3IHRA

Crystal structure of uch37
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
Knots found
sequence length
305
structure length
282
Chain Sequence
EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFAAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase isozyme L5
publication title Structural characterization of human Uch37.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 282
sequence length 305
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
A PF18031 UCH_C Ubiquitin carboxyl-terminal hydrolases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ihrA02
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 3ihrA01
3IHRA 3RIIA 4I6NA 2ETLA 1UCHA 3KW5A 1XD3A 3IRTA 1CMXA 4UEMA 3IFWA 3KVFA 4UELA 4DM9A 2LENA 4JKJA 3TB3A 3A7SA 4IG7A 3RISA
chains in the Genus database with same CATH superfamily
1ZOYA 4QX7B 4NXNT 3K3NA 2CXLA 4ASKA 3OYZA 1S35A 5KDMC 2KINB 3LDQB 3FBZA 5AQFB 2XSBA 5FY0A 3UUBA 3FZLB 2XQ9A 2V7JA 2V7MA 2W61A 5J1GA 2E9XD 2HHHT 4JEUB 2WDRA 4IREA 4HFDA 4KHZF 3EI0A 4CI3B 1WYBA 2KNDA 2P9BA 1UGOA 2PFVA 1LVFA 3E08A 2HN2A 3RX6A 3HKCE 4PW8A 4WW0A 4DM9A 4BJNA 1NEKA 2C0SA 3JAFA 4OK0A 2WB5A 5FVKA 5AQUB 1ZV4X 4AXPA 2ACZA 2FBWA 2H7VC 1BR0A 3UFEA 3SFDA 4JI8T 3ESLA 4LF5T 3CPZA 3TLVA 3N9QA 3AEDA 2LM2A 4JI7T 2VL0A 2VK9A 3RH3A 2XY8B 3P7IA 4O4JE 2UUAT 1QLBA 3TLUA 3PUZF 4JI2T 3L3PA 4X66T 3CMLA 4IE6A 3AAEB 4YTPA 4LFBT 4QXBB 4HFEA 4ZHQE 4DR6T 4UELA 4JI0T 3K3OA 5JRCB 4UV9B 1MIYA 3PU3A 4DUYT 5F3JA 4ZI3D 1YQ4A 2BG9B 4OHFA 2DWGA 2D0UA 3QNUA 5HXHA 4GK5E 5JVDE 3T1HT 2CHOA 1NENA 4ZZCA 4DV2T 4QWNB 2WZIA 3RI5A 2KWIB 1VCTA 2JMHA 4X64T 4HEAA 2LE8A 2BKOA 4P0AA 4IE4A 5LXTE 3UT5E 3P4WA 5J2UE 4MBQA 2XAQB 2NTXA 4EV6A 5J2TE 3K1SA 2K24A 4CN1A 2EHOC 3ZMZB 4UXNB 4HKAA 3D0TA 4GYSA 4DNDA 2W66A 3UQ4A 1YD8G 2VKDA 4A5XA 3M65A 2Z6EA 3ZCIA 4Z90A 4NPPA 1MNEA 2H89A 5ABHA 3HL6A 1IBMT 2X51A 4ILBA 4COFA 2XQ6A 3AEAA 1UCHA 3L8RA 3P4SA 5ABEA 5HXRA 3VRAA 3ZSTA 2IDOB 2K3WA 4G2AA 3PUQA 5L4HA 1J5WA 5F8PA 5CB4E 2ZM0A 3R84B 1XDPA 1KF6A 3O9XA 2MYSA 4CQIA 5AQSB 3NZPA 1X9BA 5LNKA 3ZSSA 3JADA 4C90A 1XZYA 3RYIE 4ZZBA 3PUWF 1UK5A 2WQYA 5LA6E 4AKIA 4PFPA 2GK9A 2ES0A 3LBXA 2RPAA 3FXEB 4GK0E 2LT3A 2V8SV 3HI2A 4DR1T 1IJ5A 3V5UA 3PURA 2XM2A 2A2FX 2Y48B 5AQIB 4AKLA 4IL9A 4L0RA 5L3DB 3KV6A 2LKHA 3AVSA 3IBPA 1T72A 4MHCA 2HN1A 2QA7A 4LF8T 4ISTA 5DABA 5ADXL 3C64A 2VKJA 2LKGA 4JEHB 4EOZB 1LKXA 2UXBT 1YXRA 4KUMB 4O8SA 1IJ6A 3AE9A 5HEGA 4A56A 4IDQA 2M6IA 2DCFA 5F5WA 3J7Yq 3C51A 2XAHB 3TB3A 4DUZT 2VKOA 2YINA 2BS3A 3OPCA 5LBQB 5AQLB 3Q5DA 3RYFE 4UV8B 2JPFA 3N5LA 3K3QC 5FL0A 3KV5A 2NTYA 3NWIA 2CBIA 4ZOLE 3UU6A 3NKZA 2XAJB 5HEHA 2DWKA 4YXDA 3RKGA 4CN4A 1ZP0A 3UUMA 3N2KE 2OLTA 2ZLYA 4UIGA 4YTMA 2BG9E 3B57A 1GQEA 3N9NA 3QB5K 1BR2A 2XUEA 4Z91A 4I6NA 1KNPA 2QGSA 3HKBE 1CHUA 5HYAA 1OXZA 4JI1T 5FKYA 4A97A 1UX5A 1Y01A 4CXWA 1J1JA 3VRBA 2D2SA 2I6HA 3FZHB 3AE2A 3OJAA 3KFWX 4GYRA 4LFCT 1D0ZA 1KNZA 2V6XA 1UUSA 2UUCT 3UQ7A 2XAGB 5C3JA 5JDLA 3F57A 4IE7A 2F4VT 3OTOT 2JQQA 4B3TT 2YDSA 2LOSA 2LLYA 4H9NC 1XNRT 3IF8B 3EVYA 2CLYC 3L39A 1HS7A 2BS4A 2CA5A 3RLFF 2CPTA 2CMRA 2WP9A 5L3GB 2LSJA 3E0ZA 5CFBA 3J9X1 1FMWA 2CHNA 2AXDS 4H9PC 2C5KT 1W09A 5LG3A 1BR1A 2CE7A 2YU1A 2UXCT 1W9RA 5H6QB 4ISSA 3AA7B 1E2AA 3Q5XA 2B76A 4WYVA 4C91A 4H9QC 4IDNA 4ILAA 5AQRB 2WDQA 4L9IA 2WMNA 2WZHA 3ZPOA 5L3CB 2A3DA 2X66A 2BKPA 4G63A 5HXSA 4Z8XA 4JUYA 4DIDB 1HFAA 3RYCE 2WSSV 4OX9T 5HWYA 2EHOA 3JC6C 5AQVB 3A7MA 2X0LB 3PUVF 4DO0A 5L47A 4HWIB 2LSIA 4JLEA 2X9YA 4X65T 4MALA 4UVCB 2VB6A 1OEDB 4TV9E 4CXXA 2M6BA 5JDGA 4XAXB 4B3MT 3AE8A 3ZT6A 5BR8T 5A1LA 4QKNA 1N36T 5CA0E 4YSXA 3DJBA 3TLSA 3ANWA 2XZEA 2E9XC 4AQGA 1HNWT 2XM1A 4GIWA 1S94A 4A98A 4H63V 3CWZB 4X62T 2X9HA 