SA 3JRGA 3FK6A 4A3EJ 2HDDA 2NP3A 4DYRA 3S2DJ 3EUPA 4A93J 3PM1A 3IH2A 2PBXA 4NN1A 2G0EA 2ELKA 1APLC 5E3MA 2H8RA 2LP0A 1ORKA 2L7FP 4FE4A 5E3LA 3HOWJ 1BW5A 5C4YA 2JA8J 2FQ4A 3HTIA 3S15J 5IP9J 4QTRA 3BG3A 3O60A 4XRSA 4Y7NJ 5GP9A 5M5XJ 3HOVJ 3VW0A 1OCPA 1I50J 4JX4A 4C3JJ 4UUSA 2JMWA 1VI0A 1JKQC 3LSJA 3HOZJ 2G7GA 1UG2A 5EEAA 1MBKA 4XRMA 2EZKA 1QPIA 3BR3A 5FKLA 1MBJA 5H9TA 1AKHA 2HYTA 3VUQA 4JP0A 2EQRA 3FRQA 4MLOA 3HTJA 2NVYJ 2CUEA 5C44J 2XPUA 2QF7A 5FKOA 2E2JJ 3NAUA 5J3LA 4JL3A 2OERA 5C4JJ 2HOSA 1OCTC 5K7HA 3RZDJ 1UI5A 2X48A 5C4XJ 1FEXA 1GV5A 3JRCA 1I6HJ 1DU6A 2COBA 4UUSB 1JKOC 3HM5A 2QOPA 9ANTA 1FJLA 2EZHA 3O8GA 3B81A 1IDYA 4MFDA 5IYDJ 2B63J 2PZ9A 4B3AA 4BY7J 2D5VA 2Y0SN 2EZLA 5M5WJ 1OFCX 1AKHB 1MNMC 3DEWA 2XSDC 1Q1VA 2UXOA 2RHAA 3D1NI 3G1MA 1TWFJ 3TW6A 1U9OA 3TEDA 2VUMJ 1ETKA 3KZ9A 2L7MP 3ZQIA 3A01B 1CQTA 2MSYA 2GFNA 3ZQFA 5J1YA 3OSFA 4D7NA 1JJ6C 3HTHA 5CXGA 1RR7A 2XGEA 1IG7A 2LY9A 2E2IJ 3E7QA 4CGRA 1VFCA 4M3BA 1X58A 5F27A 3FKIJ 1QVUA 1RKTA 4FISA 4HNVA 1ETWA 3OIOA 3TP0A 3S1QJ 2YVEA 3W6VA 3OOUA 1O4XA 1WPKA 3NRGA 2IEKA 5FKNA 5AQCA 2CQXA 5F08A 4IHYA 1FTZA 2DA7A 4ABZA 1ZK8A 3FK7A 4M3DA 5IOYA 3GTGJ 2VKVA 2LVSA 2CU7A 3HGGA 3SFIA 4RBOA 3NI7A 4PXIA 3JSJA 3LSPA 1JKPC 1AU7A 2XB0X 1BA5A 2CJJA 3TW7A 3Q0WA 3G7RA 4GFBA 3HE0A 2XPWA 4J19A 2X6OA 2IAIA 5EZHA 5D1RA 3BR1A 4M6VA 1ETXA 1JJ8C 3HEFA 4X1EA 2FJ1A 1B72A 3VOKA 3CJDA 4BBSJ 1RPWA 4GFKA 3HBLA 5EFYA 2UXUA 2DMNA 3GEUA 2DTZA 3S5RA 5DAJA 2ZCNA 2WAQN 4DZPA 4UDSA 4A3KJ 4QIWN 3BT9A 3V78A 2P81A 3NARA 2REKA 4MO7A 5K7FA 2HOTA 3ZQHA 3HKZN 1Z0XA 1Y1VJ 4GFLA 1NK3P 2QWTA 1S7EA 1K61A 2XB5A 1K83J 2QKOA 1TWAJ 1TWGJ 2WV1A 1FIPA 3E7LA 2Y2ZA 3VW1A 2DA5A 3S2HJ 3BHQA 5F0FA 5DTDA 1NTCA 5J1UA 1NK2P 1U78A 4FCYA 1B72B 3GTQJ 2JJ7A 4X6AJ 2K9QA 2ZB9A 3NNRA 1ITYA 1AHDP 3H0GJ 3MN2A 2HXOA 1LE8B 2NVTJ 2VPRA 3HB9A 4D5FA 4KWAA 3GTMJ 5IP7J 3SDGA 1ZKGA 1MSFC 4HKUA 3VVZA 2TRTA 2VKEA 4XK4A 2KDZA 4V2FA 5J1RA 4JX6A 1JKRC 3GTKJ 4A3BJ 5IOZA 3HIMA 2L7ZA 3K2AA 3P9TA 4A3MJ 1BJZA 4IHVA 5FHPA 4C2MJ 3LNQA 1U9NA 3BTCA 1HOMA 3T6NA 1ETVA 1WGXA 4FE7A 5EGOA 2ZOZA 3SJMA 1W0TA 4GCKA 2G7SA 2H1KA 3GBGA 2JA7J 2G7LA 3VPRA 1IC8A 1H88C 1VF9A 4A3JJ 4IHWA 2NOGA 1IV6A 1RESA 3M3YJ 3OSGA 3M4OJ 3PO2J 3GTJJ 4M3GA 1RETA 2Q24A 4B1RA 2WGBA 3BQYA 2Y30A 3Q0VA 2D6YA 1T56A 3QPSA 3A01A 4V2GA 5FKKA 5IPAA 1JUMA 3BQZA 2WUIA 3VOXA 3V6GA 1OJLA 3JRAA 4DW6A 4NDLA 5BNGA 1POGA 1TWHJ 1MBHA 5EGOB 4BXXJ 1ZGWA 1F36A 2DN0A 2NVQJ 2R92J 4C3IJ 4FTHA 3S14J 1UHSA 3RH2A 3CQZJ 2HYJA 3JRBA 2F07A 5FGLA 3VW2A 3JRHA 4DZJA 2DA2A 1GDTA 2HXIA 1JUSA 3BRUA 1G2HA 1SFOJ 1HDDC 3JRFA 2N8GA 1WI3A 3S1MJ 3QKXA 1X2MA 4D7MA 1W0UA 3LOCA 3BJBA 4A69C 2UXIA 5EF6A 4A3LJ 2PMZN 2AO9A 1PUFA 1F43A 2W53A 2YVHA 3HOXJ 2Y31A 3ZQCA 4RDUA 2O7TA 2O8KA 2FD5A 4D5CA 3IH4A 2DA6A 1IGNA 3AQSA 2NS7A 2OF7A 4JX5A 2XGDA 3F1BA 1SANA 2R5ZA 2O7OA 1DU0A 4QSHA 3ON4A 1ZR2A 2CQQA 5EZGA 3MNLA 1H8AC 4ICHA 3MVPA 2O9LA 5FLMJ 3LSGA 2QTQA 3HOYJ 3C07A 1T33A 1HCRA 1TC3C 2DA3A 3FIWA 1UMQA 1ETOA 3BTLA 2NS8A 1H89C 2G3BA 1Z77A 2TCTA 3UKGA 3GTPJ 2NP5A 3ANGA 2MGQA 2IBDA 3JRDA 4AYBN 5DS9A 1PUFB 3NXCA 2W48A 4MXMA 4GCTA 2GM4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XS9 A;  1I3Q J;  3KKD A;  2CRG A;  2I10 A;  2LKX A;  1JGG A;  3CCY A;  2R5Z B;  2M0C A;  1LFU P;  2X9D A;  3A03 A;  4BY1 J;  4Y52 J;  1LE8 A;  2JA5 J;  1P7I A;  3IH3 A;  5JLW A;  5FMP A;  2R93 J;  1WCM J;  5HOD A;  2WB1 N;  3L1P A;  4W1U A;  4DYQ A;  3HOU J;  4MFE A;  2GLO A;  5F04 A;  5F0C A;  5D18 A;  1RKW A;  4IHX A;  3AQT A;  3BTI A;  5FJ8 J;  2DMP A;  1JTY A;  4LOC A;  3VIB A;  4JYK A;  1XC5 A;  3LHQ A;  3ZQG A;  3RKQ A;  3RQI A;  1MSE C;  1ZQ3 P;  2EBI A;  2DMT A;  4L5E A;  2K40 A;  1MH4 A;  4M3E A;  5FLV A;  1JT6 A;  2JA6 J;  1IDZ A;  4W97 A;  2KT0 A;  5JLX A;  5M3F J;  3VVY A;  1YRN B;  3K7A J;  4XIC A;  2FX0 A;  1A6I A;  4B4C A;  4XID A;  2UXH A;  2R0Q C;  3BG9 A;  3NPI A;  1HDP A;  3BTJ A;  1ZTR A;  2DJN A;  1XG1 A;  4EEF G;  1X2N A;  4ME9 A;  3PPB A;  2K9S A;  2LLK A;  2ECB A;  5IP6 A;  2GBY A;  4M3F A;  4NEL A;  1SGM A;  4AUX A;  2MG4 A;  3QQA A;  2L9R A;  3S16 J;  1ENH A;  3FIS A;  1R9T J;  2QIB A;  2FBQ A;  1P7J A;  3LWJ A;  3C2B A;  2L0K A;  4A3C J;  2XRL A;  4DYC A;  2LFB A;  1EF4 A;  5K58 A;  1GT0 C;  2K9N A;  2DMQ A;  3QPL A;  1WH7 A;  3B6A A;  3JRI A;  3O8H A;  4GCL A;  3Q0U A;  3HTA A;  5GPC A;  3I4M J;  3PO3 J;  2JK3 A;  5C3E J;  2XGC A;  3G56 A;  3JRE A;  1IRZ A;  4S0H B;  3IUV A;  3TP3 A;  4JKZ A;  3GTL J;  5M3M J;  3S1R J;  1U8B A;  3I4N J;  5HAW A;  4BBR J;  3S17 J;  2LD5 A;  1ETQ A;  1FTT A;  1Y1W J;  1D5Y A;  2M9H A;  2ZOY A;  2VI6 A;  2E19 A;  1MBE A;  5CXI A;  2XPV A;  3BCG A;  5HBU A;  5K7Z A;  2M2E A;  2OI8 A;  2LR8 A;  1E3O C;  1QRY A;  4UUT A;  2DA4 A;  2R5Y A;  2HKU A;  3CRJ A;  1GUU A;  2ZCM A;  3S1N J;  4XRS G;  2DMU A;  2ME6 A;  1QVT A;  4I76 A;  2Y9Y A;  2ME0 A;  1VND A;  2LTP A;  3WHB A;  3H3V K;  2GEN A;  4JNN A;  4MIM A;  1A5J A;  2M8G X;  4AC0 A;  2ECC A;  2UXP A;  3BR2 A;  3GTO J;  3ZQL A;  2ID3 A;  3BR5 A;  2RAE A;  3G1L A;  3LSR A;  2DA1 A;  3F0C A;  3ON2 A;  3VP5 A;  3G1O A;  3RZO J;  3BNI A;  2JWT A;  3CMY A;  5FKM A;  3BR0 A;  2R5Y B;  4A3G J;  2CUF A;  4I6Z A;  2HQ5 A;  2YUS A;  2NVX J;  4CYC A;  1BL0 A;  2OPT A;  2Y9Z A;  3GZI A;  2MW8 A;  5IYB J;  3BR6 A;  3COL A;  3QBM A;  1GVD A;  5EDN A;  3JR9 A;  1HF0 A;  2NX4 A;  2ID6 A;  1HLV A;  5E3O A;  2E1O A;  1B8I A;  3A02 A;  1WH5 A;  2HI3 A;  3MKL A;  3KKC A;  1FIA A;  5M5Y J;  2AHQ A;  5IYC J;  5EYR A;  2E2H J;  2XDN A;  1MH3 A;  4MK6 A;  1YRN A;  3ANP A;  3CWR A;  3RD3 A;  3CDL A;  5EG0 A;  2YU9 J;  2R7Z J;  5F0H A;  4L62 A;  2HOA A;  2YS9 A;  4ACI A;  2ZCX A;  4G12 A;  5F1J A;  1JTX A;  2QCO A;  3HDD A;  1IUF A;  4CYC B;  3B6C A;  4A3I J;  1MBF A;  3ZOB A;  4C3H J;  1ZR4 A;  2GUH A;  1ETY A;  3IV5 A;  3HGY A;  5E3N A;  4BKX A;  1TWC J;  1B8I B;  4A3F J;  2JN6 A;  4IEJ A;  5GPA A;  3BG5 A;  4AF5 A;  3WHC A;  1BW6 A;  2LK2 A;  1JUP A;  1JT0 A;  3KNW A;  4AC6 A;  3LJL A;  3DPJ A;  3VVX A;  2EH3 A;  5EG0 B;  3PAS A;  2M34 A;  1LFB A;  3EGQ A;  1GV2 A;  1MBG A;  2EZI A;  2V57 A;  5HSZ A;  3DCF A;  1IJW C;  4A3D J;  2DG8 A;  2RAS A;  5D19 A;  4YZE A;  1UI6 A;  2DG7 A;  5CW8 A;  2IU5 A;  3Q3S A;  3JRG A;  3FK6 A;  4A3E J;  2HDD A;  2NP3 A;  4DYR A;  3S2D J;  3EUP A;  4A93 J;  3PM1 A;  3IH2 A;  2PBX A;  4NN1 A;  2G0E A;  2ELK A;  1APL C;  5E3M A;  2H8R A;  2LP0 A;  1ORK A;  2L7F P;  4FE4 A;  5E3L A;  3HOW J;  1BW5 A;  5C4Y A;  2JA8 J;  2FQ4 A;  3HTI A;  3S15 J;  5IP9 J;  4QTR A;  3BG3 A;  3O60 A;  4XRS A;  4Y7N J;  5GP9 A;  5M5X J;  3HOV J;  3VW0 A;  1OCP A;  1I50 J;  4JX4 A;  4C3J J;  4UUS A;  2JMW A;  1VI0 A;  1JKQ C;  3LSJ A;  3HOZ J;  2G7G A;  1UG2 A;  5EEA A;  1MBK A;  4XRM A;  2EZK A;  1QPI A;  3BR3 A;  5FKL A;  1MBJ A;  5H9T A;  1AKH A;  2HYT A;  3VUQ A;  4JP0 A;  2EQR A;  3FRQ A;  4MLO A;  3HTJ A;  2NVY J;  2CUE A;  5C44 J;  2XPU A;  2QF7 A;  5FKO A;  2E2J J;  3NAU A;  5J3L A;  4JL3 A;  2OER A;  5C4J J;  2HOS A;  1OCT C;  5K7H A;  3RZD J;  1UI5 A;  2X48 A;  5C4X J;  1FEX A;  1GV5 A;  3JRC A;  1I6H J;  1DU6 A;  2COB A;  4UUS B;  1JKO C;  3HM5 A;  2QOP A;  9ANT A;  1FJL A;  2EZH A;  3O8G A;  3B81 A;  1IDY A;  4MFD A;  5IYD J;  2B63 J;  2PZ9 A;  4B3A A;  4BY7 J;  2D5V A;  2Y0S N;  2EZL A;  5M5W J;  1OFC X;  1AKH B;  1MNM C;  3DEW A;  2XSD C;  1Q1V A;  2UXO A;  2RHA A;  3D1N I;  3G1M A;  1TWF J;  3TW6 A;  1U9O A;  3TED A;  2VUM J;  1ETK A;  3KZ9 A;  2L7M P;  3ZQI A;  3A01 B;  1CQT A;  2MSY A;  2GFN A;  3ZQF A;  5J1Y A;  3OSF A;  4D7N A;  1JJ6 C;  3HTH A;  5CXG A;  1RR7 A;  2XGE A;  1IG7 A;  2LY9 A;  2E2I J;  3E7Q A;  4CGR A;  1VFC A;  4M3B A;  1X58 A;  5F27 A;  3FKI J;  1QVU A;  1RKT A;  4FIS A;  4HNV A;  1ETW A;  3OIO A;  3TP0 A;  3S1Q J;  2YVE A;  3W6V A;  3OOU A;  1O4X A;  1WPK A;  3NRG A;  2IEK A;  5FKN A;  5AQC A;  2CQX A;  5F08 A;  4IHY A;  1FTZ A;  2DA7 A;  4ABZ A;  1ZK8 A;  3FK7 A;  4M3D A;  5IOY A;  3GTG J;  2VKV A;  2LVS A;  2CU7 A;  3HGG A;  3SFI A;  4RBO A;  3NI7 A;  4PXI A;  3JSJ A;  3LSP A;  1JKP C;  1AU7 A;  2XB0 X;  1BA5 A;  2CJJ A;  3TW7 A;  3Q0W A;  3G7R A;  4GFB A;  3HE0 A;  2XPW A;  4J19 A;  2X6O A;  2IAI A;  5EZH A;  5D1R A;  3BR1 A;  4M6V A;  1ETX A;  1JJ8 C;  3HEF A;  4X1E A;  2FJ1 A;  1B72 A;  3VOK A;  3CJD A;  4BBS J;  1RPW A;  4GFK A;  3HBL A;  5EFY A;  2UXU A;  2DMN A;  3GEU A;  2DTZ A;  3S5R A;  5DAJ A;  2ZCN A;  2WAQ N;  4DZP A;  4UDS A;  4A3K J;  4QIW N;  3BT9 A;  3V78 A;  2P81 A;  3NAR A;  2REK A;  4MO7 A;  5K7F A;  2HOT A;  3ZQH A;  3HKZ N;  1Z0X A;  1Y1V J;  4GFL A;  1NK3 P;  2QWT A;  1S7E A;  1K61 A;  2XB5 A;  1K83 J;  2QKO A;  1TWA J;  1TWG J;  2WV1 A;  1FIP A;  3E7L A;  2Y2Z A;  3VW1 A;  2DA5 A;  3S2H J;  3BHQ A;  5F0F A;  5DTD A;  1NTC A;  5J1U A;  1NK2 P;  1U78 A;  4FCY A;  1B72 B;  3GTQ J;  2JJ7 A;  4X6A J;  2K9Q A;  2ZB9 A;  3NNR A;  1ITY A;  1AHD P;  3H0G J;  3MN2 A;  2HXO A;  1LE8 B;  2NVT J;  2VPR A;  3HB9 A;  4D5F A;  4KWA A;  3GTM J;  5IP7 J;  3SDG A;  1ZKG A;  1MSF C;  4HKU A;  3VVZ A;  2TRT A;  2VKE A;  4XK4 A;  2KDZ A;  4V2F A;  5J1R A;  4JX6 A;  1JKR C;  3GTK J;  4A3B J;  5IOZ A;  3HIM A;  2L7Z A;  3K2A A;  3P9T A;  4A3M J;  1BJZ A;  4IHV A;  5FHP A;  4C2M J;  3LNQ A;  1U9N A;  3BTC A;  1HOM A;  3T6N A;  1ETV A;  1WGX A;  4FE7 A;  5EGO A;  2ZOZ A;  3SJM A;  1W0T A;  4GCK A;  2G7S A;  2H1K A;  3GBG A;  2JA7 J;  2G7L A;  3VPR A;  1IC8 A;  1H88 C;  1VF9 A;  4A3J J;  4IHW A;  2NOG A;  1IV6 A;  1RES A;  3M3Y J;  3OSG A;  3M4O J;  3PO2 J;  3GTJ J;  4M3G A;  1RET A;  2Q24 A;  4B1R A;  2WGB A;  3BQY A;  2Y30 A;  3Q0V A;  2D6Y A;  1T56 A;  3QPS A;  3A01 A;  4V2G A;  5FKK A;  5IPA A;  1JUM A;  3BQZ A;  2WUI A;  3VOX A;  3V6G A;  1OJL A;  3JRA A;  4DW6 A;  4NDL A;  5BNG A;  1POG A;  1TWH J;  1MBH A;  5EGO B;  4BXX J;  1ZGW A;  1F36 A;  2DN0 A;  2NVQ J;  2R92 J;  4C3I J;  4FTH A;  3S14 J;  1UHS A;  3RH2 A;  3CQZ J;  2HYJ A;  3JRB A;  2F07 A;  5FGL A;  3VW2 A;  3JRH A;  4DZJ A;  2DA2 A;  1GDT A;  2HXI A;  1JUS A;  3BRU A;  1G2H A;  1SFO J;  1HDD C;  3JRF A;  2N8G A;  1WI3 A;  3S1M J;  3QKX A;  1X2M A;  4D7M A;  1W0U A;  3LOC A;  3BJB A;  4A69 C;  2UXI A;  5EF6 A;  4A3L J;  2PMZ N;  2AO9 A;  1PUF A;  1F43 A;  2W53 A;  2YVH A;  3HOX J;  2Y31 A;  3ZQC A;  4RDU A;  2O7T A;  2O8K A;  2FD5 A;  4D5C A;  3IH4 A;  2DA6 A;  1IGN A;  3AQS A;  2NS7 A;  2OF7 A;  4JX5 A;  2XGD A;  3F1B A;  1SAN A;  2R5Z A;  2O7O A;  1DU0 A;  4QSH A;  3ON4 A;  1ZR2 A;  2CQQ A;  5EZG A;  3MNL A;  1H8A C;  4ICH A;  3MVP A;  2O9L A;  5FLM J;  3LSG A;  2QTQ A;  3HOY J;  3C07 A;  1T33 A;  1HCR A;  1TC3 C;  2DA3 A;  3FIW A;  1UMQ A;  1ETO A;  3BTL A;  2NS8 A;  1H89 C;  2G3B A;  1Z77 A;  2TCT A;  3UKG A;  3GTP J;  2NP5 A;  3ANG A;  2MGQ A;  2IBD A;  3JRD A;  4AYB N;  5DS9 A;  1PUF B;  3NXC A;  2W48 A;  4MXM A;  4GCT A;  2GM4 A; 
#chains in the Genus database with same CATH topology
 5ICF A;  2MC4 A;  1HXD A;  2GXA A;  2O6G E;  2A05 A;  3KKD A;  3CCY A;  4F7Z A;  5J40 A;  2PFV A;  5AIP A;  3A03 A;  1F1Z A;  3R4K A;  4Y52 J;  1EH7 A;  1KZH A;  5FMP A;  1WCM J;  3ABU A;  3L1P A;  4W1U A;  3DKW A;  2M87 A;  3CC7 I;  5F04 A;  3F22 A;  1E2X A;  3DFG A;  3AQT A;  3BTI A;  4XL9 A;  2ZJP F;  2DMP A;  4E7H A;  3VIB A;  4RLF A;  1M1E B;  2RVC A;  3M9A A;  3RKQ A;  3HKZ A;  4GXO A;  1MSE C;  3O2P E;  2EBI A;  3IC7 A;  4NNJ A;  2DMT A;  1BIA A;  2K40 A;  4M3E A;  4MTE A;  2PLY A;  5FLV A;  3F8F A;  2X85 A;  1IDZ A;  1TQM A;  1BIB A;  3F8M A;  4W97 A;  1D0X A;  2FE3 A;  3VEP A;  4AU7 A;  2Y75 A;  2B9S A;  3FF5 A;  4CCN A;  2MD0 A;  2K86 A;  3FXQ A;  5IT9 Z;  1A6I A;  1WJE A;  4B4C A;  4YRV A;  2KLO A;  3NPI A;  3BTJ A;  4LD5 A;  2NVU B;  1TT5 B;  4EEF G;  2PJR B;  1MD0 A;  1TL8 A;  3SFZ A;  2K9S A;  2DK8 A;  2OZU A;  4YEL A;  1K4T A;  4IX7 A;  4G7O F;  1DQU A;  1LJ9 A;  1SGM A;  3OV8 A;  4AUX A;  2XAQ A;  3ZMT A;  3ASO H;  3S16 J;  3U1D A;  2P8T A;  1LVA A;  3FIS A;  1IZ1 A;  2GQQ A;  3S3M A;  2A61 A;  3ZMU A;  2KJC A;  2L0K A;  1UHM A;  3BJO A;  3RIR A;  4E7K A;  2CWE A;  2UUZ A;  2K5C A;  2K9N A;  4HA8 A;  3BC8 A;  3BZC A;  4IZZ A;  4GCL A;  4U0Y A;  3O8H A;  4L18 B;  5HLG A;  3C7J A;  3VYR B;  2DXI A;  1X3Z