3IH2A

Tm1030 crystallized at 323k
Total Genus 70
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
70
sequence length
201
structure length
201
Chain Sequence
HMLSKRDAILKAAVEVFGKKGYDRATTDEIAEKAGVAKGLIFHYFKNKEELYYQAYMSVTEKLQKEFENFLMKNRNRDIFDFMERWIEKKLEYSASHPEEADFLITLVSVDEGLRKRILLDLEKSQRVFFDFVREKLKDLDLAEDVTEEIALKFLMWFFSGFEEVYLRTYQGKPELLKRDMNTLVEEVKVMLRILKKGMTK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 'Hot' macromolecular crystals.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Transcription regulator
molecule keywords Transcriptional regulator, TetR family
total genus 70
structure length 201
sequence length 201
ec nomenclature
pdb deposition date 2009-07-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00440 TetR_N Bacterial regulatory proteins, tetR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 3ih2A01
1.10.357.10 Mainly Alpha Orthogonal Bundle Tetracycline Repressor; domain 2 Tetracycline Repressor, domain 2 3ih2A02
1GV2A 1X2MA 2DA6A 4D5FA 4A3CJ 1F43A 1LFUP 2GBYA 5IYCJ 4IHYA 1HOMA 4JKZA 3VPRA 5F0HA 2EH3A 4G12A 3A03A 1APLC 1BL0A 3HBLA 4W97A 1ETQA 5FKOA 5F0CA 1FTZA 2XDNA 5FLMJ 4UUSB 2XPWA 5F08A 1ZR2A 3NNRA 1XS9A 4V2FA 4C3IJ 5FGLA 1B72B 5IP9J 3B6AA 3BR0A 4QSHA 1DU0A 3BNIA 2XSDC 1PUFA 3RZDJ 2OPTA 5IYDJ 5E3LA 2QF7A 4AUXA 5EDNA 4RBOA 3QQAA 1D5YA 1ETKA 1MNMC 3Q0WA 3C2BA 3MN2A 1TWGJ 3TEDA 2DMUA 3BR1A 2XPUA 2QCOA 3EGQA 1AU7A 2R5ZA 3GTKJ 3S14J 2JN6A 3G1MA 4JP0A 3Q3SA 1LE8B 2AHQA 2R93J 3GTLJ 5IOYA 2YVEA 3TP3A 1NK2P 1ZTRA 1R9TJ 2OI8A 1GUUA 1VF9A 3PPBA 3FK7A 5FKKA 2K9NA 1MBFA 2E19A 5IP6A 1W0UA 2MSYA 1JUSA 1AHDP 1MBHA 2COBA 2Y9ZA 3CQZJ 2Q24A 2QKOA 3S15J 1TWAJ 3VW0A 2TCTA 1RESA 1HLVA 1JUPA 1ITYA 3ZQGA 2LFBA 1JKPC 5EZHA 5BNGA 2CJJA 2M34A 3RH2A 3VUQA 2NVTJ 1GV5A 1SGMA 3V78A 3BTLA 4D5CA 2OERA 3B81A 5E3MA 1VFCA 2GM4A 4HKUA 1ETXA 5GP9A 1MBGA 2V57A 3S5RA 4GFLA 3HOYJ 3BQZA 5F27A 1H89C 3GEUA 2HOTA 4C3HJ 2NP3A 2N8GA 2GFNA 3CWRA 2LY9A 3Q0UA 3TW6A 3QPLA 1WGXA 2DMTA 3JRAA 2L7MP 2LLKA 1ETVA 3F1BA 1IV6A 3NXCA 5EGOB 1FIPA 5D1RA 1VNDA 1I50J 2PMZN 3LWJA 1H88C 2ECBA 2FJ1A 3CCYA 1JKRC 2JA6J 1ZK8A 1POGA 1XC5A 4A3MJ 2LP0A 5F0FA 1ZQ3P 3BR2A 4M3EA 3VP5A 3VVYA 1AKHB 4ICHA 1MBEA 1SFOJ 3A01A 2K9SA 2O7TA 1JT6A 2QOPA 2LVSA 1T56A 4XICA 3HTHA 2ECCA 2HOAA 1Y1VJ 2ID3A 5D19A 3BG3A 3CRJA 2VKVA 3JSJA 2VUMJ 3KNWA 3HTJA 3OOUA 5FKLA 1X58A 1X2NA 2ID6A 1WPKA 5DS9A 2HYTA 2D6YA 3GZIA 5K7ZA 1GDTA 4DYQA 2NVYJ 4EEFG 1MSFC 1K61A 1ENHA 2JK3A 4DYRA 4ABZA 4B1RA 4IHVA 3QKXA 1JJ8C 2GENA 4GCLA 2M8GX 1OCPA 2Y30A 3SFIA 1EF4A 3VIBA 2EBIA 3O8HA 3VW2A 2WV1A 1ZR4A 3IV5A 1LE8A 3HGYA 1OFCX 5CXIA 4UUTA 2F07A 1Y1WJ 2HI3A 3SDGA 1NK3P 1FEXA 2ZOYA 1ETYA 2JJ7A 4J19A 3E7QA 4IHWA 4A69C 4FTHA 1YRNA 2UXHA 3DPJA 4FISA 2ZCNA 1IDYA 2X6OA 5F1JA 3T6NA 5HBUA 2EZLA 2NS8A 3CMYA 3O60A 2DA7A 2G0EA 3BTCA 4I6ZA 5M5WJ 2P81A 3V6GA 1B8IB 1PUFB 3QPSA 1JGGA 3DEWA 4MLOA 3M4OJ 3NARA 3LSPA 4JL3A 4HNVA 3IUVA 2IU5A 1ETOA 5E3NA 3D1NI 4A93J 2PZ9A 3ZQIA 3CJDA 3S1QJ 4W1UA 3GTPJ 2DJNA 2WAQN 4L5EA 5J3LA 2DMQA 5K7HA 2E2IJ 4BXXJ 4MK6A 2E1OA 3S1MJ 1S7EA 1U9NA 3E7LA 5FJ8J 1QVTA 3BR3A 3IH4A 1ZGWA 5K7FA 5CXGA 4FE7A 2G7GA 2AO9A 3RD3A 1FTTA 2G7SA 1WH5A 1G2HA 4PXIA 2DA3A 2W53A 2KDZA 3ZQFA 3WHCA 1O4XA 9ANTA 2ZCMA 5D18A 2WUIA 5M5XJ 1IG7A 4GCTA 2UXUA 2QTQA 2Y31A 3HOUJ 3M3YJ 2MGQA 1HDDC 3IH2A 2L7FP 3F0CA 4UUSA 3NRGA 3ZQLA 2D5VA 4GFBA 2R92J 1I3QJ 4DYCA 3ON4A 1UG2A 2W48A 2ZOZA 3HEFA 3B6CA 4L62A 2R7ZJ 4ME9A 4M3GA 3OIOA 2DA4A 1UI6A 1UI5A 2Y0SN 2RAEA 2GLOA 2HXIA 2R5YB 4QTRA 3RKQA 4DW6A 3HTAA 2MW8A 3IH3A 3S2DJ 2YS9A 3S2HJ 4JYKA 1TWCJ 3ZQHA 1UMQA 5M3MJ 4FE4A 4GFKA 2TRTA 3LOCA 3PO3J 5JLWA 5F04A 2OF7A 2WGBA 3HE0A 3BR6A 1E3OC 3ZOBA 1IDZA 1U78A 4BKXA 4BBSJ 2LD5A 1QRYA 4XK4A 4YZEA 2R5YA 1TWHJ 5C44J 1OJLA 2K9QA 1Z0XA 4M3FA 1K83J 5IP7J 2Y9YA 3MNLA 1FIAA 4A3BJ 4RDUA 3G1OA 3GBGA 1RKWA 2IEKA 2IAIA 4A3LJ 2XPVA 3FIWA 4NELA 4A3DJ 2XGEA 1IGNA 2DA2A 1B72A 3SJMA 3BR5A 1JKOC 1Z77A 3LNQA 3GTQJ 1IUFA 2L0KA 2X9DA 5IOZA 2DMPA 2FD5A 4JX5A 2ME6A 5GPCA 5C4JJ 5M3FJ 3GTJJ 3I4NJ 1I6HJ 4Y52J 5GPAA 1SANA 2G3BA 2XGDA 1QPIA 3KKDA 1NTCA 3EUPA 5CW8A 2PBXA 1U9OA 3HOVJ 5HSZA 3HOZJ 1VI0A 1W0TA 2M9HA 5EEAA 2JA5J 4S0HB 3K2AA 2YVHA 4A3IJ 4MO7A 3HB9A 1A6IA 3LSJA 2LR8A 5EYRA 2QIBA 2YU9J 1HF0A 2O8KA 2E2HJ 3FISA 3WHBA 3BG9A 2NVQJ 1RKTA 1MSEC 2RASA 1IJWC 5EG0A 4MIMA 2ME0A 5FKMA 1B8IA 2VI6A 4DZPA 3JR9A 3RZOJ 5DAJA 5J1YA 3VVZA 3QBMA 3PM1A 3LSRA 1BW6A 2NX4A 3VW1A 1P7IA 3BQYA 3JRBA 3A02A 3Q0VA 1YRNB 2IBDA 2LK2A 4MFDA 1GT0C 3S16J 3ANGA 2EZKA 2UXPA 2UXOA 1WCMJ 2CU7A 3S1RJ 5EFYA 3H0GJ 1TC3C 1AKHA 5C4XJ 1JJ6C 1ORKA 2GUHA 3VVXA 5J1RA 3TW7A 2X48A 1BJZA 2E2JJ 2JA7J 3COLA 4AYBN 3GTMJ 1OCTC 2NP5A 2VPRA 2EZIA 2HQ5A 1DU6A 3DCFA 3HIMA 2JWTA 4CYCB 4JX4A 2K40A 3PO2J 2KT0A 4XIDA 1ZKGA 2WB1N 2QWTA 3HM5A 5FLVA 2RHAA 3PASA 4NDLA 1JKQC 4MXMA 2MG4A 1IRZA 1MH4A 3JRFA 2CUEA 2Y2ZA 1HCRA 3H3VK 3JREA 3MKLA 5HAWA 3ZQCA 2I10A 1JUMA 3HGGA 1WI3A 2DN0A 2XGCA 4M6VA 2REKA 3AQSA 3L1PA 3JRCA 3VOKA 2EZHA 3S17J 5EG0B 5E3OA 2H8RA 2H1KA 4A3FJ 2O7OA 3BT9A 3BCGA 5EZGA 4NN1A 4BY7J 3FK6A 5C3EJ 3HOXJ 3BHQA 5EGOA 1RR7A 4A3EJ 1MBJA 3VOXA 3AQTA 2HOSA 3CDLA 3S1NJ 2LKXA 4X6AJ 3KZ9A 3BTIA 2O9LA 5HODA 3HKZN 1MH3A 2ZB9A 4IEJA 3HDDA 2R5ZB 2G7LA 3JRHA 1ETWA 2HDDA 2FX0A 2NS7A 4V2GA 3JRGA 4JNNA 4QIWN 3OSGA 5FKNA 4JX6A 1QVUA 2XB0X 5DTDA 1UHSA 5AQCA 5H9TA 1Q1VA 1A5JA 2XRLA 1MBKA 4M3BA 2LTPA 4M3DA 5J1UA 2L9RA 5FMPA 4LOCA 3JRIA 2HYJA 3GTGJ 3FKIJ 4DZJA 5K58A 5M5YJ 2CUFA 3MVPA 4D7NA 4KWAA 2HXOA 2DA1A 4XRSG 4C2MJ 4AC0A 3UKGA 1RETA 4CGRA 1F36A 3HTIA 3A01B 2DMNA 4A3JJ 2DTZA 4UDSA 2L7ZA 4GCKA 2FQ4A 2XB5A 1RPWA 1H8AC 3GTOJ 1FJLA 3O8GA 2HKUA 3BJBA 2JA8J 3LHQA 4B4CA 3LJLA 3BG5A 4CYCA 3G7RA 2ELKA 4I76A 2JMWA 4BY1J 4AF5A 4BBRJ 1IC8A 3C07A 3KKCA 5C4YA 1HDPA 2UXIA 3LSGA 4A3GJ 1CQTA 1JTXA 3RQIA 1U8BA 4X1EA 4C3JJ 3HOWJ 2CQXA 3TP0A 4A3KJ 2DG7A 2M2EA 4ACIA 4D7MA 4FCYA 4XRMA 3ON2A 2FBQA 3G1LA 2NVXJ 1JTYA 1T33A 4MFEA 2R0QC 4AC6A 2ZCXA 2EQRA 2VKEA 4B3AA 5IPAA 3P9TA 3BTJA 3NPIA 4IHXA 2B63J 2DA5A 2CRGA 1JT0A 1TWFJ 3NI7A 2YUSA 1P7JA 2NOGA 3I4MJ 2CQQA 2M0CA 3NAUA 3G56A 4Y7NJ 5FHPA 3ANPA 3JRDA 3K7AJ 3BRUA 1BA5A 5JLXA 3W6VA 1XG1A 1WH7A 3OSFA 4XRSA 1BW5A 3FRQA 2DG8A 1GVDA 1LFBA 5IYBJ 5EF6A
chains in the Genus database with same CATH superfamily
3MCZA 1J5YA 4XONA 2O6GE 4D5FA 2Q1ZB 5IYCJ 2FMLA 3VSKA 1APLC 3HBLA 1KU3A 2IVMA 1FTZA 2GXGA 2RNJA 4Y33A 2XDNA 4UUSB 5HVQC 1ZR2A 3NNRA 4XRFA 4QLCU 1T08B 1TNSA 5E1XA 5E20A 1A31A 3OL4A 2K4BA 3GXOA 3M8FA 3RKYA 2OPTA 4B47A 3QQAA 1ZRCA 2BVMA 3Q0WA 2EJRA 3TEDA 2PQ8A 1A6QA 2QCOA 3K4NA 1FOKA 3BCAA 2ZNYA 4UNOA 5FRNA 3GW2A 5DV5A 4HYEA 5DM7F 4XKBA 4IO9F 4L0ZB 3G1MA 4JP0A 5LHHA 1R22A 4RB2C 4U7BA 3ECOA 3GMEA 3JSPA 5BOXA 4CUGA 1QZYA 3PFIA 3E6CC 4BNCA 1R9TJ 3DEEA 3PPBA 3FK7A 1KZHA 3I3LA 4CO8A 3W6KB 2MSYA 1V55H 3ZMUA 5DM6F 3RCOA 1UJ8A 1XGOA 3BPVA 3RDIA 3A4CA 2HKOA 3S15J 2TCTA 1RESA 1X1DA 3K0LA 3K8PC 3ZXSA 4II2A 1Z3XA 3GLLA 1B9NA 1Y0UA 1JKPC 5EZHA 2K3FA 3M07A 2M34A 3RH2A 1SGMA 1D0ZA 4U9NA 4KIBA 1ETXA 1K6OA 3F6VA 2KFDA 4P1WA 3VYSB 2QQAA 3BQZA 3DV8A 3ML6A 3FBNB 3GEUA 1BC7C 1HW5A 1HSTA 2ADUA 3E1SA 2EIJH 2QWWA 3JRAA 1FP2A 4IPAA 1IV6A 1QPMA 1F9NA 2P4WA 1JE8A 1ACIA 3OYLA 3LWJA 4QPQA 1ZGJA 4F7ZA 4HNUA 3Q9VA 3CO7C 1I39A 2JPBA 2JA6J 2LP0A 1PP7U 3PQJA 3CCLI 4WXCA 1RI7A 3VYTB 5CVRA 1R4MB 1ZQ3P 1W7PA 4EJTA 1XGSA 3LAJA 2EIMH 1SFOJ 4U7DA 2IA0A 1JT6A 2QOPA 3F8MA 2ID3A 3CRJA 3CP2A 1S6LA 3DU5A 5FKLA 4BQNA 5D5WB 4OIPF 1MKMA 2ID6A 4CH7A 1XPXA 5BQTA 3WTWC 1YJNI 2QBYA 1FOWA 3K2ZA 4I09A 2H09A 4DYQA 5TISC 5LGUA 4CDGA 5DCMB 1K61A 2JK3A 2HQAA 4ABZA 2VC1A 4IHVA 1TW3A 1JJ8C 1R36A 1P4AA 1LUJB 2M8GX 4KUMA 5FLXK 1YG2A 4S04A 3O8HA 3VIBA 3U1DA 1XDSA 2WV1A 3FKJA 3CC2I 2YX7A 1FOXA 5CXIA 3L2CA 2F07A 4U88A 3SDGA 1FWZA 5AIPA 2NNYA 2JRTA 3KPHA 3FMRA 3WU2C 1USTA 2OCCH 3C1DA 4A69C 2Q2EB 1IXRC 3T6NA 1W5SA 2F48A 2EZLA 4OAYA 3OYDA 2EFQA 3VWBA 2JSPA 2G0EA 2XAHA 2P81A 4XOPA 1B8IB 1PUFB 4XQFA 3HTSB 2FJI1 1XGNA 1JGGA 4MLOA 1MJBA 2BHZA 2STWA 2VB6A 3V7SA 4PJ0C 1YW7A 3NARA 4DJAA 2HPIA 4BDZA 1Z7LA 2EV6A 4A93J 3CJDA 2XSJC 1ZG3A 3C2GA 2A61A 3V8LA 3EYYA 3KP7A 2O8XA 3WG9A 1XSDA 5LGNA 1U5TB 2L9VA 5JHFA 3VDXA 1BBYA 2KJBA 4BJTA 1ZGWA 5K7FA 5CXGA 1T0FC 2AO9A 3RD3A 1PDNC 1MGTA 2G7SA 4ETSA 2DA3A 4IX7A 4HEA2 3ASNH 1R5HA 3M8EA 5LLQA 4F3QA 4UB6C 2ZCMA 5FD5A 2VQLA 1HKQA 2EWNA 2KIQA 5CVVA 4WK8F 3DKXA 2QTQA 5AONA 1BN5A 4AIHA 2V1UA 1F1ZA 2MGQA 4IL6C 4E7SA 5HLGA 3WGIA 2D45A 1HDDC 2FF4A 2L7FP 1VQNI 5E79C 3JSOA 3ZQLA 5KK1A 1Y56A 4NC8A 4HV6A 3BZKA 2BY1A 2J5OA 2XKOA 5B1AH 3WTVC 4HQEA 3AG2H 2TDXA 5FB2A 4GCVA 4XL9A 4L62A 2ZXJA 5H6RA 3CCEI 2PLYA 1VZ0A 1ZAOA 4ZZDA 1VTNC 2RAEA 2XF6A 5F6FA 4NBQA 2R5YB 2FXAA 3DXJF 2H6CA 1DQUA 2GOMA 4G6TB 4PFOA 3C18A 4JYKA 1YW9A 1J9IA 4FE4A 1B59A 2QUFA 4GFKA 3LOCA 4KFCA 2WGBA 3DTEA 2WBMA 3K9TA 5J4VA 1AOYA 1U78A 3FXQA 3OR1C 4BBSJ 5H6QA 5B5EC 4PZJA 3B02A 4CCMA 1TWHJ 4YFXF 1OJLA 2K9QA 4A6DA 2V1NA 1QZEA 2M1BA 5IP7J 2CSOA 2Y9YA 2O61A 2EILH 4UVAA 3C3WA 1FIAA 3JAMZ 4RDUA 2QQBA 1RZ4A 2IEKA 2P5LC 3OYGA 3FIWA 1H9TA 1KQ9A 4PSXA 5J4YA 1B72A 1FSEA 2KDOA 2L0KA 2DK5A 4HQMA 1KONA 2DMPA 3O3KA 1FMVA 2FD5A 4L9VA 5C4JJ 3WU1B 1MMNA 5M3FJ 4FQGA 5GPAA 1XDUA 5FROA 1QPIA 3KKDA 2A6TA 5E18F 1O3SA 2L9NA 3EUPA 4KT5C 5CW8A 2PBXA 3ULQB 1U9OA 2MD0A 4LK1F 4CCJA 4U87A 4JQFA 4B48A 2HEOA 4V19K 1W0TA 2M9HA 1R58A 4H4KC 4M72A 4AIJA 1J2XA 3CMEI 1D3YA 4HAMA 2QSHX 2YVHA 4IXAA 4MO7A 5D8KB 4BHPA 2EPFA 3F8CA 2BHYA 2DQLA 4MQVA 2QGUA 3FISA 4XSZF 2LKPA 3DPTA 3ZQQA 1W36D 1RKTA 3KIOA 4HF1A 4IQJA 2RASA 1OYIA 3RJPA 5EG0A 3L09A 2VJJA 2L2OA 3PUFA 3PL8A 4WXHA 2M45A 1IRFA 3PM1A 3PSFA 2I8DA 1NHAA 1WZ2A 4KMFA 3QU6A 3KEYA 3BQYA 3DKYA 2NX4A 3A02A 3C2HA 2GAUA 1GT0C 2LK2A 4CXFA 2Y0MA 3ISPA 2UXOA 1I5ZA 4B09A 3H0GJ 1ORKA 5CVIA 2I5UA 1E3HA 2GUHA 3VVXA 3FDYA 