2SPCA 5AQNB 1H7CA 4ZS2A 4EGWA 4HFCA 1NWMX 4DR4T 1N33T 5FY1A 4KX6A 4LFAT 2BBJA 5JREA 1YQ3A 3C4ZA 4CI1B 4U31A 4YSYA 4XZCA 4DBQA 4ERRA 5BMVE 5ABFB 4ANJA 1CMXA 3GN5A 3CQCB 3RYHE 4HFBA 2KZ7B 2ZM6T 1CUNA 5AQPB 4LF9T 5JR9C 3QC9A 3CX6B 4DR3T 5LJNA 4ILUA 4AQYT 1T7SA 1HG5A 4DR5T 3CIRA 4WBNE 2V6YA 3FB2A 2UXDT 3RKOA 4TUYE 4U2ZA 2FJDA 3P4QA 4QH1A 4ZI3C 2I0MA 2K48A 4HFVA 3AEEA 4X1IE 2Y8DA 4DR7T 4L5GA 2CRBA 5C2TA 1D1AA 2UXNB 4M1PA 5AQJB 3CQGB 2EHOB 2IMLA 5DQVA 4B6XA 3MKDA 3A8YC 4TNWA 2VQFT 3RRWA 3Q5WA 4NUVA 3RIIA 3BQKA 4DV5T 4BJMA 4P09A 2VKHA 3RIAA 4X5TA 2D9DA 4U7IA 4PK6A 3PUYF 4DV4T 3O1HA 5FL1A 4QH4A 2VWAA 2HPJA 2LHRA 1XNQT 3FBLA 3T1YT 2CWOA 1DU2A 4JI6T 5HCJA 2Q9QB 3RF1A 3I9YA 2L3LA 1N32T 4PAGA 4HWDA 1QUUA 3P4RA 2HPLA 4JBWF 3P4PA 1D1CA 5H6RB 3LSVA 2LHNA 4KMCA 5LHGB 2JRKA 2WU2A 1XMOT 3IHRA 4FI5A 4AISA 4DMVA 2J62A 4UVAB 5FP3A 3LG7A 4EAHA 4KBMB 3RGLA 5FNVE 1JNZA 3GN5B 2YK0A 3UU3A 1FMVA 2RP4A 5EK2A 2VQET 5LJMA 3K8PC 5LHIB 1VOMA 4NIQA 5FXWA 3ZEFB 1WLXA 4DBRA 4IGUA 2V6YB 2V5DA 2BG9C 4HWFA 1MMGA 4WNKA 3AE1A 5LBMA 4B3ST 4AQFC 2XPKA 2UXXB 2VL8A 4HN9A 3AA0B 2ACXA 1D0YA 4PJMA 5AQQB 4IL4A 1OEDE 4IDOA 1N34T 2QRXA 3P8CD 3AE4A 3EDVA 4ZI7E 4ZXLA 3VU7H 4LMLA 2W67A 2NP9A 2VVSA 4KP3C 2M67A 4PJJA 3AEFA 5HEOA 2CBJA 2JJ9A 3I0QA 2UUBT 5J0ZA 3TKLB 4Q25A 3UU4A 2Q9QD 4I4TE 3ETVA 4ILCA 4TX5A 3Q2MA 2I59A 3QUJA 3MK7C 3O4XE 3PUXF 2WCAA 3GMIA 4EZ4A 2JQHA 4YTNA 2AE9A 2LJLA 5HEJA 2G0UA 4X1KE 3N9PA 4TWDA 5CA1E 1WRDA 3FZFB 4H9RC 4O2AE 3SFEA 1HNZT 4IDPA 4U7YA 2CEAA 3QB5A 3PE0A 4YT0A 1U5PA 4GOUA 2NW7A 3SRZA 1M7KA 4EXTA 2X68A 2CXDA 2E9XA 1W0AA 3VKHA 2H7OA 3MZKB 3MACA 4P0BA 2ZMAA 1HCIA 2K9AA 1XD3A 3KBTA 4LF7T 4AIUA 4I55E 2NW9A 2CXFA 4TV8E 4QH5A 1Z0PA 5L2LA 2XQ5A 5AQKB 3EABA 4TN7B 1E7PA 1WFDA 3GWHA 3GA8A 3NRXA 3VR9A 4MLKA 2XQ8A 4DV6T 3ZKRA 3TLWA 3LBXB 1FEWA 2NW8A 5HAXA 1KFYA 2KMFA 2LENA 2CCQA 5JR9A 3RHWA 2XSAA 4YSZA 2NR4A 3ABVA 2MBGA 4I43B 4DV3T 3RC8A 3ETUA 4AI6A 2J4GA 5L3BB 2XQ3A 4AKRB 4O4LE 3CKDA 4OFZA 1UCUA 4PJNA 2H3RA 3U78A 4EYUA 4KI0F 2X0YA 1MIVA 1QSDA 2A9UA 4TWFA 4TWHA 1IBLT 2VURA 3LJCA 1WYCA 2N2NA 2W63A 4DV0T 5L3FB 2WM9A 2ODVA 3NVOA 3ZC1A 5IWAT 4F8HA 2KLQA 2XASB 3ZYLA 3VKGA 4X1YE 3C4WA 3H3AA 2YN6A 2LRKA 5ABGA 4ADZA 3N9LA 2BKNA 2X9WA 2XQ7A 3VR8A 4BAYB 3JCFA 4QHOA 4CZZB 4QXHB 4PK5A 3UTKA 3KV4A 1M62A 4DV7T 3R6NA 4NUUA 3QK6A 2YKSA 2L9QA 3I9WA 1YKEB 5DQWA 2ODUA 5JTGA 2BS2A 2XQ4A 4UVBB 2VVNA 4OYKA 4YJ3E 3IFWA 4ZI2D 3MA9A 2ZM2A 1LVKA 5E0OA 3N9OA 2WAUA 3ZMSB 5JR9B 3ONXA 3ZC0A 3UUNA 2YDQA 3I0OA 2IAKA 2W4XA 3WI3A 3RQUA 3ZMTB 5JRCA 2LSGA 1UX4A 1SE7A 2D0TA 2RA1A 2YDRA 2BG9A 3ZT5A 5IHYA 5CGMA 4U2YA 3AEGA 3IRTA 4AQFA 2LRLA 2XQAA 4LMJA 4O2BE 1IAPA 3AA1B 4N78D 2WMOA 4QX8B 3EAMA 3CX8B 3C4XA 4EEDA 4AKHA 3KV9A 4IE0A 5JDHA 2VASA 1HX8A 2FUPA 5HEUA 3MJXA 4LF6T 2PTFA 3AECA 2B1EA 4MFRA 3AA6B 2YEVC 3N9MA 3LK3B 4E7SA 2BDEA 2BVMA 3RIFA 2DI4A 3F31A 4JI5T 2JQ9A 3WAJA 2PG8A 4PNIA 2LM9A 4HFHA 5JDNA 4TNVA 1OEDC 1I6ZA 3EHZA 3A7SA 2WS3A 4HE8A 4EIWA 1BR4A 4HFIA 3SS1A 3V5SA 5HWXA 3JAEA 4I0UA 2NWBA 1HG2A 1UURA 3Q9DA 4YHHT 4LF4T 1W0BA 5C8YE 4JYAT 5LG4A 5GONE 2H88A 4CXYA 2V7KA 2DHRA 3Q5EA 4HTEA 1ZKEA 4TZ4C 3PDYA 4U33A 1T8BA 2IIUA 2C5JA 5ETWA 1VRBA 1L0VA 4HWCA 5M4YA 4EYYR 3EDUA 4V1Av 3P50A 3ANWB 4H9SE 1B7TA 2ZM8A 4IE5A 3AE7A 3LK2B 4IT4A 5LMNT 5EK4A 3ZYMA 2IC6A 3KVAA 1IZNB 5LB7B 2CWYA 3RIUC 3A5XA 5LGNB 1Z8UA 2E2AA 1AJ3A 3B13A 3U3IA 2V5CA 3AE5A 4WBOA 3O1JA 4K0KT 5LMUT 2JIWA 4U72A 4GKKT 3AAIA 2V7LA 2MTQA 5JDQA 4F6RC 4LMKA 4UR9A 1D0XA 2OA5A 5AQMB 3UU5A 1SUMB 1HF8A 2PJQA 2KXPB 4H63H 3FZKB 2W62A 2WY2A 4UEMA 3IA3A 5FY7A 2ETLA 2WDVA 5LYJE 1T98A 3N2GE 2XHEB 3AXJA 3PTRB 4OYJA 3KVBA 4YY3T 1I94T 4U74A 1V9DA 2K5BB 3BQIA 1HTJF 3TLTA 3O1IA 2V7IA 5FVLA 5JDMA 