3IHRA

Crystal structure of uch37
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
Knots found
sequence length
305
structure length
282
Chain Sequence
EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFAAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase isozyme L5
publication title Structural characterization of human Uch37.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 282
sequence length 305
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
A PF18031 UCH_C Ubiquitin carboxyl-terminal hydrolases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ihrA02
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 3ihrA01
4I6NA 1UCHA 1CMXA 1XD3A 2LENA 3IHRA 3IRTA 2ETLA 3RIIA 3IFWA 3A7SA 4DM9A 3RISA 3TB3A 4IG7A 3KW5A 3KVFA 4JKJA 4UEMA 4UELA
chains in the Genus database with same CATH superfamily
4L0RA 4JBWF 4EZ4A 4DO0A 5LHIB 3W15B 5IHYA 5LG3A 4EV6A 1G8XA 3TB3A 4IE0A 2EHOB 3M65A 2DWKA 1HS7A 2CLYC 2UUAT 4DV1T 4A56A 2IUBA 3R6NA 5FY7A 2DCFA 3SOLA 2VK9A 2LSJA 4QKNA 3UU6A 3P4PA 1NENA 5LXTE 4OHFA 3AVRA 1ZEEA 3I0OA 3I1AA 5JDFA 3OJAA 4HFDA 2JQQA 2V1DB 5TAOA 3VHLA 1IBKT 2N9DA 2XJ7A 4X1IE 1XZYA 4KHZF 2LOPA 4JI7T 5AQKB 4U74A 1YQ4A 2LLYA 2X67A 2W61A 4CXYA 4QX7B 3A7MA 3VKGA 3TLVA 2BG9A 2H88A 2VQET 1GQEA 3N9OA 2BBHA 3ZYKA 4AKHA 4NIQA 1JNZA 2UU9T 3ONXA 3HR0A 4ZHQE 2K24A 5L2LA 2X51A 4A98A 1KFYA 2XSBA 4WW0A 3N5LA 5FMNA 4TX5A 2X0YA 3AEAA 1J5ET 2WMOA 2NP9A 4ILCA 1WR0A 4JI5T 1W9RA 4LFCT 5HEOA 4C90A 2Y8DA 2ACZA 4X65T 3OPCA 2E5VA 2A2FX 2IC9A 2WCAA 1US7B 3OYXA 4AQFC 2DL1A 4B6XA 5LMNT 2M6IA 4GOUA 2E9XC 5AQMB 2JQHA 3C50A 4AKIA 5HCMA 1HNXT 2HHHT 2J62A 5AQHB 3K3NA 4LF8T 4NXNT 3AAIA 3PUVF 3T8OA 2RP4A 4P0AA 4EEBA 5ABEA 2BVLA 3BK9A 4I0UA 3PTRB 2HPLA 3K3QC 3UT5E 1MMNA 4X5TA 3UQ4A 3LSVA 4HFHA 4WYVA 5JVDE 4DVDA 1FJGT 2YU2A 3RPUA 1MIVA 3ZMZB 1VCTA 1D1CA 1MMGA 2CLYB 4B3TT 4OX9T 2BS3A 3MK7C 2CHOA 3GWHA 5FXVA 5ABFA 3EVYA 3Q2MA 1FMWA 2WDQA 4CI3B 2C5JA 5LMUT 4QX8B 4BJNA 4CI1B 4EOZB 4YSYA 2MPKA 1HNWT 1OEDE 3SWHA 1HX1B 3AAEB 4EAHA 3AXJA 5AQFB 3IRTA 5FXXA 1KNZA 4HGAA 5EK4A 4TZ4C 3RC3A 1XNRT 4M1PA 4B3RT 1D1BA 3J9X1 4J2CA 3U78A 3P4WA 3EABA 5J2TE 4ZI3C 1UGOA 2UXXB 3QK6A 5BR8T 3FXEB 3RH3A 1I94T 2WDVA 4I6NA 4PW8A 1T7SA 2FJDA 3QOFA 4LF6T 1HFAA 3E22E 4I55E 4IGUA 3VR9A 3WAJA 2L9QA 5FKYA 5LHHB 2H7VC 2UXDT 3JAEA 4I50E 4QXHB 4ILBA 2E9XD 2X9YA 2OA5A 3CX8B 2ZM6T 3LDQB 5JDNA 4H9NC 2XQYA 1U5PA 2XQAA 4ZS2A 3NBXX 4EXTA 1ZV4X 2YU1A 3S4UA 4LF5T 2IW5B 3AE2A 4CI2B 3L39A 2LHRA 4OFZA 1M7KA 1E7PA 2ZMAA 5GONE 3Q5WA 1I6ZA 3PUYF 2CRBA 5AQJB 2FJAA 5EK3A 2E9XB 2J4GA 4KP3C 5AQPB 4DMVA 2D5UA 3LK2B 3IFWA 2YEVC 1W0AA 5LBMA 4B3MT 2X66A 1U4QA 2W63A 4X1YE 3ZT6A 1N32T 4XBFB 4UV9B 3CX6B 1WFDA 5AQUB 2MOZA 2KNDA 4DV3T 2BKOA 1MNDA 2WZHA 1WR6A 2A3DA 2E9XA 2BG9C 3AA1B 3HKBE 3C51A 4AISA 4KBMB 3ZC1A 1N34T 3NVOA 5KX5E 4IG7A 3FXDB 1JNRA 2Y48B 2VKHA 4TWFA 2ZM0A 2BKNA 4V1Av 2Q9QD 3I9YA 1T98A 4HTEA 4Z8XA 3CMLA 3IHRA 5H6RB 2IIUA 3NWIA 4WBNE 2IC6A 4AI6A 1HNZT 4KX6A 2JQ9A 5LNKA 3LBXB 4B3ST 2M67A 1D0XA 2VKOA 4ZZBA 4DBQA 3KVAA 5AQQB 3EDUA 3RIFA 3QB5K 4U31A 4ILUA 1YKEB 4G2AA 4H9QC 1XNQT 4A5XA 2XAGB 2D0UA 2D9DA 5LGNB 3VRAA 3A8YC 2V6YB 3PDYA 2ZM8A 2LEHA 4KUMB 1NEKA 2CA5A 2GK9A 3EDVA 4IREA 5FXWA 2Q9QA 5C8YE 3AE3A 4HWHA 5AQSB 2K48A 3N9PA 3ZYLA 5FY1A 1VRBA 2V6YA 3JC6C 2LRLA 2ODUA 5L3BB 5LA6E 3RIUC 1D0ZA 4CZZB 4X64T 4EB6E 4DV6T 4IL4A 3FBZA 4U7YA 3FZFB 3FBLA 4ZXLA 3NRXA 3UU5A 3FHNA 3DJBA 1Z0PA 4EEDA 1UX5A 1KK7A 3OBVE 1FMVA 4XZCA 5AQOB 4YHJA 4XAXB 3WI3A 4H9RC 5HXHA 4Z91A 4IDQA 2L3LA 3RYFE 3AE5A 5HXSA 5L3GB 5LBQB 5M4YA 5LGUB 2XPKA 4BA9A 1M62A 5F5WA 2LSGA 2X9HA 2NW9A 5LHGB 5L3DB 3ONJA 4L5GA 5HYAA 4NUVA 3CIRA 3RI5A 2NWBA 4EIWA 5LYJE 4DR4T 5FL0A 3TLSA 3O4XE 5CFBA 2WY2A 3IBPA 4ZI7E 3LJCA 5AQNB 3DP7A 3ZLIA 2WS3A 3EI0A 4U2YA 2BG9B 2JRKA 4NPPA 4GK0E 2LT3A 5FYMA 5F3JA 3ONLC 2NW8A 1D0YA 1IJ6A 3ZT7A 3ABVA 3O1IA 4JYAT 3ESLA 3UQ7A 4JV5T 3QB5A 5C2TA 4DNDA 4HFEA 5J1GA 4C91A 4TNVA 2I0MA 3BQIA 2WWVA 4WZXA 4FJOA 1BR1A 3N9NA 3A5XA 1HG2A 3GN5B 2VVNA 5FXZA 3RKOA 4HFBA 1BR0A 1N33T 3KFWX 2H3RA 2E2AA 5KMGP 3KVBA 5DQVA 5ABGA 4OK0A 1W09A 3UUMA 4QH5A 3ETVA 4E7SA 2LRKA 3BQKA 4U3CA 3GN5A 2XM2A 1CHUA 2XQ5A 2B76A 4ADZA 1BR4A 4YXDA 3RRWA 3JC6D 1IZNB 3ZCJA 5AQTB 4LF4T 5L3CB 2BVMA 4TWHA 2JPFA 4KHPT 2BDEA 4YJ2E 1S35A 3Q5EA 2CWOA 3N9MA 4TV8E 1X79A 2CPTA 5FVLA 4PK5A 2XUEA 2V7IA 3UULA 2CBIA 4WBOA 3L8RA 