3SWHA 1BIBA 3HG9A 2VBYA 3COLA 2JZYA 2WY7Q 3AG4H 5LFAA 3DTKA 3I56I 1OCTC 3GTMJ 1HQCA 4Q48A 1DU6A 4IRGA 4OINF 4G7HF 3CDHA 3HZJA 2ESNA 2ICWG 1ZREA 4XIDA 4OIOF 2WB1N 5JFRA 1BIAA 2DPDA 1K7AA 2FOWA 2QBYB 1V54H 1Z6TA 3GZ5A 1JKQC 4MXMA 2JUGA 1O7FA 2MG4A 4YIRX 2HPMA 1V4RA 3LSTA 5EEGA 3MKLA 2HDWA 5HAWA 3RI4A 2L5QA 3LA7A 3MZ8A 3ZQCA 1JUMA 3VFZA 4M71A 2ZKZA 4M6VA 2REKA 2V9KA 2G9WA 2O3FA 2G7HA 2QSFX 4O6JA 1D0XA 3W6JB 5EG0B 2Z2SB 2H8RA 4YG2F 4AWXB 2O7OA 3BCGA 2EFOA 3EUHA 3FK6A 4BY7J 4RGUA 2D1HA 3BHQA 1RR7A 4A3EJ 1MBJA 3J81Z 3UR3C 1WVRA 3OV8A 4HDVA 2CV1A 3GFMA 4NNJA 2QQ8A 4F92B 4RGRA 4UUVA 3KZ9A 3TDUC 2GXBA 2HTJA 3H5RA 3TOBA 4Q47A 1MH3A 2E5ZA 2XAGA 1OLTA 3K70D 2BY0A 1ETWA 2HDDA 1IRGA 2FBIA 3JRGA 1P4WA 4B44A 3GYHX 5FKNA 3RKWA 4E4HA 2GA2A 1XX5A 3A0BC 3E6MA 5LGTA 1UHSA 5AQCA 1BR2A 1A5JA 4UY8I 2VLAA 2Z1DA 4M3DA 4AD9A 1XCVA 4LOCA 4ENMA 2AS5F 2E1MB 4LMYA 4ENKA 2M30A 3K10A 4NB5A 2X1DA 5K1YA 1R4NB 3W3CA 3A01B 2FBKA 3HTIA 2DTZA 2OD5A 4A2UA 1BI2A 2FQ4A 2HGCA 2ZO4A 1TQMA 1FJLA 2CMPA 5B66C 3G7RA 3AL0B 2JMWA 3HOSA 1EV7A 4EJWA 4G94A 3SYTA 4BE0A 5CYVA 1IN6A 2JRMA 2AQFA 2FUG2 2CFXA 4OD4A 1F4KA 1LJ9A 2BYVE 5E1ZB 3LSGA 2R7XA 3RPUD 4C3JJ 1Z9CA 2CQXA 4KIGA 3HOWJ 2GZWA 3FXKA 2MD5A 1KU7A 2M2EA 4YFNF 1O3TA 3CCUI 4FCYA 2F4IA 4XRMA 4WF2A 3OL3A 2L3DA 2VQCA 2IT0A 1OR7A 4ZJZA 1JTYA 4BHBA 1T33A 2RQPA 3LFUA 3SZTA 4XMYA 1WSUA 4AC6A 4KISA 3CCRI 4E70A 4H0EA 1MMAA 1SD6A 3J81K 1DGRM 4KNYA 2DA5A 1MIJA 2L9SA 3ABKH 3HKZA 4A12A 1YIOA 3O2PE 4TV7A 3OIPA 4U0VA 1SVMA 2CQQA 2M0CA 1D5VA 3L2QA 3J7ZI 4Y7NJ 2XROA 1SMYF 1LDKB 3F8NA 2OZUA 1D0YA 4A0ZA 1WH7A 3OSFA 2KRFA 3OYHA 3QU3A 2V7FA 1YX3A 2HVSA 5IYBJ 2JUCA 3EQLF 1GV2A 2L4MA 2VBZA 4BXUA 5EF6A 2VASA 2QA4I 3CZ6A 1KA8A 5DEQA 5D5XB 1LFUP 2GBYA 2NYXA 4IHYA 3AL0C 4JKZA 5F0HA 2VJ4A 2F2EA 5HLIA 1JGSA 2XPWA 3CC7I 1TBXA 4V2FA 1B72B 4P9FA 2Q8KA 5IP9J 3V8JA 3FZVA 2W4SA 3GFJA 4ZYGA 5BMZA 3K4LA 3KCCA 1PUFA 5IYDJ 4AUXA 3EPZA 1T8IA 3HYIA 2B9SA 1N77A 2OTLI 1ETKA 1TWGJ 3D5RC 2MBFA 3BR1A 1KYWA 3E5QA 3PNYA 2XPUA 4QWQA 3OYIA 2XASA 3L7WA 2ZC2A 2R7VA 1FYKA 2JN6A 3N4MA 3GTLJ 5IOYA 1RUOA 2YVEA 2KRCA 4EVIA 1R7JA 1GUUA 5K5QA 1ZH5A 1I6XA 1YW8A 1W0UA 3H35A 4KA4A 5J6XA 1JUSA 1AHDP 5DYMA 1MBHA 4IHTA 4EM2A 4KITB 2QKOA 3HRTA 1TWAJ 5KCMA 3VW0A 1T98A 4C2UA 2W7NA 3COAC 1JUPA 2LFBA 2VXDA 3DKWA 5J47A 3B73A 2FSWA 1HKSA 4DVYP 2QKLB 3QP5A 2L54A 1VQ7I 1GV5A 2HVRA 2ELJA 3FHZA 1U0JA 1V5FA 2OERA 5E3MA 1QO0D 3HSFA 3JCUC 5L3FA 3FXJA 2V57A 3R4KA 5GAGJ 4JK1X 4C9YA 1R71A 4J00A 1H89C 4C3HJ 3KP5A 3OR2C 1XB4A 1L3LA 2LY9A 3Q0UA 3WGGA 1K4TA 2A69F 1WJFA 2DMTA 3JTHA 2OU2A 3LQRA 3QWLA 3QYEA 3I59A 4OIQF 1VNDA 2VOPA 2FJ1A 1ZK8A 1POGA 3RSNA 3QOEA 4LFUA 3VYRB 1X4OA 2W82A 3ZMDA 2MA3A 4M3EA 1U5TA 2MYSA 1AKHB 4IOCF 3MD2A 1X1CA 2F5FA 3G6EI 1O3QA 4Y15A 3HTHA 4L9NA 1S7OA 2GQQA 1WWXA 2BXYA 3EUKL 2VKVA 4KN4X 2VUMJ 1S5LC 3WTYC 3OOUA 3J7AO 4XLCA 1X58A 1X2NA 2DCEA 1XD7A 2GIZA 3SEQA 1VQMI 2OQRA 2NRAC 2RV8A 3N97A 1WPKA 1ERDA 2D6YA 4RLFA 3TO6A 4Y4RA 2LBFA 1F5TA 3IUOA 3G3ZA 1LQ1A 4HX4A 5F64A 1MSFC 2Z3YA 1ENHA 4HF2A 2JQ7A 1J7KA 2HS5A 4XLFA 3CCVI 1BR1A 2GENA 1I1GA 2IA2A 3ZMZA 4GCLA 3CCJI 1LB2A 2Y30A 3SFIA 3VW2A 3HGYA 1FEXA 5DDGA 1G8XA 2HQRA 2DBBA 1K78B 2XHKA 1NH3A 3K6GA 3ZQ7A 2DFHA 3DPJA 1IDYA 3GFLA 1YS6A 3CMYA 4B43A 2PBIA 3IL2A 1P9QC 3H9JA 3OMYA 4XLAA 1U3EM 1YITI 2K4JA 3M4OJ 2Y48A 4M6XA 4JL3A 2OQGA 3ELKA 4HX8A 4LJZF 3D1NI 1ZHFA 3ZQIA 4BXFA 2H27A 4W1UA 3WTSC 2WAQN 5D5VB 3TKYA 2HWVA 2ZY9A 4BXXJ 2KPMA 5FD6A 2E1OA 3S1MJ 2CUJA 1S7EA 3OYCA 1G59A 3V42A 1VQ9I 5L3EA 1T2KA 5IT9K 1FTTA 2OUMA 2ZJ2A 2XRNA 4PXIA 1MMDA 4HSTA 2KDZA 2LOOA 5B1BH 3K4KA 3WHCA 4Y3OA 4IRIA 9ANTA 3GZ6A 2JA2A 2XAUA 2FU4A 2UXUA 3VYUB 3T1BA 3QAHA 1YOVB 3ZN1A 5ERIA 4DNCA 2M4KA 3IH2A 4EM1A 3F0CA 4GFBA 2HYFA 3ON4A 4I02A 1UG2A 4ZZLA 1R00A 2ZOZA 3FX3A 3HEFA 4A0XA 2MH9A 4ZYEA 4BQAA 1ZYRF 5L3BA 2Y0SN 2YSRA 3E6BA 3HTUA 3H0DA 1SFXA 1R5ID 2MH2A 4QTRA 3VOEA 2R3SA 3LA3A 4M9ZA 4DW6A 2LNBA 3HTAA 2Z16A 1WQ2A 2MW8A 1Y8RB 3IH3A 5K5OA 3S2DJ 2YS9A 3S2HJ 1TWCJ 3SEZA 5FRMA 3BG7A 4OMYA 4K2EA 2TRTA 3IKVA 3H9GA 3OS0A 3KZYA 2OF7A 3DQVC 4XSXF 3I0TA 3ZOBA 4XN0A 2VOOA 4I98B 4BKXA 4CCLA 3Q5FA 1IDZA 2OBPA 2VT2A 2LD5A 1EH7A 1LNWA 4ON0A 1Z0XA 1HA8A 1P4XA 1HXDA 4N4NB 2XF5A 2X6XA 1ULYA 3GBGA 2ISZA 1EH6A 1RKWA 2CQ7A 2IAIA 3BC8A 4A3LJ 3GEZA 4XLPF 1FLIA 5HS7A 1PYVA 1GHCA 2XGEA 5DUIA 1YFHA 2DTRA 3BCBA 5K5RA 3W2VA 3SJMA 4C30A 1JKOC 1Y39A 3GTQJ 1SFKA 1IUFA 3E97A 2BOLA 3F9KA 3L00A 2FMYA 4LIUA 2X51A 2ME6A 2CO5A 2ESHA 5TRDA 3MKWB 4F55A 3MFKA 1VQOI 4IKFA 5FO5A 2D1VA 2G3BA 2XGDA 4FASD 4N4OB 3J7YJ 1WHUA 1MW7A 2RGVA 4QPOA 2OTJI 3WTZA 3GVAA 2FA5A 3HL2A 4I99C 1Z05A 4L9TA 2PFVA 5HSZA 3HOZJ 1JI8A 4DGWB 5EEAA 2R7OA 4S0HB 3IWZA 3S2WA 3K2AA 1BI1A 3HB9A 5IT9Z 4PSWA 4RB0A 1RC9A 1UHWA 1H9GA 4RGSA 3HPGA 1PP8F 2YU9J 2QIBA 2M8EA 1HF0A 2O8KA 3L9FA 3OYKA 3ABUA 2E2HJ 4XLEA 4DIQA 3BG9A 3HSRA 2EA4A 4UXNA 1MSEC 1BJAA 1IJWC 4BQOA 4ESJA 1WI9A 4LK0F 3NS4A 1Q1HA 4A0YA 5FKMA 4OWRB 5DAJA 2ACJA 5J1YA 2IP2A 2KIUA 1EJ9A 2LF8A 1FP1D 5GTIC 3VW1A 3IRRA 3ZN0A 3Q0VA 2HZTA 1YRNB 1R1VA 3ANGA 1YS7A 2A3SA 1MMSA 1J59A 2ZFWA 2MC3A 2DOEA 2CU7A 3S1RJ 1E0EA 3CESA 2HTSA 3BZCA 3GCMA 1AKHA 5C4XJ 1ZLJA 5J1RA 2H6BA 3BOQA 3E0JB 2E34A 4AYBN 2EIKH 1ODDA 2VPRA 2EZIA 2HQ5A 2VJIA 3DCFA 1T6SA 2NP5A 3LSHA 2JWTA 3H5AA 3S93A 4CYCB 3I59B 4UVBA 2F5CA 3PO2J 2KT0A 3OYAA 4KIFA 2KKOA 2W24A 5FLVA 1MH4A 1GVJA 1TL8A 3NRVA 2Y2ZA 2R7SA 4EV0A 1X1PA 5HNHA 4FT8A 1R49A 3RPQA 5ICFA 2I10A 3SZPA 1YTYA 4YRVA 1PJRA 2X0LA 2DN0A 3HUGA 3DPLC 4AM3A 3PUBA 4XLHA 3L1PA 3JRCA 3VOKA 1TP4A 1MNEA 4M9SA 4LG0A 4ESBA 1QHHD 1W1WE 1OCRH 2XF7A 3M8JA 3ESWB 3DWLE 2IS2A 1U6GA 2PMZA 3VOXA 2CYYA 2O03A 5CJ9A 1OPCA 1N78A 3BTIA 1FYMA 2ZSIB 4CA0A 5LHGA 2O9LA 2G7LA 3H3ZA 1DGWY 4P5OA 3KYCB 1MNDA 2FX0A 2NS7A 2RN7A 4V2GA 4YEJA 4JNNA 3OSGA 2CQKA 1BI0A 2R7DA 2HR3A 3HXLA 3K4JA 3U21A 5DTDA 3IC7A 4PUSA 3QYBA 1KU9A 3QODA 2XRLA 3UNGC 3GF2A 2O5RA 2A68F 3JRIA 3G73A 4BEHB 3GTGJ 4GXOA 2EB7A 5M5YJ 2GXAA 2CUFA 4F93B 1V3FA 3EYIA 4WIBA 3WGHA 4C2TA 1RETA 1LVAA 2EV5A 1F36A 4YFKF 3CLOA 1J09A 3CDIA 2KQRA 4GCKA 3WTUC 2A6HF 1XMXA 2CW0F 2WTEA 1RPWA 2JA8J 3LWFA 4RA2A 2DDBA 2XAFA 3IWFA 4HLYA 1IXCA 1EKEA 2ELKA 4I76A 4U0YA 1FBUA 1MD0A 3IHUA 3CC4I 4AF5A 4BBRJ 5CVUA 2L01A 2PMHA 3CJTB 1LVKA 1Z91A 2FEZA 2P6SA 2E1MC 4CCNA 5LHIA 4R8HA 3RQIA 1TTYA 2DO7A 3TP0A 2DG7A 4ACIA 1DPRA 2X6WA 4BE1A 4MNUA 2ZFUA 3HRUA 2DYSH 3ON2A 4PJJA 3BG6A 4AVZA 2R7WA 4XN3A 2VKEA 4B3AA 4CCKA 2P5VA 3NPIA 4IRHA 3LSKA 1G4DA 2CRGA 4UB8C 1IW7F 2VE9A 1K78A 1R23A 1P7JA 1JHHA 3IKTA 3BY6A 3OYFA 3NAUA 3I55I 4CZZA 5JLXA 3ZP5A 2LY2A 4BUPA 2DG8A 1I1SA 4MEYF 4C2MA 3H1CA 5TGTA 1X2MA 2LREA 1F43A 4A3CJ 2MLGA 2LBFB 3P9KA 3WTTC 4DOZA 3VPRA 1IF1A 2EH3A 2XGXA 3BZ6A 1YHQI 1BL0A 1OMIA 4W97A 3KZIC 1O7LA 1W7PD 2B0LA 5F0CA 4G7ZF 4Y13A 5FLMJ 1LFPA 3CJQB 4R1HA 4C3IJ 3W2WA 5FGLA 3MEXA 3LMMA 4P55A 3GZNB 1T39A 1CF7B 4L18B 3BR0A 2VXZA 1DU0A 3BNIA 4O5VA 3RZDJ 2Z9OA 1YIJI 3M1CA 3BWGA 3R6SA 2MABA 2QF7A 5EDNA 1R5GA 2M7AA 4RBOA 3T8RA 2NNNA 3TDZC 2M87A 1REPC 1Z7UA 3EGQA 1BR4A 4RM3A 3K70C 1AU7A 1C0WA 3KP3A 1QHGA 2GWRA 5HDGA 5LEJA 2KIMA 3QOPA 1LKXA 1LE8B 2AHQA 2DK8A 4DQ2A 1NK2P 5D8LB 1ZTRA 2K86A 3LFKA 1MJAA 1VF9A 1GLNA 2VC0A 3DBLB 5FKKA 4CICA 2OI8A 2K9NA 1SFEA 3WE2A 3KLNA 1ZELA 1XGMA 2DJIA 2DAOA 3U9GA 2DLLA 4ZDLA 3VSLA 1TW2A 2COBA 2ZMEC 2Y9ZA 3CQZJ 2XIGA 2FOKA 3R0JA 1BOAA 1ITYA 5J8FA 4KDPA 2L7KA 3E6DA 5KAFC 2X6YA 4UVCA 2JSCA 2CJJA 5FFXA 2UWMA 3ROUA 3CUQA 4PJNA 2F4OB 4J01A 3ABTA 3BTLA 4D5CA 3B81A 2ZXWH 3DP7A 4HKUA 2VBXA 3CJRB 5GP9A 1S29A 4M73A 3CO6C 3D5SC 2KJCA 3HOYJ 3HHHA 2HOTA 2JPCA 2NP3A 2N8GA 4NHJA 3CWRA 2KISA 3TW6A 1X19A 2XUBA 4RAFA 2QEXI 2DYRH 1ETVA 2ZMEB 5JR3A 5EGOB 5D1RA 1I50J 2E36A 1H88C 3OIQA 2V1DA 3CCYA 3DEUA 3I54A 1TQIA 4IVNA 4E7KA 4LG0B 4A3MJ 3BP8A 4PDKA 3GUDA 4D9JA 1TZLA 1G3YA 5F1RA 4XKWA 4KT6A 1HW1A 3VVYA 3A01A 2V9VA 1BM9A 2LVSA 1T56A 3LAPA 3NQOA 4HF0A 1TT5B 2HDCA 3HRSA 5D19A 2UV1A 3JSJA 3KNWA 1SAUA 3ZMTA 3KETA 4BU2A 5DS9A 2HYTA 5K7ZA 4I01A 4EMSA 3DLLF 1ZG1A 3IRQA 4HPQA 1FMWA 4ZTJA 1LEBA 1N75A 4DYRA 2CV0A 3REOA 2K02A 1FPQA 3KLOA 1S3JA 2D2WA 1OCPA 1SFUA 2E71A 3K69A 5CQGA 4RAYA 1IN4A 4LLLA 4Q5SF 3W2AA 3IV5A 2EINH 1Y1WJ 2HI3A 5JVTA 2JJ7A 1FNNA 1FY7A 4J19A 1WJAA 3J80K 4FTHA 1YRNA 5F1JA 5HBUA 3DTIA 2DI3A 1FX7A 2LRDA 2DA7A 3BTCA 4I6ZA 5M5WJ 2CV2A 3QPSA 4LD5A 2DXIA 3P5JA 3LSPA 3OWTA 4HNVA 1ETOA 2ETHA 1W5CC 2PZ9A 1WRJA 3OYNA 3GTPJ 2DJNA 5J3LA 3KYLA 4A5MA 2DMQA 4IQ4A 3F21A 4ZH4F 5K7HA 5JHUA 3PIOF 4MK6A 3M9AA 1B4AA 5CQEA 4Q4ZF 3S3OA 2IW5A 1U9NA 3E7LA 5FJ8J 4GDFA 2ISYA 2EK5A 3BR3A 3IH4A 2K85A 3QPHA 4Z6YA 4ZTFA 2G7GA 3TQNA 1IN5A 4E7ZA 2BGCA 1WH5A 2ZMEA 2W53A 3PFYA 2ZJPF 3G71I 3ZQFA 3LA2A 1YQAA 2B7EA 1TQPA 4B8XA 1CGPA 5D18A 2VE8A 4RGXA 2OAZA 1IG7A 1DDNA 3RIRA 1AWCA 4L0YB 1RUNA 4P96A 3JAMK 4JBAA 4RMNA 2Y31A 2ZJQF 1YX5A 4UUSA 3ZCOA 3NRGA 2R92J 1I3QJ 4DYCA 1DUXC 4D0PA 2W48A 4BYYA 2HVQA 2R7ZJ 4M3GA 3OIOA 2FNPA 4LB5A 1UI6A 1UI5A 3CCSI 3I71A 1OKRA 3WTXC 2P0WA 1UZCA 1KU2A 1X3UA 4ENNA 1K79A 1A04A 1UMQA 3MQ0A 4UHTA 5D5UB 1RR8C 3PO3J 2M3AA 2W57A 2W00A 3BR6A 4NC6A 1E3OC 1DP7P 4XR6A 4BS9A 2B3WA 1VQLI 4XK4A 1RNLA 4IF4A 3MWMA 3CUQC 5C44J 5H2FC 4M3FA 2BY3A 2V26A 4BH9A 4ZYHA 4EGZA 4OU0A 5FFZA 4A3BJ 2AXLA 5KAIC 2XPVA 4NELA 3IAM2 4MHGA 1RRJA 5EEHA 3PJRA 3LNQA 4AIDA 2R7UA 2VBWA 4JX5A 3OOPA 4ITVA 2YX4A 2ZBKA 4CSWA 2UUZA 3I4NJ 4Y52J 2QYOA 3K1PA 4HRIA 1SANA 5IT3A 1NTCA 2F4MB 3AG1H 4WX9A 1SEUA 4KN7X 1NG7A 2VQHA 5FGMA 2R7RA 1P6RA 3E3VA 4L5JA 2CQNA 4LB6B 3CF5F 3HOVJ 2BZTA 4RAGA 1VI0A 4HZFA 2M5WA 3SHFA 2OCEA 1USSA 2FE3A 1X3WB 4M6YA 2P5KA 5B3SH 2PMUA 2VL8A 4Y17A 1S7AA 3WHBA 1TLHB 1VQ6I 3NWSA 5TJJA 3ERMA 4N9HA 1JHFA 5E8IA 3HOTA 1IO2A 4MIMA 2LMDA 3JR9A 4DZPA 1JXSA 5HOOA 3E5UA 5L3DA 3VVZA 2VIXA 2OZ6A 1SMTA 1BW6A 3LSRA 2KZVA 2IBDA 4MFDA 2KRHA 4GYGA 