5DJQC 3W15B 3PV0F 4U3CA 4NXMT 1FIOA 5L4EA 3ONLC 4HGAA 3KINB 1IBKT 2IC9A 5KMGP 2EHOD 4YJ2E 3OVUA 2N9DA 4ZEYA 2Q9QC 3AAAB 3B5MA 1SA0E 3RRCA 4EB6E 5AQOB 3AE6A 3KBUA 5IYZE 3ZJ1A 2IUBA 3UUXB 5L3EB 2LSYA 1J5ET 5FYMA 5KX5E 4I50E 3HA4A 1MMDA 5HXEA 2KWHA 4IHJE 4O4HE 3F2EA 3VHLA 5JQGE 3KVFA 3PU8A 3OYXA 1MNDA 3FZMB 3M3ZB 5LGUB 2WWUA 4DV1T 3UU8A 3RC3A 1XMQT 1ZHCA 3HR0A 1HX1B 5FXZA 3FXDB 1YW0A 2W2UA 5LCYA 2X0HA 4GKJT 4YHJA 2X9XA 1E1HB 2YOEA 2IHR1 3OBVE 3OKQA 2UU9T 2WBLA 2KT9A 2D5UA 5CJ5A 3DTOA 4DVDA 3AB3B 3AXJB 4JI3T 2J1DG 2JQKA 2R6GF 4K0UA 3ZJ2A 4CI2B 2DL1A 1MIWA 4YFSA 4JV5T 2JMKA 4IIJE 1NAFA 1WCRA 5HXCA 4JI4T 3BK9A 1EZ3A 2DLRA 5FXXA 2XJ7A 1YKHB 4DR2T 2CLYB 2J47A 4H9OC 3DP7A 1Y64B 1HR0T 3CVRA 3RPUA 1HNXT 3UULA 3KW5A 3AE3A 4CN6A 3S4UA 2W0GA 5KXJA 1VCSA 5AQHB 3IEEA 1MMAA 4FJOA 2MPKA 5LGTB 3ZN0B 2E8IA 1LRZA 4EEBA 2XTLA 4JKJA 2BVLA 3NZQA 3SOLA 4IG7A 1JNRA 5AFUL 2L8KA 1XDOA 3PUGA 2IW5B 1U4QA 2MAWA 3G06A 5TAOA 1US7B 2QYWA 1OEDA 2YU2A 3LFMA 4PK4A 4DMWA 4E7ZA 1ZEEA 2PBIA 3AEBA 3HKEE 3PUAA 1KNRA 2W00A 4O4IE 3LK42 5JH7E 2LSKA 3C50A 2WWVA 2X67A 2E5LT 4P1NA 1FJGT 1O3XA 4HWHA 1XWMA 4UF0A 2CM0A 4PJLA 3MXZA 2XAFB 3SWHA 5LOVE 2LEHA 3ONJA 1WR6A 3KDSE 3UFGA 2A72A 4EZHA 2NOXA 4WZXA 2LOPA 2QVAA 5FXVA 5JDFA 5EK3A 4PFOA 2MOZA 3H3MA 3FHNA 4QXCB 4B3RT 5ABFA 3N2OA 2DNXA 4ZI2C 2C5IT 3CQXC 2E9XB 4BA9A 3CK6A 1R8IA 5LP6E 2FJBA 3L09A 4ZS3A 3AVRA 3RIUA 2WU5A 4AKGA 2HH7A 3PJAJ 3ZYKA 1G8XA 3BQLA 3RQWA 3I1AA 2V26A 1G73A 2V1DB 2KSRA 3WAKA 3ZCJA 2E5VA 2OV9A 5AQGB 4KHPT 1D1BA 4YLHA 5HCMA 3EUHA 3T8OA 3PUSA 3NBXX 1KEYA 1MMNA 3ZLIA 1X79A 3X1DA 5EZYE 3ZN1B 4IDZA 5IUXA 4XBFB 2XQYA 2FJEA 2Y6XA 2N1GA 2FJAA 3RISA 5FMNA 3ZT7A 3CX7B 3C98B 3NRYA 3H37A 3JC6D 1SHZC 3ZMUB 3HKDE 4J2CA 1KK7A 5LHHB 3E22E 5AQTB 1WR0A 3ZMVB 2BBHA 1OWAA 2BZBA 2Q9QA 3QOFA 4X20E 4UF0B 3PJAA
chains in the Genus database with same CATH topology
2LJLA 4QX7B 3K3NA 4H9NC 2CXLA 4U72A 4ASKA 2G0UA 3EVYA 3IF8B 2CLYC 4X1KE 3OYZA 3AAIA 1S35A 2V7LA 2MTQA 5JDQA 3N9PA 5KDMC 1HS7A 2KINB 4F6RC 3FBZA 2CA5A 5CA1E 1D0XA 1WRDA 2CMRA 2OA5A 5L3GB 4H9RC 1HF8A 2LSJA 2PJQA 4O2AE 5FY0A 2KXPB 4H63H 2V7JA 2V7MA 2W61A 2CEAA 2W62A 3E0ZA 4UEMA 5J1GA 2E9XD 3J9X1 5FY7A 2ETLA 4JEUB 5LYJE 1FMWA 1T98A 3N2GE 2XHEB 4H9PC 3PE0A 2C5KT 3PTRB 4OYJA 3KVBA 1BR1A 2CE7A 1U5PA 2YU1A 4GOUA 2NW7A 5H6QB 4U74A 4CI3B 3SRZA 1WYBA 2KNDA 4ISSA 4EXTA 3AA7B 2P9BA 1V9DA 2PFVA 2X68A 1LVFA 2K5BB 3BQIA 3E08A 3Q5XA 1HTJF 2CXDA 3RX6A 3HKCE 3O1IA 2V7IA 5JDMA 4PW8A 4WW0A 4C91A 4DM9A 4H9QC 5DJQC 4BJNA 2C0SA 2E9XA 4OK0A 3VKHA 2H7OA 3W15B 3MZKB 3MACA 4L9IA 4P0BA 2ZMAA 1FIOA 1HCIA 2K9AA 2WMNA 4HGAA 1XD3A 3KBTA 3KINB 3ZPOA 4I55E 1ZV4X 2IC9A 4AXPA 5L3CB 5KMGP 2A3DA 2EHOD 2NW9A 4YJ2E 2X66A 2H7VC 2CXFA 2N9DA 1BR0A 3UFEA 4TV8E 4G63A 5HXSA 3ESLA 4Z8XA 3CPZA 4JUYA 3N9QA 1HFAA 2Q9QC 1Z0PA 3AAAB 5L2LA 1SA0E 4TN7B 3RRCA 2VK9A 3RYCE 4EB6E 3GWHA 2WSSV 3RH3A 3GA8A 3NRXA 4MLKA 3P7IA 5HWYA 4O4JE 2EHOA 3JC6C 3KBUA 3LBXB 5IYZE 3ZJ1A 3UUXB 3L3PA 1FEWA 5L3EB 3CMLA 4IE6A 3AAEB 2NW8A 2X0LB 4QXBB 2LSYA 4DO0A 4ZHQE 4UELA 5HAXA 5FYMA 3K3OA 2KMFA 2LENA 2CCQA 2LSIA 5JR9A 4UV9B 4JLEA 2X9YA 4I50E 5KX5E 5JRCB 1MIYA 4MALA 3PU3A 4UVCB 3HA4A 5F3JA 4ZI3D 2VB6A 1MMDA 5HXEA 4TV9E 4CXXA 2KWHA 4IHJE 4OHFA 2DWGA 2D0UA 4O4HE 3F2EA 2MBGA 5JDGA 5HXHA 4GK5E 4I43B 4XAXB 3VHLA 5JVDE 3RC8A 5JQGE 3KVFA 3ETUA 4AI6A 3PU8A 3OYXA 5L3BB 5A1LA 4QKNA 5CA0E 4AKRB 4O4LE 1MNDA 3CKDA 3DJBA 4OFZA 1UCUA 4PJNA 3ANWA 4QWNB 2H3RA 5LGUB 3U78A 2E9XC 4AQGA 2KWIB 4EYUA 2JMHA 2WWUA 1MIVA 1QSDA 4HEAA 4GIWA 1S94A 2LE8A 3RC3A 4H63V 1ZHCA 4P0AA 3CWZB 4IE4A 3HR0A 3LJCA 1WYCA 2N2NA 5LXTE 3UT5E 2W63A 5J2UE 2X9HA 5FXZA 2SPCA 3FXDB 4MBQA 1H7CA 1YW0A 5LCYA 5L3FB 2XAQB 4ZS2A 2WM9A 1NWMX 