1KF6A 3O1JA 2BKPA 3B5MA 4PFOA 2YDRA 4PJJA 3CWZB 5HAXA 4CN1A 5LG4A 3SRZA 4O4HE 2XAFB 3ZT5A 2WDRA 3FZLB 2J1DG 2MAWA 3RYHE 3PUXF 2LENA 3PJAA 3B57A 3ZSTA 4PK6A 4HFIA 5DQWA 2LKHA 1ZP0A 3L09A 2E8IA 2QVAA 2HN2A 2XQ6A 2UXCT 2QA7A 4AKGA 2XAHB 4ILAA 3I9WA 5JDLA 3R84B 3ZMUB 3PU8A 3BQLA 4MFRA 4AQYT 3RIUA 3PUWF 2PFVA 4P0BA 3RISA 2UXNB 3SS1A 3KW5A 3RF1A 1J1JA 4A97A 1YQ3A 5JRCA 4YSZA 2UUBT 2WAUA 3RKGA 5ABFB 3CQCB 3HL6A 4HWIB 3E0ZA 2K9AA 4YTMA 1CMXA 4G63A 3T1YT 3CQXC 2X9XA 3PURA 4DR7T 2DNXA 3CPZA 5JQGE 3AXJB 5JR9A 4O2BE 3LFMA 4ZOLE 1OXZA 2XZEA 3RIAA 2Q9QC 2QYWA 3WAKA 4UIGA 2YDQA 2RA1A 1J5WA 3ANWA 2XASB 4DBRA 4IDNA 2AXDS 3UUBA 2KZ7B 3AA0B 2H89A 4IE5A 4P09A 4LF7T 2YN6A 2CCQA 3MJXA 1NWMX 1VOMA 3N2GE 3RC8A 1XDOA 5L4HA 5L47A 3P50A 4PJNA 4IL9A 3ZMSB 1OWAA 3P4SA 4I4TE 4EGWA 4NXMT 2IHR1 2LJLA 3DTOA 2XTLA 3AE1A 2G0UA 2XAQB 3ZMVB 4HWCA 3Q5DA 3N9QA 4UF0A 2SPCA 4O2AE 5FL1A 4HKAA 2K3WA 3UU4A 3C98B 1N36T 4HN9A 5AQIB 3ZPOA 1B7TA 2FJBA 1BR2A 1IJ5A 4X62T 4ZI2D 2QGSA 4LFBT 3K3OA 4DR5T 1S94A 2D2SA 4U7IA 3FB2A 4ISSA 5JREA 1LVKA 2WP9A 2JQKA 2QRXA 2A9UA 1FIOA 2HPJA 3D0TA 2IAKA 2K5BB 3HI2A 5JDGA 2ES0A 2MBGA 3AEEA 4YT0A 1QLBA 4OYKA 4X20E 4DV5T 3NKZA 4IE7A 5AQLB 2OLTA 3I0QA 2C5KT 2XY8B 2V7LA 4YLHA 2W62A 4U33A 4HFCA 1ZHCA 3HKCE 1H7CA 3UUXB 3RLFF 2I59A 4E7ZA 3RHWA 5CA0E 1SA0E 5KDMC 4LMJA 2V26A 2BG9E 4AIUA 2D0TA 5DJQC 3E08A 3PUSA 4JKJA 1KNRA 2HH7A 3C64A 2XQ8A 1LRZA 3AE6A 3VKHA 4AXPA 3AEGA 4ZEYA 1UCUA 2CWYA 4H63H 3N2KE 4EYYR 1D1AA 3TLTA 2IDOB 4GIWA 1HTJF 2M6BA 4NUUA 4TWDA 4JI3T 2JMHA 3C4WA 4ASKA 2UXBT 4AKRB 1HR0T 1XWMA 4K0UA 2LSYA 4FI5A 5A1LA 2ODVA 5CGMA 2V5DA 3AA7B 1IAPA 4COFA 2Q9QB 2X9WA 4OYJA 5JDHA 2LE8A 2YOEA 1SUMB 4YTNA 2W66A 3AEBA 4UVCB 4YSXA 3RYCE 4EYUA 1SE7A 4JUYA 3F31A 2V8SV 2B1EA 4MALA 2VURA 1ZKEA 4QHOA 2LHNA 4UVAB 5AQRB 4IDZA 3PUQA 3CX7B 1XMQT 3UFGA 1MMAA 2NTYA 4JEHB 3KV6A 2DWGA 4F8HA 3ZMTB 3GA8A 2CEAA 2J47A 3N2OA 1OEDA 3KV5A 3X1DA 3M3ZB 4O8SA 4GYRA 3EUHA 3HKEE 4CN4A 4O4JE 2LSIA 4HWDA 4X1KE 2KWIB 5HXCA 1R8IA 5HEHA 4LF9T 1YXRA 2VVSA 5HWYA 4ZS3A 4DR6T 2XM1A 2F4VT 4YFSA 4UR9A 1Y01A 2EHOD 1X9BA 2E5LT 3O9XA 2UUCT 5JR9C 5ETWA 5AFUL 2VASA 4JI4T 3K8PC 3VRBA 4HE8A 3UU3A 2CXFA 3RQWA 3KV4A 3PUZF 1V9DA 5L3EB 2VKDA 3JAFA 2FBWA 3CVRA 2JIWA 2NTXA 4HFVA 2CMRA 3UUNA 3OVUA 3ZC0A 2CXDA 5FVKA 4U2ZA 2KT9A 2VB6A 2R6GF 4DR1T 3UU8A 2LM9A 3Q5XA 3TLWA 4AKLA 3F2EA 4PFPA 4O4IE 1MIWA 2EHOA 5J2UE 2KMFA 2IMLA 4TUYE 3ZN0B 1LKXA 2Z6EA 1UCHA 2VWAA 4P1NA 1XMOT 1VCSA 2H7OA 4PAGA 5J0ZA 3AE9A 5HEJA 4WNKA 3QC9A 5LOVE 3NRYA 4QXBB 3P7IA 5CA1E 4UXNB 4YTPA 3P4RA 2ZM2A 2PG8A 4DR2T 2YINA 5EK2A 3AVSA 1XDPA 2XSAA 2WZIA 3SFDA 2RPAA 3JADA 3AE4A 5LB7B 1HX8A 2XQ4A 2VQFT 5CJ5A 3PUGA 2XHEB 5LJMA 3IA3A 5AQVB 2FJEA 4H9OC 4MHCA 5E0OA 1MNEA 5EZYE 1MMDA 3OKQA 4CXXA 1SHZC 2W2UA 3G06A 5ADXL 4X66T 1WLXA 2W4XA 2WSSV 4ZI2C 2BZBA 4DR3T 3IF8B 4YHHT 1HF8A 4ERRA 5LGTB 1KEYA 4ANJA 4IIJE 3PJAJ 2KSRA 5IYZE 3ZKRA 5JRCB 1UX4A 2LKGA 3MACA 2ZLYA 4IE4A 2JJ9A 2HN1A 3ZYMA 1ZOYA 3AEDA 4DIDB 4K0KT 5JDQA 3AE8A 3HKDE 3CQGB 4DV7T 3KVFA 5ABHA 4UELA 3K1SA 3J7Yq 2VL0A 4DV0T 3LG7A 4CN6A 2ETLA 3F57A 5JR9B 2CBJA 2DI4A 3ZJ2A 3T1HT 4LMKA 4UV8B 2WMNA 2AE9A 3SFEA 3ANWB 2YK0A 2Y6XA 4IE6A 3FZHB 2YKSA 3P8CD 1WYBA 4H9SE 4PNIA 3A7SA 1E1HB 1HG5A 2VKJA 3OTOT 1NAFA 3ZSSA 4PJMA 2PJQA 4HWFA 1WRDA 1YD8G 5FP3A 2N1GA 5H6QB 2XAJB 3V5SA 1UURA 2WM9A 4QXCB 5AQGB 5IUXA 4L9IA 3NZQA 4JI1T 1OEDC 4HEAA 4IDPA 1IBLT 2MYSA 4JEUB 5HCJA 2KLQA 3KBTA 2WBLA 1UUSA 4TN7B 2MTQA 4UF0B 1LVFA 2ACXA 4AQGA 2A72A 5LCYA 2VL8A 5CB4E 5FNVE 4IHJE 2X0HA 3EHZA 2WB5A 3MXZA 2C5IT 4MBQA 3RYIE 4JI8T 3AA6B 5DABA 4LMLA 3AE7A 4ISTA 3VU7H 4QWNB 2CM0A 4KMCA 3U3IA 2XQ9A 5JH7E 3CKDA 5JTGA 2PTFA 4GKKT 2XQ7A 1W0BA 2W00A 4MLKA 2BBJA 2WU5A 4BJMA 5HXEA 4U72A 4O4LE 2LM2A 1UK5A 2CXLA 2BS2A 4GKJT 4JI2T 5FY0A 2KWHA 2LSKA 3KINB 3Q9DA 3MZKB 3ETUA 1E2AA 5KXJA 3RIIA 1KNPA 3PU3A 3IEEA 5C3JA 2FUPA 3ZJ1A 2L8KA 2W0GA 2V7JA 2EHOC 3V5UA 2X0LB 3RGLA 4KI0F 5LJNA 3LK42 3H37A 3MA9A 2P9BA 4UEMA 3KBUA 2NOXA 3H3MA 2KXPB 2C0SA 1O3XA 4JI0T 4DV2T 3C4ZA 2YDSA 2BS4A 4Q25A 3AECA 2LOSA 4DUYT 5LP6E 2V7KA 1YW0A 4DUZT 3L3PA 3N9LA 4F6RC 1Y64B 5HXRA 2KINB 4AQFA 4IDOA 1WCRA 1XD3A 2OV9A 1CUNA 4EZHA 4H63V 1AJ3A 5F8PA 3QUJA 3NZPA 3RX6A 4N78D 3ZCIA 1QUUA 3UFEA 2PBIA 5IWAT 3GMIA 4YJ3E 5HWXA 3O1HA 4UVBB 3PV0F 3UTKA 5JDMA 2NR4A 5HEGA 4TV9E 3EAMA 4QH1A 4CQIA 3KV9A 4DMWA 2WWUA 4GK5E 2X68A 2W67A 3TKLB 3PUAA 4YY3T 5L3FB 4LFAT 4IT4A 2NW7A 4DM9A 1EZ3A 5BMVE 3AAAB 4QH4A 4Z90A 1WYCA 3B13A 4JI6T 1OEDB 4ZI3D 3HA4A 1YKHB 5HEUA 3MKDA 3LBXA 1IBMT 3PE0A 3OYZA 1T72A 3P4QA 4DV4T 2WU2A 4BAYB 1Z8UA 5L4EA 1T8BA 3QNUA 3CK6A 2CE7A 2V7MA 4CXWA 1MIYA 1QSDA 2N2NA 1G73A 2V6XA 3VR8A 4ZZCA 3FZMB 2DHRA 4JLEA 1HCIA 3AEFA 4PK4A 3ZN1B 2CHNA 3JCFA 2I6HA 1FEWA 3FZKB 3TLUA 3LK3B 2V5CA 3RQUA 1DU2A 4TNWA 1L0VA 3ZEFB 3AB3B 4I43B 2WQYA 3H3AA 4PJLA 3C4XA 3KDSE 4GYSA 2DLRA 2JMKA 2XQ3A 4H9PC 3RRCA