2BY2A 2EZKA 5ILVA 2UXPA 5E17F 5DUKA 1OYYA 5EFYA 2COMA 3CP8A 2HU9A 4ANJA 2K9LA 4L9JA 1Z6RA 4L5IA 2W85A 2OV7A 1Z21A 2X48A 1S72I 1BJZA 2E2JJ 3F3XA 2P7CB 2KP6A 2JA7J 4U9LA 4E7IA 1UG0A 4JX4A 2KMUA 1VQKI 4ZC3A 4F52A 2QWTA 3HM5A 2RHAA 4NDLA 2CUEA 2ZJRF 2NOJB 3H3VK 3JREA 3CLQA 4XKCA 5ICEA 4E6KG 3I5UA 3S3MA 4A5NA 3I4PA 4LIVA 1ZG5A 5CVJA 3ZR8X 3HGGA 2RKHA 2XGCA 4ASNA 3AFHA 2V9PA 5BS6A 4XKVA 5ED4A 4E7LA 1EH8A 5E3OA 2H1KA 2KLOA 1L0OC 3F22A 4A3FJ 2KIFA 5EZGA 1BI3A 5C3EJ 3WODF 1ONVA 2LSOA 3HOXJ 5EGOA 4LG3A 2HOSA 4P9UA 3S1NJ 1YLFA 2CG4A 4X6AJ 2VJ5A 3LL7A 2DW4A 3SXYA 1QQIA 4S05A 2XAQA 4ZYAA 3HKZN 3TO7A 4IEJA 2ZB9A 3HDDA 3HSEA 3MZHA 3RQ4A 4QIWN 2HKXA 3K1MA 3K4CA 4JX6A 2XB0X 3QRFF 3F23A 3OYEA 3FWEA 2DFIA 2LTPA 3I9V2 3VB2A 3T0YA 2L9RA 2QZ8A 5FMPA 5K58A 2HYJA 4DZJA 3G4SI 1Z67A 3ABMH 1HW2A 3MVPA 4KWAA 2DT6A 3DFGA 2HXOA 4HLXA 2M4GA 1STZA 5KVRA 5AIQA 4AC0A 4C2MJ 4D1QA 2BVLA 1V5EA 3UKGA 2DMNA 3C7JA 4A3JJ 1VQ4I 4II3A 2QVOA 2E5NA 2WB1A 4R79A 3FM5A 3IAS2 3L2RA 3OS2A 1H8AC 3ZPLA 3GTOJ 2IGMA 3O8GA 1AA7A 2EFPA 3AAFA 3CCMI 2HKUA 4B4CA 2E60A 3BJBA 1KQ0A 4BJ6C 3FF5A 3BG5A 3ERED 2WWYA 1IV8A 3FXMA 1Z3YA 4BY1J 1W4MA 1FBSA 1ON1A 1PVEA 3MZYA 4EATA 1IC8A 3ZMSA 4NC7A 2IS6A 4XOTA 4JOMA 5C4YA 3OY9A 2UXIA 3LSMA 2A6EF 4G7OF 1K6YA 3KEOA 5D4RA 3SZGA 5HLTA 4A3GJ 2IS4A 1XSXA 2E7XA 4RS8A 3S32A 2VKHA 1T95A 2HYGD 1U8BA 4X1EA 1Z1DA 2LG4A 4HX7A 1FBQA 6PAXA 2M7BA 4O3MA 1XMKA 4D7MA 3A2KA 3CUOA 4GRIA 2FBQA 2P7VB 3HRMA 3FHNA 2VQGA 2WAQA 1IXSB 3K1NA 2ZCXA 2AXTC 1LEAA 1ZN2A 2WY8Q 3P9TA 5IPAA 3BTJA 3BLYA 4IHXA 2Q2EA 4U0WA 4OIRF 2WAFA 2R4GA 1S9HA 5ICGA 5GTHC 1JT0A 2VONA 1TWFJ 2PJPA 2BW3B 4RM2A 2NOGA 3I4MJ 1FT9A 3TL4X 2X1CA 1K4SA 4XNFA 2HFHA 4AVPA 4FX4A 3JRDA 3K7AJ 3BRUA 3D5LA 1BA5A 2RC4A 2H1LA 4YIIA 5J8CA 4BHCA 2ZXHA 3H36A 4XRSA 1BW5A 3FRQA 1IZ1A 1LFBA 1WKMA 2PFBA 1X3ZB 4RAZA 1HSJA 3T5XA 3PSIA 3HHGA 1P92A 2DA6A 2P6TA 1HOMA 1H0MA 2W1OA 4G12A 2M0MA 3A03A 4X0GA 1ETQA 5FKOA 3HUGB 3PNTA 4KICA 2K27A 5F08A 2VPLA 2YPRA 1XS9A 1U2WA 4LGWA 1YYVA 2MC4A 3B6AA 1EA3A 5DD4A 4QSHA 1YO5C 3I64A 2DT7B 2XSDC 1I27A 4EJVA 5E3LA 1W7PB 1D8KA 5D6EA 1D5YA 3F8BA 4EJOA 1MNMC 3FXRA 3C2BA 3MN2A 3SQNA 3TBIA 5A2QZ 2DMUA 2K5CA 1LPQA 2IGOA 2Y69H 2JVGA 5CKTA 1OCZH 2R7TA 4E7JA 1X1BA 3O6BB 5LBQA 2R5ZA 3Q9SA 2DFEA 3GTKJ 3S14J 4ZDOA 3MKYB 1UAAA 4KMUX 3Q3SA 4FETA 4XM3A 2R93J 2LF7A 5J40A 3V8KA 5GADJ 3TP3A 2ZCWA 4PJMA 4WCGA 3A0HC 3RPUA 1OISA 3QPTA 1D8JA 2J5PA 2RDPA 1MBFA 2E19A 5IP6A 2LC2A 4IJAA 1O57A 1DP3A 1OQYA 3BJOA 5HNFA 1MJ9A 2Q24A 4BEHA 3DBHB 2VT3A 1HLVA 2Z33A 2EV0A 3ZQGA 5LRRA 3WE3A 2PJRB 5BNGA 2PJRA 4HV5A 3FM3A 3R0AA 2WV0A 1FSHA 3VUQA 1WJEA 2NVTJ 2UXXA 3PQKA 3V78A 2VN2A 1PUEE 3X2QH 2OJED 4HBLA 1VFCA 3FXUA 3LSIA 3WU0A 2GM4A 5KNLA 1MBGA 3S5RA 2L02A 4GFLA 1W5TA 5A2QK 5F27A 3ZRGA 4E7HA 3TO9A 2H94A 2V6EA 2Y0SA 2GFNA 3I53A 2XAJA 4UV8A 5DD8A 2DOAA 2WADA 3QPLA 5DCFA 1WGXA 2L7MP 2LLKA 4GGGA 2OC6A 4MQ9F 1QU3A 1Y8QB 4IOAF 3F1BA 3NXCA 1I3AA 2IA1A 3BJ6A 1FIPA 3I58A 3K4MA 4YIFA 3OS1A 1ZLKA 2PI0A 1FZPB 2PMZN 2ECBA 3G2BA 1JKRC 1XC5A 1YE9A 3P9CA 1IUYA 3FMSA 5F0FA 2P8TA 2DDAA 5E1WA 3BR2A 2BXZA 3VP5A 4ICHA 2CH0A 2EFNA 1MBEA 2PG4A 2K9SA 2O7TA 3CF2A 4XICA 2X1EA 1E3PA 2ECCA 3SFZA 2ZXIA 2HOAA 1Y1VJ 4BDYA 1UFMA 3BG3A 5FLXZ 5BPDA 3HTJA 4G6QA 4OD5A 2KZGA 4RB1A 4NUBA 1XTAA 3FXLA 1D1CA 2IS1A 2XVCA 5CPRB 1MMGA 3GZIA 1SC7A 5LRSA 4B3XA 2NVYJ 4EEFG 1GDTA 2G7UA 3AKZA 5E8GA 1VQPI 4B1RA 3QKXA 4NQWB 3EETA 3CTAA 2BBYA 4FHTA 4BJ5C 1A36A 1W36C 2K9MA 1B9MA 1EF4A 2EBIA 3OYBA 1ZR4A 2F5VA 3JW4A 1LE8A 1J75A 1OFCX 4UUTA 1U5TC 2ZOYA 1NK3P 4CGZA 1ETYA 2CFOA 2FBHA 3S8PA 3V7RA 2BW3A 2E7WA 3KX2A 4Z2YA 4FX0A 3E7QA 4IHWA 4OAZA 2UXHA 2NXNB 4FISA 2ZCNA 2X6OA 1SD4A 3CUQB 2NS8A 4BL0B 1XCBA 3O60A 3P9IA 2NS0A 2XV4S 3V6GA 3DEWA 2R7QA 5KHDA 1B6AA 3IUVA 2IU5A 1XSVA 1FOYA 5E3NA 1QNTA 4CYDA 3S1QJ 2HZDA 1E17A 4L5EA 1R6RA 2QLZA 2E2IJ 1WJ5A 4I0AA 4OOIA 3M1EA 1QVTA 2DU9A 4CCOA 2YVXA 3SDBA 4FE7A 4ESFA 1G2HA 2DFFA 3FXOA 4F91B 1O4XA 4RB3C 1YJ9I 2WUIA 3PNVA 2QQ9A 5M5XJ 4GCTA 3ECHA 5CLSA 2UXNA 1CF7A 1VQ8I 1SD7A 5IY5H 3HOUJ 1D1BA 2X4HA 4HDUA 3M3YJ 3FBIB 3ONQA 5HDNA 2WA0A 1UB9A 1KYZA 2D5VA 4N9IA 4XLNF 2ZNZA 4IRVA 2V79A 1J0RA 3B6CA 4MGRA 1QA6A 4ME9A 1QBJA 1XMAA 2DA4A 2XDVA 5LEKA 1KGSA 3HPHA 2GLOA 2HXIA 3VTIA 3RKQA 2Q0OA 4BGDA 2A5WA 3EDPA 3ZQHA 5M3MJ 2AQEA 1A35A 4DBQA 1M1EB 4PGHA 5JLWA 3KFWX 5F04A 3HE0A 1FYLA 1WFXA 1E2XA 2L4AA 2ZSHB 3RTRA 3WG7H 4ENJA 3S3NA 2CGPA 3H3UA 4LLGF 4IHSA 1QRYA 3H9QA 2EFWA 2GOXB 4YZEA 2R5YA 2QSGX 1FC3A 2IPQX 4RLQA 3GO5A 1K83J 3MNLA 3ZGKA 2A5YB 1D1AA 3G1OA 2QM3A 2DODA 4AU7A 1GXQA 2FNAA 4A3DJ 3F8FA 1IGNA 2DA2A 2MFZA 3BR5A 1Z77A 5D6FA 1U8RA 2STTA 3VODA 2X9DA 3K4BA 5IOZA 2Z99A 2C6YA 4HNTA 2DPUA 2HNHA 2KHMA 5GPCA 4LITA 4EJUA 3GTJJ 1HBXG 1I6HJ 1LDDA 1G3WA 4PGGA 1VQ5I 1GXPA 4M9XA 4YELA 5BPIA 3U2RA 2DT5A 3IP4B 2JA5J 3TOAA 5HS9A 3ZMVA 1HC8A 3M7GA 1WJBA 4A3IJ 3L2VA 1A6IA 3LSJA 2LR8A 5EYRA 3L2UA 2UZKA 2IRFG 3H5NA 3DPUA 3JTGA 4NQWA 5JVGF 1SAXA 2A2FX 1TT0A 1KQ8A 2NVQJ 2FQ3A 1G6NA 3NEUA 1YJWI 2B1EA 5DCMA 2RREA 3DBRB 3GFIA 2IXSA 2R7FA 2XKPA 2QKMB 4WWCA 2ME0A 1B8IA 2VI6A 3J80Z 3RZOJ 5GAHJ 1OYWA 4ZDPA 1ZRDA 3QBMA 1ON2A 3AG3H 1V5GA 1P7IA 2YU3A 4XBFA 3JRBA 1UCRA 2A07F 2IGNA 1Y0NA 3VEPA 3S16J 5JI6A 1BOBA 1OCCH 1QZZA 1UELB 2CW8A 3V4GA 2LH9A 3HJEA 3CMMA 3KEQA 3NWTA 1WCMJ 2LY1A 2PEXA 2DQRA 1TC3C 5ILUA 2CWEA 1JJ6C 4MTDA 2V6CA 2RVCA 3TW7A 3E5XA 2ELHA 5ILSA 1IN8A 2LKSA 2F5EA 3RYPA 4PFPA 1X4PA 2E1NA 3HIMA 3F6OA 2K40A 4G8XA 2HQNA 4WXDA 1T0FA 1ZKGA 4EM0B 2GA1A 4EGYA 4GO1A 2A05A 1Y6IA 2JT1A 1ZARA 3A1YA 3TGNA 3OYJA 3RYRA 3PASA 2RQQA 1G3TA 1IRZA 1SD5A 2OA4A 4I0BA 3ABLH 3U1KA 2LYCA 2WC2A 3JRFA 1HCRA 4AYBA 3J7AY 2QENA 1IN7A 1QGPA 2O0YA 3R61A 4PCQA 1P2FA 3DF8A 4MTEA 3EUHC 1WI3A 3AQSA 5L3GA 3CJNA 1LDJA 1B1BA 3R60A 3TMOA 5GAEJ 3BPXA 3MAJA 2EZHA 4OMZA 5L3CA 3S17J 2BE5F 2JTVA 2VKDA 4GYIA 4BQQA 2MLKA 3KP6A 1OR7C 3BT9A 1N25A 2LDUA 3QP6A 4NN1A 4AIKA 2EA2A 3KP2A 3AQTA 5ICCA 1BC8C 3CDLA 3FMQA 2LKXA 2DOFA 2H8WA 2JVHA 2PN6A 5HODA 2NAZA 4I7HA 3HIFA 4BAYA 3PIPF 2R5ZB 3JRHA 4HOBA 5EJCA 4UV9A 1O3RA 4G6DA 4HA8A 4MEXF 2CUZA 4HSRA 3L2WA 1HKTA 1QVUA 2W25A 4XORA 2IJLA 3D0SA 2RNGA 4ZYDA 5H9TA 1R1TA 1Q1VA 4CHUA 2Z5UA 2HOEA 3CCQI 1MBKA 4M3BA 4PJLA 4CZCA 1TNTA 5J1UA 4IZZA 2GIVA 2E35A 4BE2A 3FKIJ 5HLHA 3GLXA 4D7NA 3KYDB 2F5DA 3H92A 4KJZA 2DA1A 4XRSG 4CGRA 3MMYB 1X1AA 1IAWA 3T8TA 4UDSA 1R1UA 2L7ZA 3GWZA 2XC7A 2PX9A 1IRXA 2XB5A 3EUAA 3LHQA 3LQQA 2X85A 3GX4X 3LJLA 4DBRA 2K7LA 4CYCA 4PK4A 4BACA 1OCOH 1WJCA 3BJAA 1XN7A 3P7NA 1SVOA 2V4JC 2F6CA 1MZBA 4N0BA 4LLNA 3C07A 1RIOH 2V1XA 2CW7A 3KKCA 2KL4A 3ASOH 3KP4A 1HDPA 3KZZA 1MDMA 3DU6A 3F72A 3BROA 1G3SA 2CS3A 1CQTA 1JTXA 4M74A 3MKZA 2FRHA 4A3KJ 5D4SA 3N05A 4EQQA 3DLAA 3G1LA 1ZRFA 2NVXJ 2BEOA 3RKXA 1UHMA 4MFEA 1NG6A 2R0QC 1DPUA 2YR2A 3V7CA 2EQRA 4HG2A 2NVUB 1YI2I 4G9YA 2B63J 2IGKA 3NI7A 2YUSA 5LD2C 3HC7A 4A6EA 2K3PA 4HW0A 5HS8A 5H20A 3G56A 5FHPA 1SVLA 2VODA 3KE2A 3ANPA 2WAEA 1MDMB 3CMAI 1T38A 2W84A 5HDKA 3W6VA 1XG1A 3CD6I 2Y75A 2E1CA 3BDDA 4I2OA 1ZGAA 3OYMA 3QYFA 1S8NA 1GVDA 4KYWA 2BV6A 1WJDA
chains in the Genus database with same CATH topology
1GV2A 1X2MA 2DA6A 4D5FA 4A3CJ 1F43A 1LFUP 2GBYA 5IYCJ 4IHYA 1HOMA 4JKZA 3VPRA 5F0HA 2EH3A 4G12A 3A03A 1APLC 1BL0A 3HBLA 4W97A 1ETQA 5FKOA 5F0CA 1FTZA 2XDNA 5FLMJ 4UUSB 2XPWA 5F08A 1ZR2A 3NNRA 1XS9A 4V2FA 4C3IJ 5FGLA 1B72B 5IP9J 3B6AA 3BR0A 4QSHA 1DU0A 3BNIA 2XSDC 1PUFA 3RZDJ 2OPTA 5IYDJ 5E3LA 2QF7A 4AUXA 5EDNA 4RBOA 3QQAA 1D5YA 1ETKA 1MNMC 3Q0WA 3C2BA 3MN2A 1TWGJ 3TEDA 2DMUA 3BR1A 2XPUA 2QCOA 3EGQA 1AU7A 2R5ZA 3GTKJ 3S14J 2JN6A 3G1MA 4JP0A 3Q3SA 1LE8B 2AHQA 2R93J 3GTLJ 5IOYA 2YVEA 3TP3A 1NK2P 1ZTRA 1R9TJ 2OI8A 1GUUA 1VF9A 3PPBA 3FK7A 5FKKA 2K9NA 1MBFA 2E19A 5IP6A 1W0UA 2MSYA 1JUSA 1AHDP 1MBHA 2COBA 2Y9ZA 3CQZJ 2Q24A 2QKOA 3S15J 1TWAJ 3VW0A 2TCTA 1RESA 1HLVA 1JUPA 1ITYA 3ZQGA 2LFBA 1JKPC 5EZHA 5BNGA 2CJJA 2M34A 3RH2A 3VUQA 2NVTJ 1GV5A 1SGMA 3V78A 3BTLA 4D5CA 2OERA 3B81A 5E3MA 1VFCA 2GM4A 4HKUA 1ETXA 5GP9A 1MBGA 2V57A 3S5RA 4GFLA 3HOYJ 3BQZA 5F27A 1H89C 3GEUA 2HOTA 4C3HJ 2NP3A 2N8GA 2GFNA 3CWRA 2LY9A 3Q0UA 3TW6A 3QPLA 1WGXA 2DMTA 3JRAA 2L7MP 2LLKA 1ETVA 3F1BA 1IV6A 3NXCA 5EGOB 1FIPA 5D1RA 1VNDA 1I50J 2PMZN 3LWJA 1H88C 2ECBA 2FJ1A 3CCYA 1JKRC 2JA6J 1ZK8A 1POGA 1XC5A 4A3MJ 2LP0A 5F0FA 1ZQ3P 3BR2A 4M3EA 3VP5A 3VVYA 1AKHB 4ICHA 1MBEA 1SFOJ 3A01A 2K9SA 2O7TA 1JT6A 2QOPA 2LVSA 1T56A 4XICA 3HTHA 2ECCA 2HOAA 1Y1VJ 2ID3A 5D19A 3BG3A 3CRJA 2VKVA 3JSJA 2VUMJ 3KNWA 3HTJA 3OOUA 5FKLA 1X58A 1X2NA 2ID6A 1WPKA 5DS9A 2HYTA 2D6YA 3GZIA 5K7ZA 1GDTA 4DYQA 2NVYJ 4EEFG 1MSFC 1K61A 1ENHA 2JK3A 4DYRA 4ABZA 4B1RA 4IHVA 3QKXA 1JJ8C 2GENA 4GCLA 2M8GX 1OCPA 2Y30A 3SFIA 1EF4A 3VIBA 2EBIA 3O8HA 3VW2A 2WV1A 1ZR4A 3IV5A 1LE8A 3HGYA 1OFCX 5CXIA 4UUTA 2F07A 1Y1WJ 2HI3A 3SDGA 1NK3P 1FEXA 2ZOYA 1ETYA 2JJ7A 4J19A 3E7QA 4IHWA 4A69C 4FTHA 1YRNA 2UXHA 3DPJA 4FISA 2ZCNA 1IDYA 2X6OA 5F1JA 3T6NA 5HBUA 2EZLA 2NS8A 3CMYA 3O60A 2DA7A 2G0EA 3BTCA 4I6ZA 5M5WJ 2P81A 3V6GA 1B8IB 1PUFB 3QPSA 1JGGA 3DEWA 4MLOA 3M4OJ 3NARA 3LSPA 4JL3A 4HNVA 3IUVA 2IU5A 1ETOA 5E3NA 3D1NI 4A93J 2PZ9A 3ZQIA 3CJDA 3S1QJ 4W1UA 3GTPJ 2DJNA 2WAQN 4L5EA 5J3LA 2DMQA 5K7HA 2E2IJ 4BXXJ 4MK6A 2E1OA 3S1MJ 1S7EA 1U9NA 3E7LA 5FJ8J 1QVTA 3BR3A 3IH4A 1ZGWA 5K7FA 5CXGA 4FE7A 2G7GA 2AO9A 3RD3A 1FTTA 2G7SA 1WH5A 1G2HA 4PXIA 2DA3A 2W53A 2KDZA 3ZQFA 3WHCA 1O4XA 9ANTA 2ZCMA 5D18A 2WUIA 5M5XJ 1IG7A 4GCTA 2UXUA 2QTQA 2Y31A 3HOUJ 3M3YJ 2MGQA 1HDDC 3IH2A 2L7FP 3F0CA 4UUSA 3NRGA 3ZQLA 2D5VA 4GFBA 2R92J 1I3QJ 4DYCA 3ON4A 1UG2A 2W48A 2ZOZA 3HEFA 3B6CA 4L62A 2R7ZJ 4ME9A 4M3GA 3OIOA 2DA4A 1UI6A 1UI5A 2Y0SN 2RAEA 2GLOA 2HXIA 2R5YB 4QTRA 3RKQA 4DW6A 3HTAA 2MW8A 3IH3A 3S2DJ 2YS9A 3S2HJ 4JYKA 1TWCJ 3ZQHA 1UMQA 5M3MJ 4FE4A 4GFKA 2TRTA 3LOCA 3PO3J 5JLWA 5F04A 2OF7A 2WGBA 