2NTXA 2ODVA 5FY1A 3ZC1A 4YHJA 5J2TE 2X9XA 5JREA 1E1HB 2K24A 3C4ZA 4CI1B 3OBVE 2KLQA 2EHOC 3OKQA 4UXNB 2WBLA 4XZCA 4HKAA 3ZMZB 4DBQA 2KT9A 2D5UA 4ERRA 5BMVE 2XASB 3D0TA 4GYSA 3ZYLA 4ANJA 4DNDA 1CMXA 3VKGA 3GN5A 3CQCB 3RYHE 3DTOA 4X1YE 1YD8G 4DVDA 3C4WA 3AB3B 2KZ7B 3H3AA 2VKDA 2J1DG 3M65A 1CUNA 2Z6EA 3ZCIA 5JR9C 4ADZA 3N9LA 3QC9A 3CX6B 4K0UA 3ZJ2A 4CI2B 1MIWA 5LJNA 4ILUA 1MNEA 2X9WA 4YFSA 4BAYB 3HL6A 4QHOA 2JMKA 2X51A 4CZZB 4IIJE 1HG5A 4QXHB 1UCHA 1NAFA 4PK5A 5HXCA 4WBNE 3FB2A 3BK9A 5HXRA 3RKOA 3KV4A 3UTKA 1EZ3A 2DLRA 4G2AA 4TUYE 5FXXA 3R6NA 3PUQA 4NUUA 3QK6A 1YKHB 5F8PA 2CLYB 4ZI3C 5CB4E 2ZM0A 2L9QA 4H9OC 3I9WA 1YKEB 3DP7A 2K48A 4HFVA 5DQWA 3R84B 3O9XA 2ODUA 4X1IE 1Y64B 2MYSA 2Y8DA 4CQIA 4UVBB 3CVRA 3RPUA 3NZPA 4L5GA 3UULA 3KW5A 5LNKA 4OYKA 4C90A 4YJ3E 1D1AA 2UXNB 3S4UA 3IFWA 4M1PA 4ZI2D 3RYIE 2W0GA 3CQGB 2EHOB 3MA9A 2ZM2A 3IEEA 1MMAA 4FJOA 1LVKA 5LGTB 5E0OA 5LA6E 3N9OA 5DQVA 3ZN0B 4AKIA 4PFPA 2E8IA 2WAUA 4B6XA 3MKDA 1LRZA 3ZMSB 2XTLA 2GK9A 4JKJA 3RRWA 2ES0A 2BVLA 3NZQA 3LBXA 3Q5WA 3SOLA 4NUVA 4IG7A 5JR9B 3RIIA 3ONXA 3BQKA 5AFUL 4BJMA 2L8KA 3FXEB 4GK0E 4P09A 2LT3A 2VKHA 3PUGA 3HI2A 3ZC0A 3UUNA 2IW5B 1U4QA 1IJ5A 3I0OA 3V5UA 5TAOA 2IAKA 4PK6A 3WI3A 3ZMTB 5JRCA 2LSGA 3PURA 3O1HA 1UX4A 1US7B 2D0TA 2RA1A 2A2FX 2Y48B 2YU2A 3LFMA 5IHYA 2VWAA 4PK4A 4DMWA 2HPJA 4AKLA 2LHRA 3FBLA 4L0RA 5L3DB 3KV6A 4E7ZA 2CWOA 1ZEEA 2Q9QB 2PBIA 3IRTA 3AVSA 4AQFA 3HKEE 3PUAA 3I9YA 2L3LA 2W00A 3IBPA 4O2BE 3LK42 4O4IE 5JH7E 1IAPA 2LSKA 4PAGA 4MHCA 3C50A 3AA1B 4N78D 1QUUA 2X67A 2HPLA 2WMOA 4QX8B 2QA7A 1O3XA 1D1CA 4ISTA 3CX8B 4UF0A 2CM0A 5H6RB 5DABA 4PJLA 3C4XA 5ADXL 2LHNA 3C64A 3MXZA 4KMCA 2XAFB 3SWHA 5LHGB 4AKHA 2VKJA 3KV9A 4IE0A 2JRKA 5LOVE 5JDHA 2VASA 3IHRA 2LEHA 4JEHB 4EOZB 1HX8A 1LKXA 1WR6A 3KDSE 3MJXA 4FI5A 4KUMB 2A72A 4O8SA 1IJ6A 4UVAB 5FP3A 4DMVA 4A56A 2B1EA 3LG7A 4EAHA 4EZHA 4MFRA 2NOXA 3AA6B 4KBMB 2YEVC 3N9MA 2DCFA 2LOPA 3LK3B 5FNVE 3GN5B 2YK0A 4E7SA 2BDEA 5FXVA 5JDFA 2BVMA 1FMVA 5EK3A 4PFOA 2MOZA 3J7Yq 3C51A 2DI4A 3F31A 3FHNA 2RP4A 4QXCB 5EK2A 2XAHB 5LJMA 3TB3A 3WAJA 3N2OA 2DNXA 3K8PC 5LHIB 4ZI2C 2PG8A 1VOMA 2C5IT 2VKOA 2YINA 2LM9A 4PNIA 3CQXC 5FXWA 2E9XB 3ZEFB 4BA9A 1WLXA 4DBRA 4IGUA 5JDNA 5LP6E 5LBQB 3RYFE 3L09A 4ZS3A 4UV8B 3AVRA 4AKGA 2JPFA 1MMGA 3N5LA 2HH7A 3ZYKA 3K3QC 4WNKA 1G8XA 3BQLA 3KV5A 2NTYA 3A7SA 3I1AA 5LBMA 2V26A 4HE8A 4EIWA 1BR4A 4ZOLE 1G73A 2V1DB 3SS1A 2XAJB 3V5SA 4AQFC 5HWXA 2DWKA 3WAKA 3ZCJA 2UXXB 2VL8A 4HN9A 2NWBA 3UUMA 3AA0B 2ACXA 3N2KE 1HG2A 3Q9DA 1D0YA 5C8YE 4PJMA 2ZLYA 4UIGA 1D1BA 5LG4A 4YLHA 5GONE 3B57A 3EUHA 3T8OA 3N9NA 4CXYA 3P8CD 3PUSA 3EDVA 3NBXX 2V7KA 2DHRA 4ZI7E 1BR2A 1MMNA 2XUEA 4HTEA 3VU7H 3ZLIA 1ZKEA 4I6NA 4TZ4C 2NP9A 2QGSA 3HKBE 1X79A 3PDYA 5HYAA 4KP3C 5EZYE 1OXZA 2M67A 2C5JA 4PJJA 3ZN1B 1UX5A 4CXWA 5ETWA 1VRBA 4IDZA 2D2SA 3OJAA 4XBFB 2XQYA 2JJ9A 3I0QA 2Y6XA 3KFWX 5M4YA 2N1GA 4GYRA 3TKLB 4EYYR 3EDUA 1D0ZA 4V1Av 3RISA 2Q9QD 5FMNA 3ANWB 1KNZA 4H9SE 1B7TA 2ZM8A 4IE5A 3CX7B 3C98B 3LK2B 4I4TE 3ETVA 3NRYA 2XAGB 5EK4A 3ZYMA 4TX5A 3Q2MA 3H37A 3JC6D 2IC6A 2I59A 1IZNB 1SHZC 3F57A 3KVAA 4IE7A 3ZMUB 3HKDE 5JDLA 2CWYA 3QUJA 4J2CA 1KK7A 3A5XA 5LHHB 5LGNB 2JQQA 3E22E 1AJ3A 3B13A 3MK7C 3ZMVB 3O4XE 3U3IA 1OWAA 2BZBA 2LOSA 2Q9QA 3GMIA 4EZ4A 4WBOA 3O1JA 4X20E 4UF0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IHR A;  3RII A;  4I6N A;  2ETL A;  1UCH A;  3KW5 A;  1XD3 A;  3IRT A;  1CMX A;  4UEM A;  3IFW A;  3KVF A;  4UEL A;  4DM9 A;  2LEN A;  4JKJ A;  3TB3 A;  3A7S A;  4IG7 A;  3RIS A; 
#chains in the Genus database with same CATH topology
