3IHRA

Crystal structure of uch37
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
Knots found
sequence length
305
structure length
282
Chain Sequence
EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFAAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of human Uch37.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase isozyme L5
total genus 83
structure length 282
sequence length 305
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
A PF18031 UCH_C Ubiquitin carboxyl-terminal hydrolases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ihrA02
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 3ihrA01
4JKJA 1XD3A 3RISA 3RIIA 3TB3A 4DM9A 4UELA 3IHRA 3IRTA 2ETLA 3KW5A 2LENA 3KVFA 4UEMA 3IFWA 1UCHA 3A7SA 1CMXA 4IG7A 4I6NA
chains in the Genus database with same CATH superfamily
3MK7C 3RYIE 1OWAA 1OEDB 3L39A 3I0QA 4DUZT 3P50A 4PAGA 2OV9A 4JUYA 2CWOA 2W2UA 2W62A 3JC6C 2LSKA 2WWVA 3ZT5A 3LK2B 1FIOA 2CXLA 4B3MT 3QK6A 3ESLA 4PK6A 3N5LA 2Y6XA 2BG9C 2ES0A 2KLQA 3KV9A 4EIWA 4JI0T 4IDZA 3T1HT 5AQFB 3M3ZB 3RRWA 4BJMA 3IHRA 3LSVA 4TNWA 4CZZB 1WYBA 5J0ZA 4PFOA 2KWIB 2J47A 4I55E 5FP3A 1Y01A 1OEDA 3UU6A 1J1JA 3LK3B 4IT4A 2OLTA 1N34T 1R8IA 4CN4A 3A8YC 3AAIA 3IRTA 1L0VA 5LA6E 4BA9A 5HEJA 2VK9A 4M1PA 4DV2T 2WCAA 4TUYE 5F5WA 3UU5A 3N9LA 4HFDA 1X9BA 5ABFB 2C5KT 3GWHA 3RIFA 3UU3A 3SWHA 4AIUA 3K8PC 3E0ZA 3NVOA 2DWGA 2C5JA 2NW7A 2M6BA 4AI6A 3FZLB 1J5WA 3FB2A 2QA7A 4L9IA 3WAKA 1QSDA 2ZM2A 3KVAA 2YDSA 2UUCT 2E9XB 2WSSV 3RC3A 5LGTB 2NW9A 1KF6A 1UX4A 4NUUA 2UU9T 3AEDA 3V5SA 1IZNB 4CXXA 2KSRA 2BZBA 3GN5A 3IBPA 3JADA 3LG7A 2VKHA 4CI3B 4X1KE 2K24A 2X51A 5HEGA 2K48A 1UCHA 3OJAA 4X66T 3QOFA 2ACXA 3EI0A 4EGWA 4ASKA 4UELA 4V1Av 4U2YA 4O2AE 2JMKA 5HWXA 1D1BA 1MIYA 2V6YA 1HFAA 1ZEEA 3RGLA 4AKLA 3HKEE 3ETVA 2CCQA 3N9OA 2E8IA 3AEAA 3W15B 3ZSSA 3N9PA 2H89A 2QYWA 5AQTB 4X1YE 3RYFE 4X62T 1N32T 1MIWA 3FZMB 3NZPA 5LGUB 4MHCA 3ANWA 4IGUA 4IL9A 4GYSA 4Z91A 1KNRA 3I0OA 5JDFA 1XDPA 4Z90A 1IJ5A 3OTOT 4GKJT 4LFBT 4WNKA 5JVDE 3H37A 5J1GA 1U5PA 1IAPA 4HTEA 1D1CA 5AQNB 4HWFA 5LOVE 3UU4A 2XM1A 2IIUA 5HWYA 3PUWF 4EAHA 1HNXT 1KK7A 2CE7A 3PJAA 2NP9A 4OHFA 1ZOYA 2WM9A 3ZC0A 1BR0A 3EAMA 4A56A 4WW0A 2A72A 4I6NA 4YT0A 2CXFA 3ZMSB 4BAYB 5LXTE 4KHPT 4KMCA 4X1IE 4LFAT 1G8XA 3PU3A 4ZS3A 2V8SV 4G63A 2HH7A 1CUNA 4JI5T 2NOXA 4COFA 1UURA 5HCMA 5JQGE 4X65T 1GQEA 1ZHCA 2FUPA 4JEHB 4U2ZA 4PK4A 5KDMC 1HX1B 1MNEA 5LCYA 5EK2A 5LNKA 4EB6E 1DU2A 1XMQT 2A2FX 3H3AA 2CLYC 2CEAA 3Q2MA 5ABGA 2Y8DA 3UFGA 4YTPA 5CJ5A 1XNQT 4QKNA 2KMFA 5FVKA 5HXSA 5C3JA 2MYSA 5LP6E 4X64T 2VWAA 2Z6EA 5C8YE 3P4QA 1LKXA 3NWIA 5CFBA 3AE8A 1S35A 3CX7B 4XZCA 5L4EA 4CXWA 3K1SA 1BR1A 2BBHA 2CA5A 2W66A 2FJEA 2YKSA 3ONLC 1MMAA 2ACZA 2KWHA 2J62A 3C98B 3EABA 4UVCB 3CK6A 4XAXB 2Q9QA 3TLSA 3UUMA 2XAGB 3RIAA 4P1NA 5JR9B 4ILAA 2X0YA 2WQYA 4L5GA 4P09A 3HKBE 3LJCA 2E9XA 3O4XE 4UVAB 1CHUA 3VRBA 4X20E 2CXDA 2EHOC 4GK5E 2L8KA 2VL0A 4HFEA 4HKAA 3KBUA 5AQRB 5HEHA 4DV6T 3N2OA 3X1DA 1SE7A 2LSYA 4NXMT 2WZIA 3C4ZA 5IWAT 2E5LT 5AQOB 5AQIB 2BG9E 1LVKA 1VCTA 4UXNB 4QX8B 2A3DA 1XWMA 2V7KA 1FMVA 4HEAA 4J2CA 1I94T 2FJAA 4LF9T 2LSIA 5FXZA 3AE7A 5L4HA 3OYXA 3OVUA 4YTMA 2JQ9A 4TN7B 3J9X1 2BG9A 3P4WA 3BQIA 3N2GE 4AQFC 2XQ4A 3FXDB 1UCUA 4GIWA 4ZXLA 2XQYA 4H9RC 1IBMT 1IJ6A 2CBIA 2DI4A 4QHOA 2BVMA 3RIUC 4CQIA 4YXDA 5LHIB 3R84B 1W0BA 2JRKA 4JI3T 4IE0A 2LM9A 3MKDA 1O3XA 2D0TA 4HGAA 3F2EA 2D5UA 5CA0E 4ZEYA 3ZSTA 4JEUB 5FY7A 1JNRA 1D0YA 2BKNA 2W0GA 3UUBA 4LF6T 4DR4T 4IL4A 4DIDB 4HFBA 2IUBA 1MNDA 1V9DA 2EHOD 5DABA 4AKIA 5HXEA 4ZI2D 2UXXB 1VOMA 1XDOA 1YW0A 2WU5A 2UXNB 3I9YA 5LHGB 2KNDA 2LKHA 2KXPB 2EHOB 2LEHA 3KDSE 3Q5WA 2XY8B 3QB5A 4QH5A 4PJJA 4QXCB 3ONXA 5FMNA 1W09A 1WFDA 3WAJA 2X9XA 2V26A 3PUQA 2D9DA 2V6YB 4YHHT 4LMLA 4DR3T 4N78D 3KW5A 2XTLA 2BVLA 5CA1E 4JI4T 2XQ3A 2XAHB 3C51A 5LJNA 4DR6T 2XAFB 4HWHA 4IE6A 1ZP0A 4AISA 2M67A 2UXCT 4PJMA 1FMWA 2PBIA 3GN5B 2CMRA 3M65A 2BKPA 2IW5B 4FJOA 3RYCE 3SFEA 2VVSA 2ZM0A 3AEFA 4KBMB 4ZS2A 3KV5A 2CLYB 2X9HA 1N33T 3TLWA 3CVRA 5HCJA 4ISSA 3VR8A 4KI0F 3WI3A 4F6RC 2LRLA 5AQVB 1E2AA 5JH7E 1BR4A 3ABVA 2LKGA 3RPUA 2LOSA 3TKLB 2V6XA 1LVFA 4JLEA 5AQPB 5LBMA 2AE9A 3QB5K 4U7IA 3SRZA 3KVFA 4TWFA 3AEBA 1WR6A 4HFCA 1KNZA 4ZHQE 5JDLA 4DV4T 2VL8A 4P0BA 3FZHB 3TLTA 4HN9A 3ZMZB 3ZEFB 5C2TA 1AJ3A 4NIQA 5HEUA 2KINB 3AA7B 3UULA 4WZXA 5LGNB 2NTXA 3J7Yq 4I50E 4DBRA 2WS3A 2IHR1 5F8PA 2XAJB 