chains in the Genus database with same CATH topology
2VKHA 4L0RA 2ZM0A 4V1Av 4EZ4A 4DO0A 4PJNA 1MMDA 3OKQA 3ZMSB 5LHIB 1OWAA 2Q9QD 3I9YA 1T98A 4CXXA 4HTEA 4I4TE 4Z8XA 3CMLA 3IHRA 5H6RB 1SHZC 3W15B 5IHYA 4WBNE 5ADXL 2IC6A 4AI6A 1G8XA 1WLXA 4IE0A 2EHOB 3TB3A 3M65A 2WSSV 4ZI2C 2BZBA 2DWKA 1HS7A 2LJLA 3IF8B 2CLYC 3DTOA 4A56A 1HF8A 4ERRA 3R6NA 5LGTB 5LNKA 3LBXB 2XTLA 5FY7A 2DCFA 3SOLA 4ANJA 4IIJE 2VK9A 2G0UA 2M67A 2XAQB 3ZMVB 1D0XA 2VKOA 2LSJA 4QKNA 4DBQA 3KVAA 5IYZE 5JRCB 1UX4A 3MACA 3N9QA 2ZLYA 4IE4A 4UF0A 2JJ9A 2SPCA 3ZYMA 3EDUA 5LXTE 4O2AE 4OHFA 5JDQA 3AVRA 1ZEEA 4HKAA 3C98B 3I0OA 3HKDE 3I1AA 3CQGB 4HN9A 3ZPOA 3KVFA 5JDFA 4ILUA 1YKEB 1B7TA 4UELA 3J7Yq 1BR2A 1IJ5A 3OJAA 4G2AA 4H9QC 2JQQA 2XAGB 2D0UA 4ZI2D 2V1DB 5TAOA 3VHLA 5LGNB 2N9DA 2QGSA 3K3OA 4X1IE 3LG7A 2ETLA 3PDYA 2ZM8A 2LEHA 4KUMB 3F57A 5JR9B 2CA5A 2GK9A 1S94A 2D2SA 2DI4A 2LOPA 3ZJ2A 4U74A 3FB2A 2X67A 4ISSA 4UV8B 5JREA 3EDVA 5FXWA 2W61A 1LVKA 2Q9QA 5C8YE 4CXYA 2WMNA 4QX7B 3VKGA 1FIOA 2HPJA 2K48A 3D0TA 3ANWB 2IAKA 2YK0A 2Y6XA 4IE6A 2K5BB 3HI2A 5JDGA 3N9PA 2ES0A 3ZYLA 3P8CD 5FY1A 2MBGA 3N9OA 1WYBA 1VRBA 3JC6C 4H9SE 3ZYKA 4PNIA 2ODUA 3A7SA 1E1HB 5L3BB 5LA6E 4AKHA 4OYKA 1D0ZA 1HG5A 2VKJA 4X20E 4CZZB 1NAFA 4EB6E 3ONXA 4PJMA 3HR0A 4IE7A 4ZHQE 2K24A 5L2LA 3I0QA 2C5KT 2PJQA 3FBZA 3FBLA 2X51A 1WRDA 2V7LA 4YLHA 2W62A 1ZHCA 3HKCE 1YD8G 3NRXA 3FHNA 1H7CA 3DJBA 5FP3A 2N1GA 5H6QB 2XAJB 3UUXB 1Z0PA 3V5SA 2I59A 4E7ZA 2WM9A 4QXCB 4L9IA 1UX5A 3NZQA 1KK7A 4WW0A 5CA0E 1SA0E 3OBVE 5KDMC 1FMVA 2V26A 3N5LA 5FMNA 4XZCA 4HEAA 2D0TA 4TX5A 4YHJA 5DJQC 3E08A 4XAXB 2WMOA 2NP9A 3WI3A 2MYSA 3PUSA 4JKJA 2HH7A 3C64A 4H9RC 4C90A 4JEUB 1LRZA 3VKHA 4AXPA 5HXHA 2Y8DA 2L3LA 1UCUA 2CWYA 2KLQA 4H63H 3RYFE 3KBTA 2A2FX 3N2KE 2WBLA 5HXSA 5L3GB 4TN7B 1D1AA 2MTQA 2IC9A 4UF0B 1LVFA 5LBQB 4EYYR 5M4YA 1US7B 4GIWA 5LGUB 1HTJF 2ACXA 4NUUA 4AQGA 2A72A 4BA9A 3OYXA 5LCYA 2JMHA 3C4WA 4AQFC 2LSGA 4B6XA 4ASKA 2VL8A 2X9HA 2NW9A 5CB4E 4GOUA 2E9XC 5FNVE 4IHJE 4AKRB 5LHGB 5L3DB 4K0UA 2LSYA 4FI5A 3MXZA 3C50A 4AKIA 2C5IT 4L5GA 4MBQA 3RYIE 4NUVA 2ODVA 5A1LA 5HYAA 3AA6B 2NWBA 4EIWA 3AA7B 5LYJE 1IAPA 5DABA 4ISTA 2Q9QB 3O4XE 3VU7H 2X9WA 4QWNB 3K3NA 2CM0A 4KMCA 3U3IA 4OYJA 5JDHA 2LE8A 3IBPA 4ZI7E 3LJCA 5JH7E 3AAIA 3DP7A 3ZLIA 3T8OA 4UVCB 3CKDA 3RYCE 2RP4A 4EYUA 4JUYA 2JRKA 4P0AA 2W00A 4GK0E 3F31A 4MLKA 2LT3A 5FYMA 5F3JA 2B1EA 2BVLA 3BK9A 2NW8A 4BJMA 5HXEA 4U72A 3PTRB 1D0YA 4O4LE 1IJ6A 4MALA 2CXLA 2HPLA 3K3QC 3UT5E 1ZKEA 3O1IA 1MMNA 2LHNA 4QHOA 3ESLA 4UVAB 5FY0A 2KWHA 4IDZA 2LSKA 3PUQA 4DNDA 3KINB 3Q9DA 3CX7B 1MMAA 2NTYA 5J1GA 3MZKB 4JEHB 4C91A 3ETUA 3BQIA 5JVDE 3KV6A 4FJOA 4DVDA 2DWGA 1BR1A 3RIIA 3PU3A 3N9NA 3IEEA 2YU2A 3ZMTB 3GA8A 3ZJ1A 3A5XA 2L8KA 2W0GA 2V7JA 1HG2A 3GN5B 2CEAA 2EHOC 3V5UA 5FXZA 3N2OA 3KV5A 3RKOA 2X0LB 1BR0A 3KFWX 4GYRA 4O8SA 2H3RA 5LJNA 3LK42 3H37A 3MA9A 1MIVA 2P9BA 3KVBA 4UEMA 3RPUA 3ZMZB 3EUHA 5DQVA 1D1CA 1MMGA 2CLYB 3KBUA 3HKEE 4O4JE 2NOXA 4OK0A 3UUMA 2LSIA 2KXPB 4X1KE 2C0SA 1O3XA 3ETVA 4E7SA 2KWIB 5KMGP 3C4ZA 5HXCA 3MK7C 3GWHA 5FXVA 2LOSA 3BQKA 3EVYA 3Q2MA 3GN5A 1FMWA 5LP6E 2V7KA 5HWYA 1YW0A 4ZS3A 4CI3B 2C5JA 3L3PA 3N9LA 4QX8B 1Y64B 4ADZA 4BJNA 4F6RC 4CI1B 1BR4A 4YFSA 5HXRA 3RRWA 3JC6D 4EOZB 1IZNB 3ZCJA 2KINB 4AQFA 5L3CB 2BVMA 2EHOD 2JPFA 3SWHA 2BDEA 4YJ2E 3AAEB 1S35A 4EAHA 2CWOA 1XD3A 1CUNA 3N9MA 4TV8E 3O9XA 1X79A 4EZHA 4H63V 3IRTA 4PK5A 2XUEA 5JR9C 5FXXA 1KNZA 4HGAA 5EK4A 5ETWA 2V7IA 5F8PA 5AFUL 3UULA 1AJ3A 3QUJA 2VASA 3NZPA 4WBOA 3K8PC 3RX6A 3O1JA 4TZ4C 4HE8A 4N78D 4PFOA 3ZCIA 3RC3A 4M1PA 1QUUA 4PJJA 3CWZB 5HAXA 3UFEA 2PBIA 1D1BA 3J9X1 3RC8A 2CXFA 5LG4A 3KV4A 3SRZA 4J2CA 4O4HE 3GMIA 4YJ3E 1V9DA 2XAFB 5HWXA 5L3EB 3U78A 2VKDA 3O1HA 4UVBB 3CVRA 2J1DG 2NTXA 3UTKA 3RYHE 5JDMA 2LENA 4HFVA 5J2TE 4TV9E 2CMRA 4ZI3C 2UXXB 3UUNA 3B57A 4PK6A 5DQWA 3QK6A 3ZC0A 3L09A 2E8IA 3FXEB 2CXDA 4CQIA 3RH3A 2KT9A 2VB6A 3KV9A 4DMWA 2WWUA 