B;  5C3E J;  2ZSI B;  2IJL A;  4XOP A;  3JRE A;  4HLY A;  5TGT A;  3CDI A;  5DCM A;  1TZL A;  2EIL H;  5E18 F;  2F4I A;  2LKS A;  4MTD A;  5B66 C;  2Q8K A;  4BBR J;  3AKZ A;  1MDM A;  1FTT A;  4LB5 A;  3H5N A;  2FBH A;  2L02 A;  2B0L A;  4BYY A;  2VI6 A;  4WF2 A;  1ZRC A;  2B1E A;  1MBE A;  3A0B C;  3DPU A;  1W7P D;  1O3T A;  4IF4 A;  2EV6 A;  2RQQ A;  1LVK A;  3OYL A;  5H2F C;  2LR8 A;  2IPQ X;  2MAB A;  2BEO A;  5DCF A;  1E3O C;  2DA4 A;  2R5Y A;  3I54 A;  1SVO A;  3IP4 B;  5GAE J;  1TW3 A;  1VQO I;  4XRS G;  2VLA A;  3IHU A;  1WWX A;  2DFE A;  1VQN I;  1OQY A;  3E6M A;  3LSI A;  2GEN A;  2LRD A;  5IT3 A;  3OMY A;  1D0Y A;  1HW1 A;  4AC0 A;  5JR3 A;  2LF8 A;  3BR2 A;  1D1C A;  3ZQL A;  1J7K A;  4KA4 A;  3RJP A;  2E1M C;  1A6Q A;  3F8N A;  3OR2 C;  3LSR A;  4CYD A;  2OAZ A;  5JHF A;  1K6O A;  1D8K A;  2V79 A;  3Q9V A;  2XVC A;  1V3F A;  5LBQ A;  3PUB A;  3SZT A;  3KP2 A;  4AYB A;  3C1D A;  5ICC A;  4YG2 F;  4CYC A;  1IRG A;  1XCB A;  3H9Q A;  5H6R A;  2MW8 A;  1RUN A;  1G3S A;  1PVE A;  1WJ5 A;  1HF0 A;  5LRR A;  4XKV A;  4BQA A;  1U2W A;  1T2K A;  2YVX A;  3FZV A;  3MZH A;  4XOT A;  1WH5 A;  3KKC A;  3K70 D;  4HDU A;  3RPU A;  1HA8 A;  1Y0U A;  2PN6 A;  1MH3 A;  3MZY A;  3G71 I;  4U7B A;  3DKY A;  3P9I A;  3QOE A;  4LIT A;  3ZRG A;  4QWQ A;  4P9F A;  2YU9 J;  2WB1 A;  4Y15 A;  5J6X A;  3JTG A;  1ACI A;  2MH2 A;  2HOA A;  1UAA A;  3BCA A;  2YS9 A;  3SQN A;  3RQ4 A;  3CUO A;  1MBF A;  3IV5 A;  4QLC U;  6PAX A;  3J7Z I;  1T95 A;  1Y8Q B;  1TWC J;  2A5W A;  3BWG A;  3CMM A;  4IEJ A;  4A3F J;  4YFN F;  2E1N A;  3OOP A;  4A2U A;  1YE9 A;  3K4L A;  3IRQ A;  1JUP A;  4K2E A;  3GFI A;  4AC6 A;  4UV9 A;  3CLQ A;  4EJU A;  3GZ5 A;  2M34 A;  2WAF A;  3CC4 I;  4I02 A;  3EGQ A;  1MBG A;  2EZI A;  1IJW C;  1XGN A;  1GXP A;  1F5T A;  3WG7 H;  2BBY A;  2RAS A;  4YZE A;  2DG7 A;  5D19 A;  4HNT A;  4WX9 A;  1DP3 A;  3WTU C;  3FK6 A;  4A3E J;  3HPH A;  2HDD A;  1HKQ A;  3S2D J;  2IS1 A;  1VZ0 A;  2R7R A;  3EUP A;  1Z9C A;  2PBX A;  2G0E A;  4FX4 A;  1APL C;  2H8R A;  4PCQ A;  2LP0 A;  2L7F P;  1MMD A;  3R0J A;  2UZK A;  1ZG5 A;  2IGO A;  5E3L A;  2XAF A;  2V1N A;  1BW5 A;  5L3G A;  2WWY A;  3F8C A;  1BR4 A;  3O60 A;  3HOV J;  4A3G J;  4RM2 A;  2KZV A;  4HX4 A;  4JX4 A;  3TO6 A;  4L9J A;  4C3J J;  5ILV A;  4UUS A;  2Z99 A;  4ESJ A;  2ZFU A;  2EZK A;  2JSP A;  3CP2 A;  1HQC A;  1QPI A;  1X1B A;  1I39 A;  3BOQ A;  4CUG A;  3E6D A;  1FOW A;  1MBJ A;  2ZCW A;  4L5I A;  2FRH A;  2HYT A;  4JP0 A;  4MLO A;  4HQM A;  2NVY J;  4HRI A;  5J8C A;  1REP C;  2QF7 A;  2GA2 A;  3MFK A;  3PFI A;  2VIX A;  5HOO A;  1KU7 A;  2OER A;  3E0J B;  2HOS A;  1OCT C;  2XKP A;  5K7H A;  4HYE A;  3RZD J;  1HW2 A;  2HU9 A;  3KP3 A;  1RNL A;  3K4M A;  3M8J A;  1FOX A;  2HZD A;  3B02 A;  1QZY A;  2BZT A;  1OLT A;  2G7H A;  1SFE A;  2VQG A;  2WC2 A;  1YFH A;  2COB A;  1DU6 A;  4G94 A;  1FEX A;  3ABL H;  3S2W A;  3DV8 A;  1FJL A;  2EZH A;  4MFD A;  1SD4 A;  5FRN A;  2PZ9 A;  4N4N B;  4BY7 J;  1WKM A;  4BQN A;  2ISZ A;  2EZL A;  2OCC H;  3AFH A;  5LEK A;  2ZME B;  3N05 A;  3SHF A;  1Q1V A;  1MJ9 A;  4IRH A;  2XUB A;  3G1M A;  4XOR A;  4S04 A;  1ZEL A;  4EM0 B;  3REO A;  1AOY A;  4F93 B;  2F5F A;  1W7P B;  2IW5 A;  1G6N A;  2FXA A;  4KIF A;  4PJJ A;  3ZQF A;  3FKJ A;  3OSF A;  2MYS A;  4D7N A;  2NXN B;  5JFR A;  1O3S A;  1IG7 A;  3I5U A;  3DBR B;  3HTH A;  1T0F A;  2A5Y B;  3LMM A;  3ROU A;  3I64 A;  2E2I J;  3E7Q A;  2R7O A;  3W2A A;  4O6J A;  1X58 A;  3FKI J;  2XF6 A;  2R4G A;  4E7L A;  1QPM A;  3WGH A;  4R79 A;  3K0L A;  1ETW A;  3S1Q J;  2HNH A;  1X4O A;  2YVE A;  3W6V A;  3PQK A;  1FC3 A;  1WPK A;  3NRG A;  2IEK A;  4IHY A;  1KA8 A;  2DA7 A;  4ZC3 A;  2V4J C;  2QQ8 A;  4ABZ A;  1X19 A;  3GTG J;  4J00 A;  2LVS A;  4BEH B;  3OS1 A;  4PXI A;  5E8G A;  4RB3 C;  2I5U A;  3T8R A;  1BA5 A;  3M07 A;  3OYH A;  2R7S A;  3TW7 A;  4LK1 F;  3QOD A;  4LFU A;  4RGS A;  4U88 A;  3EYY A;  1QO0 D;  3IKV A;  2NNN A;  4H4K C;  2A6H F;  2EA4 A;  1ETX A;  3BR1 A;  4AID A;  1YJW I;  4A5M A;  2DLL A;  1R23 A;  3FXJ A;  1B72 A;  2STW A;  4EJO A;  1QA6 A;  4BBS J;  3GCM A;  3U1K A;  3JSO A;  1U3E M;  4EM2 A;  1TQP A;  3TL4 X;  2UXU A;  2BOL A;  4I0A A;  1HSJ A;  4IQJ A;  4F55 A;  2KQR A;  2LSO A;  5B5E C;  1OCR H;  4KN7 X;  1I1G A;  1X3W B;  4WXD A;  2V7F A;  1NH3 A;  3DPL C;  3PNV A;  4GFL A;  2KP6 A;  1S7E A;  1KON A;  2QKO A;  3VW1 A;  3E7L A;  1FIP A;  1Z91 A;  2DA5 A;  4HV5 A;  5F0F A;  1NTC A;  5J1U A;  3IAM 2;  4CO8 A;  2PMH A;  4IL6 C;  2ZB9 A;  4XKC A;  3NNR A;  3SZP A;  3CC2 I;  2NYX A;  2AQE A;  3TKY A;  2NVT J;  1DGR M;  1XDU A;  3WU1 B;  4DVY P;  3GTM J;  1MSF C;  2OTL I;  5EEG A;  3KYL A;  2WY8 Q;  2YSR A;  4MQ9 F;  4V2F A;  4C30 A;  5J1R A;  4A12 A;  1V5G A;  3KLN A;  3V4G A;  2CFX A;  3ERM A;  3UR3 C;  2CQN A;  3V8K A;  2CSO A;  2D2W A;  3LNQ A;  1OCC H;  3CD6 I;  1TP4 A;  1JHF A;  4U7D A;  4LK0 F;  3T6N A;  5LHI A;  4FE7 A;  3CP8 A;  4P9U A;  3H3U A;  1B9N A;  2H1K A;  3GBG A;  3WU2 C;  5CQG A;  2LOO A;  1W1W E;  3HJE A;  4UY8 I;  1VF9 A;  2NOG A;  5BMZ A;  1L3L A;  3I55 I;  3WTT C;  3EYI A;  1RZ4 A;  5LHH A;  2Y30 A;  4MEX F;  2D6Y A;  3KET A;  2CFO A;  2P0W A;  1I6X A;  2WUI A;  3SDB A;  5LLQ A;  3LSK A;  2JPB A;  3FM3 A;  5TJJ A;  4BU2 A;  3V6G A;  3JRA A;  4NDL A;  2X4H A;  1WI9 A;  3F8B A;  2E34 A;  4HSR A;  1ZGW A;  4E7Z A;  4N9H A;  2NVQ J;  4OWR B;  3S14 J;  2CW7 A;  1UHS A;  2W85 A;  3RH2 A;  2CV2 A;  3TDZ C;  2IXS A;  1XCV A;  3K4C A;  3JRH A;  3GO5 A;  4M73 A;  1JUS A;  3ZP5 A;  2K02 A;  2W25 A;  3SYT A;  4XLA A;  3OWT A;  1U5T C;  1SFO J;  1WI3 A;  3QKX A;  1MMA A;  1X2M A;  3TOA A;  4NC6 A;  3BJB A;  1I27 A;  2JUG A;  4A3L J;  2PMZ N;  2EIJ H;  3O6B B;  1D8J A;  3MKY B;  1D3Y A;  2O8K A;  2FD5 A;  3D5R C;  2QM3 A;  4FX0 A;  2BGC A;  2ESH A;  2NS7 A;  4JX5 A;  5GAD J;  2XGD A;  1WSU A;  1XD7 A;  2R5Z A;  4ZYG A;  2MD5 A;  1W36 D;  1IF1 A;  2BY0 A;  5D8K B;  1B6A A;  3JSP A;  2CQQ A;  3MNL A;  1H8A C;  1FY7 A;  2O9L A;  3LSG A;  2QTQ A;  2QUF A;  1U6G A;  4WXH A;  