4EXTA 2W63A 4TV9E 3RKOA 2UXBT 1T98A 3KINB 2Y48B 4U3CA 4YY3T 2W61A 3AA6B 4X5TA 2K9AA 2IC6A 4DV0T 5BMVE 4IDOA 2B76A 3ZMTB 2P9BA 2K5BB 3HI2A 1YKEB 3QUJA 4TZ4C 4CN6A 5GONE 2XASB 5KX5E 4EEDA 3OKQA 3SS1A 5JDNA 5L2LA 2L3LA 5LMUT 2E2AA 2XQ9A 2H7OA 4H9NC 1Z8UA 2IDOB 4ZZBA 4O4LE 4OFZA 5L3EB 5LJMA 5JRCB 2PG8A 3CPZA 5JTGA 4YHJA 4TWDA 2KZ7B 1E1HB 3DTOA 4YTNA 2XPKA 1CMXA 3B13A 2PTFA 1HF8A 4MALA 3A5XA 4GK0E 3JC6D 5LBQB 5L3CB 4O4IE 2BS3A 4CN1A 4H9QC 3RH3A 2PJQA 5F3JA 5M4YA 2JQHA 5FXXA 2N2NA 1OEDE 4YLHA 2YINA 3BQKA 5TAOA 3O1HA 3MACA 3PUXF 2M6IA 5JDHA 4IDNA 4AKRB 3RC8A 3RQUA 3VKHA 3CQXC 2LRKA 5AQLB 2BBJA 2I59A 4UVBB 3L8RA 4AQYT 4LF4T 3VU7H 3NKZA 3SFDA 2X67A 4AXPA 4DR5T 3F57A 2XQ6A 3AVRA 3MA9A 4YFSA 3IFWA 5ADXL 3AEGA 5E0OA 3C4WA 3B57A 2WP9A 5AQGB 2LSGA 2AXDS 2N1GA 2XM2A 3F31A 3ZYMA 4YSYA 2BG9B 2DNXA 4DR1T 3A7MA 2DL1A 3C64A 4DR7T 1KEYA 1US7B 2WDRA 3D0TA 3PJAJ 2NW8A 3N9QA 4PJNA 4YJ2E 1S94A 2BKOA 2C5IT 2H88A 3PUYF 4IIJE 4H9OC 3ZJ2A 1G73A 1HG2A 3NRYA 4CXYA 3AE4A 3AVSA 5HXCA 5HAXA 5FXVA 4EZ4A 1NWMX 3Q9DA 4JI6T 2LM2A 1NAFA 3KBTA 3MZKB 4Q25A 4DNDA 3N2KE 3N9MA 5FNVE 4ANJA 5ABEA 2UXDT 3AE3A 3LK42 3PUVF 3PUZF 3RLFF 3TLUA 1T8BA 4QH4A 3ZCIA 1QLBA 4EYUA 3HA4A 3ZMVB 3CX6B 5AQQB 5J2TE 3CQGB 3PUAA 2IMLA 1I6ZA 5DQVA 3RI5A 2YDRA 2CBJA 2GK9A 5FYMA 2XSBA 2BS4A 4H9PC 4EZHA 4IG7A 4ZI2C 3PE0A 2HPJA 5FKYA 2FJBA 2RP4A 3AEEA 3BQLA 3CQCB 2DCFA 3FHNA 3NZQA 3Q5DA 3ZMUB 4A5XA 2WB5A 3FBZA 4I0UA 4ILCA 2YU2A 5LYJE 4DM9A 4JI8T 3ZN1B 1YKHB 2J1DG 3HKDE 2VQET 2WDVA 2X0LB 4GKKT 2LENA 3PUSA 4U7YA 1D0ZA 2HHHT 2ODVA 5L3FB 2MBGA 4IHJE 4ISTA 4NPPA 4UIGA 1MMGA 3RRCA 1HS7A 4O2BE 5EZYE 2LT3A 1SHZC 2Q9QC 4IDQA 1MMDA 5HEOA 5L3DB 4H63H 3H3MA 1KFYA 3KVBA 3P7IA 3HL6A 1XZYA 3IEEA 3ZCJA 1XNRT 1OEDC 3LBXA 5FVLA 3OPCA 3CKDA 3FBLA 5LMNT 5HXRA 4ILUA 4UV9B 5H6RB 2MAWA 3ZT6A 3HKCE 1FJGT 3E08A 3DJBA 2E9XD 4MLKA 2CPTA 5JREA 1FEWA 3CMLA 4QXHB 3ZPOA 3GMIA 4I43B 4KUMB 4DV7T 2JQKA 5JDGA 2ETLA 2CWYA 2HPLA 2OA5A 4IE4A 5CGMA 2X9WA 4LFCT 2FBWA 4C91A 1HTJF 2D0UA 5EK3A 4DUYT 3ZC1A 3LFMA 5L3GB 1SUMB 2I6HA 2YK0A 4HFIA 2UUAT 1VCSA 2ZM8A 2K3WA 3LBXB 2E5VA 2CHNA 4WBOA 4EEBA 4EYYR 5JR9A 3GA8A 2LSJA 1SA0E 3L3PA 2LOPA 2WWUA 4GOUA 2IAKA 2YOEA 3FZFB 5IYZE 4EOZB 2DLRA 2W4XA 3FZKB 4HFHA 1UK5A 2VKOA 4H9SE 2V7IA 4PW8A 4DMWA 4DV5T 3RIIA 2LJLA 3HR0A 3MXZA 2CHOA 3AE9A 3N9NA 2HN1A 4JI2T 3VRAA 2C0SA 3AB3B 3E22E 2H3RA 3MJXA 4PJLA 4TX5A 1U4QA 4OYKA 4B3ST 3O1IA 4U72A 2E9XC 3CWZB 5A1LA 2QGSA 3KV4A 4MBQA 3P4SA 2XQ7A 1WYCA 4U74A 4P0AA 1WRDA 4LF7T 5JR9C 4KHZF 3UU8A 1XD3A 4ILBA 3Q5EA 2V7LA 3UQ7A 3KV6A 5ABHA 5AQHB 3AA1B 2N9DA 1BR2A 5AQKB 5CB4E 4NXNT 1HNWT 1UGOA 3PURA 4XBFB 2W67A 3AE2A 3JCFA 1YXRA 1Z0PA 3NBXX 2VQFT 4TWHA 4JI1T 2EHOA 4DBQA 2HN2A 3PUGA 5ETWA 3ZLIA 4AKGA 2BDEA 2XZEA 4GYRA 2WY2A 1E7PA 2LE8A 4NUVA 5IHYA 3T1YT 4OX9T 3RKGA 5KXJA 3QC9A 4B3TT 5AQJB 2X9YA 3K3NA 2WBLA 3QNUA 2WZHA 4QH1A 4TV8E 1T7SA 2XQAA 3I1AA 5AQMB 3AAEB 2FJDA 2LHRA 4IE5A 4ZOLE 3KFWX 4HFVA 5DJQC 3RHWA 3FXEB 4AQFA 4CI2B 3UQ4A 4ZI3D 4ZZCA 2Q9QD 3ONJA 2D2SA 4DV1T 3T8OA 4ZI3C 5LHHB 3EHZA 3U78A 2CRBA 1EZ3A 1W9RA 5FY0A 5BR8T 1HR0T 3ETUA 2RA1A 2V7MA 1M7KA 2I0MA 1LRZA 2YU1A 4B3RT 2WMNA 4E7ZA 5JDMA 2VKJA 3V5UA 3PV0F 3AE5A 4YJ3E 4F8HA 1HX8A 5L3BB 4WYVA 3B5MA 3UUXB 2PFVA 4K0UA 2CM0A 1YQ4A 2B1EA 1HCIA 2VURA 5FL1A 1H7CA 3JAFA 3O1JA 1YD8G 2ZMAA 1W0AA 2XUEA 1HG5A 3AE1A 4H63V 5AQUB 1WR0A 3AECA 2V5DA 3OYZA 3ZJ1A 2XHEB 4UEMA 5IUXA 3AXJB 4BJNA 3EUHA 4JYAT 4Z8XA 2A9UA 2MOZA 2V7JA 4C90A 4IE7A 4HWDA 5J2UE 1D0XA 3UUNA 4UV8B 2LLYA 3AE6A 2DWKA 3BK9A 3C50A 4LF5T 4QXBB 2X0HA 3S4UA 3UTKA 2ZM6T 1MIVA 5LG3A 3Q5XA 4PNIA 3RYHE 4ERRA 4QWNB 5ABFA 1IBLT 5JRCA 2UUBT 3EVYA 5L47A 3LDQB 3ZYLA 2WAUA 2G0UA 3VHLA 4YSZA 3JAEA 5AFUL 4HE8A 4HWIB 3PDYA 3RQWA 1OXZA 3VR9A 4A98A 5HXHA 4MFRA 2JJ9A 2DHRA 3UFEA 4A97A 2X68A 3NRXA 4WBNE 1UUSA 2WDQA 4PK5A 4ADZA 4IREA 5HYAA 5JDQA 1XMOT 1VRBA 3EDVA 4UR9A 2JQQA 4O8SA 4L0RA 3RIUA 4AQGA 1NEKA 3CIRA 2XQ8A 2JPFA 3TLVA 3ZN0B 2R6GF 4PFPA 4CI1B 1UX5A 2MTQA 2LHNA 4DO0A 2NWBA 4JI7T 5FY1A 2JMHA 3P4RA 2IC9A 4OYJA 3ZYKA 1Y64B 1KNPA 2H7VC 4O4HE 4DR2T 4B6XA 3ZT7A 2NR4A 3IF8B 4U33A 4EV6A 4E7SA 5DQWA 4FI5A 4YSXA 4ZI7E 3VKGA 1N36T 4DVDA 2YDQA 3K3QC 2XJ7A 4KX6A 3AAAB 3ANWB 4LMJA 3EDUA 3CX8B 5FL0A 3RF1A 3A7SA 5FXWA 2SPCA 3PTRB 1MMNA 2QRXA 4JKJA 5AQSB 3RISA 2BS2A 2ODUA 2KT9A 2XQ5A 2VASA 1ZKEA 4IDPA 4U31A 3U3IA 4UF0B 2Q9QB 2JIWA 3ZKRA 2MPKA 1T72A 3SOLA 1X79A 2RPAA 4AKHA 4JBWF 1NENA 3IA3A 4TNVA 2XSAA 2QVAA 1J5ET 4I4TE 3K3OA 5KMGP 5LB7B 3R6NA 3AA0B 3G06A 3P4PA 3O9XA 4LMKA 2L9QA 1ZV4X 4HWCA 4K0KT 2XAQB 3OBVE 4UF0A 1HNZT 4JV5T 2W00A 4LF8T 3TB3A 5LG4A 1M62A 3P8CD 4QX7B 3PU8A 4OK0A 4O4JE 2V5CA 2VVNA 2X66A 2ZLYA 2VKDA 1B7TA 3C4XA 3I9WA 5H6QB 1YQ3A 3AXJA 3UT5E 4DMVA 1JNZA 1D1AA 2YN6A 4DV3T 2F4VT 3DP7A 1WCRA 2WMOA 4G2AA 2NTYA 1QUUA 2YEVC 3L09A 3RX6A 2VB6A 2J4GA 4KP3C 5EK4A 2V1DB 2WU2A 1WLXA 1IBKT