3HE0A 3BR6A 1E3OC 3ZOBA 1IDZA 1U78A 4BKXA 4BBSJ 2LD5A 1QRYA 4XK4A 4YZEA 2R5YA 1TWHJ 5C44J 1OJLA 2K9QA 1Z0XA 4M3FA 1K83J 5IP7J 2Y9YA 3MNLA 1FIAA 4A3BJ 4RDUA 3G1OA 3GBGA 1RKWA 2IEKA 2IAIA 4A3LJ 2XPVA 3FIWA 4NELA 4A3DJ 2XGEA 1IGNA 2DA2A 1B72A 3SJMA 3BR5A 1JKOC 1Z77A 3LNQA 3GTQJ 1IUFA 2L0KA 2X9DA 5IOZA 2DMPA 2FD5A 4JX5A 2ME6A 5GPCA 5C4JJ 5M3FJ 3GTJJ 3I4NJ 1I6HJ 4Y52J 5GPAA 1SANA 2G3BA 2XGDA 1QPIA 3KKDA 1NTCA 3EUPA 5CW8A 2PBXA 1U9OA 3HOVJ 5HSZA 3HOZJ 1VI0A 1W0TA 2M9HA 5EEAA 2JA5J 4S0HB 3K2AA 2YVHA 4A3IJ 4MO7A 3HB9A 1A6IA 3LSJA 2LR8A 5EYRA 2QIBA 2YU9J 1HF0A 2O8KA 2E2HJ 3FISA 3WHBA 3BG9A 2NVQJ 1RKTA 1MSEC 2RASA 1IJWC 5EG0A 4MIMA 2ME0A 5FKMA 1B8IA 2VI6A 4DZPA 3JR9A 3RZOJ 5DAJA 5J1YA 3VVZA 3QBMA 3PM1A 3LSRA 1BW6A 2NX4A 3VW1A 1P7IA 3BQYA 3JRBA 3A02A 3Q0VA 1YRNB 2IBDA 2LK2A 4MFDA 1GT0C 3S16J 3ANGA 2EZKA 2UXPA 2UXOA 1WCMJ 2CU7A 3S1RJ 5EFYA 3H0GJ 1TC3C 1AKHA 5C4XJ 1JJ6C 1ORKA 2GUHA 3VVXA 5J1RA 3TW7A 2X48A 1BJZA 2E2JJ 2JA7J 3COLA 4AYBN 3GTMJ 1OCTC 2NP5A 2VPRA 2EZIA 2HQ5A 1DU6A 3DCFA 3HIMA 2JWTA 4CYCB 4JX4A 2K40A 3PO2J 2KT0A 4XIDA 1ZKGA 2WB1N 2QWTA 3HM5A 5FLVA 2RHAA 3PASA 4NDLA 1JKQC 4MXMA 2MG4A 1IRZA 1MH4A 3JRFA 2CUEA 2Y2ZA 1HCRA 3H3VK 3JREA 3MKLA 5HAWA 3ZQCA 2I10A 1JUMA 3HGGA 1WI3A 2DN0A 2XGCA 4M6VA 2REKA 3AQSA 3L1PA 3JRCA 3VOKA 2EZHA 3S17J 5EG0B 5E3OA 2H8RA 2H1KA 4A3FJ 2O7OA 3BT9A 3BCGA 5EZGA 4NN1A 4BY7J 3FK6A 5C3EJ 3HOXJ 3BHQA 5EGOA 1RR7A 4A3EJ 1MBJA 3VOXA 3AQTA 2HOSA 3CDLA 3S1NJ 2LKXA 4X6AJ 3KZ9A 3BTIA 2O9LA 5HODA 3HKZN 1MH3A 2ZB9A 4IEJA 3HDDA 2R5ZB 2G7LA 3JRHA 1ETWA 2HDDA 2FX0A 2NS7A 4V2GA 3JRGA 4JNNA 4QIWN 3OSGA 5FKNA 4JX6A 1QVUA 2XB0X 5DTDA 1UHSA 5AQCA 5H9TA 1Q1VA 1A5JA 2XRLA 1MBKA 4M3BA 2LTPA 4M3DA 5J1UA 2L9RA 5FMPA 4LOCA 3JRIA 2HYJA 3GTGJ 3FKIJ 4DZJA 5K58A 5M5YJ 2CUFA 3MVPA 4D7NA 4KWAA 2HXOA 2DA1A 4XRSG 4C2MJ 4AC0A 3UKGA 1RETA 4CGRA 1F36A 3HTIA 3A01B 2DMNA 4A3JJ 2DTZA 4UDSA 2L7ZA 4GCKA 2FQ4A 2XB5A 1RPWA 1H8AC 3GTOJ 1FJLA 3O8GA 2HKUA 3BJBA 2JA8J 3LHQA 4B4CA 3LJLA 3BG5A 4CYCA 3G7RA 2ELKA 4I76A 2JMWA 4BY1J 4AF5A 4BBRJ 1IC8A 3C07A 3KKCA 5C4YA 1HDPA 2UXIA 3LSGA 4A3GJ 1CQTA 1JTXA 3RQIA 1U8BA 4X1EA 4C3JJ 3HOWJ 2CQXA 3TP0A 4A3KJ 2DG7A 2M2EA 4ACIA 4D7MA 4FCYA 4XRMA 3ON2A 2FBQA 3G1LA 2NVXJ 1JTYA 1T33A 4MFEA 2R0QC 4AC6A 2ZCXA 2EQRA 2VKEA 4B3AA 5IPAA 3P9TA 3BTJA 3NPIA 4IHXA 2B63J 2DA5A 2CRGA 1JT0A 1TWFJ 3NI7A 2YUSA 1P7JA 2NOGA 3I4MJ 2CQQA 2M0CA 3NAUA 3G56A 4Y7NJ 5FHPA 3ANPA 3JRDA 3K7AJ 3BRUA 1BA5A 5JLXA 3W6VA 1XG1A 1WH7A 3OSFA 4XRSA 1BW5A 3FRQA 2DG8A 1GVDA 1LFBA 5IYBJ 5EF6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GV2 A;  1X2M A;  2DA6 A;  4D5F A;  4A3C J;  1F43 A;  1LFU P;  2GBY A;  5IYC J;  4IHY A;  1HOM A;  4JKZ A;  3VPR A;  5F0H A;  2EH3 A;  4G12 A;  3A03 A;  1APL C;  1BL0 A;  3HBL A;  4W97 A;  1ETQ A;  5FKO A;  5F0C A;  1FTZ A;  2XDN A;  5FLM J;  4UUS B;  2XPW A;  5F08 A;  1ZR2 A;  3NNR A;  1XS9 A;  4V2F A;  4C3I J;  5FGL A;  1B72 B;  5IP9 J;  3B6A A;  3BR0 A;  4QSH A;  1DU0 A;  3BNI A;  2XSD C;  1PUF A;  3RZD J;  2OPT A;  5IYD J;  5E3L A;  2QF7 A;  4AUX A;  5EDN A;  4RBO A;  3QQA A;  1D5Y A;  1ETK A;  1MNM C;  3Q0W A;  3C2B A;  3MN2 A;  1TWG J;  3TED A;  2DMU A;  3BR1 A;  2XPU A;  2QCO A;  3EGQ A;  1AU7 A;  2R5Z A;  3GTK J;  3S14 J;  2JN6 A;  3G1M A;  4JP0 A;  3Q3S A;  1LE8 B;  2AHQ A;  2R93 J;  3GTL J;  5IOY A;  2YVE A;  3TP3 A;  1NK2 P;  1ZTR A;  1R9T J;  2OI8 A;  1GUU A;  1VF9 A;  3PPB A;  3FK7 A;  5FKK A;  2K9N A;  1MBF A;  2E19 A;  5IP6 A;  1W0U A;  2MSY A;  1JUS A;  1AHD P;  1MBH A;  2COB A;  2Y9Z A;  3CQZ J;  2Q24 A;  2QKO A;  3S15 J;  1TWA J;  3VW0 A;  2TCT A;  1RES A;  1HLV A;  1JUP A;  1ITY A;  3ZQG A;  2LFB A;  1JKP C;  5EZH A;  5BNG A;  2CJJ A;  2M34 A;  3RH2 A;  3VUQ A;  2NVT J;  1GV5 A;  1SGM A;  3V78 A;  3BTL A;  4D5C A;  2OER A;  3B81 A;  5E3M A;  1VFC A;  2GM4 A;  4HKU A;  1ETX A;  5GP9 A;  1MBG A;  2V57 A;  3S5R A;  4GFL A;  3HOY J;  3BQZ A;  5F27 A;  1H89 C;  3GEU A;  2HOT A;  4C3H J;  2NP3 A;  2N8G A;  2GFN A;  3CWR A;  2LY9 A;  3Q0U A;  3TW6 A;  3QPL A;  1WGX A;  2DMT A;  3JRA A;  2L7M P;  2LLK A;  1ETV A;  3F1B A;  1IV6 A;  3NXC A;  5EGO B;  1FIP A;  5D1R A;  1VND A;  1I50 J;  2PMZ N;  3LWJ A;  1H88 C;  2ECB A;  2FJ1 A;  3CCY A;  1JKR C;  2JA6 J;  1ZK8 A;  1POG A;  1XC5 A;  4A3M J;  2LP0 A;  5F0F A;  1ZQ3 P;  3BR2 A;  4M3E A;  3VP5 A;  3VVY A;  1AKH B;  4ICH A;  1MBE A;  1SFO J;  3A01 A;  2K9S A;  2O7T A;  1JT6 A;  2QOP A;  2LVS A;  1T56 A;  4XIC A;  3HTH A;  2ECC A;  2HOA A;  1Y1V J;  2ID3 A;  5D19 A;  3BG3 A;  3CRJ A;  2VKV A;  3JSJ A;  2VUM J;  3KNW A;  3HTJ A;  3OOU A;  5FKL A;  1X58 A;  1X2N A;  2ID6 A;  1WPK A;  5DS9 A;  2HYT A;  2D6Y A;  3GZI A;  5K7Z A;  1GDT A;  4DYQ A;  2NVY J;  4EEF G;  1MSF C;  1K61 A;  1ENH A;  2JK3 A;  4DYR A;  4ABZ A;  4B1R A;  4IHV A;  3QKX A;  1JJ8 C;  2GEN A;  4GCL A;  2M8G X;  1OCP A;  2Y30 A;  3SFI A;  1EF4 A;  3VIB A;  2EBI A;  3O8H A;  3VW2 A;  2WV1 A;  1ZR4 A;  3IV5 A;  1LE8 A;  3HGY A;  1OFC X;  5CXI A;  4UUT A;  2F07 A;  1Y1W J;  2HI3 A;  3SDG A;  1NK3 P;  1FEX A;  2ZOY A;  1ETY A;  2JJ7 A;  4J19 A;  3E7Q A;  4IHW A;  4A69 C;  4FTH A;  1YRN A;  2UXH A;  3DPJ A;  4FIS A;  2ZCN A;  1IDY A;  2X6O A;  5F1J A;  3T6N A;  5HBU A;  2EZL A;  2NS8 A;  3CMY A;  3O60 A;  2DA7 A;  2G0E A;  3BTC A;  4I6Z A;  5M5W J;  2P81 A;  3V6G A;  1B8I B;  1PUF B;  3QPS A;  1JGG A;  3DEW A;  4MLO A;  3M4O J;  3NAR A;  3LSP A;  4JL3 A;  4HNV A;  3IUV A;  2IU5 A;  1ETO A;  5E3N A;  3D1N I;  4A93 J;  2PZ9 A;  3ZQI A;  3CJD A;  3S1Q J;  4W1U A;  3GTP J;  2DJN A;  2WAQ N;  4L5E A;  5J3L A;  2DMQ A;  5K7H A;  2E2I J;  4BXX J;  4MK6 A;  2E1O A;  3S1M J;  1S7E A;  1U9N A;  3E7L A;  5FJ8 J;  1QVT A;  3BR3 A;  3IH4 A;  1ZGW A;  5K7F A;  5CXG A;  4FE7 A;  2G7G A;  2AO9 A;  3RD3 A;  1FTT A;  2G7S A;  1WH5 A;  1G2H A;  4PXI A;  2DA3 A;  2W53 A;  2KDZ A;  3ZQF A;  3WHC A;  1O4X A;  9ANT A;  2ZCM A;  5D18 A;  2WUI A;  5M5X J;  1IG7 A;  4GCT A;  2UXU A;  2QTQ A;  2Y31 A;  3HOU J;  3M3Y J;  2MGQ A;  1HDD C;  3IH2 A;  2L7F P;  3F0C A;  4UUS A;  3NRG A;  3ZQL A;  2D5V A;  4GFB A;  2R92 J;  1I3Q J;  4DYC A;  3ON4 A;  1UG2 A;  2W48 A;  2ZOZ A;  3HEF A;  3B6C A;  4L62 A;  2R7Z J;  4ME9 A;  4M3G A;  3OIO A;  2DA4 A;  1UI6 A;  1UI5 A;  2Y0S N;  2RAE A;  2GLO A;  2HXI A;  2R5Y B;  4QTR A;  3RKQ A;  4DW6 A;  3HTA A;  2MW8 A;  3IH3 A;  3S2D J;  2YS9 A;  3S2H J;  4JYK A;  1TWC J;  3ZQH A;  1UMQ A;  5M3M J;  4FE4 A;  4GFK A;  2TRT A;  3LOC A;  3PO3 J;  5JLW A;  5F04 A;  2OF7 A;  2WGB A;  3HE0 A;  3BR6 A;  1E3O C;  3ZOB A;  1IDZ A;  1U78 A;  4BKX A;  4BBS J;  2LD5 A;  1QRY A;  4XK4 A;  4YZE A;  2R5Y A;  1TWH J;  5C44 J;  1OJL A;  2K9Q A;  1Z0X A;  4M3F A;  1K83 J;  5IP7 J;  2Y9Y A;  3MNL A;  1FIA A;  4A3B J;  4RDU A;  3G1O A;  3GBG A;  1RKW A;  2IEK A;  2IAI A;  4A3L J;  2XPV A;  3FIW A;  4NEL A;  4A3D J;  2XGE A;  1IGN A;  2DA2 A;  1B72 A;  3SJM A;  3BR5 A;  1JKO C;  1Z77 A;  3LNQ A;  3GTQ J;  1IUF A;  2L0K A;  2X9D A;  5IOZ A;  2DMP A;  2FD5 A;  4JX5 A;  2ME6 A;  5GPC A;  5C4J J;  5M3F J;  3GTJ J;  3I4N J;  1I6H J;  4Y52 J;  5GPA A;  1SAN A;  2G3B A;  2XGD A;  1QPI A;  3KKD A;  1NTC A;  3EUP A;  5CW8 A;  2PBX A;  1U9O A;  3HOV J;  5HSZ A;  3HOZ J;  1VI0 A;  1W0T A;  2M9H A;  5EEA A;  2JA5 J;  4S0H B;  3K2A A;  2YVH A;  4A3I J;  4MO7 A;  3HB9 A;  1A6I A;  3LSJ A;  2LR8 A;  5EYR A;  2QIB A;  2YU9 J;  1HF0 A;  2O8K A;  2E2H J;  3FIS A;  3WHB A;  3BG9 A;  2NVQ J;  1RKT A;  1MSE C;  2RAS A;  1IJW C;  5EG0 A;  4MIM A;  2ME0 A;  5FKM A;  1B8I A;  2VI6 A;  4DZP A;  3JR9 A;  3RZO J;  5DAJ A;  5J1Y A;  3VVZ A;  3QBM A;  3PM1 A;  3LSR A;  1BW6 A;  2NX4 A;  3VW1 A;  1P7I A;  3BQY A;  3JRB A;  3A02 A;  3Q0V A;  1YRN B;  2IBD A;  2LK2 A;  4MFD A;  1GT0 C;  3S16 J;  3ANG A;  2EZK A;  2UXP A;  2UXO A;  1WCM J;  2CU7 A;  3S1R J;  5EFY A;  3H0G J;  1TC3 C;  1AKH A;  5C4X J;  1JJ6 C;  1ORK A;  2GUH A;  3VVX A;  5J1R A;  3TW7 A;  2X48 A;  1BJZ A;  2E2J J;  2JA7 J;  3COL A;  4AYB N;  3GTM J;  1OCT C;  2NP5 A;  2VPR A;  2EZI A;  2HQ5 A;  1DU6 A;  3DCF A;  3HIM A;  2JWT A;  4CYC B;  4JX4 A;  2K40 A;  3PO2 J;  2KT0 A;  4XID A;  1ZKG A;  2WB1 N;  2QWT A;  3HM5 A;  5FLV A;  2RHA A;  3PAS A;  4NDL A;  1JKQ C;  4MXM A;  2MG4 A;  1IRZ A;  1MH4 A;  3JRF A;  2CUE A;  2Y2Z A;  1HCR A;  3H3V K;  3JRE A;  3MKL A;  5HAW A;  3ZQC A;  2I10 A;  1JUM A;  3HGG A;  1WI3 A;  2DN0 A;  2XGC A;  4M6V A;  2REK A;  3AQS A;  3L1P A;  3JRC A;  3VOK A;  2EZH A;  3S17 J;  5EG0 B;  5E3O A;  2H8R A;  2H1K A;  4A3F J;  2O7O A;  3BT9 A;  3BCG A;  5EZG A;  4NN1 A;  4BY7 J;  3FK6 A;  5C3E J;  3HOX J;  3BHQ A;  5EGO A;  1RR7 A;  4A3E J;  1MBJ A;  3VOX A;  3AQT A;  2HOS A;  3CDL A;  3S1N J;  2LKX A;  4X6A J;  3KZ9 A;  3BTI A;  2O9L A;  5HOD A;  3HKZ N;  1MH3 A;  2ZB9 A;  4IEJ A;  3HDD A;  2R5Z B;  2G7L A;  3JRH A;  1ETW A;  2HDD A;  2FX0 A;  2NS7 A;  4V2G A;  3JRG A;  4JNN A;  4QIW N;  3OSG A;  5FKN A;  4JX6 A;  1QVU A;  2XB0 X;  5DTD A;  1UHS A;  5AQC A;  5H9T A;  1Q1V A;  1A5J A;  2XRL A;  1MBK A;  4M3B A;  2LTP A;  4M3D A;  5J1U A;  2L9R A;  5FMP A;  4LOC A;  3JRI A;  2HYJ A;  3GTG J;  3FKI J;  4DZJ A;  5K58 A;  5M5Y J;  2CUF A;  3MVP A;  4D7N A;  4KWA A;  2HXO A;  2DA1 A;  4XRS G;  4C2M J;  4AC0 A;  3UKG A;  1RET A;  4CGR A;  1F36 A;  3HTI A;  3A01 B;  2DMN A;  4A3J J;  2DTZ A;  4UDS A;  2L7Z A;  4GCK A;  2FQ4 A;  2XB5 A;  1RPW A;  1H8A C;  3GTO J;  1FJL A;  3O8G A;  2HKU A;  3BJB A;  2JA8 J;  3LHQ A;  4B4C A;  3LJL A;  3BG5 A;  4CYC A;  3G7R A;  2ELK A;  4I76 A;  2JMW A;  4BY1 J;  4AF5 A;  4BBR J;  1IC8 A;  3C07 A;  3KKC A;  5C4Y A;  1HDP A;  2UXI A;  3LSG A;  4A3G J;  1CQT A;  1JTX A;  3RQI A;  1U8B A;  4X1E A;  4C3J J;  3HOW J;  2CQX A;  3TP0 A;  4A3K J;  2DG7 A;  2M2E A;  4ACI A;  4D7M A;  4FCY A;  4XRM A;  3ON2 A;  2FBQ A;  3G1L A;  2NVX J;  1JTY A;  1T33 A;  4MFE A;  2R0Q C;  4AC6 A;  2ZCX A;  2EQR A;  2VKE A;  4B3A A;  5IPA A;  3P9T A;  3BTJ A;  3NPI A;  4IHX A;  2B63 J;  2DA5 A;  2CRG A;  1JT0 A;  1TWF J;  3NI7 A;  2YUS A;  1P7J A;  2NOG A;  3I4M J;  2CQQ A;  2M0C A;  3NAU A;  3G56 A;  4Y7N J;  5FHP A;  3ANP A;  3JRD A;  3K7A J;  3BRU A;  1BA5 A;  5JLX A;  3W6V A;  1XG1 A;  1WH7 A;  3OSF A;  4XRS A;  1BW5 A;  3FRQ A;  2DG8 A;  1GVD A;  1LFB A;  5IYB J;  5EF6 A; 