4H9PC 4GK5E 2X68A 2QA7A 4AKGA 3TKLB 4I6NA 2LM9A 3PUAA 4PW8A 3Q5XA 4AKLA 2XAHB 5L3FB 3F2EA 3I9WA 4PFPA 1HFAA 5JDLA 3E22E 4I55E 3R84B 3ZMUB 4IGUA 3RISA 3WAJA 2L9QA 3PU8A 5LHHB 3BQLA 2H7VC 4I50E 4QXHB 2NW7A 4O4IE 4DM9A 4MFRA 1EZ3A 5BMVE 3AAAB 1MIWA 1WYCA 2PFVA 2E9XD 2EHOA 2UXNB 3B13A 4P0BA 2X9YA 2OA5A 3CX8B 3SS1A 5J2UE 2KMFA 4ZI3D 3HA4A 1YKHB 4TUYE 3KW5A 3ZN0B 5JDNA 4H9NC 1LKXA 2Z6EA 2XQYA 1U5PA 3MKDA 3LBXA 4ZS2A 3NBXX 1UCHA 4EXTA 2VWAA 3PE0A 1ZV4X 3OYZA 4BAYB 5JRCA 2H7OA 4PAGA 2YU1A 2WAUA 3S4UA 2CE7A 4WNKA 2V7MA 3CQCB 3HL6A 1MIYA 3QC9A 4CXWA 5LOVE 3NRYA 4QXBB 3P7IA 5CA1E 2IW5B 4UXNB 3E0ZA 4CI2B 2LHRA 1QSDA 2N2NA 2ZM2A 1G73A 4OFZA 2K9AA 2ZMAA 5GONE 3Q5WA 1CMXA 4G63A 2PG8A 3CQXC 2X9XA 3PURA 2YINA 5EK3A 2DNXA 2E9XB 4KP3C 2DHRA 4DMVA 4JLEA 5EK2A 3AVSA 1HCIA 3CPZA 5JQGE 2D5UA 3LK2B 4PK4A 3ZN1B 5JR9A 3IFWA 4O2BE 2YEVC 3LFMA 5LBMA 4ZOLE 1FEWA 1OXZA 2X66A 1U4QA 2Q9QC 2W63A 3LK3B 4X1YE 3WAKA 4UIGA 4XBFB 4UV9B 2RA1A 1HX8A 3CX6B 2MOZA 2KNDA 3ZEFB 3AB3B 1MNDA 3ANWA 4I43B 2XASB 1WR6A 2A3DA 4DBRA 3PUGA 2E9XA 3H3AA 2XHEB 3AA1B 3HKBE 3C51A 2KZ7B 3AA0B 4PJLA 5LJMA 4KBMB 3ZC1A 3C4XA 3KDSE 4IE5A 4GYSA 4P09A 5KX5E 4H9OC 2CCQA 2DLRA 3MJXA 4IG7A 3FXDB 4MHCA 5E0OA 2JMKA 1NWMX 1MNEA 5EZYE 2Y48B 1VOMA 3N2GE 3RRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6N A;  1UCH A;  1CMX A;  1XD3 A;  2LEN A;  3IHR A;  3IRT A;  2ETL A;  3RII A;  3IFW A;  3A7S A;  4DM9 A;  3RIS A;  3TB3 A;  4IG7 A;  3KW5 A;  3KVF A;  4JKJ A;  4UEM A;  4UEL A; 
#chains in the Genus database with same CATH topology
 4L0R A;  4JBW F;  4EZ4 A;  4DO0 A;  5LHI B;  3W15 B;  5IHY A;  5LG3 A;  4EV6 A;  1G8X A;  3TB3 A;  4IE0 A;  2EHO B;  3M65 A;  2DWK A;  1HS7 A;  2CLY C;  2UUA T;  4DV1 T;  4A56 A;  2IUB A;  3R6N A;  5FY7 A;  2DCF A;  3SOL A;  2VK9 A;  2LSJ A;  4QKN A;  3UU6 A;  3P4P A;  1NEN A;  5LXT E;  4OHF A;  3AVR A;  1ZEE A;  3I0O A;  3I1A A;  5JDF A;  3OJA A;  4HFD A;  2JQQ A;  2V1D B;  5TAO A;  3VHL A;  1IBK T;  2N9D A;  2XJ7 A;  4X1I E;  1XZY A;  4KHZ F;  2LOP A;  4JI7 T;  5AQK B;  4U74 A;  1YQ4 A;  2LLY A;  2X67 A;  2W61 A;  4CXY A;  4QX7 B;  3A7M A;  3VKG A;  3TLV A;  2BG9 A;  2H88 A;  2VQE T;  1GQE A;  3N9O A;  2BBH A;  3ZYK A;  4AKH A;  4NIQ A;  1JNZ A;  2UU9 T;  3ONX A;  3HR0 A;  4ZHQ E;  2K24 A;  5L2L A;  2X51 A;  4A98 A;  1KFY A;  2XSB A;  4WW0 A;  3N5L A;  5FMN A;  4TX5 A;  2X0Y A;  3AEA A;  1J5E T;  2WMO A;  2NP9 A;  4ILC A;  1WR0 A;  4JI5 T;  1W9R A;  4LFC T;  5HEO A;  4C90 A;  2Y8D A;  2ACZ A;  4X65 T;  3OPC A;  2E5V A;  2A2F X;  2IC9 A;  2WCA A;  1US7 B;  3OYX A;  4AQF C;  2DL1 A;  4B6X A;  5LMN T;  2M6I A;  4GOU A;  2E9X C;  5AQM B;  2JQH A;  3C50 A;  4AKI A;  5HCM A;  1HNX T;  2HHH T;  2J62 A;  5AQH B;  3K3N A;  4LF8 T;  4NXN T;  3AAI A;  3PUV F;  3T8O A;  2RP4 A;  4P0A A;  4EEB A;  5ABE A;  2BVL A;  3BK9 A;  4I0U A;  3PTR B;  2HPL A;  3K3Q C;  3UT5 E;  1MMN A;  4X5T A;  3UQ4 A;  3LSV A;  4HFH A;  4WYV A;  5JVD E;  4DVD A;  1FJG T;  2YU2 A;  3RPU A;  1MIV A;  3ZMZ B;  1VCT A;  1D1C A;  1MMG A;  2CLY B;  4B3T T;  4OX9 T;  2BS3 A;  3MK7 C;  2CHO A;  3GWH A;  5FXV A;  5ABF A;  3EVY A;  3Q2M A;  1FMW A;  2WDQ A;  4CI3 B;  2C5J A;  5LMU T;  4QX8 B;  4BJN A;  4CI1 B;  4EOZ B;  4YSY A;  2MPK A;  1HNW T;  1OED E;  3SWH A;  1HX1 B;  3AAE B;  4EAH A;  3AXJ A;  5AQF B;  3IRT A;  5FXX A;  1KNZ A;  4HGA A;  5EK4 A;  4TZ4 C;  3RC3 A;  1XNR T;  4M1P A;  4B3R T;  1D1B A;  3J9X 1;  4J2C A;  3U78 A;  3P4W A;  3EAB A;  5J2T E;  4ZI3 C;  1UGO A;  2UXX B;  3QK6 A;  5BR8 T;  3FXE B;  3RH3 A;  1I94 T;  2WDV A;  4I6N A;  4PW8 A;  1T7S A;  2FJD A;  3QOF A;  4LF6 T;  1HFA A;  3E22 E;  4I55 E;  4IGU A;  3VR9 A;  3WAJ A;  2L9Q A;  5FKY A;  5LHH B;  2H7V C;  2UXD T;  3JAE A;  4I50 E;  4QXH B;  4ILB A;  2E9X D;  2X9Y A;  2OA5 A;  3CX8 B;  2ZM6 T;  3LDQ B;  5JDN A;  4H9N C;  2XQY A;  1U5P A;  2XQA A;  4ZS2 A;  3NBX X;  4EXT A;  1ZV4 X;  2YU1 A;  3S4U A;  4LF5 T;  2IW5 B;  3AE2 A;  4CI2 B;  3L39 A;  2LHR A;  4OFZ A;  1M7K A;  1E7P A;  2ZMA A;  5GON E;  3Q5W A;  1I6Z A;  3PUY F;  2CRB A;  5AQJ B;  2FJA A;  5EK3 A;  2E9X B;  2J4G A;  4KP3 C;  5AQP B;  4DMV A;  2D5U A;  3LK2 B;  3IFW A;  2YEV C;  1W0A A;  5LBM A;  4B3M T;  2X66 A;  1U4Q A;  2W63 A;  4X1Y E;  3ZT6 A;  1N32 T;  4XBF B;  4UV9 B;  3CX6 B;  1WFD A;  5AQU B;  2MOZ A;  2KND A;  4DV3 T;  2BKO