chains in the Genus database with same CATH topology
3MK7C 3RYIE 1OWAA 3I0QA 4PAGA 4JUYA 2CWOA 3JC6C 2W62A 2LSKA 3LK2B 1FIOA 2CXLA 3QK6A 3ESLA 4PK6A 3N5LA 2Y6XA 2ES0A 2KLQA 3KV9A 4EIWA 4IDZA 3RRWA 4BJMA 3IHRA 4CZZB 1WYBA 4PFOA 2KWIB 5FP3A 4I55E 3LK3B 3IRTA 3AAIA 4BA9A 5LA6E 2VK9A 4M1PA 4TUYE 3N9LA 2C5KT 3GWHA 3SWHA 3K8PC 3E0ZA 2DWGA 2C5JA 2NW7A 4AI6A 3FB2A 2QA7A 4L9IA 3WAKA 1QSDA 2ZM2A 3KVAA 2E9XB 2WSSV 3RC3A 5LGTB 2NW9A 1UX4A 4NUUA 3V5SA 4CXXA 1IZNB 2BZBA 3GN5A 3IBPA 3LG7A 4CI3B 2VKHA 4X1KE 2K24A 2X51A 1UCHA 2K48A 3OJAA 2ACXA 4ASKA 4V1Av 4O2AE 2JMKA 5HWXA 1D1BA 1MIYA 1HFAA 1ZEEA 4AKLA 3HKEE 3ETVA 2CCQA 3N9OA 2E8IA 3W15B 3N9PA 4X1YE 3RYFE 1MIWA 3NZPA 5LGUB 4MHCA 3ANWA 4IGUA 4GYSA 3I0OA 5JDFA 1IJ5A 4WNKA 5JVDE 3H37A 5J1GA 1U5PA 1IAPA 4HTEA 1D1CA 5LOVE 5HWYA 4EAHA 1KK7A 2CE7A 3ZC0A 2NP9A 4OHFA 2WM9A 1BR0A 4A56A 4WW0A 2A72A 4I6NA 2CXFA 3ZMSB 4BAYB 5LXTE 4KMCA 4X1IE 1G8XA 3PU3A 4ZS3A 4G63A 2HH7A 1CUNA 2NOXA 5JQGE 1ZHCA 4JEHB 5KDMC 4PK4A 5EK2A 1MNEA 5LCYA 5LNKA 4EB6E 2A2FX 3H3AA 2CLYC 2CEAA 3Q2MA 2Y8DA 4QKNA 2KMFA 5HXSA 5LP6E 2MYSA 2VWAA 2Z6EA 5C8YE 1LKXA 1S35A 3CX7B 4XZCA 4CXWA 1BR1A 2CA5A 4YLHA 3UUMA 4ZI2D 1MMAA 2KWHA 3C98B 4XAXB 2Q9QA 2XAGB 5JR9B 4L5GA 4P09A 3HKBE 3LJCA 2E9XA 3O4XE 4UVAB 4X20E 2CXDA 2EHOC 4GK5E 2L8KA 4HKAA 3KBUA 3N2OA 2LSYA 3C4ZA 1LVKA 4UXNB 4QX8B 2A3DA 2V7KA 1FMVA 4HEAA 4J2CA 2LSIA 5FXZA 3OYXA 4TN7B 3J9X1 4AQFC 3BQIA 3N2GE 3FXDB 1UCUA 4GIWA 2XQYA 4H9RC 1IJ6A 2DI4A 4QHOA 2BVMA 4CQIA 5LHIB 3R84B 2JRKA 4IE0A 2LM9A 3MKDA 1O3XA 2D0TA 4HGAA 3F2EA 2D5UA 5CA0E 4JEUB 5FY7A 1D0YA 2W0GA 5DABA 1MNDA 1V9DA 2EHOD 5HXEA 2UXXB 1VOMA 1YW0A 2UXNB 3I9YA 5LHGB 2KNDA 2KXPB 4UVCB 2EHOB 2LEHA 3KDSE 3Q5WA 4PJJA 4ZI3D 4QXCB 3ONXA 5FMNA 3WAJA 2X9XA 2V26A 3PUQA 4N78D 3KW5A 2XTLA 2BVLA 5CA1E 2XAHB 3C51A 5LJNA 2XAFB 4IE6A 2M67A 4PJMA 1FMWA 2PBIA 3GN5B 2CMRA 3M65A 2IW5B 3RYCE 4FJOA 2ZM0A 4KBMB 4ZS2A 3KV5A 2CLYB 2X9HA 3CVRA 3WI3A 4ISSA 4F6RC 5JH7E 1BR4A 3RPUA 2LOSA 3TKLB 1LVFA 4JLEA 5LBMA 3SRZA 3KVFA 1WR6A 1KNZA 4ZHQE 5JDLA 2VL8A 4P0BA 3ZEFB 1AJ3A 4HN9A 3ZMZB 2KINB 3AA7B 3UULA 5LGNB 2NTXA 3J7Yq 4I50E 4DBRA 5F8PA 2XAJB 4EXTA 2W63A 4TV9E 3RKOA 1T98A 3KINB 2Y48B 2W61A 3AA6B 2K9AA 2IC6A 5BMVE 3ZMTB 2P9BA 2K5BB 3HI2A 1YKEB 3QUJA 4TZ4C 5KX5E 5GONE 2XASB 3OKQA 3SS1A 5JDNA 5L2LA 2L3LA 2H7OA 4H9NC 5L3EB 5LJMA 4O4LE 4OFZA 5JRCB 2PG8A 3CPZA 4YHJA 2KZ7B 1E1HB 3DTOA 1CMXA 3B13A 1HF8A 4MALA 3A5XA 4GK0E 3JC6D 5LBQB 5L3CB 4O4IE 4H9QC 3RH3A 2PJQA 5F3JA 5M4YA 5FXXA 2N2NA 2YINA 3BQKA 5TAOA 3O1HA 3MACA 5JDHA 3RC8A 4AKRB 3VKHA 3CQXC 2I59A 4UVBB 3VU7H 2X67A 4AXPA 3F57A 4YFSA 3AVRA 3MA9A 3IFWA 5ADXL 5E0OA 3C4WA 3B57A 2LSGA 3F31A 2N1GA 3ZYMA 2DNXA 3C64A 3D0TA 1US7B 2NW8A 3N9QA 4PJNA 4YJ2E 1S94A 2C5IT 4IIJE 3ZJ2A 4CXYA 4H9OC 1G73A 1HG2A 3NRYA 3AVSA 5HXCA 5HAXA 5FXVA 4EZ4A 1NWMX 3Q9DA 1NAFA 3KBTA 3MZKB 4DNDA 3N2KE 3N9MA 5FNVE 4ANJA 3LK42 4EYUA 3ZCIA 3HA4A 3ZMVB 3CX6B 5J2TE 3CQGB 3PUAA 5DQVA 5FYMA 2GK9A 4H9PC 4EZHA 4IG7A 4ZI2C 3PE0A 2HPJA 2RP4A 3CQCB 3BQLA 3NZQA 2DCFA 3FHNA 3ZMUB 3FBZA 2YU2A 5LYJE 4DM9A 3ZN1B 1YKHB 2J1DG 3HKDE 2X0LB 3PUSA 1D0ZA 2ODVA 5L3FB 2MBGA 4IHJE 4ISTA 4UIGA 1MMGA 3RRCA 1HS7A 4O2BE 5EZYE 2LT3A 1SHZC 2Q9QC 1MMDA 5L3DB 4H63H 3KVBA 3P7IA 3HL6A 3IEEA 3ZCJA 3LBXA 3CKDA 3FBLA 5HXRA 4ILUA 4UV9B 5H6RB 3HKCE 3E08A 3DJBA 2E9XD 4MLKA 5JREA 1FEWA 3CMLA 4QXHB 3ZPOA 3GMIA 4I43B 4KUMB 2ETLA 5JDGA 2CWYA 2HPLA 2OA5A 4IE4A 2X9WA 4C91A 1HTJF 2D0UA 5EK3A 3ZC1A 3LFMA 5L3GB 2YK0A 2ZM8A 3LBXB 4WBOA 4EYYR 5JR9A 3GA8A 2LSJA 1SA0E 3L3PA 2LOPA 2WWUA 4GOUA 2IAKA 5IYZE 4EOZB 2DLRA 4H9SE 2VKOA 4PW8A 2V7IA 4DMWA 3RIIA 2LJLA 3HR0A 3MXZA 3N9NA 2LENA 2C0SA 3AB3B 3E22E 2H3RA 3MJXA 4PJLA 4TX5A 1U4QA 4OYKA 3O1IA 4U72A 2E9XC 3CWZB 5A1LA 2QGSA 3KV4A 4MBQA 4U74A 4P0AA 1WYCA 1WRDA 5JR9C 1XD3A 2V7LA 3KV6A 3AA1B 2N9DA 1BR2A 5CB4E 4XBFB 4AKIA 3PURA 1Z0PA 3NBXX 2EHOA 4DBQA 3PUGA 5ETWA 3ZLIA 4AKGA 2BDEA 