#chains in the Genus database with same CATH topology
 3MCZ A;  1J5Y A;  4XON A;  2O6G E;  4D5F A;  2Q1Z B;  5IYC J;  2FML A;  3VSK A;  1APL C;  3HBL A;  1KU3 A;  2IVM A;  1FTZ A;  2GXG A;  2RNJ A;  4Y33 A;  2XDN A;  4UUS B;  5HVQ C;  1ZR2 A;  3NNR A;  4XRF A;  4QLC U;  1T08 B;  1TNS A;  5E1X A;  5E20 A;  1A31 A;  3OL4 A;  2K4B A;  3GXO A;  3M8F A;  3RKY A;  2OPT A;  4B47 A;  3QQA A;  1ZRC A;  2BVM A;  3Q0W A;  2EJR A;  3TED A;  2PQ8 A;  1A6Q A;  2QCO A;  3K4N A;  1FOK A;  3BCA A;  2ZNY A;  4UNO A;  5FRN A;  3GW2 A;  5DV5 A;  4HYE A;  5DM7 F;  4XKB A;  4IO9 F;  4L0Z B;  3G1M A;  4JP0 A;  5LHH A;  1R22 A;  4RB2 C;  4U7B A;  3ECO A;  3GME A;  3JSP A;  5BOX A;  4CUG A;  1QZY A;  3PFI A;  3E6C C;  4BNC A;  1R9T J;  3DEE A;  3PPB A;  3FK7 A;  1KZH A;  3I3L A;  4CO8 A;  3W6K B;  2MSY A;  1V55 H;  3ZMU A;  5DM6 F;  3RCO A;  1UJ8 A;  1XGO A;  3BPV A;  3RDI A;  3A4C A;  2HKO A;  3S15 J;  2TCT A;  1RES A;  1X1D A;  3K0L A;  3K8P C;  3ZXS A;  4II2 A;  1Z3X A;  3GLL A;  1B9N A;  1Y0U A;  1JKP C;  5EZH A;  2K3F A;  3M07 A;  2M34 A;  3RH2 A;  1SGM A;  1D0Z A;  4U9N A;  4KIB A;  1ETX A;  1K6O A;  3F6V A;  2KFD A;  4P1W A;  3VYS B;  2QQA A;  3BQZ A;  3DV8 A;  3ML6 A;  3FBN B;  3GEU A;  1BC7 C;  1HW5 A;  1HST A;  2ADU A;  3E1S A;  2EIJ H;  2QWW A;  3JRA A;  1FP2 A;  4IPA A;  1IV6 A;  1QPM A;  1F9N A;  2P4W A;  1JE8 A;  1ACI A;  3OYL A;  3LWJ A;  4QPQ A;  1ZGJ A;  4F7Z A;  4HNU A;  3Q9V A;  3CO7 C;  1I39 A;  2JPB A;  2JA6 J;  2LP0 A;  1PP7 U;  3PQJ A;  3CCL I;  4WXC A;  1RI7 A;  3VYT B;  5CVR A;  1R4M B;  1ZQ3 P;  1W7P A;  4EJT A;  1XGS A;  3LAJ A;  2EIM H;  1SFO J;  4U7D A;  2IA0 A;  1JT6 A;  2QOP A;  3F8M A;  2ID3 A;  3CRJ A;  3CP2 A;  1S6L A;  3DU5 A;  5FKL A;  4BQN A;  5D5W B;  4OIP F;  1MKM A;  2ID6 A;  4CH7 A;  1XPX A;  5BQT A;  3WTW C;  1YJN I;  2QBY A;  1FOW A;  3K2Z A;  4I09 A;  2H09 A;  4DYQ A;  5TIS C;  5LGU A;  4CDG A;  5DCM B;  1K61 A;  2JK3 A;  2HQA A;  4ABZ A;  2VC1 A;  4IHV A;  1TW3 A;  1JJ8 C;  1R36 A;  1P4A A;  1LUJ B;  2M8G X;  4KUM A;  5FLX K;  1YG2 A;  4S04 A;  3O8H A;  3VIB A;  3U1D A;  1XDS A;  2WV1 A;  3FKJ A;  3CC2 I;  2YX7 A;  1FOX A;  5CXI A;  3L2C A;  2F07 A;  4U88 A;  3SDG A;  1FWZ A;  5AIP A;  2NNY A;  2JRT A;  3KPH A;  3FMR A;  3WU2 C;  1UST A;  2OCC H;  3C1D A;  4A69 C;  2Q2E B;  1IXR C;  3T6N A;  1W5S A;  2F48 A;  2EZL A;  4OAY A;  3OYD A;  2EFQ A;  3VWB A;  2JSP A;  2G0E A;  2XAH A;  2P81 A;  4XOP A;  1B8I B;  1PUF B;  4XQF A;  3HTS B;  2FJI 1;  1XGN A;  1JGG A;  4MLO A;  1MJB A;  2BHZ A;  2STW A;  2VB6 A;  3V7S A;  4PJ0 C;  1YW7 A;  3NAR A;  4DJA A;  2HPI A;  4BDZ A;  1Z7L A;  2EV6 A;  4A93 J;  3CJD A;  2XSJ C;  1ZG3 A;  3C2G A;  2A61 A;  3V8L A;  3EYY A;  3KP7 A;  2O8X A;  3WG9 A;  1XSD A;  5LGN A;  1U5T B;  2L9V A;  5JHF A;  3VDX A;  1BBY A;  2KJB A;  4BJT A;  1ZGW A;  5K7F A;  5CXG A;  1T0F C;  2AO9 A;  3RD3 A;  1PDN C;  1MGT A;  2G7S A;  4ETS A;  2DA3 A;  4IX7 A;  4HEA 2;  3ASN H;  1R5H A;  3M8E A;  5LLQ A;  4F3Q A;  4UB6 C;  2ZCM A;  5FD5 A;  2VQL A;  1HKQ A;  2EWN A;  2KIQ A;  5CVV A;  4WK8 F;  3DKX A;  2QTQ A;  5AON A;  1BN5 A;  4AIH A;  2V1U A;  1F1Z A;  2MGQ A;  4IL6 C;  4E7S A;  5HLG A;  3WGI A;  2D45 A;  1HDD C;  2FF4 A;  2L7F P;  1VQN I;  5E79 C;  3JSO A;  3ZQL A;  5KK1 A;  1Y56 A;  4NC8 A;  4HV6 A;  3BZK A;  2BY1 A;  2J5O A;  2XKO A;  5B1A H;  3WTV C;  4HQE A;  3AG2 H;  2TDX A;  5FB2 A;  4GCV A;  4XL9 A;  4L62 A;  2ZXJ A;  5H6R A;  3CCE I;  2PLY A;  1VZ0 A;  1ZAO A;  4ZZD A;  1VTN C;  2RAE A;  2XF6 A;  5F6F A;  4NBQ A;  2R5Y B;  2FXA A;  3DXJ F;  2H6C A;  1DQU A;  2GOM A;  4G6T B;  4PFO A;  3C18 A;  4JYK A;  1YW9 A;  1J9I A;  4FE4 A;  1B59 A;  2QUF A;  4GFK A;  3LOC A;  4KFC A;  2WGB A;  3DTE A;  2WBM A;  3K9T A;  5J4V A;  1AOY A;  1U78 A;  3FXQ A;  3OR1 C;  4BBS J;  5H6Q A;  5B5E C;  4PZJ A;  3B02 A;  4CCM A;  1TWH J;  4YFX F;  1OJL A;  2K9Q A;  4A6D A;  2V1N A;  1QZE A;  2M1B A;  5IP7 J;  2CSO A;  2Y9Y A;  2O61 A;  2EIL H;  4UVA A;  3C3W A;  1FIA A;  3JAM Z;  4RDU A;  2QQB A;  1RZ4 A;  2IEK A;  2P5L C;  3OYG A;  3FIW A;  1H9T A;  1KQ9 A;  4PSX A;  5J4Y A;  1B72 A;  1FSE A;  2KDO A;  2L0K A;  2DK5 A;  4HQM A;  1KON A;  2DMP A;  3O3K A;  1FMV A;  2FD5 A;  4L9V A;  5C4J J;  3WU1 B;  1MMN A;  5M3F J;  4FQG A;  5GPA A;  1XDU A;  5FRO A;  1QPI A;  3KKD A;  2A6T A;  5E18 F;  1O3S A;  2L9N A;  3EUP A;  4KT5 C;  5CW8 A;  2PBX A;  3ULQ B;  1U9O A;  2MD0 A;  4LK1 F;  4CCJ A;  4U87 A;  4JQF A;  4B48 A;  2HEO A;  4V19 K;  1W0T A;  2M9H A;  1R58 A;  4H4K C;  4M72 A;  4AIJ A;  1J2X A;  3CME I;  1D3Y A;  4HAM A;  2QSH X;  2YVH A;  4IXA A;  4MO7 A;  5D8K B;  4BHP A;  2EPF A;  3F8C A;  2BHY A;  2DQL A;  4MQV A;  2QGU A;  3FIS A;  4XSZ F;  2LKP A;  3DPT A;  3ZQQ A;  1W36 D;  1RKT A;  3KIO A;  4HF1 A;  4IQJ A;  2RAS A;  1OYI A;  3RJP A;  5EG0 A;  3L09 A;  2VJJ A;  2L2O A;  3PUF A;  3PL8 A;  4WXH A;  2M45 A;  1IRF A;  3PM1 A;  3PSF A;  2I8D A;  1NHA A;  1WZ2 A;  4KMF A;  3QU6 A;  3KEY A;  3BQY A;  3DKY A;  2NX4 A;  3A02 A;  3C2H A;  2GAU A;  1GT0 C;  2LK2 A;  4CXF A;  2Y0M A;  3ISP A;  2UXO A;  1I5Z A;  4B09 A;  3H0G J;  1ORK A;  5CVI A;  2I5U A;  1E3H A;  2GUH A;  3VVX A;  3FDY A;  3SWH A;  1BIB A;  3HG9 A;  2VBY A;  3COL A;  2JZY A;  2WY7 Q;  3AG4 H;  5LFA A;  3DTK A;  3I56 I;  1OCT C;  3GTM J;  1HQC A;  4Q48 A;  1DU6 A;  4IRG A;  4OIN F;  4G7H F;  3CDH A;  3HZJ A;  2ESN A;  2ICW G;  1ZRE A;  4XID A;  4OIO F;  2WB1 N;  5JFR A;  1BIA A;  2DPD A;  1K7A A;  2FOW A;  2QBY B;  1V54 H;  1Z6T A;  3GZ5 A;  1JKQ C;  4MXM A;  2JUG A;  1O7F A;  2MG4 A;  4YIR X;  2HPM A;  1V4R A;  3LST A;  5EEG A;  3MKL A;  2HDW A;  5HAW A;  3RI4 A;  2L5Q A;  3LA7 A;  3MZ8 A;  3ZQC A;  1JUM A;  3VFZ A;  4M71 A;  2ZKZ A;  4M6V A;  2REK A;  2V9K A;  2G9W A;  2O3F A;  2G7H A;  2QSF X;  4O6J A;  1D0X A;  3W6J B;  5EG0 B;  2Z2S B;  2H8R A;  4YG2 F;  4AWX B;  2O7O A;  3BCG A;  2EFO A;  3EUH A;  3FK6 A;  4BY7 J;  4RGU A;  2D1H A;  3BHQ A;  1RR7 A;  4A3E J;  1MBJ A;  3J81 Z;  3UR3 C;  1WVR A;  3OV8 A;  4HDV A;  2CV1 A;  3GFM A;  4NNJ A;  2QQ8 A;  4F92 B;  4RGR A;  4UUV A;  3KZ9 A;  3TDU C;  2GXB A;  2HTJ A;  3H5R A;  3TOB A;  4Q47 A;  1MH3 A;  2E5Z A;  2XAG A;  1OLT A;  3K70 D;  2BY0 A;  1ETW A;  2HDD A;  1IRG A;  2FBI A;  3JRG A;  1P4W A;  4B44 A;  3GYH X;  5FKN A;  3RKW A;  4E4H A;  2GA2 A;  1XX5 A;  3A0B C;  3E6M A;  5LGT A;  1UHS A;  5AQC A;  1BR2 A;  1A5J A;  4UY8 I;  2VLA A;  2Z1D A;  4M3D A;  4AD9 A;  1XCV A;  4LOC A;  4ENM A;  2AS5 F;  2E1M B;  4LMY A;  4ENK A;  2M30 A;  3K10 A;  4NB5 A;  2X1D A;  5K1Y A;  1R4N B;  3W3C A;  3A01 B;  2FBK A;  3HTI A;  2DTZ A;  2OD5 A;  4A2U A;  1BI2 A;  2FQ4 A;  2HGC A;  2ZO4 A;  1TQM A;  1FJL A;  2CMP A;  5B66 C;  3G7R A;  3AL0 B;  2JMW A;  3HOS A;  1EV7 A;  4EJW A;  4G94 A;  3SYT A;  4BE0 A;  5CYV A;  1IN6 A;  2JRM A;  2AQF A;  2FUG 2;  2CFX A;  4OD4 A;  1F4K A;  1LJ9 A;  2BYV E;  5E1Z B;  3LSG A;  2R7X A;  3RPU D;  4C3J J;  1Z9C A;  2CQX A;  4KIG A;  3HOW J;  2GZW A;  3FXK A;  2MD5 A;  1KU7 A;  2M2E A;  4YFN F;  1O3T A;  3CCU I;  4FCY A;  2F4I A;  4XRM A;  4WF2 A;  3OL3 A;  2L3D A;  2VQC A;  2IT0 A;  1OR7 A;  4ZJZ A;  1JTY A;  4BHB A;  1T33 A;  2RQP A;  3LFU A;  3SZT A;  4XMY A;  1WSU A;  4AC6 A;  4KIS A;  3CCR I;  4E70 A;  4H0E A;  1MMA A;  1SD6 A;  3J81 K;  1DGR M;  4KNY A;  2DA5 A;  1MIJ A;  2L9S A;  3ABK H;  3HKZ A;  4A12 A;  1YIO A;  3O2P E;  4TV7 A;  3OIP A;  4U0V A;  1SVM A;  2CQQ A;  2M0C A;  1D5V A;  3L2Q A;  3J7Z I;  4Y7N J;  2XRO A;  1SMY F;  1LDK B;  3F8N A;  2OZU A;  1D0Y A;  4A0Z A;  1WH7 A;  3OSF A;  2KRF A;  3OYH A;  3QU3 A;  2V7F A;  1YX3 A;  2HVS A;  5IYB J;  2JUC A;  3EQL F;  1GV2 A;  2L4M A;  2VBZ A;  4BXU A;  5EF6 A;  2VAS A;  2QA4 I;  3CZ6 A;  1KA8 A;  5DEQ A;  5D5X B;  1LFU P;  2GBY A;  2NYX A;  4IHY A;  3AL0 C;  4JKZ A;  5F0H A;  2VJ4 A;  2F2E A;  5HLI A;  1JGS A;  2XPW A;  3CC7 I;  1TBX A;  4V2F A;  1B72 B;  4P9F A;  2Q8K A;  5IP9 J;  3V8J A;  3FZV A;  2W4S A;  3GFJ A;  4ZYG A;  5BMZ A;  3K4L A;  3KCC A;  1PUF A;  5IYD J;  4AUX A;  3EPZ A;  1T8I A;  3HYI A;  2B9S A;  1N77 A;  2OTL I;  1ETK A;  1TWG J;  3D5R C;  2MBF A;  3BR1 A;  1KYW A;  3E5Q A;  3PNY A;  2XPU A;  4QWQ A;  3OYI A;  2XAS A;  3L7W A;  2ZC2 A;  2R7V A;  1FYK A;  2JN6 A;  3N4M A;  3GTL J;  5IOY A;  1RUO A;  2YVE A;  2KRC A;  4EVI A;  1R7J A;  1GUU A;  5K5Q A;  1ZH5 A;  1I6X A;  1YW8 A;  1W0U A;  3H35 A;  4KA4 A;  5J6X A;  1JUS A;  1AHD P;  5DYM A;  1MBH A;  4IHT A;  4EM2 A;  4KIT B;  2QKO A;  3HRT A;  1TWA J;  5KCM A;  3VW0 A;  1T98 A;  4C2U A;  2W7N A;  3COA C;  1JUP A;  2LFB A;  2VXD A;  3DKW A;  5J47 A;  3B73 A;  2FSW A;  1HKS A;  4DVY P;  2QKL B;  3QP5 A;  2L54 A;  1VQ7 I;  1GV5 A;  2HVR A;  2ELJ A;  3FHZ A;  1U0J A;  1V5F A;  2OER A;  5E3M A;  1QO0 D;  3HSF A;  3JCU C;  5L3F A;  3FXJ A;  2V57 A;  3R4K A;  5GAG J;  4JK1 X;  4C9Y A;  1R71 A;  4J00 A;  1H89 C;  4C3H J;  3KP5 A;  3OR2 C;  1XB4 A;  1L3L A;  2LY9 A;  3Q0U A;  3WGG A;  1K4T A;  