A;  1MND A;  2WZH A;  1WR6 A;  2A3D A;  2E9X A;  2BG9 C;  3AA1 B;  3HKB E;  3C51 A;  4AIS A;  4KBM B;  3ZC1 A;  1N34 T;  3NVO A;  5KX5 E;  4IG7 A;  3FXD B;  1JNR A;  2Y48 B;  2VKH A;  4TWF A;  2ZM0 A;  2BKN A;  4V1A v;  2Q9Q D;  3I9Y A;  1T98 A;  4HTE A;  4Z8X A;  3CML A;  3IHR A;  5H6R B;  2IIU A;  3NWI A;  4WBN E;  2IC6 A;  4AI6 A;  1HNZ T;  4KX6 A;  2JQ9 A;  5LNK A;  3LBX B;  4B3S T;  2M67 A;  1D0X A;  2VKO A;  4ZZB A;  4DBQ A;  3KVA A;  5AQQ B;  3EDU A;  3RIF A;  3QB5 K;  4U31 A;  4ILU A;  1YKE B;  4G2A A;  4H9Q C;  1XNQ T;  4A5X A;  2XAG B;  2D0U A;  2D9D A;  5LGN B;  3VRA A;  3A8Y C;  2V6Y B;  3PDY A;  2ZM8 A;  2LEH A;  4KUM B;  1NEK A;  2CA5 A;  2GK9 A;  3EDV A;  4IRE A;  5FXW A;  2Q9Q A;  5C8Y E;  3AE3 A;  4HWH A;  5AQS B;  2K48 A;  3N9P A;  3ZYL A;  5FY1 A;  1VRB A;  2V6Y A;  3JC6 C;  2LRL A;  2ODU A;  5L3B B;  5LA6 E;  3RIU C;  1D0Z A;  4CZZ B;  4X64 T;  4EB6 E;  4DV6 T;  4IL4 A;  3FBZ A;  4U7Y A;  3FZF B;  3FBL A;  4ZXL A;  3NRX A;  3UU5 A;  3FHN A;  3DJB A;  1Z0P A;  4EED A;  1UX5 A;  1KK7 A;  3OBV E;  1FMV A;  4XZC A;  5AQO B;  4YHJ A;  4XAX B;  3WI3 A;  4H9R C;  5HXH A;  4Z91 A;  4IDQ A;  2L3L A;  3RYF E;  3AE5 A;  5HXS A;  5L3G B;  5LBQ B;  5M4Y A;  5LGU B;  2XPK A;  4BA9 A;  1M62 A;  5F5W A;  2LSG A;  2X9H A;  2NW9 A;  5LHG B;  5L3D B;  3ONJ A;  4L5G A;  5HYA A;  4NUV A;  3CIR A;  3RI5 A;  2NWB A;  4EIW A;  5LYJ E;  4DR4 T;  5FL0 A;  3TLS A;  3O4X E;  5CFB A;  2WY2 A;  3IBP A;  4ZI7 E;  3LJC A;  5AQN B;  3DP7 A;  3ZLI A;  2WS3 A;  3EI0 A;  4U2Y A;  2BG9 B;  2JRK A;  4NPP A;  4GK0 E;  2LT3 A;  5FYM A;  5F3J A;  3ONL C;  2NW8 A;  1D0Y A;  1IJ6 A;  3ZT7 A;  3ABV A;  3O1I A;  4JYA T;  3ESL A;  3UQ7 A;  4JV5 T;  3QB5 A;  5C2T A;  4DND A;  4HFE A;  5J1G A;  4C91 A;  4TNV A;  2I0M A;  3BQI A;  2WWV A;  4WZX A;  4FJO A;  1BR1 A;  3N9N A;  3A5X A;  1HG2 A;  3GN5 B;  2VVN A;  5FXZ A;  3RKO A;  4HFB A;  1BR0 A;  1N33 T;  3KFW X;  2H3R A;  2E2A A;  5KMG P;  3KVB A;  5DQV A;  5ABG A;  4OK0 A;  1W09 A;  3UUM A;  4QH5 A;  3ETV A;  4E7S A;  2LRK A;  3BQK A;  4U3C A;  3GN5 A;  2XM2 A;  1CHU A;  2XQ5 A;  2B76 A;  4ADZ A;  1BR4 A;  4YXD A;  3RRW A;  3JC6 D;  1IZN B;  3ZCJ A;  5AQT B;  4LF4 T;  5L3C B;  2BVM A;  4TWH A;  2JPF A;  4KHP T;  2BDE A;  4YJ2 E;  1S35 A;  3Q5E A;  2CWO A;  3N9M A;  4TV8 E;  1X79 A;  2CPT A;  5FVL A;  4PK5 A;  2XUE A;  2V7I A;  3UUL A;  2CBI A;  4WBO A;  3L8R A;  1KF6 A;  3O1J A;  2BKP A;  3B5M A;  4PFO A;  2YDR A;  4PJJ A;  3CWZ B;  5HAX A;  4CN1 A;  5LG4 A;  3SRZ A;  4O4H E;  2XAF B;  3ZT5 A;  2WDR A;  3FZL B;  2J1D G;  2MAW A;  3RYH E;  3PUX F;  2LEN A;  3PJA A;  3B57 A;  3ZST A;  4PK6 A;  4HFI A;  5DQW A;  2LKH A;  1ZP0 A;  3L09 A;  2E8I A;  2QVA A;  2HN2 A;  2XQ6 A;  2UXC T;  2QA7 A;  4AKG A;  2XAH B;  4ILA A;  3I9W A;  5JDL A;  3R84 B;  3ZMU B;  3PU8 A;  3BQL A;  4MFR A;  4AQY T;  3RIU A;  3PUW F;  2PFV A;  4P0B A;  3RIS A;  2UXN B;  3SS1 A;  3KW5 A;  3RF1 A;  1J1J A;  4A97 A;  1YQ3 A;  5JRC A;  4YSZ A;  2UUB T;  2WAU A;  3RKG A;  5ABF B;  3CQC B;  3HL6 A;  4HWI B;  3E0Z A;  2K9A A;  4YTM A;  1CMX A;  4G63 A;  3T1Y T;  3CQX C;  2X9X A;  3PUR A;  4DR7 T;  2DNX A;  3CPZ A;  5JQG E;  3AXJ B;  5JR9 A;  4O2B E;  3LFM A;  4ZOL E;  1OXZ A;  2XZE A;  3RIA A;  2Q9Q C;  2QYW A;  3WAK A;  4UIG A;  2YDQ A;  2RA1 A;  1J5W A;  3ANW A;  2XAS B;  4DBR A;  4IDN A;  2AXD S;  3UUB A;  2KZ7 B;  3AA0 B;  2H89 A;  4IE5 A;  4P09 A;  4LF7 T;  2YN6 A;  2CCQ A;  3MJX A;  1NWM X;  1VOM A;  3N2G E;  3RC8 A;  1XDO A;  5L4H A;  5L47 A;  3P50 A;  4PJN A;  4IL9 A;  3ZMS B;  1OWA A;  3P4S A;  4I4T E;  4EGW A;  4NXM T;  2IHR 1;  2LJL A;  3DTO A;  2XTL A;  3AE1 A;  2G0U A;  2XAQ B;  3ZMV B;  4HWC A;  3Q5D A;  3N9Q A;  4UF0 A;  2SPC A;  4O2A E;  5FL1 A;  4HKA A;  2K3W A;  3UU4 A;  3C98 B;  1N36 T;  4HN9 A;  5AQI B;  3ZPO A;  1B7T A;  2FJB A;  1BR2 A;  1IJ5 A;  4X62 T;  4ZI2 D;  2QGS A;  4LFB T;  3K3O A;  4DR5 T;  1S94 A;  2D2S A;  4U7I A;  3FB2 A;  4ISS A;  5JRE A;  1LVK A;  2WP9 A;  2JQK A;  2QRX A;  2A9U A;  1FIO A;  2HPJ A;  3D0T A;  2IAK A;  2K5B B;  3HI2 A;  5JDG A;  2ES0 A;  2MBG A;  3AEE A;  4YT0 A;  1QLB A;  4OYK A;  4X20 E;  4DV5 T;  3NKZ A;  4IE7 A;  5AQL B;  2OLT A;  3I0Q A;  2C5K T;  2XY8 B;  2V7L A;  4YLH A;  2W62 A;  4U33 A;  4HFC A;  1ZHC A;  3HKC E;  1H7C A;  3UUX B;  3RLF