3C07 A;  2XRN A;  2M8E A;  3MAJ A;  3PL8 A;  2VQL A;  3ZPL A;  4HF1 A;  1ETO A;  4F91 B;  2NS8 A;  3ANG A;  1Z77 A;  4ANJ A;  3UKG A;  2PQ8 A;  2MGQ A;  4XKW A;  1YW7 A;  2IGM A;  2IBD A;  2VJI A;  1PUF B;  4CZZ A;  1XS9 A;  2UWM A;  1FPQ A;  2EFP A;  4XLN F;  1I3Q J;  4P1W A;  2I10 A;  1JGG A;  1UB9 A;  1LFU P;  3FXK A;  4KMF A;  2NOJ B;  4BY1 J;  1LKX A;  3CZ6 A;  5D4R A;  5JLW A;  3FX3 A;  2X1D A;  2M30 A;  3RPU D;  5H20 A;  3FDY A;  5DD8 A;  3HOU J;  2PEX A;  4MFE A;  2CW8 A;  3FHZ A;  5JI6 A;  5F0C A;  5D18 A;  3BRO A;  3LAJ A;  2F4M B;  3CO7 C;  3IRR A;  3AG4 H;  4KIB A;  1KQ0 A;  1KQ8 A;  4EJT A;  3KZY A;  4JYK A;  1T39 A;  3LHQ A;  1QZZ A;  1UG0 A;  4HDV A;  4L5E A;  2E36 A;  4IHT A;  4KYW A;  2E1C A;  2Z1D A;  4FT8 A;  2V9P A;  3E6C C;  5D6F A;  1Z05 A;  4LJZ F;  4DQ2 A;  5ICG A;  1XN7 A;  2JA6 J;  4TV7 A;  3CCS I;  4HEA 2;  4DBR A;  1FBS A;  5M3F J;  2XIG A;  3OYI A;  2X1E A;  2FOW A;  1O3R A;  2DJN A;  2IA2 A;  2O03 A;  1G59 A;  2ZXI A;  1BOB A;  1OYY A;  2DDA A;  3K1M A;  3LST A;  4CCJ A;  2VJ4 A;  2KIQ A;  4RAF A;  4LMY A;  5HLI A;  3QQA A;  1XMK A;  2QA4 I;  3N4M A;  4II3 A;  2HS5 A;  4E7J A;  1LB2 A;  1B9M A;  2X51 A;  3VYS B;  2P7V B;  2COM A;  2STT A;  4I09 A;  4M74 A;  3AL0 C;  1TW2 A;  1P4A A;  3M1E A;  5LD2 C;  2M4K A;  4G7Z F;  5K58 A;  4WXC A;  3EET A;  4PJM A;  3Q0U A;  4XLH A;  1YS6 A;  3H5R A;  2QQB A;  5GPC A;  3PO3 J;  1YOV B;  2JK3 A;  2A68 F;  4CDG A;  3HOS A;  2XGC A;  3WGG A;  3ZR8 X;  3G56 A;  3W6K B;  3FWE A;  2VBW A;  1T8I A;  2QKM B;  3A0H C;  2G9W A;  1N78 A;  3BPV A;  4RS8 A;  2K3P A;  5M3M J;  2YU3 A;  2P6T A;  3A2K A;  1OR7 A;  5HAW A;  4BQO A;  2LD5 A;  4UUV A;  3KCC A;  5D5X B;  2E19 A;  2ZXH A;  2Z16 A;  1ZYR F;  3E5U A;  4OD5 A;  3VTI A;  3I58 A;  2OI8 A;  4S05 A;  2HPI A;  3BP8 A;  3TQN A;  4AVP A;  4XRF A;  1PP7 U;  2CV1 A;  4KIG A;  1QRY A;  3CRJ A;  1GUU A;  4HG2 A;  1YIT I;  1J75 A;  2ZCM A;  2EV0 A;  1HBX G;  3COA C;  2DMU A;  2HZT A;  2E7W A;  2ME6 A;  4B43 A;  2VON A;  3P7N A;  2H1L A;  4B48 A;  4FAS D;  5DCM B;  5FFZ A;  3ZQQ A;  4IRV A;  2ME0 A;  3QPH A;  1N77 A;  1IUY A;  2V9V A;  2KMU A;  1NG7 A;  2VE8 A;  1TTY A;  3CJN A;  3HSE A;  2ID3 A;  2DA1 A;  4GYG A;  5HNF A;  3VP5 A;  4PDK A;  3M8E A;  2JA2 A;  2KIU A;  4M9X A;  2KFD A;  5FKM A;  1TBX A;  5KCM A;  3BR0 A;  1MND A;  2R5Y B;  2LH9 A;  1FYM A;  2CUF A;  2RKH A;  4HX8 A;  4I6Z A;  2HQ5 A;  2YUS A;  4UVC A;  2NVX J;  2KHM A;  1IRF A;  2Y9Z A;  4JOM A;  2BW3 B;  2R7D A;  5D5V B;  4DOZ A;  2JTV A;  5E3O A;  5FO5 A;  1FIA A;  1OMI A;  2ZY9 A;  5IYC J;  3F21 A;  4XON A;  3QP5 A;  2XDN A;  2WAE A;  5DDG A;  4MK6 A;  3CME I;  4EAT A;  1YYV A;  3ANP A;  2EFO A;  5EG0 A;  4CIC A;  1YIJ I;  3ZN0 A;  2EV5 A;  5HS8 A;  4N9I A;  2CGP A;  2VBY A;  3OYC A;  1PJR A;  2YX4 A;  1P4X A;  1ULY A;  2ZNZ A;  4G12 A;  2DBB A;  2QCO A;  2D45 A;  4CYC B;  4A3I J;  3ZOB A;  3IWZ A;  1KGS A;  3ZMZ A;  4BGD A;  1ODD A;  4ZYD A;  3CCR I;  3CCJ I;  2I8D A;  3OL3 A;  3CDH A;  5E79 C;  1S7A A;  2D1V A;  5LFA A;  1S6L A;  4BKX A;  4AF5 A;  1P4W A;  1BW6 A;  2HQN A;  2LK2 A;  2MFZ A;  4EMS A;  4KIS A;  2H6C A;  4A5N A;  4I01 A;  3DPJ A;  2DQR A;  3E97 A;  1LFB A;  2ZBK A;  5HSZ A;  1XGM A;  2BY2 A;  5DYM A;  4A3D J;  3G4S I;  2FSW A;  1UI6 A;  4P96 A;  2LY1 A;  2XF7 A;  3L00 A;  3G73 A;  2NP3 A;  3DLA A;  5LRS A;  4PFP A;  4CCL A;  4NHJ A;  3LL7 A;  2RC4 A;  1YS7 A;  2HEO A;  1O57 A;  1K79 A;  3GW2 A;  1EJ9 A;  3KZI C;  3HOW J;  2GWR A;  4R8H A;  5FRO A;  3DWL E;  2XV4 S;  1X1D A;  1BR2 A;  4QTR A;  3KPH A;  2VBZ A;  1R58 A;  3HC7 A;  4XRS A;  4Y7N J;  1RC9 A;  3VW0 A;  4RGR A;  4XR6 A;  3V7S A;  2WV0 A;  1PUE E;  2K7L A;  1S8N A;  5BPD A;  3LSJ A;  2PI0 A;  3GEZ A;  3HOZ J;  1UG2 A;  2AQF A;  5EEA A;  2E60 A;  3E5Q A;  4GDF A;  3Q9S A;  2ZKZ A;  4AIJ A;  3V42 A;  2B7E A;  3DBH B;  2WBM A;  3BZK A;  4M6X A;  2NS0 A;  5FKO A;  4ZTF A;  3NAU A;  5J3L A;  4JL3 A;  1R1T A;  2DO7 A;  2JT1 A;  5L3F A;  4IRI A;  1R36 A;  2DFF A;  1BI1 A;  3ABK H;  1I6H J;  4LGW A;  4BXU A;  4UUS B;  1JKO C;  9ANT A;  3CF5 F;  4M6Y A;  2OA4 A;  4KJZ A;  1ON1 A;  1IDY A;  1EH6 A;  2O0Y A;  3B73 A;  2B63 J;  1HKS A;  3UNG C;  4B3A A;  2KIF A;  2D5V A;  4Q4Z F;  2Y0S N;  2BW3 A;  3C18 A;  2GA1 A;  2VQH A;  4GCV A;  1QBJ A;  4IKF A;  3F72 A;  2O5R A;  5E1X A;  3DEW A;  2UV1 A;  3JTH A;  4LLN A;  4ZDO A;  1S9H A;  1SD6 A;  1LEA A;  1V5E A;  3CLO A;  4CH7 A;  1DUX C;  1JXS A;  1U9O A;  4PZJ A;  1CQT A;  3A01 B;  5FFX A;  5J8F A;  1IXC A;  2DQL A;  3ONQ A;  1RR7 A;  1WZ2 A;  2X0L A;  3DTK A;  4IO9 F;  1H9T A;  2IS2 A;  3P9C A;  3OYE A;  4M3B A;  3BCB A;  4G8X A;  5F27 A;  4ZYE A;  3KYD B;  3K4J A;  1RKT A;  1YQA A;  5JHU A;  1FYL A;  3D5L A;  1XMX A;  2VT2 A;  2JUC A;  3WTY C;  3CCM I;  2LBF A;  4GRI A;  5CVI A;  4ZYH A;  3N97 A;  5F08 A;  2HVQ A;  2XF5 A;  5IOY A;  3PSF A;  4AWX B;  5E20 A;  2QSG X;  4RBO A;  3HGG A;  3SFI A;  1IN8 A;  3JSJ A;  3HZJ A;  2VAS A;  4I0B A;  1WRJ A;  2QGU A;  4FET A;  2DCE A;  1UCR A;  2F5V A;  2K3F A;  2YPR A;  4GFB A;  4MNU A;  4J19 A;  4BJ6 C;  2ZC2 A;  2VN2 A;  3L9F A;  4BHB A;  5EZH A;  2W53 A;  2R7W A;  1SFU A;  3RYR A;  1SC7 A;  1Y56 A;  1OPC A;  2EJR A;  4E7S A;  2A2F X;  3CJD A;  3K1P A;  4GFK A;  3BY6 A;  1QQI A;  3TGN A;  4IJA A;  4CXF A;  2MH9 A;  5CLS A;  2HR3 A;  4DZP A;  4A6D A;  4RGU A;  4A3K J;  5A2Q K;  1CF7 A;  4NC8 A;  1VQ8 I;  3NAR A;  5KVR A;  2REK A;  4GO1 A;  4MO7 A;  5HS9 A;  1C0W A;  2E5Z A;  1VQ7 I;  4HF0 A;  1QU3 A;  3HKZ N;  1NK3 P;  5K5R A;  1JGS A;  2XKO A;  2XB5 A;  3ZCO A;  1ZHF A;  2K27 A;  3TMO A;  3S32 A;  3BHQ A;  4C2M A;  1NK2 P;  1A35 A;  2FNA A;  1U78 A;  1B72 B;  1R7J A;  3NWT A;  3GTQ J;  4E4H A;  4NC7 A;  1U0J A;  2K9Q A;  2P5K A;  1IN5 A;  5HVQ C;  1AHD P;  4KWA A;  2VPR A;  4D5F A;  5D4S A;  3VVZ A;  4HX7 A;  2VKE A;  3C2H A;  3HRU A;  5F6F A;  2QWW A;  4JX6 A;  1JKR C;  3GTK J;  5IOZ A;  3PIO F;  4LLL A;  3A1Y A;  3K4K A;  4WIB A;  3HTU A;  4EQQ A;  5FHP A;  4MEY F;  4C2M J;  2V6C A;  4KFC A;  2OTJ I;  1IRX A;  2CH0 A;  1V5F A;  2G7S A;  3VPR A;  4F52 A;  1R00 A;  2EIN H;  2HPM A;  1H88 C;  1ZAR A;  3HIF A;  1RES A;  4FQG A;  4I98 B;  3M4O J;  2IA0 A;  3CMA I;  3HUG A;  4M3G A;  2FU4 A;  3MZ8 A;  4WWC A;  3ERE D;  2Q24 A;  2WGB A;  3GYH X;  1T56 A;  1ZH5 A;  2ZXW H;  3A01 A;  2HYF A;  5FKK A;  4F3Q A;  2V26 A;  3I9V 2;  3K9T A;  5CVV A;  4B09 A;  1DDN A;  2DU9 A;  3J81 K;  4M71 A;  1OJL A;  4DW6 A;  1TNS A;  5BNG A;  1TWH J;  2XAU A;  5E1Z B;  3W2V A;  5FRM A;  4Y13 A;  3LWF A;  2R92 J;  4FTH A;  2H94 A;  2FOK A;  3CQZ J;  3JRB A;  2ZME C;  1PP8 F;  3QU3 A;  3VW2 A;  3LA2 A;  3WE3 A;  1GDT A;  3F3X A;  2L9V A;  3BRU A;  3CUQ C;  2LY2 A;  4WK8 F;  3QYB A;  4V19 K;  3GFL A;  2VC1 A;  1S29 A;  3RCO A;  1W4M A;  2AO9 A;  2EFN A;  1W5C C;  3F23 A;  4BAC A;  4HZF A;  3DQV C;  1SFX A;  3GZ6 A;  2YVH A;  3ZQC A;  2O7T A;  2CW0 F;  2OD5 A;  1BC8 C;  5HDG A;  3F1B A;  1OKR A;  1SAN A;  2ELJ A;  4F92 B;  1DU0 A;  3ON4 A;  4PGH A;  4XBF A;  1ZR2 A;  3BLY A;  1P92 A;  3LA7 A;  5EZG A;  2K9L A;  4NB5 A;  4OAY A;  3SEZ A;  4ICH A;  2KIM A;  1LQ1 A;  3HOY J;  1T33 A;  2HKX A;  1TC3 C;  3OYJ A;  3E3V A;  2DA3 A;  5B1A H;  3PIP F;  2DOF A;  1R71 A;  3FXR A;  2TCT A;  1V55 H;  2DOA A;  3NXC A;  4AYB N;  5DS9 A;  1FBU A;  4MXM A;  2GM4 A;  5KAI C;  3CCV I;  1Z3Y A;  2WA0 A;  3DEE A;  1FX7 A;  4Z6Y A;  1FBQ A;  2CRG A;  2CQK A;  2LG4 A;  2R5Z B;  2Z5U A;  2X9D A;  2ZXJ A;  1R5G A;  4U87 A;  2ESN A;  1F9N A;  1FSH A;  1IN4 A;  1KU9 A;  5E8I A;  3WTW C;  1EH8 A;  1A31 A;  2JA5 J;  1P7I A;  1WHU A;  3GFJ A;  2EFW A;  2NRA C;  2G7U A;  1K78 A;  3ELK A;  5HOD A;  3E1S A;  1Z67 A;  2QVO A;  2WB1 N;  4II2 A;  5CPR B;  4RB0 A;  2AXT C;  4DYQ A;  3KFW X;  3K70 C;  2WAQ A;  1RKW A;  2AXL A;  3DPT A;  3GX4 X;  4IHX A;  1I5Z A;  1Y8R B;  3F6V A;  5FJ8 J;  3P5J A;  2XHK A;  4B44 A;  1S72 I;  3S8P A;  1V4R A;  1XC5 A;  3GUD A;  3OYM A;  4HV6 A;  4RMN A;  1FNN A;  1FZP B;  4ZTJ A;  1R1U A;  1Z3X A;  3I53 A;  4N4O B;  2FUG 2;  2O61 A;  3NRV A;  3S3N A;  3NWS A;  1WJD A;  1LPQ A;  1S3J A;  1N75 A;  1E3H A;  2OBP A;  1OIS A;  1T98 A;  2XRO A;  2OU2 A;  5JLX A;  4XN3 A;  5L3C A;  2VT3 A;  2DK5 A;  2JRM A;  2FX0 A;  4XIC A;  2UXH A;  4XID A;  2R0Q C;  3V7R A;  4KT6 A;  4KIT B;  4HOB A;  1VQM I;  1ZTR A;  2QBY A;  2X1C A;  3OIP A;  4EV0 A;  1X2N A;  1GVJ A;  3PPB A;  4ME9 A;  5IP6 A;  2LLK A;  2ECB A;  5A2Q Z;  1H9G A;  2GBY A;  5FLX K;  4M3F A;  3ECH A;  4NEL A;  2K85 A;  5FGM A;  2MG4 A;  3CCL I;  3GF2 A;  2W7N A;  1R9T J;  3FXL A;  2MLK A;  2QIB A;  4OU0 A;  2GXB A;  2FBQ A;  3LWJ A;  2F5C A;  3ABT A;  3C2B A;  4A3C J;  2XRL A;  4DYC A;  3FBN B;  1SD5 A;  2CUZ A;  1YI2 I;  2YX7 A;  2FBI A;  4Y4R A;  3I56 I;  3QPL A;  4RB2 C;  3JRI A;  2W00 A;  1ZRF A;  5H6Q A;  3WTS C;  4OIO F;  1I1S A;  2DFI A;  2QYO A;  2QQA A;  3H35 A;  3HHH A;  3WE2 A;  5E1W A;  1IV8 A;  3QAH A;  1FLI A;  4S0H B;  4HST A;  1WJF A;  3J7A O;  3IUV A;  1VQP I;  3ZGK A;  2GZW A;  2QZ8 A;  3GTL J;  3S1R J;  1U8B A;  1LEB A;  2OC6 A;  3S17 J;  2VXD A;  2Z3Y A;  2M9H A;  5ED4 A;  2IP2 A;  2XPV A;  2ACJ A;  5CVU A;  1O3Q A;  3BCG A;  1O7F A;  2BE5 F;  1WFX A;  3DEU A;  2O3F A;  2IGN A;  4EM1 A;  4UUT A;  4LG3 A;  4G9Y A;  2R3S A;  2HKU A;  3KEO A;  4YII A;  5J4Y A;  2VQC A;  3QRF F;  1QHG A;  2PJP A;  3W3C A;  3J7Y J;  4KT5 C;  4OOI A;  3J81 Z;  2Y9Y A;  4P5O A;  1VND A;  1LDD A;  2H6B A;  2LTP A;  2W24 A;  2JRT A;  3DLL F;  3H3V K;  3WGI A;  3C2G A;  3RI4 A;  2F4O B;  4XLF A;  2M8G X;  2ECC A;  4ENK A;  2UXP A;  2DYS H;  2E7X A;  4UB8 C;  3EUH C;  4IHS A;  3BR5 A;  1T6S A;  2RAE A;  3F0C A;  3D5S C;  3TO7 A;  4L9T A;  2VL8 A;  4L9N A;  1R4M B;  1YHQ I;  3GME A;  3BNI A;  2EK5 A;  2HQR A;  2L01 A;  4KN4 X;  4EGZ A;  2X6W A;  3OYN A;  4PSW A;  2FNP A;  3KP5 A;  1BC7 C;  1BL0 A;  2OPT A;  3NEU A;  5IYB J;  3BR6 A;  3HL2 A;  3COL A;  1GVD A;  1MNE A;  2L5Q A;  5EDN A;  3JR9 A;  1XSX A;  3J7A Y;  2NX4 A;  3ZMD A;  4PJ0 C;  3MEX A;  2E1O A;  4UVA A;  4ESF A;  1B8I A;  2H27 A;  1XB4 A;  2HI3 A;  3FM5 A;  3V8L A;  5M5Y J;  1Z1D A;  1HST A;  4ASN A;  2LMD A;  3CWR A;  2W4S A;  1BI3 A;  2K4B A;  1KU2 A;  5KAF C;  1QHH D;  1B59 A;  2R7Z J;  2JQ7 A;  1RI7 A;  2RV8 A;  1FP1 D;  2DT5 A;  2VKD A;  1STZ A;  4LB6 B;  2ZCX A;  2BXY A;  2NP5 A;  3B6C A;  1Z6T A;  1EV7 A;  1OYI A;  2QSH X;  2V9K A;  1ETY A;  2TDX A;  1R4N B;  4RB1 A;  5E3N A;  1AA7 A;  5JVG F;  4R1H A;  1MZB A;  2OJE D;  4Y33 A;  2UXN A;  2JN6 A;  2OUM A;  1UZC A;  4IQ4 A;  3BG5 A;  3V7C A;  1ZRE A;  1JT0 A;  1BR1 A;  4OIR F;  3HPG A;  1P6R A;  3ZXS A;  3AG1 H;  5EG0 B;  5FD5 A;  3PAS A;  4RLQ A;  1GV2 A;  2V57 A;  3GLL A;  4LG0 B;  3DCF A;  3VYT B;  2DG8 A;  1ZGA A;  2FEZ A;  2V6E A;  1J0R A;  2A6E F;  2W57 A;  5J47 A;  2RN7 A;  2QLZ A;  3FMS A;  4DYR A;  3KEQ A;  2L4M A;  4A93 J;  3IH2 A;  1TT0 A;  1J5Y A;  5DV5 A;  3HRS A;  5KK1 A;  1ORK A;  2RNJ A;  2R7Q A;  1YG2 A;  2F6C A;  1J09 A;  1MKM A;  2F5D A;  3C3W A;  5LEJ A;  2FQ4 A;  2H8W A;  4EJV A;  3HTI A;  3S15 J;  3VFZ A;  5IP9 J;  3PNY A;  1FT9 A;  2KZG A;  5GP9 A;  3J80 K;  3PQJ A;  2HQA A;  4X0G A;  1G3T A;  4O5V A;  1Z7U A;  1VI0 A;  2B3W A;  1YW8 A;  4HW0 A;  1MBK A;  1VQL I;  4NBQ A;  3BR3 A;  3HOT A;  3KEY A;  3H9J A;  5H9T A;  1AKH A;  4DNC A;  3HTJ A;  3F6O A;  2VKH A;  3T0Y A;  2CUE A;  4I2O A;  3AL0 B;  5C44 J;  4BDZ A;  2DJI A;  1U5T A;  2E2J J;  3GVA A;  4MQV A;  5CQE A;  5FLX Z;  2QEX I;  3M1C A;  4XSZ F;  1VQK I;  4KDP A;  2W1O A;  1BN5 A;  3LFK A;  4BE1 A;  3IWF A;  5KHD A;  2X48 A;  5C4X J;  3JRC A;  2VBX A;  3HM5 A;  2C6Y A;  2QOP A;  2LYC A;  2FJI 1;  1YX3 A;  3O8G A;  3B81 A;  2FML A;  1WJA A;  2XC7 A;  3H36 A;  4BE2 A;  4AVZ A;  5K5O A;  2Y69 H;  4BNC A;  3L2R A;  1L0O C;  3M8F A;  1OFC X;  1UEL B;  1SVM A;  1XMA A;  3EUH A;  2XSD C;  3ZQ7 A;  3D1N I;  3ZN1 A;  3G3Z A;  3TW6 A;  3OYG A;  4ON0 A;  3DBL B;  3NS4 A;  1XX5 A;  4CSW A;  1XGO A;  2L7M P;  3ZQI A;  5K5Q A;  2PFB A;  1Y39 A;  2MSY A;  2XGE A;  3H1C A;  3H92 A;  2M4G A;  2LY9 A;  4D1Q A;  4PUS A;  4CGR A;  