2A69 F;  1WJF A;  2DMT A;  3JTH A;  2OU2 A;  3LQR A;  3QWL A;  3QYE A;  3I59 A;  4OIQ F;  1VND A;  2VOP A;  2FJ1 A;  1ZK8 A;  1POG A;  3RSN A;  3QOE A;  4LFU A;  3VYR B;  1X4O A;  2W82 A;  3ZMD A;  2MA3 A;  4M3E A;  1U5T A;  2MYS A;  1AKH B;  4IOC F;  3MD2 A;  1X1C A;  2F5F A;  3G6E I;  1O3Q A;  4Y15 A;  3HTH A;  4L9N A;  1S7O A;  2GQQ A;  1WWX A;  2BXY A;  3EUK L;  2VKV A;  4KN4 X;  2VUM J;  1S5L C;  3WTY C;  3OOU A;  3J7A O;  4XLC A;  1X58 A;  1X2N A;  2DCE A;  1XD7 A;  2GIZ A;  3SEQ A;  1VQM I;  2OQR A;  2NRA C;  2RV8 A;  3N97 A;  1WPK A;  1ERD A;  2D6Y A;  4RLF A;  3TO6 A;  4Y4R A;  2LBF A;  1F5T A;  3IUO A;  3G3Z A;  1LQ1 A;  4HX4 A;  5F64 A;  1MSF C;  2Z3Y A;  1ENH A;  4HF2 A;  2JQ7 A;  1J7K A;  2HS5 A;  4XLF A;  3CCV I;  1BR1 A;  2GEN A;  1I1G A;  2IA2 A;  3ZMZ A;  4GCL A;  3CCJ I;  1LB2 A;  2Y30 A;  3SFI A;  3VW2 A;  3HGY A;  1FEX A;  5DDG A;  1G8X A;  2HQR A;  2DBB A;  1K78 B;  2XHK A;  1NH3 A;  3K6G A;  3ZQ7 A;  2DFH A;  3DPJ A;  1IDY A;  3GFL A;  1YS6 A;  3CMY A;  4B43 A;  2PBI A;  3IL2 A;  1P9Q C;  3H9J A;  3OMY A;  4XLA A;  1U3E M;  1YIT I;  2K4J A;  3M4O J;  2Y48 A;  4M6X A;  4JL3 A;  2OQG A;  3ELK A;  4HX8 A;  4LJZ F;  3D1N I;  1ZHF A;  3ZQI A;  4BXF A;  2H27 A;  4W1U A;  3WTS C;  2WAQ N;  5D5V B;  3TKY A;  2HWV A;  2ZY9 A;  4BXX J;  2KPM A;  5FD6 A;  2E1O A;  3S1M J;  2CUJ A;  1S7E A;  3OYC A;  1G59 A;  3V42 A;  1VQ9 I;  5L3E A;  1T2K A;  5IT9 K;  1FTT A;  2OUM A;  2ZJ2 A;  2XRN A;  4PXI A;  1MMD A;  4HST A;  2KDZ A;  2LOO A;  5B1B H;  3K4K A;  3WHC A;  4Y3O A;  4IRI A;  9ANT A;  3GZ6 A;  2JA2 A;  2XAU A;  2FU4 A;  2UXU A;  3VYU B;  3T1B A;  3QAH A;  1YOV B;  3ZN1 A;  5ERI A;  4DNC A;  2M4K A;  3IH2 A;  4EM1 A;  3F0C A;  4GFB A;  2HYF A;  3ON4 A;  4I02 A;  1UG2 A;  4ZZL A;  1R00 A;  2ZOZ A;  3FX3 A;  3HEF A;  4A0X A;  2MH9 A;  4ZYE A;  4BQA A;  1ZYR F;  5L3B A;  2Y0S N;  2YSR A;  3E6B A;  3HTU A;  3H0D A;  1SFX A;  1R5I D;  2MH2 A;  4QTR A;  3VOE A;  2R3S A;  3LA3 A;  4M9Z A;  4DW6 A;  2LNB A;  3HTA A;  2Z16 A;  1WQ2 A;  2MW8 A;  1Y8R B;  3IH3 A;  5K5O A;  3S2D J;  2YS9 A;  3S2H J;  1TWC J;  3SEZ A;  5FRM A;  3BG7 A;  4OMY A;  4K2E A;  2TRT A;  3IKV A;  3H9G A;  3OS0 A;  3KZY A;  2OF7 A;  3DQV C;  4XSX F;  3I0T A;  3ZOB A;  4XN0 A;  2VOO A;  4I98 B;  4BKX A;  4CCL A;  3Q5F A;  1IDZ A;  2OBP A;  2VT2 A;  2LD5 A;  1EH7 A;  1LNW A;  4ON0 A;  1Z0X A;  1HA8 A;  1P4X A;  1HXD A;  4N4N B;  2XF5 A;  2X6X A;  1ULY A;  3GBG A;  2ISZ A;  1EH6 A;  1RKW A;  2CQ7 A;  2IAI A;  3BC8 A;  4A3L J;  3GEZ A;  4XLP F;  1FLI A;  5HS7 A;  1PYV A;  1GHC A;  2XGE A;  5DUI A;  1YFH A;  2DTR A;  3BCB A;  5K5R A;  3W2V A;  3SJM A;  4C30 A;  1JKO C;  1Y39 A;  3GTQ J;  1SFK A;  1IUF A;  3E97 A;  2BOL A;  3F9K A;  3L00 A;  2FMY A;  4LIU A;  2X51 A;  2ME6 A;  2CO5 A;  2ESH A;  5TRD A;  3MKW B;  4F55 A;  3MFK A;  1VQO I;  4IKF A;  5FO5 A;  2D1V A;  2G3B A;  2XGD A;  4FAS D;  4N4O B;  3J7Y J;  1WHU A;  1MW7 A;  2RGV A;  4QPO A;  2OTJ I;  3WTZ A;  3GVA A;  2FA5 A;  3HL2 A;  4I99 C;  1Z05 A;  4L9T A;  2PFV A;  5HSZ A;  3HOZ J;  1JI8 A;  4DGW B;  5EEA A;  2R7O A;  4S0H B;  3IWZ A;  3S2W A;  3K2A A;  1BI1 A;  3HB9 A;  5IT9 Z;  4PSW A;  4RB0 A;  1RC9 A;  1UHW A;  1H9G A;  4RGS A;  3HPG A;  1PP8 F;  2YU9 J;  2QIB A;  2M8E A;  1HF0 A;  2O8K A;  3L9F A;  3OYK A;  3ABU A;  2E2H J;  4XLE A;  4DIQ A;  3BG9 A;  3HSR A;  2EA4 A;  4UXN A;  1MSE C;  1BJA A;  1IJW C;  4BQO A;  4ESJ A;  1WI9 A;  4LK0 F;  3NS4 A;  1Q1H A;  4A0Y A;  5FKM A;  4OWR B;  5DAJ A;  2ACJ A;  5J1Y A;  2IP2 A;  2KIU A;  1EJ9 A;  2LF8 A;  1FP1 D;  5GTI C;  3VW1 A;  3IRR A;  3ZN0 A;  3Q0V A;  2HZT A;  1YRN B;  1R1V A;  3ANG A;  1YS7 A;  2A3S A;  1MMS A;  1J59 A;  2ZFW A;  2MC3 A;  2DOE A;  2CU7 A;  3S1R J;  1E0E A;  3CES A;  2HTS A;  3BZC A;  3GCM A;  1AKH A;  5C4X J;  1ZLJ A;  5J1R A;  2H6B A;  3BOQ A;  3E0J B;  2E34 A;  4AYB N;  2EIK H;  1ODD A;  2VPR A;  2EZI A;  2HQ5 A;  2VJI A;  3DCF A;  1T6S A;  2NP5 A;  3LSH A;  2JWT A;  3H5A A;  3S93 A;  4CYC B;  3I59 B;  4UVB A;  2F5C A;  3PO2 J;  2KT0 A;  3OYA A;  4KIF A;  2KKO A;  2W24 A;  5FLV A;  1MH4 A;  1GVJ A;  1TL8 A;  3NRV A;  2Y2Z A;  2R7S A;  4EV0 A;  1X1P A;  5HNH A;  4FT8 A;  1R49 A;  3RPQ A;  5ICF A;  2I10 A;  3SZP A;  1YTY A;  4YRV A;  1PJR A;  2X0L A;  2DN0 A;  3HUG A;  3DPL C;  4AM3 A;  3PUB A;  4XLH A;  3L1P A;  3JRC A;  3VOK A;  1TP4 A;  1MNE A;  4M9S A;  4LG0 A;  4ESB A;  1QHH D;  1W1W E;  1OCR H;  2XF7 A;  3M8J A;  3ESW B;  3DWL E;  2IS2 A;  1U6G A;  2PMZ A;  3VOX A;  2CYY A;  2O03 A;  5CJ9 A;  1OPC A;  1N78 A;  3BTI A;  1FYM A;  2ZSI B;  4CA0 A;  5LHG A;  2O9L A;  2G7L A;  3H3Z A;  1DGW Y;  4P5O A;  3KYC B;  1MND A;  2FX0 A;  2NS7 A;  2RN7 A;  4V2G A;  4YEJ A;  4JNN A;  3OSG A;  2CQK A;  1BI0 A;  2R7D A;  2HR3 A;  3HXL A;  3K4J A;  3U21 A;  5DTD A;  3IC7 A;  4PUS A;  3QYB A;  1KU9 A;  3QOD A;  2XRL A;  3UNG C;  3GF2 A;  2O5R A;  2A68 F;  3JRI A;  3G73 A;  4BEH B;  3GTG J;  4GXO A;  2EB7 A;  5M5Y J;  2GXA A;  2CUF A;  4F93 B;  1V3F A;  3EYI A;  4WIB A;  3WGH A;  4C2T A;  1RET A;  1LVA A;  2EV5 A;  1F36 A;  4YFK F;  3CLO A;  1J09 A;  3CDI A;  2KQR A;  4GCK A;  3WTU C;  2A6H F;  1XMX A;  2CW0 F;  2WTE A;  1RPW A;  2JA8 J;  3LWF A;  4RA2 A;  2DDB A;  2XAF A;  3IWF A;  4HLY A;  1IXC A;  1EKE A;  2ELK A;  4I76 A;  4U0Y A;  1FBU A;  1MD0 A;  3IHU A;  3CC4 I;  4AF5 A;  4BBR J;  5CVU A;  2L01 A;  2PMH A;  3CJT B;  1LVK A;  1Z91 A;  2FEZ A;  2P6S A;  2E1M C;  4CCN A;  5LHI A;  4R8H A;  3RQI A;  1TTY A;  2DO7 A;  3TP0 A;  2DG7 A;  4ACI A;  1DPR A;  2X6W A;  4BE1 A;  4MNU A;  2ZFU A;  3HRU A;  2DYS H;  3ON2 A;  4PJJ A;  3BG6 A;  4AVZ A;  2R7W A;  4XN3 A;  2VKE A;  4B3A A;  4CCK A;  2P5V A;  3NPI A;  4IRH A;  3LSK A;  1G4D A;  2CRG A;  4UB8 C;  1IW7 F;  2VE9 A;  1K78 A;  1R23 A;  1P7J A;  1JHH A;  3IKT A;  3BY6 A;  3OYF A;  3NAU A;  3I55 I;  4CZZ A;  5JLX A;  3ZP5 A;  2LY2 A;  4BUP A;  2DG8 A;  1I1S A;  4MEY F;  4C2M A;  3H1C A;  5TGT A;  1X2M A;  2LRE A;  1F43 A;  4A3C J;  2MLG A;  2LBF B;  3P9K A;  3WTT C;  4DOZ A;  3VPR A;  1IF1 A;  2EH3 A;  2XGX A;  3BZ6 A;  1YHQ I;  1BL0 A;  1OMI A;  4W97 A;  3KZI C;  1O7L A;  1W7P D;  2B0L A;  5F0C A;  4G7Z F;  4Y13 A;  5FLM J;  1LFP A;  3CJQ B;  4R1H A;  4C3I J;  3W2W A;  5FGL A;  3MEX A;  3LMM A;  4P55 A;  3GZN B;  1T39 A;  1CF7 B;  4L18 B;  3BR0 A;  2VXZ A;  1DU0 A;  3BNI A;  4O5V A;  3RZD J;  2Z9O A;  1YIJ I;  3M1C A;  3BWG A;  3R6S A;  2MAB A;  2QF7 A;  5EDN A;  1R5G A;  2M7A A;  4RBO A;  3T8R A;  2NNN A;  3TDZ C;  2M87 A;  1REP C;  1Z7U A;  3EGQ A;  1BR4 A;  4RM3 A;  3K70 C;  1AU7 A;  1C0W A;  3KP3 A;  1QHG A;  2GWR A;  5HDG A;  5LEJ A;  2KIM A;  3QOP A;  1LKX A;  1LE8 B;  2AHQ A;  2DK8 A;  4DQ2 A;  1NK2 P;  5D8L B;  1ZTR A;  2K86 A;  3LFK A;  1MJA A;  1VF9 A;  1GLN A;  2VC0 A;  3DBL B;  5FKK A;  4CIC A;  2OI8 A;  2K9N A;  1SFE A;  3WE2 A;  3KLN A;  1ZEL A;  1XGM A;  2DJI A;  2DAO A;  3U9G A;  2DLL A;  4ZDL A;  3VSL A;  1TW2 A;  2COB A;  2ZME C;  2Y9Z A;  3CQZ J;  2XIG A;  2FOK A;  3R0J A;  1BOA A;  1ITY A;  5J8F A;  4KDP A;  2L7K A;  3E6D A;  5KAF C;  2X6Y A;  4UVC A;  2JSC A;  2CJJ A;  5FFX A;  2UWM A;  3ROU A;  3CUQ A;  4PJN A;  2F4O B;  4J01 A;  3ABT A;  3BTL A;  4D5C A;  3B81 A;  2ZXW H;  3DP7 A;  4HKU A;  2VBX A;  3CJR B;  5GP9 A;  1S29 A;  4M73 A;  3CO6 C;  3D5S C;  2KJC A;  3HOY J;  3HHH A;  2HOT A;  2JPC A;  2NP3 A;  2N8G A;  4NHJ A;  3CWR A;  2KIS A;  3TW6 A;  1X19 A;  2XUB A;  4RAF A;  2QEX I;  2DYR H;  1ETV A;  2ZME B;  5JR3 A;  5EGO B;  5D1R A;  1I50 J;  2E36 A;  1H88 C;  3OIQ A;  2V1D A;  3CCY A;  3DEU A;  3I54 A;  1TQI A;  4IVN A;  4E7K A;  4LG0 B;  4A3M J;  3BP8 A;  4PDK A;  3GUD A;  4D9J A;  1TZL A;  1G3Y A;  5F1R A;  4XKW A;  4KT6 A;  1HW1 A;  3VVY A;  3A01 A;  2V9V A;  1BM9 A;  2LVS A;  1T56 A;  3LAP A;  3NQO A;  4HF0 A;  1TT5 B;  2HDC A;  3HRS A;  5D19 A;  2UV1 A;  3JSJ A;  3KNW A;  1SAU A;  3ZMT A;  3KET A;  4BU2 A;  5DS9 A;  2HYT A;  5K7Z A;  4I01 A;  4EMS A;  3DLL F;  1ZG1 A;  3IRQ A;  4HPQ A;  1FMW A;  4ZTJ A;  1LEB A;  1N75 A;  4DYR A;  2CV0 A;  3REO A;  2K02 A;  1FPQ A;  3KLO A;  1S3J A;  2D2W A;  1OCP A;  1SFU A;  2E71 A;  3K69 A;  5CQG A;  4RAY A;  1IN4 A;  4LLL A;  4Q5S F;  3W2A A;  3IV5 A;  2EIN H;  1Y1W J;  2HI3 A;  5JVT A;  2JJ7 A;  1FNN A;  1FY7 A;  4J19 A;  1WJA A;  3J80 K;  4FTH A;  1YRN A;  5F1J A;  5HBU A;  3DTI A;  2DI3 A;  1FX7 A;  2LRD A;  2DA7 A;  3BTC A;  4I6Z A;  5M5W J;  2CV2 A;  3QPS A;  4LD5 A;  2DXI A;  3P5J A;  3LSP A;  3OWT A;  4HNV A;  1ETO A;  2ETH A;  1W5C C;  2PZ9 A;  1WRJ A;  3OYN A;  3GTP J;  2DJN A;  5J3L A;  3KYL A;  4A5M A;  2DMQ A;  4IQ4 A;  3F21 A;  4ZH4 F;  5K7H A;  5JHU A;  3PIO F;  4MK6 A;  3M9A A;  1B4A A;  5CQE A;  4Q4Z F;  3S3O A;  2IW5 A;  1U9N A;  3E7L A;  5FJ8 J;  4GDF A;  2ISY A;  2EK5 A;  3BR3 A;  3IH4 A;  2K85 A;  3QPH A;  4Z6Y A;  4ZTF A;  2G7G A;  3TQN A;  1IN5 A;  4E7Z A;  2BGC A;  1WH5 A;  2ZME A;  2W53 A;  3PFY A;  2ZJP F;  3G71 I;  3ZQF A;  3LA2 A;  1YQA A;  2B7E A;  1TQP A;  4B8X A;  1CGP A;  5D18 A;  2VE8 A;  4RGX A;  2OAZ A;  1IG7 A;  1DDN A;  3RIR A;  1AWC A;  4L0Y B;  1RUN A;  4P96 A;  3JAM K;  4JBA A;  4RMN A;  2Y31 A;  2ZJQ F;  1YX5 A;  4UUS A;  3ZCO A;  3NRG A;  2R92 J;  1I3Q J;  4DYC A;  1DUX C;  4D0P A;  2W48 A;  4BYY A;  2HVQ A;  2R7Z J;  4M3G A;  3OIO A;  2FNP A;  4LB5 A;  1UI6 A;  1UI5 A;  3CCS I;  3I71 A;  1OKR A;  3WTX C;  2P0W A;  1UZC A;  1KU2 A;  1X3U A;  4ENN A;  1K79 A;  1A04 A;  1UMQ A;  3MQ0 A;  4UHT A;  5D5U B;  1RR8 C;  3PO3 J;  2M3A A;  2W57 A;  2W00 A;  3BR6 A;  4NC6 A;  1E3O C;  1DP7 P;  4XR6 A;  4BS9 A;  