 1ZOY A;  4QX7 B;  4NXN T;  3K3N A;  2CXL A;  4ASK A;  3OYZ A;  1S35 A;  5KDM C;  2KIN B;  3LDQ B;  3FBZ A;  5AQF B;  2XSB A;  5FY0 A;  3UUB A;  3FZL B;  2XQ9 A;  2V7J A;  2V7M A;  2W61 A;  5J1G A;  2E9X D;  2HHH T;  4JEU B;  2WDR A;  4IRE A;  4HFD A;  4KHZ F;  3EI0 A;  4CI3 B;  1WYB A;  2KND A;  2P9B A;  1UGO A;  2PFV A;  1LVF A;  3E08 A;  2HN2 A;  3RX6 A;  3HKC E;  4PW8 A;  4WW0 A;  4DM9 A;  4BJN A;  1NEK A;  2C0S A;  3JAF A;  4OK0 A;  2WB5 A;  5FVK A;  5AQU B;  1ZV4 X;  4AXP A;  2ACZ A;  2FBW A;  2H7V C;  1BR0 A;  3UFE A;  3SFD A;  4JI8 T;  3ESL A;  4LF5 T;  3CPZ A;  3TLV A;  3N9Q A;  3AED A;  2LM2 A;  4JI7 T;  2VL0 A;  2VK9 A;  3RH3 A;  2XY8 B;  3P7I A;  4O4J E;  2UUA T;  1QLB A;  3TLU A;  3PUZ F;  4JI2 T;  3L3P A;  4X66 T;  3CML A;  4IE6 A;  3AAE B;  4YTP A;  4LFB T;  4QXB B;  4HFE A;  4ZHQ E;  4DR6 T;  4UEL A;  4JI0 T;  3K3O A;  5JRC B;  4UV9 B;  1MIY A;  3PU3 A;  4DUY T;  5F3J A;  4ZI3 D;  1YQ4 A;  2BG9 B;  4OHF A;  2DWG A;  2D0U A;  3QNU A;  5HXH A;  4GK5 E;  5JVD E;  3T1H T;  2CHO A;  1NEN A;  4ZZC A;  4DV2 T;  4QWN B;  2WZI A;  3RI5 A;  2KWI B;  1VCT A;  2JMH A;  4X64 T;  4HEA A;  2LE8 A;  2BKO A;  4P0A A;  4IE4 A;  5LXT E;  3UT5 E;  3P4W A;  5J2U E;  4MBQ A;  2XAQ B;  2NTX A;  4EV6 A;  5J2T E;  3K1S A;  2K24 A;  4CN1 A;  2EHO C;  3ZMZ B;  4UXN B;  4HKA A;  3D0T A;  4GYS A;  4DND A;  2W66 A;  3UQ4 A;  1YD8 G;  2VKD A;  4A5X A;  3M65 A;  2Z6E A;  3ZCI A;  4Z90 A;  4NPP A;  1MNE A;  2H89 A;  5ABH A;  3HL6 A;  1IBM T;  2X51 A;  4ILB A;  4COF A;  2XQ6 A;  3AEA A;  1UCH A;  3L8R A;  3P4S A;  5ABE A;  5HXR A;  3VRA A;  3ZST A;  2IDO B;  2K3W A;  4G2A A;  3PUQ A;  5L4H A;  1J5W A;  5F8P A;  5CB4 E;  2ZM0 A;  3R84 B;  1XDP A;  1KF6 A;  3O9X A;  2MYS A;  4CQI A;  5AQS B;  3NZP A;  1X9B A;  5LNK A;  3ZSS A;  3JAD A;  4C90 A;  1XZY A;  3RYI E;  4ZZB A;  3PUW F;  1UK5 A;  2WQY A;  5LA6 E;  4AKI A;  4PFP A;  2GK9 A;  2ES0 A;  3LBX A;  2RPA A;  3FXE B;  4GK0 E;  2LT3 A;  2V8S V;  3HI2 A;  4DR1 T;  1IJ5 A;  3V5U A;  3PUR A;  2XM2 A;  2A2F X;  2Y48 B;  5AQI B;  4AKL A;  4IL9 A;  4L0R A;  5L3D B;  3KV6 A;  2LKH A;  3AVS A;  3IBP A;  1T72 A;  4MHC A;  2HN1 A;  2QA7 A;  4LF8 T;  4IST A;  5DAB A;  5ADX L;  3C64 A;  2VKJ A;  2LKG A;  4JEH B;  4EOZ B;  1LKX A;  2UXB T;  1YXR A;  4KUM B;  4O8S A;  1IJ6 A;  3AE9 A;  5HEG A;  4A56 A;  4IDQ A;  2M6I A;  2DCF A;  5F5W A;  3J7Y q;  3C51 A;  2XAH B;  3TB3 A;  4DUZ T;  2VKO A;  2YIN A;  2BS3 A;  3OPC A;  5LBQ B;  5AQL B;  3Q5D A;  3RYF E;  4UV8 B;  2JPF A;  3N5L A;  3K3Q C;  5FL0 A;  3KV5 A;  2NTY A;  3NWI A;  2CBI A;  4ZOL E;  3UU6 A;  3NKZ A;  2XAJ B;  5HEH A;  2DWK A;  4YXD A;  3RKG A;  4CN4 A;  1ZP0 A;  3UUM A;  3N2K E;  2OLT A;  2ZLY A;  4UIG A;  4YTM A;  2BG9 E;  3B57 A;  1GQE A;  3N9N A;  3QB5 K;  1BR2 A;  2XUE A;  4Z91 A;  4I6N A;  1KNP A;  2QGS A;  3HKB E;  1CHU A;  5HYA A;  1OXZ A;  4JI1 T;  5FKY A;  4A97 A;  1UX5 A;  1Y01 A;  4CXW A;  1J1J A;  3VRB A;  2D2S A;  2I6H A;  3FZH B;  3AE2 A;  3OJA A;  3KFW X;  4GYR A;  4LFC T;  1D0Z A;  1KNZ A;  2V6X A;  1UUS A;  2UUC T;  3UQ7 A;  2XAG B;  5C3J A;  5JDL A;  3F57 A;  4IE7 A;  2F4V T;  3OTO T;  2JQQ A;  4B3T T;  2YDS A;  2LOS A;  2LLY A;  4H9N C;  1XNR T;  3IF8 B;  3EVY A;  2CLY C;  3L39 A;  1HS7 A;  2BS4 A;  2CA5 A;  3RLF F;  2CPT A;  2CMR A;  2WP9 A;  5L3G B;  2LSJ A;  3E0Z A;  5CFB A;  3J9X 1;  1FMW A;  2CHN A;  2AXD S;  4H9P C;  2C5K T;  1W09 A;  5LG3 A;  1BR1 A;  2CE7 A;  2YU1 A;  2UXC T;  1W9R A;  5H6Q B;  4ISS A;  3AA7 B;  1E2A A;  3Q5X A;  2B76 A;  4WYV A;  4C91 A;  4H9Q C;  4IDN A;  4ILA A;  5AQR B;  2WDQ A;  4L9I A;  2WMN A;  2WZH A;  3ZPO A;  5L3C B;  2A3D A;  2X66 A;  2BKP A;  4G63 A;  5HXS A;  4Z8X A;  4JUY A;  4DID B;  1HFA A;  3RYC E;  2WSS V;  4OX9 T;  5HWY A;  2EHO A;  3JC6 C;  5AQV B;  3A7M A;  2X0L B;  3PUV F;  4DO0 A;  5L47 A;  4HWI B;  2LSI A;  4JLE A;  2X9Y A;  4X65 T;  4MAL A;  4UVC B;  2VB6 A;  1OED B;  4TV9 E;  4CXX A;  2M6B A;  5JDG A;  4XAX B;  4B3M T;  3AE8 A;  3ZT6 A;  5BR8 T;  5A1L A;  4QKN A;  1N36 T;  5CA0 E;  4YSX A;  3DJB A;  3TLS A;  3ANW A;  2XZE A;  2E9X C;  4AQG A;  1HNW T;  2XM1 A;  4GIW A;  1S94 A;  4A98 A;  4H63 V;  3CWZ B;  4X62 T;  2X9H A;  2SPC A;  5AQN B;  1H7C A;  4ZS2 A;  4EGW A;  4HFC A;  1NWM X;  4DR4 T;  1N33 T;  5FY1 A;  4KX6 A;  4LFA T;  2BBJ A;  5JRE A;  1YQ3 A;  3C4Z A;  4CI1 B;  4U31 A;  4YSY A;  4XZC A;  4DBQ A;  4ERR A;  5BMV E;  5ABF B;  4ANJ A;  1CMX A;  3GN5 A;  3CQC B;  3RYH E;  4HFB A;  2KZ7 B;  2ZM6 T;  1CUN A;  5AQP B;  4LF9 T;  5JR9 C;  3QC9 A;  3CX6 B;  4DR3 T;  5LJN A;  4ILU A;  4AQY T;  1T7S A;  1HG5 A;  4DR5 T;  3CIR A;  4WBN E;  2V6Y A;  3FB2 A;  2UXD T;  3RKO A;  4TUY E;  4U2Z A;  2FJD A;  3P4Q A;  4QH1 A;  4ZI3 C;  2I0M A;  2K48 A;  4HFV A;  3AEE A;  4X1I E;  2Y8D A;  4DR7 T;  4L5G A;  2CRB A;  5C2T A;  1D1A A;  2UXN B;  4M1P A;  5AQJ B;  3CQG B;  2EHO B;  2IML A;  5DQV A;  4B6X A;  3MKD A;  3A8Y C;  4TNW A;  2VQF T;  3RRW A;  3Q5W A;  4NUV A;  3RII A;  3BQK A;  4DV5 T;  4BJM A;  4P09 A;  2VKH A;  3RIA A;  4X5T A;  2D9D A;  4U7I A;  4PK6 A;  3PUY F;  4DV4 T;  3O1H A;  5FL1 A;  4QH4 A;  2VWA A;  2HPJ A;  2LHR A;  1XNQ T;  3FBL A;  3T1Y T;  2CWO A;  1DU2 A;  4JI6 T;  5HCJ A;  2Q9Q B;  3RF1 A;  3I9Y A;  2L3L A;  1N32 T;  4PAG A;  4HWD A;  1QUU A;  3P4R A;  2HPL A;  4JBW F;  3P4P A;  1D1C A;  5H6R B;  3LSV A;  2LHN A;  4KMC A;  5LHG B;  2JRK A;  2WU2 A;  1XMO T;  3IHR A;  4FI5 A;  4AIS A;  4DMV A;  2J62 A;  4UVA B;  5FP3 A;  3LG7 A;  4EAH A;  4KBM B;  3RGL A;  5FNV E;  1JNZ A;  3GN5 B;  2YK0 A;  3UU3 A;  1FMV A;  2RP4 A;  5EK2 A;  2VQE T;  5LJM A;  3K8P C;  5LHI B;  1VOM A;  4NIQ A;  5FXW A;  3ZEF B;  1WLX A;  4DBR A;  4IGU A;  2V6Y B;  2V5D A;  2BG9 C;  4HWF A;  1MMG A;  4WNK A;  3AE1 A;  5LBM A;  4B3S T;  4AQF C;  2XPK A;  2UXX B;  2VL8 A;  4HN9 A;  3AA0 B;  2ACX A;  1D0Y A;  4PJM A;  5AQQ B;  4IL4 A;  1OED E;  4IDO A;  1N34 T;  2QRX A;  3P8C D;  3AE4 A;  3EDV A;  4ZI7 E;  4ZXL A;  3VU7 H;  4LML A;  2W67 A;  2NP9 A;  2VVS A;  4KP3 C;  2M67 A;  4PJJ A;  3AEF A;  5HEO A;  2CBJ A;  2JJ9 A;  3I0Q A;  2UUB T;  5J0Z A;  3TKL B;  4Q25 A;  3UU4 A;  2Q9Q D;  4I4T E;  3ETV A;  4ILC A;  4TX5 A;  3Q2M A;  2I59 A;  3QUJ A;  3MK7 C;  3O4X E;  3PUX F;  2WCA A;  3GMI A;  4EZ4 A;  2JQH A;  4YTN A;  2AE9 A;  2LJL A;  5HEJ A;  2G0U A;  4X1K E;  3N9P A;  4TWD A;  5CA1 E;  1WRD A;  3FZF B;  4H9R C;  4O2A E;  3SFE A;  1HNZ T;  4IDP A;  4U7Y A;  2CEA A;  3QB5 A;  3PE0 A;  4YT0 A;  1U5P A;  4GOU A;  2NW7 A;  3SRZ A;  1M7K A;  4EXT A;  2X68 A;  2CXD A;  2E9X A;  1W0A A;  3VKH A;  2H7O A;  3MZK B;  3MAC A;  4P0B A;  2ZMA A;  1HCI A;  2K9A A;  1XD3 A;  3KBT A;  4LF7 T;  4AIU A;  4I55 E;  2NW9 A;  2CXF A;  4TV8 E;  4QH5 A;  1Z0P A;  5L2L A;  2XQ5 A;  5AQK B;  3EAB A;  4TN7 B;  1E7P A;  1WFD A;  3GWH A;  3GA8 A;  3NRX A;  3VR9 A;  4MLK A;  2XQ8 A;  4DV6 T;  3ZKR A;  3TLW A;  3LBX B;  1FEW A;  2NW8 A;  5HAX A;  1KFY A;  2KMF A;  2LEN A;  2CCQ A;  5JR9 A;  3RHW A;  2XSA A;  4YSZ A;  2NR4 A;  3ABV A;  2MBG A;  4I43 B;  4DV3 T;  3RC8 A;  3ETU A;  4AI6 A;  2J4G A;  5L3B B;  2XQ3 A;  4AKR B;  4O4L E;  3CKD A;  4OFZ A;  1UCU A;  4PJN A;  2H3R A;  3U78 A;  4EYU A;  4KI0 F;  2X0Y A;  1MIV A;  1QSD A;  2A9U A;  4TWF A;  4TWH A;  1IBL T;  2VUR A;  3LJC A;  1WYC A;  2N2N A;  2W63 A;  4DV0 T;  5L3F B;  2WM9 A;  2ODV A;  3NVO A;  3ZC1 A;  5IWA T;  4F8H A;  2KLQ A;  2XAS B;  3ZYL A;  3VKG A;  4X1Y E;  3C4W A;  3H3A A;  2YN6 