4GYRA 2LE8A 4NUVA 5IHYA 3QC9A 2X9YA 3K3NA 2WBLA 4TV8E 3I1AA 3AAEB 2LHRA 4IE5A 4ZOLE 4CI2B 3KFWX 4HFVA 5DJQC 4AQFA 3FXEB 2Q9QD 2D2SA 3T8OA 4ZI3C 5LHHB 3U78A 1EZ3A 5FY0A 3ETUA 2RA1A 2V7MA 2YU1A 1LRZA 2WMNA 4E7ZA 5JDMA 2VKJA 3V5UA 4YJ3E 1HX8A 5L3BB 3UUXB 2PFVA 4K0UA 2CM0A 2B1EA 1HCIA 1H7CA 3O1JA 1YD8G 2ZMAA 2XUEA 4H63V 1HG5A 3ZJ1A 3OYZA 2XHEB 4UEMA 4BJNA 3EUHA 4Z8XA 2MOZA 2V7JA 4C90A 4IE7A 5J2UE 1D0XA 3UUNA 4UV8B 2DWKA 3BK9A 3C50A 4QXBB 3S4UA 3UTKA 1MIVA 3Q5XA 4PNIA 3RYHE 4ERRA 4QWNB 5JRCA 3EVYA 3ZYLA 2WAUA 2G0UA 3VHLA 5AFUL 4HE8A 3PDYA 1OXZA 5HXHA 4MFRA 2JJ9A 2DHRA 3UFEA 2X68A 3NRXA 4WBNE 4PK5A 4ADZA 5HYAA 5JDQA 1VRBA 3EDVA 4AQGA 2JQQA 4O8SA 4L0RA 2JPFA 3ZN0B 4PFPA 4CI1B 1UX5A 2MTQA 2LHNA 4DO0A 2NWBA 5FY1A 2JMHA 2IC9A 4OYJA 3ZYKA 1Y64B 2H7VC 4O4HE 4B6XA 3IF8B 4E7SA 5DQWA 4FI5A 4ZI7E 3VKGA 4DVDA 3K3QC 3AAAB 3ANWB 3EDUA 3CX8B 3A7SA 5FXWA 2SPCA 3PTRB 1MMNA 4JKJA 3RISA 2ODUA 2KT9A 2VASA 1ZKEA 3U3IA 4UF0B 2Q9QB 3SOLA 1X79A 4AKHA 4I4TE 3K3OA 5KMGP 3R6NA 3AA0B 3O9XA 2L9QA 1ZV4X 2XAQB 3OBVE 4UF0A 2W00A 3TB3A 5LG4A 4QX7B 3P8CD 4UELA 3PU8A 4OK0A 4O4JE 2ZLYA 3C4XA 2X66A 3I9WA 2VKDA 1B7TA 5H6QB 3UT5E 4DMVA 1D1AA 3DP7A 2WMOA 4G2AA 2NTYA 1QUUA 2YEVC 3L09A 3RX6A 2VB6A 4KP3C 5EK4A 2V1DB 1WLXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JKJ A;  1XD3 A;  3RIS A;  3RII A;  3TB3 A;  4DM9 A;  4UEL A;  3IHR A;  3IRT A;  2ETL A;  3KW5 A;  2LEN A;  3KVF A;  4UEM A;  3IFW A;  1UCH A;  3A7S A;  1CMX A;  4IG7 A;  4I6N A; 
#chains in the Genus database with same CATH topology
 3MK7 C;  3RYI E;  1OWA A;  1OED B;  3L39 A;  3I0Q A;  4DUZ T;  3P50 A;  4PAG A;  2OV9 A;  4JUY A;  2CWO A;  2W2U A;  2W62 A;  3JC6 C;  2LSK A;  2WWV A;  3ZT5 A;  3LK2 B;  1FIO A;  2CXL A;  4B3M T;  3QK6 A;  3ESL A;  4PK6 A;  3N5L A;  2Y6X A;  2BG9 C;  2ES0 A;  2KLQ A;  3KV9 A;  4EIW A;  4JI0 T;  4IDZ A;  3T1H T;  5AQF B;  3M3Z B;  3RRW A;  4BJM A;  3IHR A;  3LSV A;  4TNW A;  4CZZ B;  1WYB A;  5J0Z A;  4PFO A;  2KWI B;  2J47 A;  4I55 E;  5FP3 A;  1Y01 A;  1OED A;  3UU6 A;  1J1J A;  3LK3 B;  4IT4 A;  2OLT A;  1N34 T;  1R8I A;  4CN4 A;  3A8Y C;  3AAI A;  3IRT A;  1L0V A;  5LA6 E;  4BA9 A;  5HEJ A;  2VK9 A;  4M1P A;  4DV2 T;  2WCA A;  4TUY E;  5F5W A;  3UU5 A;  3N9L A;  4HFD A;  1X9B A;  5ABF B;  2C5K T;  3GWH A;  3RIF A;  3UU3 A;  3SWH A;  4AIU A;  3K8P C;  3E0Z A;  3NVO A;  2DWG A;  2C5J A;  2NW7 A;  2M6B A;  4AI6 A;  3FZL B;  1J5W A;  3FB2 A;  2QA7 A;  4L9I A;  3WAK A;  1QSD A;  2ZM2 A;  3KVA A;  2YDS A;  2UUC T;  2E9X B;  2WSS V;  3RC3 A;  5LGT B;  2NW9 A;  1KF6 A;  1UX4 A;  4NUU A;  2UU9 T;  3AED A;  3V5S A;  1IZN B;  4CXX A;  2KSR A;  2BZB A;  3GN5 A;  3IBP A;  3JAD A;  3LG7 A;  2VKH A;  4CI3 B;  4X1K E;  2K24 A;  2X51 A;  5HEG A;  2K48 A;  1UCH A;  3OJA A;  4X66 T;  3QOF A;  2ACX A;  3EI0 A;  4EGW A;  4ASK A;  4UEL A;  4V1A v;  4U2Y A;  4O2A E;  2JMK A;  5HWX A;  1D1B A;  1MIY A;  2V6Y A;  1HFA A;  1ZEE A;  3RGL A;  4AKL A;  3HKE E;  3ETV A;  2CCQ A;  3N9O A;  2E8I A;  3AEA A;  3W15 B;  3ZSS A;  3N9P A;  2H89 A;  2QYW A;  5AQT B;  4X1Y E;  3RYF E;  4X62 T;  1N32 T;  1MIW A;  3FZM B;  3NZP A;  5LGU B;  4MHC A;  3ANW A;  4IGU A;  4IL9 A;  4GYS A;  4Z91 A;  1KNR A;  3I0O A;  5JDF A;  1XDP A;  4Z90 A;  1IJ5 A;  3OTO T;  4GKJ T;  4LFB T;  4WNK A;  5JVD E;  3H37 A;  5J1G A;  1U5P A;  1IAP A;  4HTE A;  1D1C A;  5AQN B;  4HWF A;  5LOV E;  3UU4 A;  2XM1 A;  2IIU A;  5HWY A;  3PUW F;  4EAH A;  1HNX T;  1KK7 A;  2CE7 A;  3PJA A;  2NP9 A;  4OHF A;  1ZOY A;  2WM9 A;  3ZC0 A;  1BR0 A;  3EAM A;  4A56 A;  4WW0 A;  2A72 A;  4I6N A;  4YT0 A;  2CXF A;  3ZMS B;  4BAY B;  5LXT E;  4KHP T;  4KMC A;  4X1I E;  4LFA T;  1G8X A;  3PU3 A;  4ZS3 A;  2V8S V;  4G63 A;  2HH7 A;  1CUN A;  4JI5 T;  2NOX A;  4COF A;  1UUR A;  5HCM A;  5JQG E;  4X65 T;  1GQE A;  1ZHC A;  2FUP A;  4JEH B;  4U2Z A;  4PK4 A;  5KDM C;  1HX1 B;  1MNE A;  5LCY A;  5EK2 A;  5LNK A;  4EB6 E;  1DU2 A;  1XMQ T;  2A2F X;  3H3A A;  2CLY C;  2CEA A;  3Q2M A;  5ABG A;  2Y8D A;  3UFG A;  4YTP A;  5CJ5 A;  1XNQ T;  4QKN A;  2KMF A;  5FVK A;  5HXS A;  5C3J A;  2MYS A;  5LP6 E;  4X64 T;  2VWA A;  2Z6E A;  5C8Y E;  3P4Q A;  1LKX A;  3NWI A;  5CFB A;  3AE8 A;  1S35 A;  3CX7 B;  4XZC A;  5L4E A;  4CXW A;  3K1S A;  1BR1 A;  2BBH A;  2CA5 A;  2W66 A;  2FJE A;  2YKS A;  3ONL C;  1MMA A;  2ACZ A;  2KWH