F;  2I59 A;  4E7Z A;  3RHW A;  5CA0 E;  1SA0 E;  5KDM C;  4LMJ A;  2V26 A;  2BG9 E;  4AIU A;  2D0T A;  5DJQ C;  3E08 A;  3PUS A;  4JKJ A;  1KNR A;  2HH7 A;  3C64 A;  2XQ8 A;  1LRZ A;  3AE6 A;  3VKH A;  4AXP A;  3AEG A;  4ZEY A;  1UCU A;  2CWY A;  4H63 H;  3N2K E;  4EYY R;  1D1A A;  3TLT A;  2IDO B;  4GIW A;  1HTJ F;  2M6B A;  4NUU A;  4TWD A;  4JI3 T;  2JMH A;  3C4W A;  4ASK A;  2UXB T;  4AKR B;  1HR0 T;  1XWM A;  4K0U A;  2LSY A;  4FI5 A;  5A1L A;  2ODV A;  5CGM A;  2V5D A;  3AA7 B;  1IAP A;  4COF A;  2Q9Q B;  2X9W A;  4OYJ A;  5JDH A;  2LE8 A;  2YOE A;  1SUM B;  4YTN A;  2W66 A;  3AEB A;  4UVC B;  4YSX A;  3RYC E;  4EYU A;  1SE7 A;  4JUY A;  3F31 A;  2V8S V;  2B1E A;  4MAL A;  2VUR A;  1ZKE A;  4QHO A;  2LHN A;  4UVA B;  5AQR B;  4IDZ A;  3PUQ A;  3CX7 B;  1XMQ T;  3UFG A;  1MMA A;  2NTY A;  4JEH B;  3KV6 A;  2DWG A;  4F8H A;  3ZMT B;  3GA8 A;  2CEA A;  2J47 A;  3N2O A;  1OED A;  3KV5 A;  3X1D A;  3M3Z B;  4O8S A;  4GYR A;  3EUH A;  3HKE E;  4CN4 A;  4O4J E;  2LSI A;  4HWD A;  4X1K E;  2KWI B;  5HXC A;  1R8I A;  5HEH A;  4LF9 T;  1YXR A;  2VVS A;  5HWY A;  4ZS3 A;  4DR6 T;  2XM1 A;  2F4V T;  4YFS A;  4UR9 A;  1Y01 A;  2EHO D;  1X9B A;  2E5L T;  3O9X A;  2UUC T;  5JR9 C;  5ETW A;  5AFU L;  2VAS A;  4JI4 T;  3K8P C;  3VRB A;  4HE8 A;  3UU3 A;  2CXF A;  3RQW A;  3KV4 A;  3PUZ F;  1V9D A;  5L3E B;  2VKD A;  3JAF A;  2FBW A;  3CVR A;  2JIW A;  2NTX A;  4HFV A;  2CMR A;  3UUN A;  3OVU A;  3ZC0 A;  2CXD A;  5FVK A;  4U2Z A;  2KT9 A;  2VB6 A;  2R6G F;  4DR1 T;  3UU8 A;  2LM9 A;  3Q5X A;  3TLW A;  4AKL A;  3F2E A;  4PFP A;  4O4I E;  1MIW A;  2EHO A;  5J2U E;  2KMF A;  2IML A;  4TUY E;  3ZN0 B;  1LKX A;  2Z6E A;  1UCH A;  2VWA A;  4P1N A;  1XMO T;  1VCS A;  2H7O A;  4PAG A;  5J0Z A;  3AE9 A;  5HEJ A;  4WNK A;  3QC9 A;  5LOV E;  3NRY A;  4QXB B;  3P7I A;  5CA1 E;  4UXN B;  4YTP A;  3P4R A;  2ZM2 A;  2PG8 A;  4DR2 T;  2YIN A;  5EK2 A;  3AVS A;  1XDP A;  2XSA A;  2WZI A;  3SFD A;  2RPA A;  3JAD A;  3AE4 A;  5LB7 B;  1HX8 A;  2XQ4 A;  2VQF T;  5CJ5 A;  3PUG A;  2XHE B;  5LJM A;  3IA3 A;  5AQV B;  2FJE A;  4H9O C;  4MHC A;  5E0O A;  1MNE A;  5EZY E;  1MMD A;  3OKQ A;  4CXX A;  1SHZ C;  2W2U A;  3G06 A;  5ADX L;  4X66 T;  1WLX A;  2W4X A;  2WSS V;  4ZI2 C;  2BZB A;  4DR3 T;  3IF8 B;  4YHH T;  1HF8 A;  4ERR A;  5LGT B;  1KEY A;  4ANJ A;  4IIJ E;  3PJA J;  2KSR A;  5IYZ E;  3ZKR A;  5JRC B;  1UX4 A;  2LKG A;  3MAC A;  2ZLY A;  4IE4 A;  2JJ9 A;  2HN1 A;  3ZYM A;  1ZOY A;  3AED A;  4DID B;  4K0K T;  5JDQ A;  3AE8 A;  3HKD E;  3CQG B;  4DV7 T;  3KVF A;  5ABH A;  4UEL A;  3K1S A;  3J7Y q;  2VL0 A;  4DV0 T;  3LG7 A;  4CN6 A;  2ETL A;  3F57 A;  5JR9 B;  2CBJ A;  2DI4 A;  3ZJ2 A;  3T1H T;  4LMK A;  4UV8 B;  2WMN A;  2AE9 A;  3SFE A;  3ANW B;  2YK0 A;  2Y6X A;  4IE6 A;  3FZH B;  2YKS A;  3P8C D;  1WYB A;  4H9S E;  4PNI A;  3A7S A;  1E1H B;  1HG5 A;  2VKJ A;  3OTO T;  1NAF A;  3ZSS A;  4PJM A;  2PJQ A;  4HWF A;  1WRD A;  1YD8 G;  5FP3 A;  2N1G A;  5H6Q B;  2XAJ B;  3V5S A;  1UUR A;  2WM9 A;  4QXC B;  5AQG B;  5IUX A;  4L9I A;  3NZQ A;  4JI1 T;  1OED C;  4HEA A;  4IDP A;  1IBL T;  2MYS A;  4JEU B;  5HCJ A;  2KLQ A;  3KBT A;  2WBL A;  1UUS A;  4TN7 B;  2MTQ A;  4UF0 B;  1LVF A;  2ACX A;  4AQG A;  2A72 A;  5LCY A;  2VL8 A;  5CB4 E;  5FNV E;  4IHJ E;  2X0H A;  3EHZ A;  2WB5 A;  3MXZ A;  2C5I T;  4MBQ A;  3RYI E;  4JI8 T;  3AA6 B;  5DAB A;  4LML A;  3AE7 A;  4IST A;  3VU7 H;  4QWN B;  2CM0 A;  4KMC A;  3U3I A;  2XQ9 A;  5JH7 E;  3CKD A;  5JTG A;  2PTF A;  4GKK T;  2XQ7 A;  1W0B A;  2W00 A;  4MLK A;  2BBJ A;  2WU5 A;  4BJM A;  5HXE A;  4U72 A;  4O4L E;  2LM2 A;  1UK5 A;  2CXL A;  2BS2 A;  4GKJ T;  4JI2 T;  5FY0 A;  2KWH A;  2LSK A;  3KIN B;  3Q9D A;  3MZK B;  3ETU A;  1E2A A;  5KXJ A;  3RII A;  1KNP A;  3PU3 A;  3IEE A;  5C3J A;  2FUP A;  3ZJ1 A;  2L8K A;  2W0G A;  2V7J A;  2EHO C;  3V5U A;  2X0L B;  3RGL A;  4KI0 F;  5LJN A;  3LK4 2;  3H37 A;  3MA9 A;  2P9B A;  4UEM A;  3KBU A;  2NOX A;  3H3M A;  2KXP B;  2C0S A;  1O3X A;  4JI0 T;  4DV2 T;  3C4Z A;  2YDS A;  2BS4 A;  4Q25 A;  3AEC A;  2LOS A;  4DUY T;  5LP6 E;  2V7K A;  1YW0 A;  4DUZ T;  3L3P A;  3N9L A;  4F6R C;  1Y64 B;  5HXR A;  2KIN B;  4AQF A;  4IDO A;  1WCR A;  1XD3 A;  2OV9 A;  1CUN A;  4EZH A;  4H63 V;  1AJ3 A;  5F8P A;  3QUJ A;  3NZP A;  3RX6 A;  4N78 