1VFC A;  2VOO A;  1FOK A;  2YR2 A;  2A69 F;  2HTS A;  2K4J A;  4I99 C;  4PGG A;  1QVU A;  1HC8 A;  3LSM A;  3R61 A;  3ISP A;  1W36 C;  5AQC A;  4QPO A;  1KYW A;  2CQX A;  1VTN C;  1FTZ A;  4U9N A;  1LFP A;  3LSH A;  2F2E A;  3CF2 A;  3DXJ F;  4OAZ A;  4JQF A;  4RAY A;  2CU7 A;  3NI7 A;  2KKO A;  1HW5 A;  3K10 A;  3LSP A;  2NNY A;  1JKP C;  1AU7 A;  2ADU A;  4CCO A;  3P9K A;  2LKP A;  2M5W A;  3Q0W A;  4XNF A;  2XPW A;  4LG0 A;  5J4V A;  4A0Z A;  2M7B A;  1S5L C;  4HQE A;  2IAI A;  5D1R A;  4M72 A;  4LIV A;  3SXY A;  2A07 F;  4OD4 A;  4ZZL A;  3K2Z A;  3HSF A;  1O7L A;  2LBF B;  1RPW A;  4MHG A;  4L5J A;  2IS6 A;  2RGV A;  3GEU A;  3S5R A;  2DTZ A;  2XGX A;  1FYK A;  5CVR A;  1IW7 F;  5LHG A;  4UDS A;  5EEH A;  3BT9 A;  2P81 A;  2Y48 A;  4HAM A;  5CJ9 A;  2DTR A;  4AD9 A;  2HOT A;  1R5I D;  3WTX C;  2VC0 A;  3QYF A;  1Z0X A;  4Y17 A;  2E5N A;  1B4A A;  2ZNY A;  3F9K A;  1K83 J;  2Q1Z B;  2Y2Z A;  2CQ7 A;  2QSF X;  1VQ4 I;  3R6S A;  5DTD A;  1YO5 C;  2Q2E A;  3SWH A;  2XAS A;  4FCY A;  3I59 A;  3PJR A;  1D0Z A;  2HDC A;  1NHA A;  1ITY A;  3I0T A;  3H0G J;  3MN2 A;  3MMY B;  1LE8 B;  3HRM A;  1LDJ A;  1RUO A;  4CCM A;  3CCU I;  5IP7 J;  3SDG A;  1ZKG A;  2Z9O A;  4XK4 A;  2DPD A;  4ETS A;  4IOA F;  1CF7 B;  3HRT A;  3HIM A;  1BBY A;  2NAZ A;  2L7Z A;  3K2A A;  4NQW B;  4ENJ A;  3P9T A;  4CCK A;  3O3K A;  1BI0 A;  4IHV A;  3GZN B;  2QKL B;  1U9N A;  3BTC A;  1HOM A;  2JSC A;  1RIO H;  1USS A;  4OMZ A;  1WGX A;  5EGO A;  2ZOZ A;  2LRE A;  1W0T A;  2JA7 J;  2H09 A;  1FMW A;  2G7L A;  1IC8 A;  1Y0N A;  4A3J J;  4IHW A;  2HDW A;  3ASN H;  3K6G A;  4BL0 B;  3M3Y J;  3OSG A;  2E35 A;  4OMY A;  2V1X A;  2JVH A;  3Q0V A;  3QP6 A;  4BJ5 C;  4I7H A;  5DM6 F;  4V2G A;  5D5W B;  2P5V A;  1EKE A;  1JUM A;  3BQZ A;  2OQG A;  3WU0 A;  3MKW B;  4OIQ F;  1FOY A;  1POG A;  2KPM A;  3DTI A;  3U2R A;  4EJW A;  1MBH A;  1CGP A;  1ZG1 A;  3PUF A;  4BXX J;  2OQR A;  1ONV A;  3R0A A;  4ITV A;  2CUJ A;  3J80 Z;  2DN0 A;  2HYJ A;  1OCZ H;  2X6X A;  2DT6 A;  2Q0O A;  2GAU A;  5FGL A;  3VB2 A;  2RNG A;  4BJT A;  3HUG B;  4RAZ A;  1HDD C;  3JRF A;  3S1M J;  3BG6 A;  4D7M A;  1W0U A;  3S3O A;  1SVL A;  3LOC A;  1KU3 A;  4A69 C;  1ON2 A;  5EF6 A;  2FF4 A;  2L2O A;  5CYV A;  3HOX J;  3WTZ A;  1MGT A;  4A6E A;  4RDU A;  1WQ2 A;  3IH4 A;  2DA6 A;  1P2F A;  4D5C A;  4ENN A;  2GOX B;  4UXN A;  3AQS A;  1X1A A;  3RKY A;  2EPF A;  2O7O A;  4QSH A;  4ZYA A;  3AG3 H;  4A0Y A;  5K1Y A;  4M9S A;  2KRH A;  3E6B A;  4Q47 A;  5GTH C;  2P7C B;  3MVP A;  5LGN A;  3GWZ A;  3IAS 2;  5FLM J;  4IOC F;  2E1M B;  1HCR A;  3M7G A;  3FIW A;  2KRC A;  2BHY A;  2V1D A;  4KUM A;  3CJQ B;  3RKX A;  2BXZ A;  2HWV A;  4GCT A;  3OR1 C;  3VWB A;  1TNT A;  2GIZ A;  4XSX F;  3OS2 A;  3RDI A;  3LA3 A;  2DI3 A;  4KIC A;  3ESW B;  1T0F C;  2EA2 A;  3H5A A;  1MIJ A;  2LKX A;  4ZDL A;  1XTA A;  3RSN A;  3LFU A;  1NG6 A;  4U9L A;  2OZ6 A;  2M0C A;  3BJA A;  2IA1 A;  1MJA A;  1ZG3 A;  2M7A A;  1LE8 A;  2BVM A;  3K4N A;  3ABM H;  3IH3 A;  1MMG A;  3E5X A;  3DF8 A;  1PDN C;  1MMS A;  5JVT A;  2R93 J;  1D1B A;  1A04 A;  1X1P A;  1SFK A;  3FXU A;  2GLO A;  1BI2 A;  3QPT A;  4JBA A;  4YIF A;  1A36 A;  4NQW A;  3WG9 A;  1AWC A;  3K69 A;  4C2T A;  4HNU A;  3U9G A;  2PJR A;  1JTY A;  1R22 A;  4LOC A;  2HGC A;  2R7F A;  3ZQG A;  2MC3 A;  3RQI A;  1ZQ3 P;  4KNY A;  2EWN A;  2JZY A;  2PMU A;  3MD2 A;  1MH4 A;  1JT6 A;  2PX9 A;  5AIQ A;  4WCG A;  2CYY A;  1DPR A;  2VPL A;  3D0S A;  4D9J A;  5ILU A;  5CVJ A;  2KT0 A;  2A3S A;  3TOB A;  3PFY A;  4YFX F;  1K78 B;  3I3L A;  3VVY A;  1YRN B;  2A6T A;  3K7A J;  3FBI B;  2CO5 A;  2E71 A;  3FXM A;  2WTE A;  4L9V A;  4Q48 A;  5BOX A;  1JE8 A;  5EJC A;  3BG9 A;  1HDP A;  3CJT B;  3OY9 A;  2VXZ A;  5D8L B;  3G2B A;  1XG1 A;  4UHT A;  3VSK A;  2CV0 A;  5F64 A;  4GYI A;  2IVM A;  2XSJ C;  1ZAO A;  1Z6R A;  1Q1H A;  4YFK F;  3CTA A;  1J9I A;  3HDD A;  5D5U B;  2L9R A;  1BJA A;  1ENH A;  3WOD F;  4J01 A;  2R7T A;  5HLH A;  1K7A A;  2VB6 A;  1P7J A;  3BDD A;  2LNB A;  1ZLJ A;  2J5O A;  3HYI A;  3MQ0 A;  2LFB A;  1EF4 A;  1J2X A;  2L9S A;  1GT0 C;  2GIV A;  4HLX A;  2M0M A;  2CG4 A;  4KMU X;  4BDY A;  2DMQ A;  1MW7 A;  2BYV E;  1WH7 A;  3B6A A;  4H0E A;  3HTA A;  2QBY B;  3I4M J;  1D5V A;  3EUK L;  3L09 A;  1TQI A;  1K4S A;  1G4D A;  3CCE I;  2ZJQ F;  4BHC A;  1IRZ A;  4BE0 A;  2MBF A;  3TP3 A;  1OYW A;  4JKZ A;  3RTR A;  4UNO A;  4BXF A;  5F1R A;  3OYB A;  3I4N J;  2M45 A;  4FHT A;  4BHP A;  1ETQ A;  1LNW A;  1YIO A;  1Y1W J;  1D5Y A;  2ZOY A;  1N25 A;  3HXL A;  3BG7 A;  4BH9 A;  5CXI A;  3BJ6 A;  3DU5 A;  5HBU A;  5K7Z A;  2M2E A;  3TDU C;  3HTS B;  5L3B A;  3Q5F A;  1GXQ A;  1E3P A;  2PMZ A;  3DTE A;  1IN7 A;  2HVR A;  3S1N J;  4U0W A;  2CS3 A;  2L4A A;  1WJC A;  2ZJR F;  3OS0 A;  1QVT A;  1VQ6 I;  2VE9 A;  1SMY F;  4OIP F;  4DGW B;  1XGS A;  2MLG A;  4I76 A;  3WHB A;  2L9N A;  3L2V A;  4JNN A;  1UST A;  3CUQ B;  4MIM A;  3EUA A;  1A5J A;  2HVS A;  1Y6I A;  4XMY A;  2OV7 A;  3GTO J;  1YLF A;  4BAY A;  3K8P C;  4BQQ A;  5DUK A;  4OIN F;  3G1L A;  4XM3 A;  1UJ8 A;  2CMP A;  3KP7 A;  3ON2 A;  3G1O A;  3RZO J;  2ZSH B;  4XLP F;  1R49 A;  2JWT A;  3CMY A;  1YJ9 I;  5DEQ A;  1U8R A;  3ECO A;  1E0E A;  3FHN A;  5KNL A;  1G3Y A;  1VQ9 I;  4E70 A;  3GZI A;  2DOD A;  2LC2 A;  3QBM A;  4LLG F;  3GFM A;  1R6R A;  2ID6 A;  1HLV A;  4YIR X;  2KDO A;  4HPQ A;  2LDU A;  3JW4 A;  3A02 A;  3T5X A;  3MKL A;  4RM3 A;  1RRJ A;  2M1B A;  4DJA A;  2AHQ A;  2E2H J;  5EYR A;  1IN6 A;  3KE2 A;  2X6Y A;  4RA2 A;  1YRN A;  1LUJ B;  3I71 A;  3RD3 A;  1V54 H;  3CDL A;  1WVR A;  3CES A;  5F0H A;  4GGG A;  4IRG A;  4L62 A;  3TO9 A;  1QNT A;  2LF7 A;  1SAX A;  4ACI A;  1G8X A;  3JAM K;  3VSL A;  1JTX A;  2WAD A;  5F1J A;  1IUF A;  2VJ5 A;  1ZR4 A;  1X1C A;  2KJB A;  4C3H J;  3L2W A;  2V1U A;  2GUH A;  2KRF A;  3K4B A;  1LDK B;  3HGY A;  2VJJ A;  3FMR A;  5FB2 A;  1B8I B;  4C9Y A;  5GPA A;  2W84 A;  3WHC A;  3KNW A;  3QU6 A;  3LJL A;  3KP6 A;  4YEJ A;  2EH3 A;  5D6E A;  2R7V A;  3VVX A;  4MGR A;  2IS4 