A;  2J62 A;  3C98 B;  3EAB A;  4UVC B;  3CK6 A;  4XAX B;  2Q9Q A;  3TLS A;  3UUM A;  2XAG B;  3RIA A;  4P1N A;  5JR9 B;  4ILA A;  2X0Y A;  2WQY A;  4L5G A;  4P09 A;  3HKB E;  3LJC A;  2E9X A;  3O4X E;  4UVA B;  1CHU A;  3VRB A;  4X20 E;  2CXD A;  2EHO C;  4GK5 E;  2L8K A;  2VL0 A;  4HFE A;  4HKA A;  3KBU A;  5AQR B;  5HEH A;  4DV6 T;  3N2O A;  3X1D A;  1SE7 A;  2LSY A;  4NXM T;  2WZI A;  3C4Z A;  5IWA T;  2E5L T;  5AQO B;  5AQI B;  2BG9 E;  1LVK A;  1VCT A;  4UXN B;  4QX8 B;  2A3D A;  1XWM A;  2V7K A;  1FMV A;  4HEA A;  4J2C A;  1I94 T;  2FJA A;  4LF9 T;  2LSI A;  5FXZ A;  3AE7 A;  5L4H A;  3OYX A;  3OVU A;  4YTM A;  2JQ9 A;  4TN7 B;  3J9X 1;  2BG9 A;  3P4W A;  3BQI A;  3N2G E;  4AQF C;  2XQ4 A;  3FXD B;  1UCU A;  4GIW A;  4ZXL A;  2XQY A;  4H9R C;  1IBM T;  1IJ6 A;  2CBI A;  2DI4 A;  4QHO A;  2BVM A;  3RIU C;  4CQI A;  4YXD A;  5LHI B;  3R84 B;  1W0B A;  2JRK A;  4JI3 T;  4IE0 A;  2LM9 A;  3MKD A;  1O3X A;  2D0T A;  4HGA A;  3F2E A;  2D5U A;  5CA0 E;  4ZEY A;  3ZST A;  4JEU B;  5FY7 A;  1JNR A;  1D0Y A;  2BKN A;  2W0G A;  3UUB A;  4LF6 T;  4DR4 T;  4IL4 A;  4DID B;  4HFB A;  2IUB A;  1MND A;  1V9D A;  2EHO D;  5DAB A;  4AKI A;  5HXE A;  4ZI2 D;  2UXX B;  1VOM A;  1XDO A;  1YW0 A;  2WU5 A;  2UXN B;  3I9Y A;  5LHG B;  2KND A;  2LKH A;  2KXP B;  2EHO B;  2LEH A;  3KDS E;  3Q5W A;  2XY8 B;  3QB5 A;  4QH5 A;  4PJJ A;  4QXC B;  3ONX A;  5FMN A;  1W09 A;  1WFD A;  3WAJ A;  2X9X A;  2V26 A;  3PUQ A;  2D9D A;  2V6Y B;  4YHH T;  4LML A;  4DR3 T;  4N78 D;  3KW5 A;  2XTL A;  2BVL A;  5CA1 E;  4JI4 T;  2XQ3 A;  2XAH B;  3C51 A;  5LJN A;  4DR6 T;  2XAF B;  4HWH A;  4IE6 A;  1ZP0 A;  4AIS A;  2M67 A;  2UXC T;  4PJM A;  1FMW A;  2PBI A;  3GN5 B;  2CMR A;  3M65 A;  2BKP A;  2IW5 B;  4FJO A;  3RYC E;  3SFE A;  2VVS A;  2ZM0 A;  3AEF A;  4KBM B;  4ZS2 A;  3KV5 A;  2CLY B;  2X9H A;  1N33 T;  3TLW A;  3CVR A;  5HCJ A;  4ISS A;  3VR8 A;  4KI0 F;  3WI3 A;  4F6R C;  2LRL A;  5AQV B;  1E2A A;  5JH7 E;  1BR4 A;  3ABV A;  2LKG A;  3RPU A;  2LOS A;  3TKL B;  2V6X A;  1LVF A;  4JLE A;  5AQP B;  5LBM A;  2AE9 A;  3QB5 K;  4U7I A;  3SRZ A;  3KVF A;  4TWF A;  3AEB A;  1WR6 A;  4HFC A;  1KNZ A;  4ZHQ E;  5JDL A;  4DV4 T;  2VL8 A;  4P0B A;  3FZH B;  3TLT A;  4HN9 A;  3ZMZ B;  3ZEF B;  5C2T A;  1AJ3 A;  4NIQ A;  5HEU A;  2KIN B;  3AA7 B;  3UUL A;  4WZX A;  5LGN B;  2NTX A;  3J7Y q;  4I50 E;  4DBR A;  2WS3 A;  2IHR 1;  5F8P A;  2XAJ B;  4EXT A;  2W63 A;  4TV9 E;  3RKO A;  2UXB T;  1T98 A;  3KIN B;  2Y48 B;  4U3C A;  4YY3 T;  2W61 A;  3AA6 B;  4X5T A;  2K9A A;  2IC6 A;  4DV0 T;  5BMV E;  4IDO A;  2B76 A;  3ZMT B;  2P9B A;  2K5B B;  3HI2 A;  1YKE B;  3QUJ A;  4TZ4 C;  4CN6 A;  5GON E;  2XAS B;  5KX5 E;  4EED A;  3OKQ A;  3SS1 A;  5JDN A;  5L2L A;  2L3L A;  5LMU T;  2E2A A;  2XQ9 A;  2H7O A;  4H9N C;  1Z8U A;  2IDO B;  4ZZB A;  4O4L E;  4OFZ A;  5L3E B;  5LJM A;  5JRC B;  2PG8 A;  3CPZ A;  5JTG A;  4YHJ A;  4TWD A;  2KZ7 B;  1E1H B;  3DTO A;  4YTN A;  2XPK A;  1CMX A;  3B13 A;  2PTF A;  1HF8 A;  4MAL A;  3A5X A;  4GK0 E;  3JC6 D;  5LBQ B;  5L3C B;  4O4I E;  2BS3 A;  4CN1 A;  4H9Q C;  3RH3 A;  2PJQ A;  5F3J A;  5M4Y A;  2JQH A;  5FXX A;  2N2N A;  1OED E;  4YLH A;  2YIN A;  3BQK A;  5TAO A;  3O1H A;  3MAC A;  3PUX F;  2M6I A;  5JDH A;  4IDN A;  4AKR B;  3RC8 A;  3RQU A;  3VKH A;  3CQX C;  2LRK A;  5AQL B;  2BBJ A;  2I59 A;  4UVB B;  3L8R A;  4AQY T;  4LF4 T;  3VU7 H;  3NKZ A;  3SFD A;  2X67 A;  4AXP A;  4DR5 T;  3F57 A;  2XQ6 A;  3AVR A;  3MA9 A;  4YFS A;  3IFW A;  5ADX L;  3AEG A;  5E0O A;  3C4W A;  3B57 A;  2WP9 A;  5AQG B;  2LSG A;  2AXD S;  2N1G A;  2XM2 A;  3F31 A;  3ZYM A;  4YSY A;  2BG9 B;  2DNX A;  4DR1 T;  3A7M A;  2DL1 A;  3C64 A;  4DR7 T;  1KEY A;  1US7 B;  2WDR A;  3D0T A;  3PJA J;  2NW8 A;  3N9Q A;  4PJN A;  4YJ2 E;  1S94 A;  2BKO A;  2C5I T;  2H88 A;  3PUY F;  4IIJ E;  4H9O C;  3ZJ2 A;  1G73 A;  1HG2 A;  3NRY A;  4CXY A;  3AE4 A;  3AVS A;  5HXC A;  5HAX A;  5FXV A;  4EZ4 A;  1NWM X;  3Q9D A;  4JI6 T;  2LM2 A;  1NAF A;  3KBT A;  3MZK B;  4Q25 A;  4DND A;  3N2K E;  3N9M A;  5FNV E;  4ANJ A;  5ABE A;  2UXD T;  3AE3 A;  3LK4 2;  3PUV F;  3PUZ F;  3RLF F;  3TLU A;  1T8B A;  4QH4 A;  3ZCI A;  1QLB A;  4EYU A;  3HA4 A;  3ZMV B;  3CX6 B;  5AQQ B;  5J2T E;  3CQG B;  3PUA A;  2IML A;  1I6Z A;  5DQV A;  3RI5 A;  2YDR