2B3W A;  1VQL I;  4XK4 A;  1RNL A;  4IF4 A;  3MWM A;  3CUQ C;  5C44 J;  5H2F C;  4M3F A;  2BY3 A;  2V26 A;  4BH9 A;  4ZYH A;  4EGZ A;  4OU0 A;  5FFZ A;  4A3B J;  2AXL A;  5KAI C;  2XPV A;  4NEL A;  3IAM 2;  4MHG A;  1RRJ A;  5EEH A;  3PJR A;  3LNQ A;  4AID A;  2R7U A;  2VBW A;  4JX5 A;  3OOP A;  4ITV A;  2YX4 A;  2ZBK A;  4CSW A;  2UUZ A;  3I4N J;  4Y52 J;  2QYO A;  3K1P A;  4HRI A;  1SAN A;  5IT3 A;  1NTC A;  2F4M B;  3AG1 H;  4WX9 A;  1SEU A;  4KN7 X;  1NG7 A;  2VQH A;  5FGM A;  2R7R A;  1P6R A;  3E3V A;  4L5J A;  2CQN A;  4LB6 B;  3CF5 F;  3HOV J;  2BZT A;  4RAG A;  1VI0 A;  4HZF A;  2M5W A;  3SHF A;  2OCE A;  1USS A;  2FE3 A;  1X3W B;  4M6Y A;  2P5K A;  5B3S H;  2PMU A;  2VL8 A;  4Y17 A;  1S7A A;  3WHB A;  1TLH B;  1VQ6 I;  3NWS A;  5TJJ A;  3ERM A;  4N9H A;  1JHF A;  5E8I A;  3HOT A;  1IO2 A;  4MIM A;  2LMD A;  3JR9 A;  4DZP A;  1JXS A;  5HOO A;  3E5U A;  5L3D A;  3VVZ A;  2VIX A;  2OZ6 A;  1SMT A;  1BW6 A;  3LSR A;  2KZV A;  2IBD A;  4MFD A;  2KRH A;  4GYG A;  2BY2 A;  2EZK A;  5ILV A;  2UXP A;  5E17 F;  5DUK A;  1OYY A;  5EFY A;  2COM A;  3CP8 A;  2HU9 A;  4ANJ A;  2K9L A;  4L9J A;  1Z6R A;  4L5I A;  2W85 A;  2OV7 A;  1Z21 A;  2X48 A;  1S72 I;  1BJZ A;  2E2J J;  3F3X A;  2P7C B;  2KP6 A;  2JA7 J;  4U9L A;  4E7I A;  1UG0 A;  4JX4 A;  2KMU A;  1VQK I;  4ZC3 A;  4F52 A;  2QWT A;  3HM5 A;  2RHA A;  4NDL A;  2CUE A;  2ZJR F;  2NOJ B;  3H3V K;  3JRE A;  3CLQ A;  4XKC A;  5ICE A;  4E6K G;  3I5U A;  3S3M A;  4A5N A;  3I4P A;  4LIV A;  1ZG5 A;  5CVJ A;  3ZR8 X;  3HGG A;  2RKH A;  2XGC A;  4ASN A;  3AFH A;  2V9P A;  5BS6 A;  4XKV A;  5ED4 A;  4E7L A;  1EH8 A;  5E3O A;  2H1K A;  2KLO A;  1L0O C;  3F22 A;  4A3F J;  2KIF A;  5EZG A;  1BI3 A;  5C3E J;  3WOD F;  1ONV A;  2LSO A;  3HOX J;  5EGO A;  4LG3 A;  2HOS A;  4P9U A;  3S1N J;  1YLF A;  2CG4 A;  4X6A J;  2VJ5 A;  3LL7 A;  2DW4 A;  3SXY A;  1QQI A;  4S05 A;  2XAQ A;  4ZYA A;  3HKZ N;  3TO7 A;  4IEJ A;  2ZB9 A;  3HDD A;  3HSE A;  3MZH A;  3RQ4 A;  4QIW N;  2HKX A;  3K1M A;  3K4C A;  4JX6 A;  2XB0 X;  3QRF F;  3F23 A;  3OYE A;  3FWE A;  2DFI A;  2LTP A;  3I9V 2;  3VB2 A;  3T0Y A;  2L9R A;  2QZ8 A;  5FMP A;  5K58 A;  2HYJ A;  4DZJ A;  3G4S I;  1Z67 A;  3ABM H;  1HW2 A;  3MVP A;  4KWA A;  2DT6 A;  3DFG A;  2HXO A;  4HLX A;  2M4G A;  1STZ A;  5KVR A;  5AIQ A;  4AC0 A;  4C2M J;  4D1Q A;  2BVL A;  1V5E A;  3UKG A;  2DMN A;  3C7J A;  4A3J J;  1VQ4 I;  4II3 A;  2QVO A;  2E5N A;  2WB1 A;  4R79 A;  3FM5 A;  3IAS 2;  3L2R A;  3OS2 A;  1H8A C;  3ZPL A;  3GTO J;  2IGM A;  3O8G A;  1AA7 A;  2EFP A;  3AAF A;  3CCM I;  2HKU A;  4B4C A;  2E60 A;  3BJB A;  1KQ0 A;  4BJ6 C;  3FF5 A;  3BG5 A;  3ERE D;  2WWY A;  1IV8 A;  3FXM A;  1Z3Y A;  4BY1 J;  1W4M A;  1FBS A;  1ON1 A;  1PVE A;  3MZY A;  4EAT A;  1IC8 A;  3ZMS A;  4NC7 A;  2IS6 A;  4XOT A;  4JOM A;  5C4Y A;  3OY9 A;  2UXI A;  3LSM A;  2A6E F;  4G7O F;  1K6Y A;  3KEO A;  5D4R A;  3SZG A;  5HLT A;  4A3G J;  2IS4 A;  1XSX A;  2E7X A;  4RS8 A;  3S32 A;  2VKH A;  1T95 A;  2HYG D;  1U8B A;  4X1E A;  1Z1D A;  2LG4 A;  4HX7 A;  1FBQ A;  6PAX A;  2M7B A;  4O3M A;  1XMK A;  4D7M A;  3A2K A;  3CUO A;  4GRI A;  2FBQ A;  2P7V B;  3HRM A;  3FHN A;  2VQG A;  2WAQ A;  1IXS B;  3K1N A;  2ZCX A;  2AXT C;  1LEA A;  1ZN2 A;  2WY8 Q;  3P9T A;  5IPA A;  3BTJ A;  3BLY A;  4IHX A;  2Q2E A;  4U0W A;  4OIR F;  2WAF A;  2R4G A;  1S9H A;  5ICG A;  5GTH C;  1JT0 A;  2VON A;  1TWF J;  2PJP A;  2BW3 B;  4RM2 A;  2NOG A;  3I4M J;  1FT9 A;  3TL4 X;  2X1C A;  1K4S A;  4XNF A;  2HFH A;  4AVP A;  4FX4 A;  3JRD A;  3K7A J;  3BRU A;  3D5L A;  1BA5 A;  2RC4 A;  2H1L A;  4YII A;  5J8C A;  4BHC A;  2ZXH A;  3H36 A;  4XRS A;  1BW5 A;  3FRQ A;  1IZ1 A;  1LFB A;  1WKM A;  2PFB A;  1X3Z B;  4RAZ A;  1HSJ A;  3T5X A;  3PSI A;  3HHG A;  1P92 A;  2DA6 A;  2P6T A;  1HOM A;  1H0M A;  2W1O A;  4G12 A;  2M0M A;  3A03 A;  4X0G A;  1ETQ A;  5FKO A;  3HUG B;  3PNT A;  4KIC A;  2K27 A;  5F08 A;  2VPL A;  2YPR A;  1XS9 A;  1U2W A;  4LGW A;  1YYV A;  2MC4 A;  3B6A A;  1EA3 A;  5DD4 A;  4QSH A;  1YO5 C;  3I64 A;  2DT7 B;  2XSD C;  1I27 A;  4EJV A;  5E3L A;  1W7P B;  1D8K A;  5D6E A;  1D5Y A;  3F8B A;  4EJO A;  1MNM C;  3FXR A;  3C2B A;  3MN2 A;  3SQN A;  3TBI A;  5A2Q Z;  2DMU A;  2K5C A;  1LPQ A;  2IGO A;  2Y69 H;  2JVG A;  5CKT A;  1OCZ H;  2R7T A;  4E7J A;  1X1B A;  3O6B B;  5LBQ A;  2R5Z A;  3Q9S A;  2DFE A;  3GTK J;  3S14 J;  4ZDO A;  3MKY B;  1UAA A;  4KMU X;  3Q3S A;  4FET A;  4XM3 A;  2R93 J;  2LF7 A;  5J40 A;  3V8K A;  5GAD J;  3TP3 A;  2ZCW A;  4PJM A;  4WCG A;  3A0H C;  3RPU A;  1OIS A;  3QPT A;  1D8J A;  2J5P A;  2RDP A;  1MBF A;  2E19 A;  5IP6 A;  2LC2 A;  4IJA A;  1O57 A;  1DP3 A;  1OQY A;  3BJO A;  5HNF A;  1MJ9 A;  2Q24 A;  4BEH A;  3DBH B;  2VT3 A;  1HLV A;  2Z33 A;  2EV0 A;  3ZQG A;  5LRR A;  3WE3 A;  2PJR B;  5BNG A;  2PJR A;  4HV5 A;  3FM3 A;  3R0A A;  2WV0 A;  1FSH A;  3VUQ A;  1WJE A;  2NVT J;  2UXX A;  3PQK A;  3V78 A;  2VN2 A;  1PUE E;  3X2Q H;  2OJE D;  4HBL A;  1VFC A;  3FXU A;  3LSI A;  3WU0 A;  2GM4 A;  5KNL A;  1MBG A;  3S5R A;  2L02 A;  4GFL A;  1W5T A;  5A2Q K;  5F27 A;  3ZRG A;  4E7H A;  3TO9 A;  2H94 A;  2V6E A;  2Y0S A;  2GFN A;  3I53 A;  2XAJ A;  4UV8 A;  5DD8 A;  2DOA A;  2WAD A;  3QPL A;  5DCF A;  1WGX A;  2L7M P;  2LLK A;  4GGG A;  2OC6 A;  4MQ9 F;  1QU3 A;  1Y8Q B;  4IOA F;  3F1B A;  3NXC A;  1I3A A;  2IA1 A;  3BJ6 A;  1FIP A;  3I58 A;  3K4M A;  4YIF A;  3OS1 A;  1ZLK A;  2PI0 A;  1FZP B;  2PMZ N;  2ECB A;  3G2B A;  1JKR C;  1XC5 A;  1YE9 A;  3P9C A;  1IUY A;  3FMS A;  5F0F A;  2P8T A;  2DDA A;  5E1W A;  3BR2 A;  2BXZ A;  3VP5 A;  4ICH A;  2CH0 A;  2EFN A;  1MBE A;  2PG4 A;  2K9S A;  2O7T A;  3CF2 A;  4XIC A;  2X1E A;  1E3P A;  2ECC A;  3SFZ A;  2ZXI A;  2HOA A;  1Y1V J;  4BDY A;  1UFM A;  3BG3 A;  5FLX Z;  5BPD A;  3HTJ A;  4G6Q A;  4OD5 A;  2KZG A;  4RB1 A;  4NUB A;  1XTA A;  3FXL A;  1D1C A;  2IS1 A;  2XVC A;  5CPR B;  1MMG A;  3GZI A;  1SC7 A;  5LRS A;  4B3X A;  2NVY J;  4EEF G;  1GDT A;  2G7U A;  3AKZ A;  5E8G A;  1VQP I;  4B1R A;  3QKX A;  4NQW B;  3EET A;  3CTA A;  2BBY A;  4FHT A;  4BJ5 C;  1A36 A;  1W36 C;  2K9M A;  1B9M A;  1EF4 A;  2EBI A;  3OYB A;  1ZR4 A;  2F5V A;  3JW4 A;  1LE8 A;  1J75 A;  1OFC X;  4UUT A;  1U5T C;  2ZOY A;  1NK3 P;  4CGZ A;  1ETY A;  2CFO A;  2FBH A;  3S8P A;  3V7R A;  2BW3 A;  2E7W A;  3KX2 A;  4Z2Y A;  4FX0 A;  3E7Q A;  4IHW A;  4OAZ A;  2UXH A;  2NXN B;  4FIS A;  2ZCN A;  2X6O A;  1SD4 A;  3CUQ B;  2NS8 A;  4BL0 B;  1XCB A;  3O60 A;  3P9I A;  2NS0 A;  2XV4 S;  3V6G A;  3DEW A;  2R7Q A;  5KHD A;  1B6A A;  3IUV A;  2IU5 A;  1XSV A;  1FOY A;  5E3N A;  1QNT A;  4CYD A;  3S1Q J;  2HZD A;  1E17 A;  4L5E A;  1R6R A;  2QLZ A;  2E2I J;  1WJ5 A;  4I0A A;  4OOI A;  3M1E A;  1QVT A;  2DU9 A;  4CCO A;  2YVX A;  3SDB A;  4FE7 A;  4ESF A;  1G2H A;  2DFF A;  3FXO A;  4F91 B;  1O4X A;  4RB3 C;  1YJ9 I;  2WUI A;  3PNV A;  2QQ9 A;  5M5X J;  4GCT A;  3ECH A;  5CLS A;  2UXN A;  1CF7 A;  1VQ8 I;  1SD7 A;  5IY5 H;  3HOU J;  1D1B A;  2X4H A;  4HDU A;  3M3Y J;  3FBI B;  3ONQ A;  5HDN A;  2WA0 A;  1UB9 A;  1KYZ A;  2D5V A;  4N9I A;  4XLN F;  2ZNZ A;  4IRV A;  2V79 A;  1J0R A;  3B6C A;  4MGR A;  1QA6 A;  4ME9 A;  1QBJ A;  1XMA A;  2DA4 A;  2XDV A;  5LEK A;  1KGS A;  3HPH A;  2GLO A;  2HXI A;  3VTI A;  3RKQ A;  2Q0O A;  4BGD A;  2A5W A;  3EDP A;  3ZQH A;  5M3M J;  2AQE A;  1A35 A;  4DBQ A;  1M1E B;  4PGH A;  5JLW A;  3KFW X;  5F04 A;  3HE0 A;  1FYL A;  1WFX A;  1E2X A;  2L4A A;  2ZSH B;  3RTR A;  3WG7 H;  4ENJ A;  3S3N A;  2CGP A;  3H3U A;  4LLG F;  4IHS A;  1QRY A;  3H9Q A;  2EFW A;  2GOX B;  4YZE A;  2R5Y A;  2QSG X;  1FC3 A;  2IPQ X;  4RLQ A;  3GO5 A;  1K83 J;  3MNL A;  3ZGK A;  2A5Y B;  1D1A A;  3G1O A;  2QM3 A;  2DOD A;  4AU7 A;  1GXQ A;  2FNA A;  4A3D J;  3F8F A;  1IGN A;  2DA2 A;  2MFZ A;  3BR5 A;  1Z77 A;  5D6F A;  1U8R A;  2STT A;  3VOD A;  2X9D A;  3K4B A;  5IOZ A;  2Z99 A;  2C6Y A;  4HNT A;  2DPU A;  2HNH A;  2KHM A;  5GPC A;  4LIT A;  4EJU A;  3GTJ J;  1HBX G;  1I6H J;  1LDD A;  1G3W A;  4PGG A;  1VQ5 I;  1GXP A;  4M9X A;  4YEL A;  5BPI A;  3U2R A;  2DT5 A;  3IP4 B;  2JA5 J;  3TOA A;  5HS9 A;  3ZMV A;  1HC8 A;  3M7G A;  1WJB A;  4A3I J;  3L2V A;  1A6I A;  3LSJ A;  2LR8 A;  5EYR A;  3L2U A;  2UZK A;  2IRF G;  3H5N A;  3DPU A;  3JTG A;  4NQW A;  5JVG F;  1SAX A;  2A2F X;  1TT0 A;  1KQ8 A;  2NVQ J;  2FQ3 A;  1G6N A;  3NEU A;  1YJW I;  2B1E A;  5DCM A;  2RRE A;  3DBR B;  3GFI A;  2IXS A;  2R7F A;  2XKP A;  2QKM B;  4WWC A;  2ME0 A;  1B8I A;  2VI6 A;  3J80 Z;  3RZO J;  5GAH J;  1OYW A;  4ZDP A;  1ZRD A;  3QBM A;  1ON2 A;  3AG3 H;  1V5G A;  1P7I A;  2YU3 A;  4XBF A;  3JRB A;  1UCR A;  2A07 F;  2IGN A;  1Y0N A;  3VEP A;  3S16 J;  5JI6 A;  1BOB A;  1OCC H;  1QZZ A;  1UEL B;  2CW8 A;  3V4G A;  2LH9 A;  3HJE A;  3CMM A;  3KEQ A;  3NWT A;  1WCM J;  2LY1 A;  2PEX A;  2DQR A;  1TC3 C;  5ILU A;  2CWE A;  1JJ6 C;  4MTD A;  2V6C A;  2RVC A;  3TW7 A;  3E5X A;  2ELH A;  5ILS A;  1IN8 A;  2LKS A;  2F5E A;  3RYP A;  4PFP A;  1X4P A;  2E1N A;  3HIM A;  3F6O A;  2K40 A;  4G8X A;  2HQN A;  4WXD A;  1T0F A;  1ZKG A;  4EM0 B;  2GA1 A;  4EGY A;  4GO1 A;  2A05 A;  1Y6I A;  2JT1 A;  1ZAR A;  3A1Y A;  3TGN A;  3OYJ A;  3RYR A;  3PAS A;  2RQQ A;  1G3T A;  1IRZ A;  1SD5 A;  2OA4 A;  4I0B A;  3ABL H;  3U1K A;  2LYC A;  2WC2 A;  3JRF A;  1HCR A;  4AYB A;  3J7A Y;  2QEN A;  1IN7 A;  1QGP A;  2O0Y A;  3R61 A;  4PCQ A;  1P2F A;  3DF8 A;  4MTE A;  3EUH C;  1WI3 A;  3AQS A;  5L3G A;  3CJN A;  1LDJ A;  1B1B A;  3R60 A;  3TMO A;  5GAE J;  3BPX A;  3MAJ A;  2EZH A;  4OMZ A;  5L3C A;  3S17 J;  2BE5 F;  