A;  1MJB A;  2BV6 A;  4UV8 A;  2L7K A;  2JPC A;  5CW8 A;  2IU5 A;  2ICW G;  3Q3S A;  3JRG A;  1XSV A;  2DW4 A;  3L7W A;  3PM1 A;  4PJL A;  4ENM A;  4NN1 A;  2XAH A;  3X2Q H;  2ELK A;  5CKT A;  5E3M A;  2HFH A;  1YTY A;  4FE4 A;  1FMV A;  5HNH A;  2DDB A;  3SZG A;  5C4Y A;  1BM9 A;  5BQT A;  2JA8 J;  4L0Y B;  2FQ3 A;  3KX2 A;  2QQ9 A;  3QWL A;  1XDS A;  3BG3 A;  2P6S A;  5M5X J;  1OCP A;  1I50 J;  3HSR A;  1QGP A;  4AIH A;  3KLO A;  2P5L C;  2JMW A;  1JKQ C;  3EPZ A;  2G7G A;  4IVN A;  4PSX A;  1EA3 A;  5DD4 A;  4XRM A;  1VQ5 I;  3CO6 C;  1G3W A;  4G6T B;  5FKL A;  5GTI C;  1SMT A;  1FWZ A;  4JK1 X;  2ZJ2 A;  2Z33 A;  2ZME A;  3AAF A;  3VUQ A;  1W5T A;  2EQR A;  3FRQ A;  5GAG J;  3I4P A;  3CUQ A;  2DOE A;  2XPU A;  3A4C A;  4M9Z A;  2BHZ A;  5C4J J;  2XAG A;  4XLE A;  1W7P A;  3GLX A;  4XQF A;  5L3E A;  1GHC A;  4AM3 A;  1XPX A;  3QOP A;  4HBL A;  1UI5 A;  1UFM A;  1GV5 A;  1E17 A;  1OCO H;  3CJR B;  3H0D A;  5BPI A;  5E17 F;  1IAW A;  5BS6 A;  2P4W A;  2DT7 B;  2O8X A;  1H0M A;  5IYD J;  2HTJ A;  3JCU C;  4ZH4 F;  5HS7 A;  5TIS C;  5HDK A;  4B47 A;  4EGY A;  5M5W J;  3OYD A;  1J59 A;  3QYE A;  1AKH B;  1MNM C;  2UXO A;  1SAU A;  1ZGJ A;  3EQL F;  4QPQ A;  2RHA A;  1U5T B;  3OYA A;  1TWF J;  2EIK H;  3FMQ A;  1DGW Y;  3VOD A;  3TED A;  1OR7 C;  2VUM J;  3ZMS A;  1ETK A;  3KZ9 A;  4BEH A;  2F48 A;  2GFN A;  3K1N A;  4E6K G;  3HG9 A;  2WY7 Q;  1F4K A;  1UHW A;  5J1Y A;  2XDV A;  3OYK A;  3BZ6 A;  4L0Z B;  1JJ6 C;  5CXG A;  2BVL A;  4Z2Y A;  2PG4 A;  2ETH A;  1R1V A;  3ULQ B;  2BY3 A;  3DKX A;  3BPX A;  3PNT A;  2IRF G;  4NUB A;  2M3A A;  5B1B H;  1T38 A;  4FIS A;  3KIO A;  4HNV A;  3OIO A;  3TP0 A;  2F5E A;  3GXO A;  3OOU A;  3IL2 A;  5TRD A;  1O4X A;  2R7X A;  4BS9 A;  3WTV C;  5FKN A;  1FP2 A;  4XLC A;  4G7H F;  4C2U A;  1ZK8 A;  3FK7 A;  4M3D A;  2FBK A;  2VKV A;  2ZO4 A;  3LQQ A;  4CHU A;  1B1B A;  4G6Q A;  4IPA A;  3EDP A;  3RKW A;  1BOA A;  2HKO A;  2XB0 X;  1I3A A;  5AON A;  1FSE A;  2CJJ A;  3L2C A;  3G7R A;  3HE0 A;  1YJN I;  3VDX A;  2DAO A;  2JVG A;  3SEQ A;  4UB6 C;  2X6O A;  1PYV A;  4M6V A;  1JJ8 C;  4BUP A;  2VOP A;  4U0V A;  3MWM A;  3HEF A;  4X1E A;  1JI8 A;  5L3D A;  2FJ1 A;  3VOK A;  5IT9 K;  1S7O A;  1IXS B;  4P55 A;  4A0X A;  3OL4 A;  4N0B A;  3W6J B;  1IXR C;  5GAH J;  3HBL A;  4Y3O A;  5DM7 F;  2DPU A;  3T1B A;  5EFY A;  3W2W A;  2DMN A;  2OCE A;  3IKT A;  5DAJ A;  1ZN2 A;  1X4P A;  4PK4 A;  2ZCN A;  2K9M A;  2WAQ N;  2EFQ A;  4QIW N;  2KL4 A;  3ZMV A;  4IXA A;  3V78 A;  3CCQ I;  3FXO A;  5K7F A;  4AIK A;  1WJB A;  1W5S A;  3MKZ A;  3ZQH A;  1T08 B;  1Y1V J;  2QWT A;  1K61 A;  2KIS A;  1Z7L A;  3VYU B;  1TWA J;  1TWG J;  2WV1 A;  4D0P A;  3RPQ A;  3S2H J;  2ISY A;  5ERI A;  1X3U A;  3KP4 A;  4CGZ A;  2JJ7 A;  4X6A J;  2L54 A;  4ESB A;  1ZRD A;  2HXO A;  3KYC B;  1ERD A;  3HB9 A;  2DYR H;  2IT0 A;  3RYP A;  3JAM Z;  1IO2 A;  4HKU A;  2TRT A;  2KDZ A;  4LIU A;  1P9Q C;  4E7I A;  5IY5 H;  4A3B J;  5LGU A;  2BY1 A;  2RDP A;  1TLH B;  4EVI A;  4DBQ A;  5ICE A;  4A3M J;  1D1A A;  1BJZ A;  3DP7 A;  5ILS A;  2DFH A;  4RGX A;  1R5H A;  2ELH A;  1ETV A;  3OIQ A;  4GCK A;  3SJM A;  2L3D A;  2EB7 A;  1JHH A;  1MMN A;  4CZC A;  2GXG A;  2Q2E B;  3KZZ A;  3LAP A;  2RRE A;  3I59 B;  3AG2 H;  3LQR A;  1IV6 A;  3MCZ A;  1K6Y A;  2R7U A;  3PO2 J;  3GTJ J;  1YX5 A;  3G6E I;  1RET A;  4B1R A;  3BQY A;  2EIM H;  3T8T A;  3H3Z A;  3QPS A;  4ZJZ A;  5IPA A;  4HF2 A;  3VOE A;  4UVB A;  3DU6 A;  3VOX A;  5B3S H;  2FA5 A;  2Y0M A;  3R60 A;  2W82 A;  4XN0 A;  2AS5 F;  5EGO B;  4PJN A;  1F36 A;  1GLN A;  2QEN A;  2HYG D;  4C3I J;  1DPU A;  2UXX A;  5HDN A;  2Y0S A;  2F07 A;  2XAJ A;  3H9G A;  3IUO A;  4DZJ A;  2DA2 A;  3OYF A;  1ZLK A;  2VOD A;  2HXI A;  2MA3 A;  1G2H A;  1HKT A;  2D1H A;  2N8G A;  5FD6 A;  3L2Q A;  1Z21 A;  1YW9 A;  4B8X A;  2UXI A;  1QZE A;  3NQO A;  2FMY A;  1F43 A;  1PUF A;  1KQ9 A;  2J5P A;  2Y31 A;  4CA0 A;  4G6D A;  2Z2S B;  2HOE A;  1XSD A;  2IGK A;  1IGN A;  3L2U A;  1SD7 A;  2OF7 A;  5HLT A;  3TBI A;  2PBI A;  3S93 A;  4O3M A;  1RR8 C;  1MDM B;  3ML6 A;  1KYZ A;  1DP7 P;  5DUI A;  4B3X A;  4Q5S F;  2GOM A;  3V8J A;  3U21 A;  4DIQ A;  4PFO A;  1UMQ A;  1SEU A;  2ZFW A;  3BTL A;  1H89 C;  2G3B A;  3GTP J;  5LGT A;  4ZDP A;  3JRD A;  3PSI A;  3HHG A;  2W48 A;  4RAG A;  2RQP A;  4XKB A;  4ZZD A; 
#chains in the Genus database with same CATH homology
 1XS9 A;  1I3Q J;  3KKD A;  2CRG A;  2I10 A;  2LKX A;  1JGG A;  3CCY A;  2R5Z B;  2M0C A;  1LFU P;  2X9D A;  3A03 A;  4BY1 J;  4Y52 J;  1LE8 A;  2JA5 J;  1P7I A;  3IH3 A;  5JLW A;  5FMP A;  2R93 J;  1WCM J;  5HOD A;  2WB1 N;  3L1P A;  4W1U A;  4DYQ A;  3HOU J;  4MFE A;  2GLO A;  5F04 A;  5F0C A;  5D18 A;  1RKW A;  4IHX A;  3AQT A;  3BTI A;  5FJ8 J;  2DMP A;  1JTY A;  4LOC A;  3VIB A;  4JYK A;  1XC5 A;  3LHQ A;  3ZQG A;  3RKQ A;  3RQI A;  1MSE C;  1ZQ3 P;  2EBI A;  2DMT A;  4L5E A;  2K40 A;  1MH4 A;  4M3E A;  5FLV A;  1JT6 A;  2JA6 J;  1IDZ A;  4W97 A;  2KT0 A;  5JLX A;  5M3F J;  3VVY A;  1YRN B;  3K7A J;  4XIC A;  2FX0 A;  1A6I A;  4B4C A;  4XID A;  2UXH A;  2R0Q C;  3BG9 A;  3NPI A;  1HDP A;  3BTJ A;  1ZTR A;  2DJN A;  1XG1 A;  4EEF G;  1X2N A;  4ME9 A;  3PPB A;  2K9S A;  2LLK A;  2ECB A;  5IP6 A;  2GBY A;  4M3F A;  4NEL A;  1SGM A;  4AUX A;  2MG4 A;  3QQA A;  2L9R A;  3S16 J;  1ENH A;  3FIS A;  1R9T J;  2QIB A;  2FBQ A;  1P7J A;  3LWJ A;  3C2B A;  2L0K A;  4A3C J;  2XRL A;  4DYC A;  2LFB A;  1EF4 A;  5K58 A;  1GT0 C;  2K9N A;  2DMQ A;  3QPL A;  1WH7 A;  3B6A A;  3JRI A;  3O8H A;  4GCL A;  3Q0U A;  3HTA A;  5GPC A;  3I4M J;  3PO3 J;  2JK3 A;  5C3E J;  2XGC A;  3G56 A;  3JRE A;  1IRZ A;  4S0H B;  3IUV A;  3TP3 A;  4JKZ A;  3GTL J;  5M3M J;  3S1R J;  1U8B A;  3I4N J;  5HAW A;  4BBR J;  3S17 J;  2LD5 A;  1ETQ A;  1FTT A;  1Y1W J;  1D5Y A;  2M9H A;  2ZOY A;  2VI6 A;  2E19 A;  1MBE A;  5CXI A;  2XPV A;  3BCG A;  5HBU A;  5K7Z A;  2M2E A;  2OI8 A;  2LR8 A;  1E3O C;  1QRY A;  4UUT A;  2DA4 A;  2R5Y A;  2HKU A;  3CRJ A;  1GUU A;  2ZCM A;  3S1N J;  4XRS G;  2DMU A;  