A;  2CBJ A;  2GK9 A;  5FYM A;  2XSB A;  2BS4 A;  4H9P C;  4EZH A;  4IG7 A;  4ZI2 C;  3PE0 A;  2HPJ A;  5FKY A;  2FJB A;  2RP4 A;  3AEE A;  3BQL A;  3CQC B;  2DCF A;  3FHN A;  3NZQ A;  3Q5D A;  3ZMU B;  4A5X A;  2WB5 A;  3FBZ A;  4I0U A;  4ILC A;  2YU2 A;  5LYJ E;  4DM9 A;  4JI8 T;  3ZN1 B;  1YKH B;  2J1D G;  3HKD E;  2VQE T;  2WDV A;  2X0L B;  4GKK T;  2LEN A;  3PUS A;  4U7Y A;  1D0Z A;  2HHH T;  2ODV A;  5L3F B;  2MBG A;  4IHJ E;  4IST A;  4NPP A;  4UIG A;  1MMG A;  3RRC A;  1HS7 A;  4O2B E;  5EZY E;  2LT3 A;  1SHZ C;  2Q9Q C;  4IDQ A;  1MMD A;  5HEO A;  5L3D B;  4H63 H;  3H3M A;  1KFY A;  3KVB A;  3P7I A;  3HL6 A;  1XZY A;  3IEE A;  3ZCJ A;  1XNR T;  1OED C;  3LBX A;  5FVL A;  3OPC A;  3CKD A;  3FBL A;  5LMN T;  5HXR A;  4ILU A;  4UV9 B;  5H6R B;  2MAW A;  3ZT6 A;  3HKC E;  1FJG T;  3E08 A;  3DJB A;  2E9X D;  4MLK A;  2CPT A;  5JRE A;  1FEW A;  3CML A;  4QXH B;  3ZPO A;  3GMI A;  4I43 B;  4KUM B;  4DV7 T;  2JQK A;  5JDG A;  2ETL A;  2CWY A;  2HPL A;  2OA5 A;  4IE4 A;  5CGM A;  2X9W A;  4LFC T;  2FBW A;  4C91 A;  1HTJ F;  2D0U A;  5EK3 A;  4DUY T;  3ZC1 A;  3LFM A;  5L3G B;  1SUM B;  2I6H A;  2YK0 A;  4HFI A;  2UUA T;  1VCS A;  2ZM8 A;  2K3W A;  3LBX B;  2E5V A;  2CHN A;  4WBO A;  4EEB A;  4EYY R;  5JR9 A;  3GA8 A;  2LSJ A;  1SA0 E;  3L3P A;  2LOP A;  2WWU A;  4GOU A;  2IAK A;  2YOE A;  3FZF B;  5IYZ E;  4EOZ B;  2DLR A;  2W4X A;  3FZK B;  4HFH A;  1UK5 A;  2VKO A;  4H9S E;  2V7I A;  4PW8 A;  4DMW A;  4DV5 T;  3RII A;  2LJL A;  3HR0 A;  3MXZ A;  2CHO A;  3AE9 A;  3N9N A;  2HN1 A;  4JI2 T;  3VRA A;  2C0S A;  3AB3 B;  3E22 E;  2H3R A;  3MJX A;  4PJL A;  4TX5 A;  1U4Q A;  4OYK A;  4B3S T;  3O1I A;  4U72 A;  2E9X C;  3CWZ B;  5A1L A;  2QGS A;  3KV4 A;  4MBQ A;  3P4S A;  2XQ7 A;  1WYC A;  4U74 A;  4P0A A;  1WRD A;  4LF7 T;  5JR9 C;  4KHZ F;  3UU8 A;  1XD3 A;  4ILB A;  3Q5E A;  2V7L A;  3UQ7 A;  3KV6 A;  5ABH A;  5AQH B;  3AA1 B;  2N9D A;  1BR2 A;  5AQK B;  5CB4 E;  4NXN T;  1HNW T;  1UGO A;  3PUR A;  4XBF B;  2W67 A;  3AE2 A;  3JCF A;  1YXR A;  1Z0P A;  3NBX X;  2VQF T;  4TWH A;  4JI1 T;  2EHO A;  4DBQ A;  2HN2 A;  3PUG A;  5ETW A;  3ZLI A;  4AKG A;  2BDE A;  2XZE A;  4GYR A;  2WY2 A;  1E7P A;  2LE8 A;  4NUV A;  5IHY A;  3T1Y T;  4OX9 T;  3RKG A;  5KXJ A;  3QC9 A;  4B3T T;  5AQJ B;  2X9Y A;  3K3N A;  2WBL A;  3QNU A;  2WZH A;  4QH1 A;  4TV8 E;  1T7S A;  2XQA A;  3I1A A;  5AQM B;  3AAE B;  2FJD A;  2LHR A;  4IE5 A;  4ZOL E;  3KFW X;  4HFV A;  5DJQ C;  3RHW A;  3FXE B;  4AQF A;  4CI2 B;  3UQ4 A;  4ZI3 D;  4ZZC A;  2Q9Q D;  3ONJ A;  2D2S A;  4DV1 T;  3T8O A;  4ZI3 C;  5LHH B;  3EHZ A;  3U78 A;  2CRB A;  1EZ3 A;  1W9R A;  5FY0 A;  5BR8 T;  1HR0 T;  3ETU A;  2RA1 A;  2V7M A;  1M7K A;  2I0M A;  1LRZ A;  2YU1 A;  4B3R T;  2WMN A;  4E7Z A;  5JDM A;  2VKJ A;  3V5U A;  3PV0 F;  3AE5 A;  4YJ3 E;  4F8H A;  1HX8 A;  5L3B B;  4WYV A;  3B5M A;  3UUX B;  2PFV A;  4K0U A;  2CM0 A;  1YQ4 A;  2B1E A;  1HCI A;  2VUR A;  5FL1 A;  1H7C A;  3JAF A;  3O1J A;  1YD8 G;  2ZMA A;  1W0A A;  2XUE A;  1HG5 A;  3AE1 A;  4H63 V;  5AQU B;  1WR0 A;  3AEC A;  2V5D A;  3OYZ A;  3ZJ1 A;  2XHE B;  4UEM A;  5IUX A;  3AXJ B;  4BJN A;  3EUH A;  4JYA T;  4Z8X A;  2A9U A;  2MOZ A;  2V7J A;  4C90 A;  4IE7 A;  4HWD A;  5J2U E;  1D0X A;  3UUN A;  4UV8 B;  2LLY A;  3AE6 A;  2DWK A;  3BK9 A;  3C50 A;  4LF5 T;  4QXB B;  2X0H A;  3S4U A;  3UTK A;  2ZM6 T;  1MIV A;  5LG3 A;  3Q5X A;  4PNI A;  3RYH E;  4ERR A;  4QWN B;  5ABF A;  1IBL T;  5JRC A;  2UUB T;  3EVY A;  5L47 A;  3LDQ B;  3ZYL A;  2WAU A;  2G0U A;  3VHL A;  4YSZ A;  3JAE A;  5AFU L;  4HE8 A;  4HWI B;  3PDY A;  3RQW A;  1OXZ A;  3VR9 A;  4A98 A;  5HXH A;  4MFR A;  2JJ9 A;  2DHR A;  3UFE A;  4A97 A;  2X68 A;  3NRX A;  4WBN E;  1UUS A;  2WDQ A;  4PK5 A;  4ADZ A;  4IRE A;  5HYA A;  5JDQ A;  1XMO T;  1VRB A;  3EDV A;  4UR9 A;  2JQQ A;  4O8S A;  4L0R A;  3RIU A;  4AQG A;  1NEK A;  3CIR A;  2XQ8 A;  2JPF A;  3TLV A;  3ZN0 B;  2R6G F;  4PFP A;  4CI1 B;  1UX5 A;  2MTQ A;  2LHN A;  4DO0 A;  2NWB A;  4JI7 T;  5FY1 A;  2JMH A;  3P4R A;  2IC9 A;  4OYJ A;  3ZYK A;  1Y64 B;  1KNP A;  2H7V C;  4O4H E;  4DR2 T;  4B6X A;  3ZT7 A;  2NR4 A;  3IF8 B;  4U33 A;  4EV6 A;  4E7S A;  5DQW A;  4FI5 A;  4YSX A;  4ZI7 E;  3VKG A;  1N36 T;  4DVD A;  2YDQ A;  3K3Q C;  2XJ7 A;  4KX6 A;  3AAA B;  3ANW B;  