A;  2LRK A;  5ABG A;  4ADZ A;  3N9L A;  2BKN A;  2X9W A;  2XQ7 A;  3VR8 A;  4BAY B;  3JCF A;  4QHO A;  4CZZ B;  4QXH B;  4PK5 A;  3UTK A;  3KV4 A;  1M62 A;  4DV7 T;  3R6N A;  4NUU A;  3QK6 A;  2YKS A;  2L9Q A;  3I9W A;  1YKE B;  5DQW A;  2ODU A;  5JTG A;  2BS2 A;  2XQ4 A;  4UVB B;  2VVN A;  4OYK A;  4YJ3 E;  3IFW A;  4ZI2 D;  3MA9 A;  2ZM2 A;  1LVK A;  5E0O A;  3N9O A;  2WAU A;  3ZMS B;  5JR9 B;  3ONX A;  3ZC0 A;  3UUN A;  2YDQ A;  3I0O A;  2IAK A;  2W4X A;  3WI3 A;  3RQU A;  3ZMT B;  5JRC A;  2LSG A;  1UX4 A;  1SE7 A;  2D0T A;  2RA1 A;  2YDR A;  2BG9 A;  3ZT5 A;  5IHY A;  5CGM A;  4U2Y A;  3AEG A;  3IRT A;  4AQF A;  2LRL A;  2XQA A;  4LMJ A;  4O2B E;  1IAP A;  3AA1 B;  4N78 D;  2WMO A;  4QX8 B;  3EAM A;  3CX8 B;  3C4X A;  4EED A;  4AKH A;  3KV9 A;  4IE0 A;  5JDH A;  2VAS A;  1HX8 A;  2FUP A;  5HEU A;  3MJX A;  4LF6 T;  2PTF A;  3AEC A;  2B1E A;  4MFR A;  3AA6 B;  2YEV C;  3N9M A;  3LK3 B;  4E7S A;  2BDE A;  2BVM A;  3RIF A;  2DI4 A;  3F31 A;  4JI5 T;  2JQ9 A;  3WAJ A;  2PG8 A;  4PNI A;  2LM9 A;  4HFH A;  5JDN A;  4TNV A;  1OED C;  1I6Z A;  3EHZ A;  3A7S A;  2WS3 A;  4HE8 A;  4EIW A;  1BR4 A;  4HFI A;  3SS1 A;  3V5S A;  5HWX A;  3JAE A;  4I0U A;  2NWB A;  1HG2 A;  1UUR A;  3Q9D A;  4YHH T;  4LF4 T;  1W0B A;  5C8Y E;  4JYA T;  5LG4 A;  5GON E;  2H88 A;  4CXY A;  2V7K A;  2DHR A;  3Q5E A;  4HTE A;  1ZKE A;  4TZ4 C;  3PDY A;  4U33 A;  1T8B A;  2IIU A;  2C5J A;  5ETW A;  1VRB A;  1L0V A;  4HWC A;  5M4Y A;  4EYY R;  3EDU A;  4V1A v;  3P50 A;  3ANW B;  4H9S E;  1B7T A;  2ZM8 A;  4IE5 A;  3AE7 A;  3LK2 B;  4IT4 A;  5LMN T;  5EK4 A;  3ZYM A;  2IC6 A;  3KVA A;  1IZN B;  5LB7 B;  2CWY A;  3RIU C;  3A5X A;  5LGN B;  1Z8U A;  2E2A A;  1AJ3 A;  3B13 A;  3U3I A;  2V5C A;  3AE5 A;  4WBO A;  3O1J A;  4K0K T;  5LMU T;  2JIW A;  4U72 A;  4GKK T;  3AAI A;  2V7L A;  2MTQ A;  5JDQ A;  4F6R C;  4LMK A;  4UR9 A;  1D0X A;  2OA5 A;  5AQM B;  3UU5 A;  1SUM B;  1HF8 A;  2PJQ A;  2KXP B;  4H63 H;  3FZK B;  2W62 A;  2WY2 A;  4UEM A;  3IA3 A;  5FY7 A;  2ETL A;  2WDV A;  5LYJ E;  1T98 A;  3N2G E;  2XHE B;  3AXJ A;  3PTR B;  4OYJ A;  3KVB A;  4YY3 T;  1I94 T;  4U74 A;  1V9D A;  2K5B B;  3BQI A;  1HTJ F;  3TLT A;  3O1I A;  2V7I A;  5FVL A;  5JDM A;  5DJQ C;  3W15 B;  3PV0 F;  4U3C A;  4NXM T;  1FIO A;  5L4E A;  3ONL C;  4HGA A;  3KIN B;  1IBK T;  2IC9 A;  5KMG P;  2EHO D;  4YJ2 E;  3OVU A;  2N9D A;  4ZEY A;  2Q9Q C;  3AAA B;  3B5M A;  1SA0 E;  3RRC A;  4EB6 E;  5AQO B;  3AE6 A;  3KBU A;  5IYZ E;  3ZJ1 A;  2IUB A;  3UUX B;  5L3E B;  2LSY A;  1J5E T;  5FYM A;  5KX5 E;  4I50 E;  3HA4 A;  1MMD A;  5HXE A;  2KWH A;  4IHJ E;  4O4H E;  3F2E A;  3VHL A;  5JQG E;  3KVF A;  3PU8 A;  3OYX A;  1MND A;  3FZM B;  3M3Z B;  5LGU B;  2WWU A;  4DV1 T;  3UU8 A;  3RC3 A;  1XMQ T;  1ZHC A;  3HR0 A;  1HX1 B;  5FXZ A;  3FXD B;  1YW0 A;  2W2U A;  5LCY A;  2X0H A;  4GKJ T;  4YHJ A;  2X9X A;  1E1H B;  2YOE A;  2IHR 1;  3OBV E;  3OKQ A;  2UU9 T;  2WBL A;  2KT9 A;  2D5U A;  5CJ5 A;  3DTO A;  4DVD A;  3AB3 B;  3AXJ B;  4JI3 T;  2J1D G;  2JQK A;  2R6G F;  4K0U A;  3ZJ2 A;  4CI2 B;  2DL1 A;  1MIW A;  4YFS A;  4JV5 T;  2JMK A;  4IIJ E;  1NAF A;  1WCR A;  5HXC A;  4JI4 T;  3BK9 A;  1EZ3 A;  2DLR A;  5FXX A;  2XJ7 A;  1YKH B;  4DR2 T;  2CLY B;  2J47 A;  4H9O C;  3DP7 A;  1Y64 B;  1HR0 T;  3CVR A;  3RPU A;  1HNX T;  3UUL A;  3KW5 A;  3AE3 A;  4CN6 A;  3S4U A;  2W0G A;  5KXJ A;  1VCS A;  5AQH B;  3IEE A;  1MMA A;  4FJO A;  2MPK A;  5LGT B;  3ZN0 B;  2E8I A;  1LRZ A;  4EEB A;  2XTL A;  4JKJ A;  2BVL A;  3NZQ A;  3SOL A;  4IG7 A;  1JNR A;  5AFU L;  2L8K A;  1XDO A;  3PUG A;  2IW5 B;  1U4Q A;  2MAW A;  3G06 A;  5TAO A;  1US7 B;  