2JTV A;  2VKD A;  4GYI A;  4BQQ A;  2MLK A;  3KP6 A;  1OR7 C;  3BT9 A;  1N25 A;  2LDU A;  3QP6 A;  4NN1 A;  4AIK A;  2EA2 A;  3KP2 A;  3AQT A;  5ICC A;  1BC8 C;  3CDL A;  3FMQ A;  2LKX A;  2DOF A;  2H8W A;  2JVH A;  2PN6 A;  5HOD A;  2NAZ A;  4I7H A;  3HIF A;  4BAY A;  3PIP F;  2R5Z B;  3JRH A;  4HOB A;  5EJC A;  4UV9 A;  1O3R A;  4G6D A;  4HA8 A;  4MEX F;  2CUZ A;  4HSR A;  3L2W A;  1HKT A;  1QVU A;  2W25 A;  4XOR A;  2IJL A;  3D0S A;  2RNG A;  4ZYD A;  5H9T A;  1R1T A;  1Q1V A;  4CHU A;  2Z5U A;  2HOE A;  3CCQ I;  1MBK A;  4M3B A;  4PJL A;  4CZC A;  1TNT A;  5J1U A;  4IZZ A;  2GIV A;  2E35 A;  4BE2 A;  3FKI J;  5HLH A;  3GLX A;  4D7N A;  3KYD B;  2F5D A;  3H92 A;  4KJZ A;  2DA1 A;  4XRS G;  4CGR A;  3MMY B;  1X1A A;  1IAW A;  3T8T A;  4UDS A;  1R1U A;  2L7Z A;  3GWZ A;  2XC7 A;  2PX9 A;  1IRX A;  2XB5 A;  3EUA A;  3LHQ A;  3LQQ A;  2X85 A;  3GX4 X;  3LJL A;  4DBR A;  2K7L A;  4CYC A;  4PK4 A;  4BAC A;  1OCO H;  1WJC A;  3BJA A;  1XN7 A;  3P7N A;  1SVO A;  2V4J C;  2F6C A;  1MZB A;  4N0B A;  4LLN A;  3C07 A;  1RIO H;  2V1X A;  2CW7 A;  3KKC A;  2KL4 A;  3ASO H;  3KP4 A;  1HDP A;  3KZZ A;  1MDM A;  3DU6 A;  3F72 A;  3BRO A;  1G3S A;  2CS3 A;  1CQT A;  1JTX A;  4M74 A;  3MKZ A;  2FRH A;  4A3K J;  5D4S A;  3N05 A;  4EQQ A;  3DLA A;  3G1L A;  1ZRF A;  2NVX J;  2BEO A;  3RKX A;  1UHM A;  4MFE A;  1NG6 A;  2R0Q C;  1DPU A;  2YR2 A;  3V7C A;  2EQR A;  4HG2 A;  2NVU B;  1YI2 I;  4G9Y A;  2B63 J;  2IGK A;  3NI7 A;  2YUS A;  5LD2 C;  3HC7 A;  4A6E A;  2K3P A;  4HW0 A;  5HS8 A;  5H20 A;  3G56 A;  5FHP A;  1SVL A;  2VOD A;  3KE2 A;  3ANP A;  2WAE A;  1MDM B;  3CMA I;  1T38 A;  2W84 A;  5HDK A;  3W6V A;  1XG1 A;  3CD6 I;  2Y75 A;  2E1C A;  3BDD A;  4I2O A;  1ZGA A;  3OYM A;  3QYF A;  1S8N A;  1GVD A;  4KYW A;  2BV6 A;  1WJD A; 
#chains in the Genus database with same CATH homology
 1GV2 A;  1X2M A;  2DA6 A;  4D5F A;  4A3C J;  1F43 A;  1LFU P;  2GBY A;  5IYC J;  4IHY A;  1HOM A;  4JKZ A;  3VPR A;  5F0H A;  2EH3 A;  4G12 A;  3A03 A;  1APL C;  1BL0 A;  3HBL A;  4W97 A;  1ETQ A;  5FKO A;  5F0C A;  1FTZ A;  2XDN A;  5FLM J;  4UUS B;  2XPW A;  5F08 A;  1ZR2 A;  3NNR A;  1XS9 A;  4V2F A;  4C3I J;  5FGL A;  1B72 B;  5IP9 J;  3B6A A;  3BR0 A;  4QSH A;  1DU0 A;  3BNI A;  2XSD C;  1PUF A;  3RZD J;  2OPT A;  5IYD J;  5E3L A;  2QF7 A;  4AUX A;  5EDN A;  4RBO A;  3QQA A;  1D5Y A;  1ETK A;  1MNM C;  3Q0W A;  3C2B A;  3MN2 A;  1TWG J;  3TED A;  2DMU A;  3BR1 A;  2XPU A;  2QCO A;  3EGQ A;  1AU7 A;  2R5Z A;  3GTK J;  3S14 J;  2JN6 A;  3G1M A;  4JP0 A;  3Q3S A;  1LE8 B;  2AHQ A;  2R93 J;  3GTL J;  5IOY A;  2YVE A;  3TP3 A;  1NK2 P;  1ZTR A;  1R9T J;  2OI8 A;  1GUU A;  1VF9 A;  3PPB A;  3FK7 A;  5FKK A;  2K9N A;  1MBF A;  2E19 A;  5IP6 A;  1W0U A;  2MSY A;  1JUS A;  1AHD P;  1MBH A;  2COB A;  2Y9Z A;  3CQZ J;  2Q24 A;  2QKO A;  3S15 J;  1TWA J;  3VW0 A;  2TCT A;  1RES A;  1HLV A;  1JUP A;  1ITY A;  3ZQG A;  2LFB A;  1JKP C;  5EZH A;  5BNG A;  2CJJ A;  2M34 A;  3RH2 A;  3VUQ A;  2NVT J;  1GV5 A;  1SGM A;  3V78 A;  3BTL A;  4D5C A;  2OER A;  3B81 A;  5E3M A;  1VFC A;  2GM4 A;  4HKU A;  1ETX A;  5GP9 A;  1MBG A;  2V57 A;  3S5R A;  4GFL A;  3HOY J;  3BQZ A;  5F27 A;  1H89 C;  3GEU A;  2HOT A;  4C3H J;  2NP3 A;  2N8G A;  2GFN A;  3CWR A;  2LY9 A;  3Q0U A;  3TW6 A;  3QPL A;  1WGX A;  2DMT A;  3JRA A;  2L7M P;  2LLK A;  1ETV A;  3F1B A;  1IV6 A;  3NXC A;  5EGO B;  1FIP A;  5D1R A;  1VND A;  1I50 J;  2PMZ N;  3LWJ A;  1H88 C;  2ECB A;  2FJ1 A;  3CCY A;  1JKR C;  2JA6 J;  1ZK8 A;  1POG A;  1XC5 A;  4A3M J;  2LP0 A;  5F0F A;  1ZQ3 P;  3BR2 A;  4M3E A;  3VP5 A;  3VVY A;  1AKH B;  4ICH A;  1MBE A;  1SFO J;  3A01 A;  2K9S A;  2O7T A;  1JT6 A;  2QOP A;  2LVS A;  1T56 A;  4XIC A;  3HTH A;  2ECC A;  2HOA A;  1Y1V J;  2ID3 A;  5D19 A;  3BG3 A;  3CRJ A;  2VKV A;  3JSJ A;  2VUM J;  3KNW A;  3HTJ A;  3OOU A;  5FKL A;  1X58 A;  1X2N A;  2ID6 A;  1WPK A;  5DS9 A;  2HYT A;  2D6Y A;  3GZI A;  5K7Z A;  1GDT A;  4DYQ A;  2NVY J;  4EEF G;  1MSF C;  1K61 A;  1ENH A;  2JK3 A;  4DYR A;  4ABZ A;  4B1R A;  4IHV A;  3QKX A;  1JJ8 C;  2GEN A;  4GCL A;  2M8G X;  1OCP A;  2Y30 A;  3SFI A;  1EF4 A;  3VIB A;  2EBI A;  3O8H A;  3VW2 A;  2WV1 A;  1ZR4 A;  3IV5 A;  1LE8 A;  3HGY A;  1OFC X;  5CXI A;  4UUT A;  2F07 A;  1Y1W J;  2HI3 A;  3SDG A;  1NK3 P;  1FEX A;  2ZOY A;  1ETY A;  2JJ7 A;  4J19 A;  3E7Q A;  4IHW A;  4A69 C;  4FTH A;  1YRN A;  2UXH A;  3DPJ A;  4FIS A;  2ZCN A;  1IDY A;  2X6O A;  5F1J A;  3T6N A;  5HBU A;  2EZL A;  2NS8 A;  3CMY A;  3O60 A;  2DA7 A;  2G0E A;  3BTC A;  4I6Z A;  5M5W J;  2P81 A;  3V6G A;  1B8I B;  1PUF B;  3QPS A;  1JGG A;  3DEW A;  4MLO A;  3M4O J;  3NAR A;  3LSP A;  4JL3 A;  4HNV A;  3IUV A;  2IU5 A;  1ETO A;  5E3N A;  3D1N I;  4A93 J;  2PZ9 A;  3ZQI A;  3CJD A;  3S1Q J;  4W1U A;  3GTP J;  2DJN A;  2WAQ N;  4L5E A;  5J3L A;  2DMQ A;  5K7H A;  2E2I J;  4BXX J;  4MK6 A;  2E1O A;  3S1M J;  1S7E A;  1U9N A;  3E7L A;  5FJ8 J;  1QVT A;  3BR3 A;  3IH4 A;  1ZGW A;  5K7F A;  5CXG A;  4FE7 A;  2G7G A;  2AO9 A;  3RD3 A;  1FTT A;  2G7S A;  1WH5 A;  1G2H A;  4PXI A;  2DA3 A;  2W53 A;  2KDZ A;  3ZQF A;  3WHC A;  1O4X A;  9ANT A;  2ZCM A;  5D18 A;  2WUI A;  5M5X J;  1IG7 A;  4GCT A;  2UXU A;  2QTQ A;  2Y31 A;  3HOU J;  3M3Y J;  2MGQ A;  1HDD C;  3IH2 A;  2L7F P;  3F0C A;  4UUS A;  3NRG A;  3ZQL A;  2D5V A;  4GFB A;  2R92 J;  1I3Q J;  4DYC A;  3ON4 A;  1UG2 A;  2W48 A;  2ZOZ A;  3HEF A;  3B6C A;  4L62 A;  2R7Z J;  4ME9 A;  4M3G A;  3OIO A;  2DA4 A;  1UI6 A;  1UI5 A;  2Y0S N;  2RAE A;  2GLO A;  2HXI A;  2R5Y B;  4QTR A;  3RKQ A;  4DW6 A;  3HTA A;  2MW8 A;  3IH3 A;  3S2D J;  2YS9 A;  3S2H J;  4JYK A;  1TWC J;  3ZQH A;  1UMQ A;  5M3M J;  4FE4 A;  4GFK A;  2TRT A;  3LOC A;  3PO3 J;  5JLW A;  5F04 A;  2OF7 A;  2WGB A;  3HE0 A;  3BR6 A;  1E3O C;  3ZOB A;  1IDZ A;  1U78 A;  4BKX A;  4BBS J;  2LD5 A;  1QRY A;  4XK4 A;  4YZE A;  2R5Y A;  1TWH J;  5C44 J;  1OJL A;  2K9Q A;  1Z0X A;  4M3F A;  1K83 J;  5IP7 J;  2Y9Y A;  3MNL A;  1FIA A;  4A3B J;  4RDU A;  3G1O A;  3GBG A;  1RKW A;  2IEK A;  2IAI A;  4A3L J;  2XPV A;  3FIW A;  4NEL A;  4A3D J;  2XGE A;  1IGN A;  2DA2 A;  1B72 A;  3SJM A;  3BR5 A;  1JKO C;  1Z77 A;  3LNQ A;  3GTQ J;  1IUF A;  2L0K A;  2X9D A;  5IOZ A;  2DMP A;  2FD5 A;  4JX5 A;  2ME6 A;  5GPC A;  5C4J J;  5M3F J;  3GTJ J;  3I4N J;  1I6H J;  4Y52 J;  5GPA A;  1SAN A;  2G3B A;  2XGD A;  1QPI A;  3KKD A;  1NTC A;  3EUP A;  5CW8 A;  2PBX A;  1U9O A;  3HOV J;  5HSZ A;  3HOZ J;  1VI0 A;  1W0T A;  2M9H A;  5EEA A;  2JA5 J;  4S0H B;  3K2A A;  2YVH A;  4A3I J;  4MO7 A;  3HB9 A;  1A6I A;  3LSJ A;  2LR8 A;  5EYR A;  2QIB A;  2YU9 J;  1HF0 A;  2O8K A;  2E2H J;  3FIS A;  3WHB A;  3BG9 A;  2NVQ J;  1RKT A;  1MSE C;  2RAS A;  1IJW C;  5EG0 A;  4MIM A;  2ME0 A;  5FKM A;  1B8I A;  2VI6 A;  4DZP A;  3JR9 A;  3RZO J;  5DAJ A;  5J1Y A;  3VVZ A;  3QBM A;  3PM1 A;  3LSR A;  1BW6 A;  2NX4 A;  3VW1 A;  1P7I A;  3BQY A;  3JRB A;  3A02 A;  3Q0V A;  1YRN B;  2IBD A;  2LK2 A;  4MFD A;  1GT0 C;  3S16 J;  3ANG A;  2EZK A;  2UXP A;  2UXO A;  1WCM J;  2CU7 A;  3S1R J;  5EFY A;  3H0G J;  1TC3 C;  1AKH A;  5C4X J;  1JJ6 C;  1ORK A;  2GUH A;  3VVX A;  5J1R A;  3TW7 A;  2X48 A;  1BJZ A;  2E2J J;  2JA7 J;  3COL A;  4AYB N;  3GTM J;  1OCT C;  2NP5 A;  2VPR A;  2EZI A;  2HQ5 A;  1DU6 A;  3DCF A;  3HIM A;  2JWT A;  4CYC B;  4JX4 A;  2K40 A;  3PO2 J;  2KT0 A;  4XID A;  1ZKG A;  2WB1 N;  2QWT A;  3HM5 A;  5FLV A;  2RHA A;  3PAS A;  4NDL A;  1JKQ C;  4MXM A;  2MG4 A;  1IRZ A;  1MH4 A;  3JRF A;  2CUE A;  2Y2Z A;  1HCR A;  3H3V K;  3JRE A;  3MKL A;  5HAW A;  3ZQC A;  2I10 A;  1JUM A;  3HGG A;  1WI3 A;  2DN0 A;  2XGC A;  4M6V A;  2REK A;  3AQS A;  3L1P A;  3JRC A;  3VOK A;  2EZH A;  3S17 J;  5EG0 B;  5E3O A;  2H8R A;  2H1K A;  4A3F J;  2O7O A;  3BT9 A;  3BCG A;  5EZG A;  4NN1 A;  4BY7 J;  3FK6 A;  5C3E J;  3HOX J;  3BHQ A;  5EGO A;  1RR7 A;  4A3E J;  1MBJ A;  3VOX A;  3AQT A;  2HOS A;  3CDL A;  3S1N J;  2LKX A;  4X6A J;  3KZ9 A;  3BTI A;  2O9L A;  5HOD A;  3HKZ N;  1MH3 A;  2ZB9 A;  4IEJ A;  3HDD A;  2R5Z B;  2G7L A;  3JRH A;  1ETW A;  2HDD A;  2FX0 A;  2NS7 A;  4V2G A;  3JRG A;  4JNN A;  4QIW N;  3OSG A;  5FKN A;  4JX6 A;  1QVU A;  2XB0 X;  5DTD A;  1UHS A;  5AQC A;  5H9T A;  1Q1V A;  1A5J A;  2XRL A;  1MBK A;  4M3B A;  2LTP A;  4M3D A;  5J1U A;  2L9R A;  5FMP A;  4LOC A;  3JRI A;  2HYJ A;  3GTG J;  3FKI J;  4DZJ A;  5K58 A;  5M5Y J;  2CUF A;  3MVP A;  4D7N A;  4KWA A;  2HXO A;  2DA1 A;  4XRS G;  4C2M J;  4AC0 A;  3UKG A;  1RET A;  4CGR A;  1F36 A;  3HTI A;  3A01 B;  2DMN A;  4A3J J;  2DTZ A;  4UDS A;  2L7Z A;  4GCK A;  2FQ4 A;  2XB5 A;  1RPW A;  1H8A C;  3GTO J;  1FJL A;  3O8G A;  2HKU A;  3BJB A;  2JA8 J;  3LHQ A;  4B4C A;  3LJL A;  3BG5 A;  4CYC A;  3G7R A;  2ELK A;  4I76 A;  2JMW A;  4BY1 J;  4AF5 A;  4BBR J;  1IC8 A;  3C07 A;  3KKC A;  5C4Y A;  1HDP A;  2UXI A;  3LSG A;  4A3G J;  1CQT A;  1JTX A;  3RQI A;  1U8B A;  4X1E A;  4C3J J;  3HOW J;  2CQX A;  3TP0 A;  4A3K J;  2DG7 A;  2M2E A;  4ACI A;  4D7M A;  4FCY A;  4XRM A;  3ON2 A;  2FBQ A;  3G1L A;  2NVX J;  1JTY A;  1T33 A;  4MFE A;  2R0Q C;  4AC6 A;  2ZCX A;  2EQR A;  2VKE A;  4B3A A;  5IPA A;  3P9T A;  3BTJ A;  3NPI A;  4IHX A;  2B63 J;  2DA5 A;  2CRG A;  1JT0 A;  1TWF J;  3NI7 A;  2YUS A;  1P7J A;  2NOG A;  3I4M J;  2CQQ A;  2M0C A;  3NAU A;  3G56 A;  4Y7N J;  5FHP A;  3ANP A;  3JRD A;  3K7A J;  3BRU A;  1BA5 A;  5JLX A;  3W6V A;  1XG1 A;  1WH7 A;  3OSF A;  4XRS A;  1BW5 A;  3FRQ A;  2DG8 A;  1GVD A;  1LFB A;  5IYB J;  5EF6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...