4LMJ A;  3EDU A;  3CX8 B;  5FL0 A;  3RF1 A;  3A7S A;  5FXW A;  2SPC A;  3PTR B;  1MMN A;  2QRX A;  4JKJ A;  5AQS B;  3RIS A;  2BS2 A;  2ODU A;  2KT9 A;  2XQ5 A;  2VAS A;  1ZKE A;  4IDP A;  4U31 A;  3U3I A;  4UF0 B;  2Q9Q B;  2JIW A;  3ZKR A;  2MPK A;  1T72 A;  3SOL A;  1X79 A;  2RPA A;  4AKH A;  4JBW F;  1NEN A;  3IA3 A;  4TNV A;  2XSA A;  2QVA A;  1J5E T;  4I4T E;  3K3O A;  5KMG P;  5LB7 B;  3R6N A;  3AA0 B;  3G06 A;  3P4P A;  3O9X A;  4LMK A;  2L9Q A;  1ZV4 X;  4HWC A;  4K0K T;  2XAQ B;  3OBV E;  4UF0 A;  1HNZ T;  4JV5 T;  2W00 A;  4LF8 T;  3TB3 A;  5LG4 A;  1M62 A;  3P8C D;  4QX7 B;  3PU8 A;  4OK0 A;  4O4J E;  2V5C A;  2VVN A;  2X66 A;  2ZLY A;  2VKD A;  1B7T A;  3C4X A;  3I9W A;  5H6Q B;  1YQ3 A;  3AXJ A;  3UT5 E;  4DMV A;  1JNZ A;  1D1A A;  2YN6 A;  4DV3 T;  2F4V T;  3DP7 A;  1WCR A;  2WMO A;  4G2A A;  2NTY A;  1QUU A;  2YEV C;  3L09 A;  3RX6 A;  2VB6 A;  2J4G A;  4KP3 C;  5EK4 A;  2V1D B;  2WU2 A;  1WLX A;  1IBK T; 
#chains in the Genus database with same CATH homology
 3MK7 C;  3RYI E;  1OWA A;  3I0Q A;  4PAG A;  4JUY A;  2CWO A;  3JC6 C;  2W62 A;  2LSK A;  3LK2 B;  1FIO A;  2CXL A;  3QK6 A;  3ESL A;  4PK6 A;  3N5L A;  2Y6X A;  2ES0 A;  2KLQ A;  3KV9 A;  4EIW A;  4IDZ A;  3RRW A;  4BJM A;  3IHR A;  4CZZ B;  1WYB A;  4PFO A;  2KWI B;  5FP3 A;  4I55 E;  3LK3 B;  3IRT A;  3AAI A;  4BA9 A;  5LA6 E;  2VK9 A;  4M1P A;  4TUY E;  3N9L A;  2C5K T;  3GWH A;  3SWH A;  3K8P C;  3E0Z A;  2DWG A;  2C5J A;  2NW7 A;  4AI6 A;  3FB2 A;  2QA7 A;  4L9I A;  3WAK A;  1QSD A;  2ZM2 A;  3KVA A;  2E9X B;  2WSS V;  3RC3 A;  5LGT B;  2NW9 A;  1UX4 A;  4NUU A;  3V5S A;  4CXX A;  1IZN B;  2BZB A;  3GN5 A;  3IBP A;  3LG7 A;  4CI3 B;  2VKH A;  4X1K E;  2K24 A;  2X51 A;  1UCH A;  2K48 A;  3OJA A;  2ACX A;  4ASK A;  4V1A v;  4O2A E;  2JMK A;  5HWX A;  1D1B A;  1MIY A;  1HFA A;  1ZEE A;  4AKL A;  3HKE E;  3ETV A;  2CCQ A;  3N9O A;  2E8I A;  3W15 B;  3N9P A;  4X1Y E;  3RYF E;  1MIW A;  3NZP A;  5LGU B;  4MHC A;  3ANW A;  4IGU A;  4GYS A;  3I0O A;  5JDF A;  1IJ5 A;  4WNK A;  5JVD E;  3H37 A;  5J1G A;  1U5P A;  1IAP A;  4HTE A;  1D1C A;  5LOV E;  5HWY A;  4EAH A;  1KK7 A;  2CE7 A;  3ZC0 A;  2NP9 A;  4OHF A;  2WM9 A;  1BR0 A;  4A56 A;  4WW0 A;  2A72 A;  4I6N A;  2CXF A;  3ZMS B;  4BAY B;  5LXT E;  4KMC A;  4X1I E;  1G8X A;  3PU3 A;  4ZS3 A;  4G63 A;  2HH7 A;  1CUN A;  2NOX A;  5JQG E;  1ZHC A;  4JEH B;  5KDM C;  4PK4 A;  5EK2 A;  1MNE A;  5LCY A;  5LNK A;  4EB6 E;  2A2F X;  3H3A A;  2CLY C;  2CEA A;  3Q2M A;  2Y8D A;  4QKN A;  2KMF A;  5HXS A;  5LP6 E;  2MYS A;  2VWA A;  2Z6E A;  5C8Y E;  1LKX A;  1S35 A;  3CX7 B;  4XZC A;  4CXW A;  1BR1 A;  2CA5 A;  4YLH A;  3UUM A;  4ZI2 D;  1MMA A;  2KWH A;  3C98 B;  4XAX B;  2Q9Q A;  2XAG B;  5JR9 B;  4L5G A;  4P09 A;  3HKB E;  3LJC A;  2E9X A;  3O4X E;  4UVA B;  4X20 E;  2CXD A;  2EHO C;  4GK5 E;  2L8K A;  4HKA A;  3KBU A;  3N2O A;  2LSY A;  3C4Z A;  1LVK A;  4UXN B;  4QX8 B;  2A3D A;  2V7K A;  1FMV A;  4HEA A;  4J2C A;  2LSI A;  5FXZ A;  3OYX A;  4TN7 B;  3J9X 1;  4AQF C;  3BQI A;  3N2G E;  3FXD B;  1UCU A;  4GIW A;  2XQY A;  4H9R C;  1IJ6 A;  2DI4 A;  4QHO A;  2BVM A;  4CQI A;  5LHI B;  3R84 B;  2JRK A;  4IE0 A;  2LM9 A;  3MKD A;  1O3X A;  2D0T A;  4HGA A;  3F2E A;  2D5U A;  5CA0 E;  4JEU B;  5FY7 A;  1D0Y A;  2W0G A;  5DAB A;  1MND A;  1V9D A;  2EHO D;  5HXE A;  2UXX B;  1VOM A;  1YW0 A;  2UXN B;  3I9Y A;  5LHG B;  2KND A;  2KXP B;  4UVC B;  2EHO B;  2LEH A;  3KDS E;  3Q5W A;  4PJJ A;  4ZI3 D;  4QXC B;  3ONX A;  5FMN A;  3WAJ A;  2X9X A;  2V26 A;  3PUQ A;  4N78 D;  3KW5 A;  2XTL A;  2BVL A;  5CA1 E;  2XAH B;  3C51 A;  5LJN A;  2XAF B;  4IE6 A;  2M67 A;  4PJM A;  1FMW A;  2PBI A;  3GN5 B;  2CMR A;  3M65 A;  2IW5 B;  3RYC E;  4FJO A;  2ZM0 A;  4KBM B;  4ZS2 A;  3KV5 A;  2CLY B;  2X9H A;  3CVR A;  3WI3 A;  4ISS A;  4F6R C;  5JH7 E;  1BR4 A;  3RPU A;  2LOS A;  3TKL B;  1LVF A;  4JLE A;  5LBM A;  3SRZ A;  3KVF A;  1WR6 A;  1KNZ A;  4ZHQ E;  5JDL A;  2VL8 A;  4P0B A;  3ZEF B;  1AJ3 A;  4HN9 A;  3ZMZ B;  2KIN B;  3AA7 B;  3UUL A;  5LGN B;  2NTX A;  3J7Y q;  4I50 E;  4DBR A;  5F8P A;  2XAJ B;  4EXT A;  2W63 A;  4TV9 E;  3RKO A;  1T98 A;  3KIN B;  2Y48 B;  2W61 A;  3AA6 B;  2K9A A;  2IC6 A;  5BMV E;  3ZMT B;  2P9B A;  2K5B B;  3HI2 A;  1YKE B;  3QUJ A;  4TZ4 C;  5KX5 E;  5GON E;  