2ME6 A;  1QVT A;  4I76 A;  2Y9Y A;  2ME0 A;  1VND A;  2LTP A;  3WHB A;  3H3V K;  2GEN A;  4JNN A;  4MIM A;  1A5J A;  2M8G X;  4AC0 A;  2ECC A;  2UXP A;  3BR2 A;  3GTO J;  3ZQL A;  2ID3 A;  3BR5 A;  2RAE A;  3G1L A;  3LSR A;  2DA1 A;  3F0C A;  3ON2 A;  3VP5 A;  3G1O A;  3RZO J;  3BNI A;  2JWT A;  3CMY A;  5FKM A;  3BR0 A;  2R5Y B;  4A3G J;  2CUF A;  4I6Z A;  2HQ5 A;  2YUS A;  2NVX J;  4CYC A;  1BL0 A;  2OPT A;  2Y9Z A;  3GZI A;  2MW8 A;  5IYB J;  3BR6 A;  3COL A;  3QBM A;  1GVD A;  5EDN A;  3JR9 A;  1HF0 A;  2NX4 A;  2ID6 A;  1HLV A;  5E3O A;  2E1O A;  1B8I A;  3A02 A;  1WH5 A;  2HI3 A;  3MKL A;  3KKC A;  1FIA A;  5M5Y J;  2AHQ A;  5IYC J;  5EYR A;  2E2H J;  2XDN A;  1MH3 A;  4MK6 A;  1YRN A;  3ANP A;  3CWR A;  3RD3 A;  3CDL A;  5EG0 A;  2YU9 J;  2R7Z J;  5F0H A;  4L62 A;  2HOA A;  2YS9 A;  4ACI A;  2ZCX A;  4G12 A;  5F1J A;  1JTX A;  2QCO A;  3HDD A;  1IUF A;  4CYC B;  3B6C A;  4A3I J;  1MBF A;  3ZOB A;  4C3H J;  1ZR4 A;  2GUH A;  1ETY A;  3IV5 A;  3HGY A;  5E3N A;  4BKX A;  1TWC J;  1B8I B;  4A3F J;  2JN6 A;  4IEJ A;  5GPA A;  3BG5 A;  4AF5 A;  3WHC A;  1BW6 A;  2LK2 A;  1JUP A;  1JT0 A;  3KNW A;  4AC6 A;  3LJL A;  3DPJ A;  3VVX A;  2EH3 A;  5EG0 B;  3PAS A;  2M34 A;  1LFB A;  3EGQ A;  1GV2 A;  1MBG A;  2EZI A;  2V57 A;  5HSZ A;  3DCF A;  1IJW C;  4A3D J;  2DG8 A;  2RAS A;  5D19 A;  4YZE A;  1UI6 A;  2DG7 A;  5CW8 A;  2IU5 A;  3Q3S A;  3JRG A;  3FK6 A;  4A3E J;  2HDD A;  2NP3 A;  4DYR A;  3S2D J;  3EUP A;  4A93 J;  3PM1 A;  3IH2 A;  2PBX A;  4NN1 A;  2G0E A;  2ELK A;  1APL C;  5E3M A;  2H8R A;  2LP0 A;  1ORK A;  2L7F P;  4FE4 A;  5E3L A;  3HOW J;  1BW5 A;  5C4Y A;  2JA8 J;  2FQ4 A;  3HTI A;  3S15 J;  5IP9 J;  4QTR A;  3BG3 A;  3O60 A;  4XRS A;  4Y7N J;  5GP9 A;  5M5X J;  3HOV J;  3VW0 A;  1OCP A;  1I50 J;  4JX4 A;  4C3J J;  4UUS A;  2JMW A;  1VI0 A;  1JKQ C;  3LSJ A;  3HOZ J;  2G7G A;  1UG2 A;  5EEA A;  1MBK A;  4XRM A;  2EZK A;  1QPI A;  3BR3 A;  5FKL A;  1MBJ A;  5H9T A;  1AKH A;  2HYT A;  3VUQ A;  4JP0 A;  2EQR A;  3FRQ A;  4MLO A;  3HTJ A;  2NVY J;  2CUE A;  5C44 J;  2XPU A;  2QF7 A;  5FKO A;  2E2J J;  3NAU A;  5J3L A;  4JL3 A;  2OER A;  5C4J J;  2HOS A;  1OCT C;  5K7H A;  3RZD J;  1UI5 A;  2X48 A;  5C4X J;  1FEX A;  1GV5 A;  3JRC A;  1I6H J;  1DU6 A;  2COB A;  4UUS B;  1JKO C;  3HM5 A;  2QOP A;  9ANT A;  1FJL A;  2EZH A;  3O8G A;  3B81 A;  1IDY A;  4MFD A;  5IYD J;  2B63 J;  2PZ9 A;  4B3A A;  4BY7 J;  2D5V A;  2Y0S N;  2EZL A;  5M5W J;  1OFC X;  1AKH B;  1MNM C;  3DEW A;  2XSD C;  1Q1V A;  2UXO A;  2RHA A;  3D1N I;  3G1M A;  1TWF J;  3TW6 A;  1U9O A;  3TED A;  2VUM J;  1ETK A;  3KZ9 A;  2L7M P;  3ZQI A;  3A01 B;  1CQT A;  2MSY A;  2GFN A;  3ZQF A;  5J1Y A;  3OSF A;  4D7N A;  1JJ6 C;  3HTH A;  5CXG A;  1RR7 A;  2XGE A;  1IG7 A;  2LY9 A;  2E2I J;  3E7Q A;  4CGR A;  1VFC A;  4M3B A;  1X58 A;  5F27 A;  3FKI J;  1QVU A;  1RKT A;  4FIS A;  4HNV A;  1ETW A;  3OIO A;  3TP0 A;  3S1Q J;  2YVE A;  3W6V A;  3OOU A;  1O4X A;  1WPK A;  3NRG A;  2IEK A;  5FKN A;  5AQC A;  2CQX A;  5F08 A;  4IHY A;  1FTZ A;  2DA7 A;  4ABZ A;  1ZK8 A;  3FK7 A;  4M3D A;  5IOY A;  3GTG J;  2VKV A;  2LVS A;  2CU7 A;  3HGG A;  3SFI A;  4RBO A;  3NI7 A;  4PXI A;  3JSJ A;  3LSP A;  1JKP C;  1AU7 A;  2XB0 X;  1BA5 A;  2CJJ A;  3TW7 A;  3Q0W A;  3G7R A;  4GFB A;  3HE0 A;  2XPW A;  4J19 A;  2X6O A;  2IAI A;  5EZH A;  5D1R A;  3BR1 A;  4M6V A;  1ETX A;  1JJ8 C;  3HEF A;  4X1E A;  2FJ1 A;  1B72 A;  3VOK A;  3CJD A;  4BBS J;  1RPW A;  4GFK A;  3HBL A;  5EFY A;  2UXU A;  2DMN A;  3GEU A;  2DTZ A;  3S5R A;  5DAJ A;  2ZCN A;  2WAQ N;  4DZP A;  4UDS A;  4A3K J;  4QIW N;  3BT9 A;  3V78 A;  2P81 A;  3NAR A;  2REK A;  4MO7 A;  5K7F A;  2HOT A;  3ZQH A;  3HKZ N;  1Z0X A;  1Y1V J;  4GFL A;  1NK3 P;  2QWT A;  1S7E A;  1K61 A;  2XB5 A;  1K83 J;  2QKO A;  1TWA J;  1TWG J;  2WV1 A;  1FIP A;  3E7L A;  2Y2Z A;  3VW1 A;  2DA5 A;  3S2H J;  3BHQ A;  5F0F A;  5DTD A;  1NTC A;  5J1U A;  1NK2 P;  1U78 A;  4FCY A;  1B72 B;  3GTQ J;  2JJ7 A;  4X6A J;  2K9Q A;  2ZB9 A;  3NNR A;  1ITY A;  1AHD P;  3H0G J;  3MN2 A;  2HXO A;  1LE8 B;  2NVT J;  2VPR A;  3HB9 A;  4D5F A;  4KWA A;  3GTM J;  5IP7 J;  3SDG A;  1ZKG A;  1MSF C;  4HKU A;  3VVZ A;  2TRT A;  2VKE A;  4XK4 A;  2KDZ A;  4V2F A;  5J1R A;  4JX6 A;  1JKR C;  3GTK J;  4A3B J;  5IOZ A;  3HIM A;  2L7Z A;  3K2A A;  3P9T A;  4A3M J;  1BJZ A;  4IHV A;  5FHP A;  4C2M J;  3LNQ A;  1U9N A;  3BTC A;  1HOM A;  3T6N A;  1ETV A;  1WGX A;  4FE7 A;  5EGO A;  2ZOZ A;  3SJM A;  1W0T A;  4GCK A;  2G7S A;  2H1K A;  3GBG A;  2JA7 J;  2G7L A;  3VPR A;  1IC8 A;  1H88 C;  1VF9 A;  4A3J J;  4IHW A;  2NOG A;  1IV6 A;  1RES A;  3M3Y J;  3OSG A;  3M4O J;  3PO2 J;  3GTJ J;  4M3G A;  1RET A;  2Q24 A;  4B1R A;  2WGB A;  3BQY A;  2Y30 A;  3Q0V A;  2D6Y A;  1T56 A;  3QPS A;  3A01 A;  4V2G A;  5FKK A;  5IPA A;  1JUM A;  3BQZ A;  2WUI A;  3VOX A;  3V6G A;  1OJL A;  3JRA A;  4DW6 A;  4NDL A;  5BNG A;  1POG A;  1TWH J;  1MBH A;  5EGO B;  4BXX J;  1ZGW A;  1F36 A;  2DN0 A;  2NVQ J;  2R92 J;  4C3I J;  4FTH A;  3S14 J;  1UHS A;  3RH2 A;  3CQZ J;  2HYJ A;  3JRB A;  2F07 A;  5FGL A;  3VW2 A;  3JRH A;  4DZJ A;  2DA2 A;  1GDT A;  2HXI A;  1JUS A;  3BRU A;  1G2H A;  1SFO J;  1HDD C;  3JRF A;  2N8G A;  1WI3 A;  3S1M J;  3QKX A;  1X2M A;  4D7M A;  1W0U A;  3LOC A;  3BJB A;  4A69 C;  2UXI A;  5EF6 A;  4A3L J;  2PMZ N;  2AO9 A;  1PUF A;  1F43 A;  2W53 A;  2YVH A;  3HOX J;  2Y31 A;  3ZQC A;  4RDU A;  2O7T A;  2O8K A;  2FD5 A;  4D5C A;  3IH4 A;  2DA6 A;  1IGN A;  3AQS A;  2NS7 A;  2OF7 A;  4JX5 A;  2XGD A;  3F1B A;  1SAN A;  2R5Z A;  2O7O A;  1DU0 A;  4QSH A;  3ON4 A;  1ZR2 A;  2CQQ A;  5EZG A;  3MNL A;  1H8A C;  4ICH A;  3MVP A;  2O9L A;  5FLM J;  3LSG A;  2QTQ A;  3HOY J;  3C07 A;  1T33 A;  1HCR A;  1TC3 C;  2DA3 A;  3FIW A;  1UMQ A;  1ETO A;  3BTL A;  2NS8 A;  1H89 C;  2G3B A;  1Z77 A;  2TCT A;  3UKG A;  3GTP J;  2NP5 A;  3ANG A;  2MGQ A;  2IBD A;  3JRD A;  4AYB N;  5DS9 A;  1PUF B;  3NXC A;  2W48 A;  4MXM A;  4GCT A;  2GM4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...