D;  3ZCI A;  1QUU A;  3UFE A;  2PBI A;  5IWA T;  3GMI A;  4YJ3 E;  5HWX A;  3O1H A;  4UVB B;  3PV0 F;  3UTK A;  5JDM A;  2NR4 A;  5HEG A;  4TV9 E;  3EAM A;  4QH1 A;  4CQI A;  3KV9 A;  4DMW A;  2WWU A;  4GK5 E;  2X68 A;  2W67 A;  3TKL B;  3PUA A;  4YY3 T;  5L3F B;  4LFA T;  4IT4 A;  2NW7 A;  4DM9 A;  1EZ3 A;  5BMV E;  3AAA B;  4QH4 A;  4Z90 A;  1WYC A;  3B13 A;  4JI6 T;  1OED B;  4ZI3 D;  3HA4 A;  1YKH B;  5HEU A;  3MKD A;  3LBX A;  1IBM T;  3PE0 A;  3OYZ A;  1T72 A;  3P4Q A;  4DV4 T;  2WU2 A;  4BAY B;  1Z8U A;  5L4E A;  1T8B A;  3QNU A;  3CK6 A;  2CE7 A;  2V7M A;  4CXW A;  1MIY A;  1QSD A;  2N2N A;  1G73 A;  2V6X A;  3VR8 A;  4ZZC A;  3FZM B;  2DHR A;  4JLE A;  1HCI A;  3AEF A;  4PK4 A;  3ZN1 B;  2CHN A;  3JCF A;  2I6H A;  1FEW A;  3FZK B;  3TLU A;  3LK3 B;  2V5C A;  3RQU A;  1DU2 A;  4TNW A;  1L0V A;  3ZEF B;  3AB3 B;  4I43 B;  2WQY A;  3H3A A;  4PJL A;  3C4X A;  3KDS E;  4GYS A;  2DLR A;  2JMK A;  2XQ3 A;  4H9P C;  3RRC A; 
#chains in the Genus database with same CATH homology
 2VKH A;  4L0R A;  2ZM0 A;  4V1A v;  4EZ4 A;  4DO0 A;  4PJN A;  1MMD A;  3OKQ A;  3ZMS B;  5LHI B;  1OWA A;  2Q9Q D;  3I9Y A;  1T98 A;  4CXX A;  4HTE A;  4I4T E;  4Z8X A;  3CML A;  3IHR A;  5H6R B;  1SHZ C;  3W15 B;  5IHY A;  4WBN E;  5ADX L;  2IC6 A;  4AI6 A;  1G8X A;  1WLX A;  4IE0 A;  2EHO B;  3TB3 A;  3M65 A;  2WSS V;  4ZI2 C;  2BZB A;  2DWK A;  1HS7 A;  2LJL A;  3IF8 B;  2CLY C;  3DTO A;  4A56 A;  1HF8 A;  4ERR A;  3R6N A;  5LGT B;  5LNK A;  3LBX B;  2XTL A;  5FY7 A;  2DCF A;  3SOL A;  4ANJ A;  4IIJ E;  2VK9 A;  2G0U A;  2M67 A;  2XAQ B;  3ZMV B;  1D0X A;  2VKO A;  2LSJ A;  4QKN A;  4DBQ A;  3KVA A;  5IYZ E;  5JRC B;  1UX4 A;  3MAC A;  3N9Q A;  2ZLY A;  4IE4 A;  4UF0 A;  2JJ9 A;  2SPC A;  3ZYM A;  3EDU A;  5LXT E;  4O2A E;  4OHF A;  5JDQ A;  3AVR A;  1ZEE A;  4HKA A;  3C98 B;  3I0O A;  3HKD E;  3I1A A;  3CQG B;  4HN9 A;  3ZPO A;  3KVF A;  5JDF A;  4ILU A;  1YKE B;  1B7T A;  4UEL A;  3J7Y q;  1BR2 A;  1IJ5 A;  3OJA A;  4G2A A;  4H9Q C;  2JQQ A;  2XAG B;  2D0U A;  4ZI2 D;  2V1D B;  5TAO A;  3VHL A;  5LGN B;  2N9D A;  2QGS A;  3K3O A;  4X1I E;  3LG7 A;  2ETL A;  3PDY A;  2ZM8 A;  2LEH A;  4KUM B;  3F57 A;  5JR9 B;  2CA5 A;  2GK9 A;  1S94 A;  2D2S A;  2DI4 A;  2LOP A;  3ZJ2 A;  4U74 A;  3FB2 A;  2X67 A;  4ISS A;  4UV8 B;  5JRE A;  3EDV A;  5FXW A;  2W61 A;  1LVK A;  2Q9Q A;  5C8Y E;  4CXY A;  2WMN A;  4QX7 B;  3VKG A;  1FIO A;  2HPJ A;  2K48 A;  3D0T A;  3ANW B;  2IAK A;  2YK0 A;  2Y6X A;  4IE6 A;  2K5B B;  3HI2 A;  5JDG A;  3N9P A;  2ES0 A;  3ZYL A;  3P8C D;  5FY1 A;  2MBG A;  3N9O A;  1WYB A;  1VRB A;  3JC6 C;  4H9S E;  3ZYK A;  4PNI A;  2ODU A;  3A7S A;  1E1H B;  5L3B B;  5LA6 E;  4AKH A;  4OYK A;  1D0Z A;  1HG5 A;  2VKJ A;  4X20 E;  4CZZ B;  1NAF A;  4EB6 E;  3ONX A;  4PJM A;  3HR0 A;  4IE7 A;  4ZHQ E;  2K24 A;  5L2L A;  3I0Q A;  2C5K T;  2PJQ A;  3FBZ A;  3FBL A;  2X51 A;  1WRD A;  2V7L A;  4YLH A;  2W62 A;  1ZHC A;  3HKC E;  1YD8 G;  3NRX A;  3FHN A;  1H7C A;  3DJB A;  5FP3 A;  2N1G A;  5H6Q B;  2XAJ B;  3UUX B;  1Z0P A;  3V5S A;  2I59 A;  4E7Z A;  2WM9 A;  4QXC B;  4L9I A;  1UX5 A;  3NZQ A;  1KK7 A;  4WW0 A;  5CA0 E;  1SA0 E;  3OBV E;  5KDM C;  1FMV A;  2V26 A;  3N5L A;  5FMN A;  4XZC A;  4HEA A;  2D0T A;  4TX5 A;  4YHJ A;  5DJQ C;  3E08 A;  4XAX B;  2WMO A;  2NP9 A;  3WI3 A;  2MYS A;  3PUS A;  4JKJ A;  2HH7 A;  3C64 A;  4H9R C;  4C90 A;  4JEU B;  1LRZ A;  3VKH A;  4AXP A;  5HXH A;  2Y8D A;  2L3L A;  1UCU A;  2CWY A;  2KLQ A;  4H63 H;  3RYF E;  3KBT A;  2A2F X;  3N2K E;  2WBL A;  5HXS A;  5L3G B;  4TN7 B;  1D1A A;  2MTQ A;  2IC9 A;  4UF0 B;  1LVF A;  5LBQ B;  4EYY R;  5M4Y A;  1US7 B;  4GIW A;  5LGU B;  1HTJ F;  2ACX A;  4NUU A;  4AQG A;  2A72 A;  4BA9 A;  3OYX A;  5LCY A;  2JMH A;  3C4W A;  4AQF C;  2LSG A;  4B6X A;  4ASK A;  2VL8 A;  2X9H A;  2NW9 A;  5CB4 E;  4GOU A;  2E9X C;  5FNV E;  4IHJ E;  4AKR B;  5LHG B;  5L3D B;  4K0U A;  2LSY A;  4FI5 A;  3MXZ A;  3C50 A;  4AKI A;  2C5I T;  4L5G A;  4MBQ A;  3RYI E;  4NUV A;  2ODV A;  5A1L A;  5HYA A;  3AA6 B;  2NWB A;  4EIW A;  3AA7 B;  5LYJ E;  1IAP A;  5DAB A;  4IST A;  2Q9Q B;  3O4X E;  3VU7 H;  2X9W A;  4QWN B;  3K3N A;  2CM0 A;  4KMC A;  3U3I A;  4OYJ A;  5JDH A;  2LE8 A;  3IBP A;  4ZI7 E;  3LJC A;  5JH7 E;  3AAI A;  3DP7 A;  3ZLI A;  3T8O A;  4UVC