2XAS B;  3OKQ A;  3SS1 A;  5JDN A;  5L2L A;  2L3L A;  2H7O A;  4H9N C;  5L3E B;  5LJM A;  4O4L E;  4OFZ A;  5JRC B;  2PG8 A;  3CPZ A;  4YHJ A;  2KZ7 B;  1E1H B;  3DTO A;  1CMX A;  3B13 A;  1HF8 A;  4MAL A;  3A5X A;  4GK0 E;  3JC6 D;  5LBQ B;  5L3C B;  4O4I E;  4H9Q C;  3RH3 A;  2PJQ A;  5F3J A;  5M4Y A;  5FXX A;  2N2N A;  2YIN A;  3BQK A;  5TAO A;  3O1H A;  3MAC A;  5JDH A;  3RC8 A;  4AKR B;  3VKH A;  3CQX C;  2I59 A;  4UVB B;  3VU7 H;  2X67 A;  4AXP A;  3F57 A;  4YFS A;  3AVR A;  3MA9 A;  3IFW A;  5ADX L;  5E0O A;  3C4W A;  3B57 A;  2LSG A;  3F31 A;  2N1G A;  3ZYM A;  2DNX A;  3C64 A;  3D0T A;  1US7 B;  2NW8 A;  3N9Q A;  4PJN A;  4YJ2 E;  1S94 A;  2C5I T;  4IIJ E;  3ZJ2 A;  4CXY A;  4H9O C;  1G73 A;  1HG2 A;  3NRY A;  3AVS A;  5HXC A;  5HAX A;  5FXV A;  4EZ4 A;  1NWM X;  3Q9D A;  1NAF A;  3KBT A;  3MZK B;  4DND A;  3N2K E;  3N9M A;  5FNV E;  4ANJ A;  3LK4 2;  4EYU A;  3ZCI A;  3HA4 A;  3ZMV B;  3CX6 B;  5J2T E;  3CQG B;  3PUA A;  5DQV A;  5FYM A;  2GK9 A;  4H9P C;  4EZH A;  4IG7 A;  4ZI2 C;  3PE0 A;  2HPJ A;  2RP4 A;  3CQC B;  3BQL A;  3NZQ A;  2DCF A;  3FHN A;  3ZMU B;  3FBZ A;  2YU2 A;  5LYJ E;  4DM9 A;  3ZN1 B;  1YKH B;  2J1D G;  3HKD E;  2X0L B;  3PUS A;  1D0Z A;  2ODV A;  5L3F B;  2MBG A;  4IHJ E;  4IST A;  4UIG A;  1MMG A;  3RRC A;  1HS7 A;  4O2B E;  5EZY E;  2LT3 A;  1SHZ C;  2Q9Q C;  1MMD A;  5L3D B;  4H63 H;  3KVB A;  3P7I A;  3HL6 A;  3IEE A;  3ZCJ A;  3LBX A;  3CKD A;  3FBL A;  5HXR A;  4ILU A;  4UV9 B;  5H6R B;  3HKC E;  3E08 A;  3DJB A;  2E9X D;  4MLK A;  5JRE A;  1FEW A;  3CML A;  4QXH B;  3ZPO A;  3GMI A;  4I43 B;  4KUM B;  2ETL A;  5JDG A;  2CWY A;  2HPL A;  2OA5 A;  4IE4 A;  2X9W A;  4C91 A;  1HTJ F;  2D0U A;  5EK3 A;  3ZC1 A;  3LFM A;  5L3G B;  2YK0 A;  2ZM8 A;  3LBX B;  4WBO A;  4EYY R;  5JR9 A;  3GA8 A;  2LSJ A;  1SA0 E;  3L3P A;  2LOP A;  2WWU A;  4GOU A;  2IAK A;  5IYZ E;  4EOZ B;  2DLR A;  4H9S E;  2VKO A;  4PW8 A;  2V7I A;  4DMW A;  3RII A;  2LJL A;  3HR0 A;  3MXZ A;  3N9N A;  2LEN A;  2C0S A;  3AB3 B;  3E22 E;  2H3R A;  3MJX A;  4PJL A;  4TX5 A;  1U4Q A;  4OYK A;  3O1I A;  4U72 A;  2E9X C;  3CWZ B;  5A1L A;  2QGS A;  3KV4 A;  4MBQ A;  4U74 A;  4P0A A;  1WYC A;  1WRD A;  5JR9 C;  1XD3 A;  2V7L A;  3KV6 A;  3AA1 B;  2N9D A;  1BR2 A;  5CB4 E;  4XBF B;  4AKI A;  3PUR A;  1Z0P A;  3NBX X;  2EHO A;  4DBQ A;  3PUG A;  5ETW A;  3ZLI A;  4AKG A;  2BDE A;  4GYR A;  2LE8 A;  4NUV A;  5IHY A;  3QC9 A;  2X9Y A;  3K3N A;  2WBL A;  4TV8 E;  3I1A A;  3AAE B;  2LHR A;  4IE5 A;  4ZOL E;  4CI2 B;  3KFW X;  4HFV A;  5DJQ C;  4AQF A;  3FXE B;  2Q9Q D;  2D2S A;  3T8O A;  4ZI3 C;  5LHH B;  3U78 A;  1EZ3 A;  5FY0 A;  3ETU A;  2RA1 A;  2V7M A;  2YU1 A;  1LRZ A;  2WMN A;  4E7Z A;  5JDM A;  2VKJ A;  3V5U A;  4YJ3 E;  1HX8 A;  5L3B B;  3UUX B;  2PFV A;  4K0U A;  2CM0 A;  2B1E A;  1HCI A;  1H7C A;  3O1J A;  1YD8 G;  2ZMA A;  2XUE A;  4H63 V;  1HG5 A;  3ZJ1 A;  3OYZ A;  2XHE B;  4UEM A;  4BJN A;  3EUH A;  4Z8X A;  2MOZ A;  2V7J A;  4C90 A;  4IE7 A;  5J2U E;  1D0X A;  3UUN A;  4UV8 B;  2DWK A;  3BK9 A;  3C50 A;  4QXB B;  3S4U A;  3UTK A;  1MIV A;  3Q5X A;  4PNI A;  3RYH E;  4ERR A;  4QWN B;  5JRC A;  3EVY A;  3ZYL A;  2WAU A;  2G0U A;  3VHL A;  5AFU L;  4HE8 A;  3PDY A;  1OXZ A;  5HXH A;  4MFR A;  2JJ9 A;  2DHR A;  3UFE A;  2X68 A;  3NRX A;  4WBN E;  4PK5 A;  4ADZ A;  5HYA A;  5JDQ A;  1VRB A;  3EDV A;  4AQG A;  2JQQ A;  4O8S A;  4L0R A;  2JPF A;  3ZN0 B;  4PFP A;  4CI1 B;  1UX5 A;  2MTQ A;  2LHN A;  4DO0 A;  2NWB A;  5FY1 A;  2JMH A;  2IC9 A;  4OYJ A;  3ZYK A;  1Y64 B;  2H7V C;  4O4H E;  4B6X A;  3IF8 B;  4E7S A;  5DQW A;  4FI5 A;  4ZI7 E;  3VKG A;  4DVD A;  3K3Q C;  3AAA B;  3ANW B;  3EDU A;  3CX8 B;  3A7S A;  5FXW A;  2SPC A;  3PTR B;  1MMN A;  4JKJ A;  3RIS A;  2ODU A;  2KT9 A;  2VAS A;  1ZKE A;  3U3I A;  4UF0 B;  2Q9Q B;  3SOL A;  1X79 A;  4AKH A;  4I4T E;  3K3O A;  5KMG P;  3R6N A;  3AA0 B;  3O9X A;  2L9Q A;  1ZV4 X;  2XAQ B;  3OBV E;  4UF0 A;  2W00 A;  3TB3 A;  5LG4 A;  4QX7 B;  3P8C D;  4UEL A;  3PU8 A;  4OK0 A;  4O4J E;  2ZLY A;  3C4X A;  2X66 A;  3I9W A;  2VKD A;  1B7T A;  5H6Q B;  3UT5 E;  4DMV A;  1D1A A;  3DP7 A;  2WMO A;  4G2A A;  2NTY A;  1QUU A;  2YEV C;  3L09 A;  3RX6 A;  2VB6 A;  4KP3 C;  5EK4 A;  2V1D B;  1WLX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...