B;  3CKD A;  3RYC E;  2RP4 A;  4EYU A;  4JUY A;  2JRK A;  4P0A A;  2W00 A;  4GK0 E;  3F31 A;  4MLK A;  2LT3 A;  5FYM A;  5F3J A;  2B1E A;  2BVL A;  3BK9 A;  2NW8 A;  4BJM A;  5HXE A;  4U72 A;  3PTR B;  1D0Y A;  4O4L E;  1IJ6 A;  4MAL A;  2CXL A;  2HPL A;  3K3Q C;  3UT5 E;  1ZKE A;  3O1I A;  1MMN A;  2LHN A;  4QHO A;  3ESL A;  4UVA B;  5FY0 A;  2KWH A;  4IDZ A;  2LSK A;  3PUQ A;  4DND A;  3KIN B;  3Q9D A;  3CX7 B;  1MMA A;  2NTY A;  5J1G A;  3MZK B;  4JEH B;  4C91 A;  3ETU A;  3BQI A;  5JVD E;  3KV6 A;  4FJO A;  4DVD A;  2DWG A;  1BR1 A;  3RII A;  3PU3 A;  3N9N A;  3IEE A;  2YU2 A;  3ZMT B;  3GA8 A;  3ZJ1 A;  3A5X A;  2L8K A;  2W0G A;  2V7J A;  1HG2 A;  3GN5 B;  2CEA A;  2EHO C;  3V5U A;  5FXZ A;  3N2O A;  3KV5 A;  3RKO A;  2X0L B;  1BR0 A;  3KFW X;  4GYR A;  4O8S A;  2H3R A;  5LJN A;  3LK4 2;  3H37 A;  3MA9 A;  1MIV A;  2P9B A;  3KVB A;  4UEM A;  3RPU A;  3ZMZ B;  3EUH A;  5DQV A;  1D1C A;  1MMG A;  2CLY B;  3KBU A;  3HKE E;  4O4J E;  2NOX A;  4OK0 A;  3UUM A;  2LSI A;  2KXP B;  4X1K E;  2C0S A;  1O3X A;  3ETV A;  4E7S A;  2KWI B;  5KMG P;  3C4Z A;  5HXC A;  3MK7 C;  3GWH A;  5FXV A;  2LOS A;  3BQK A;  3EVY A;  3Q2M A;  3GN5 A;  1FMW A;  5LP6 E;  2V7K A;  5HWY A;  1YW0 A;  4ZS3 A;  4CI3 B;  2C5J A;  3L3P A;  3N9L A;  4QX8 B;  1Y64 B;  4ADZ A;  4BJN A;  4F6R C;  4CI1 B;  1BR4 A;  4YFS A;  5HXR A;  3RRW A;  3JC6 D;  4EOZ B;  1IZN B;  3ZCJ A;  2KIN B;  4AQF A;  5L3C B;  2BVM A;  2EHO D;  2JPF A;  3SWH A;  2BDE A;  4YJ2 E;  3AAE B;  1S35 A;  4EAH A;  2CWO A;  1XD3 A;  1CUN A;  3N9M A;  4TV8 E;  3O9X A;  1X79 A;  4EZH A;  4H63 V;  3IRT A;  4PK5 A;  2XUE A;  5JR9 C;  5FXX A;  1KNZ A;  4HGA A;  5EK4 A;  5ETW A;  2V7I A;  5F8P A;  5AFU L;  3UUL A;  1AJ3 A;  3QUJ A;  2VAS A;  3NZP A;  4WBO A;  3K8P C;  3RX6 A;  3O1J A;  4TZ4 C;  4HE8 A;  4N78 D;  4PFO A;  3ZCI A;  3RC3 A;  4M1P A;  1QUU A;  4PJJ A;  3CWZ B;  5HAX A;  3UFE A;  2PBI A;  1D1B A;  3J9X 1;  3RC8 A;  2CXF A;  5LG4 A;  3KV4 A;  3SRZ A;  4J2C A;  4O4H E;  3GMI A;  4YJ3 E;  1V9D A;  2XAF B;  5HWX A;  5L3E B;  3U78 A;  2VKD A;  3O1H A;  4UVB B;  3CVR A;  2J1D G;  2NTX A;  3UTK A;  3RYH E;  5JDM A;  2LEN A;  4HFV A;  5J2T E;  4TV9 E;  2CMR A;  4ZI3 C;  2UXX B;  3UUN A;  3B57 A;  4PK6 A;  5DQW A;  3QK6 A;  3ZC0 A;  3L09 A;  2E8I A;  3FXE B;  2CXD A;  4CQI A;  3RH3 A;  2KT9 A;  2VB6 A;  3KV9 A;  4DMW A;  2WWU A;  4H9P C;  4GK5 E;  2X68 A;  2QA7 A;  4AKG A;  3TKL B;  4I6N A;  2LM9 A;  3PUA A;  4PW8 A;  3Q5X A;  4AKL A;  2XAH B;  5L3F B;  3F2E A;  3I9W A;  4PFP A;  1HFA A;  5JDL A;  3E22 E;  4I55 E;  3R84 B;  3ZMU B;  4IGU A;  3RIS A;  3WAJ A;  2L9Q A;  3PU8 A;  5LHH B;  3BQL A;  2H7V C;  4I50 E;  4QXH B;  2NW7 A;  4O4I E;  4DM9 A;  4MFR A;  1EZ3 A;  5BMV E;  3AAA B;  1MIW A;  1WYC A;  2PFV A;  2E9X D;  2EHO A;  2UXN B;  3B13 A;  4P0B A;  2X9Y A;  2OA5 A;  3CX8 B;  3SS1 A;  5J2U E;  2KMF A;  4ZI3 D;  3HA4 A;  1YKH B;  4TUY E;  3KW5 A;  3ZN0 B;  5JDN A;  4H9N C;  1LKX A;  2Z6E A;  2XQY A;  1U5P A;  3MKD A;  3LBX A;  4ZS2 A;  3NBX X;  1UCH A;  4EXT A;  2VWA A;  3PE0 A;  1ZV4 X;  3OYZ A;  4BAY B;  5JRC A;  2H7O A;  4PAG A;  2YU1 A;  2WAU A;  3S4U A;  2CE7 A;  4WNK A;  2V7M A;  3CQC B;  3HL6 A;  1MIY A;  3QC9 A;  4CXW A;  5LOV E;  3NRY A;  4QXB B;  3P7I A;  5CA1 E;  2IW5 B;  4UXN B;  3E0Z A;  4CI2 B;  2LHR A;  1QSD A;  2N2N A;  2ZM2 A;  1G73 A;  4OFZ A;  2K9A A;  2ZMA A;  5GON E;  3Q5W A;  1CMX A;  4G63 A;  2PG8 A;  3CQX C;  2X9X A;  3PUR A;  2YIN A;  5EK3 A;  2DNX A;  2E9X B;  4KP3 C;  2DHR A;  4DMV A;  4JLE A;  5EK2 A;  3AVS A;  1HCI A;  3CPZ A;  5JQG E;  2D5U A;  3LK2 B;  4PK4 A;  3ZN1 B;  5JR9 A;  3IFW A;  4O2B E;  2YEV C;  3LFM A;  5LBM A;  4ZOL E;  1FEW A;  1OXZ A;  2X66 A;  1U4Q A;  2Q9Q C;  2W63 A;  3LK3 B;  4X1Y E;  3WAK A;  4UIG A;  4XBF B;  4UV9 B;  2RA1 A;  1HX8 A;  3CX6 B;  2MOZ A;  2KND A;  3ZEF B;  3AB3 B;  1MND A;  3ANW A;  4I43 B;  2XAS B;  1WR6 A;  2A3D A;  4DBR A;  3PUG A;  2E9X A;  3H3A A;  2XHE B;  3AA1 B;  3HKB E;  3C51 A;  2KZ7 B;  3AA0 B;  4PJL A;  5LJM A;  4KBM B;  3ZC1 A;  3C4X A;  3KDS E;  4IE5 A;  4GYS A;  4P09 A;  5KX5 E;  4H9O C;  2CCQ A;  2DLR A;  3MJX A;  4IG7 A;  3FXD B;  4MHC A;  5E0O A;  2JMK A;  1NWM X;  1MNE A;  5EZY E;  2Y48 B;  1VOM A;  3N2G E;  3RRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...