2QYW A;  1OED A;  2YU2 A;  3LFM A;  4PK4 A;  4DMW A;  4E7Z A;  1ZEE A;  2PBI A;  3AEB A;  3HKE E;  3PUA A;  1KNR A;  2W00 A;  4O4I E;  3LK4 2;  5JH7 E;  2LSK A;  3C50 A;  2WWV A;  2X67 A;  2E5L T;  4P1N A;  1FJG T;  1O3X A;  4HWH A;  1XWM A;  4UF0 A;  2CM0 A;  4PJL A;  3MXZ A;  2XAF B;  3SWH A;  5LOV E;  2LEH A;  3ONJ A;  1WR6 A;  3KDS E;  3UFG A;  2A72 A;  4EZH A;  2NOX A;  4WZX A;  2LOP A;  2QVA A;  5FXV A;  5JDF A;  5EK3 A;  4PFO A;  2MOZ A;  3H3M A;  3FHN A;  4QXC B;  4B3R T;  5ABF A;  3N2O A;  2DNX A;  4ZI2 C;  2C5I T;  3CQX C;  2E9X B;  4BA9 A;  3CK6 A;  1R8I A;  5LP6 E;  2FJB A;  3L09 A;  4ZS3 A;  3AVR A;  3RIU A;  2WU5 A;  4AKG A;  2HH7 A;  3PJA J;  3ZYK A;  1G8X A;  3BQL A;  3RQW A;  3I1A A;  2V26 A;  1G73 A;  2V1D B;  2KSR A;  3WAK A;  3ZCJ A;  2E5V A;  2OV9 A;  5AQG B;  4KHP T;  1D1B A;  4YLH A;  5HCM A;  3EUH A;  3T8O A;  3PUS A;  3NBX X;  1KEY A;  1MMN A;  3ZLI A;  1X79 A;  3X1D A;  5EZY E;  3ZN1 B;  4IDZ A;  5IUX A;  4XBF B;  2XQY A;  2FJE A;  2Y6X A;  2N1G A;  2FJA A;  3RIS A;  5FMN A;  3ZT7 A;  3CX7 B;  3C98 B;  3NRY A;  3H37 A;  3JC6 D;  1SHZ C;  3ZMU B;  3HKD E;  4J2C A;  1KK7 A;  5LHH B;  3E22 E;  5AQT B;  1WR0 A;  3ZMV B;  2BBH A;  1OWA A;  2BZB A;  2Q9Q A;  3QOF A;  4X20 E;  4UF0 B;  3PJA A; 
#chains in the Genus database with same CATH homology
 2LJL A;  4QX7 B;  3K3N A;  4H9N C;  2CXL A;  4U72 A;  4ASK A;  2G0U A;  3EVY A;  3IF8 B;  2CLY C;  4X1K E;  3OYZ A;  3AAI A;  1S35 A;  2V7L A;  2MTQ A;  5JDQ A;  3N9P A;  5KDM C;  1HS7 A;  2KIN B;  4F6R C;  3FBZ A;  2CA5 A;  5CA1 E;  1D0X A;  1WRD A;  2CMR A;  2OA5 A;  5L3G B;  4H9R C;  1HF8 A;  2LSJ A;  2PJQ A;  4O2A E;  5FY0 A;  2KXP B;  4H63 H;  2V7J A;  2V7M A;  2W61 A;  2CEA A;  2W62 A;  3E0Z A;  4UEM A;  5J1G A;  2E9X D;  3J9X 1;  5FY7 A;  2ETL A;  4JEU B;  5LYJ E;  1FMW A;  1T98 A;  3N2G E;  2XHE B;  4H9P C;  3PE0 A;  2C5K T;  3PTR B;  4OYJ A;  3KVB A;  1BR1 A;  2CE7 A;  1U5P A;  2YU1 A;  4GOU A;  2NW7 A;  5H6Q B;  4U74 A;  4CI3 B;  3SRZ A;  1WYB A;  2KND A;  4ISS A;  4EXT A;  3AA7 B;  2P9B A;  1V9D A;  2PFV A;  2X68 A;  1LVF A;  2K5B B;  3BQI A;  3E08 A;  3Q5X A;  1HTJ F;  2CXD A;  3RX6 A;  3HKC E;  3O1I A;  2V7I A;  5JDM A;  4PW8 A;  4WW0 A;  4C91 A;  4DM9 A;  4H9Q C;  5DJQ C;  4BJN A;  2C0S A;  2E9X A;  4OK0 A;  3VKH A;  2H7O A;  3W15 B;  3MZK B;  3MAC A;  4L9I A;  4P0B A;  2ZMA A;  1FIO A;  1HCI A;  2K9A A;  2WMN A;  4HGA A;  1XD3 A;  3KBT A;  3KIN B;  3ZPO A;  4I55 E;  1ZV4 X;  2IC9 A;  4AXP A;  5L3C B;  5KMG P;  2A3D A;  2EHO D;  2NW9 A;  4YJ2 E;  2X66 A;  2H7V C;  2CXF A;  2N9D A;  1BR0 A;  3UFE A;  4TV8 E;  4G63 A;  5HXS A;  3ESL A;  4Z8X A;  3CPZ A;  4JUY A;  3N9Q A;  1HFA A;  2Q9Q C;  1Z0P A;  3AAA B;  5L2L A;  1SA0 E;  4TN7 B;  3RRC A;  2VK9 A;  3RYC E;  4EB6 E;  3GWH A;  2WSS V;  3RH3 A;  3GA8 A;  3NRX A;  4MLK A;  3P7I A;  5HWY A;  4O4J E;  2EHO A;  3JC6 C;  3KBU A;  3LBX B;  5IYZ E;  3ZJ1 A;  3UUX B;  3L3P A;  1FEW A;  5L3E B;  3CML A;  4IE6 A;  3AAE B;  2NW8 A;  2X0L B;  4QXB B;  2LSY A;  4DO0 A;  4ZHQ E;  4UEL A;  5HAX A;  5FYM A;  3K3O A;  2KMF A;  2LEN A;  2CCQ A;  2LSI A;  5JR9 A;  4UV9 B;  4JLE A;  2X9Y A;  4I50 E;  5KX5 E;  5JRC B;  1MIY A;  4MAL A;  3PU3 A;  4UVC B;  3HA4 A;  5F3J A;  4ZI3 D;  2VB6 A;  1MMD A;  5HXE A;  4TV9 E;  4CXX A;  2KWH A;  4IHJ E;  4OHF A;  2DWG A;  2D0U A;  4O4H E;  3F2E A;  2MBG A;  5JDG A;  5HXH A;  4GK5 E;  4I43 B;  4XAX B;  3VHL A;  5JVD E;  3RC8 A;  5JQG E;  3KVF A;  3ETU A;  4AI6 A;  3PU8 A;  3OYX A;  5L3B B;  5A1L A;  4QKN A;  5CA0 E;  4AKR B;  4O4L E;  1MND A;  3CKD A;  3DJB A;  4OFZ A;  1UCU A;  4PJN A;  3ANW A;  4QWN B;  2H3R A;  5LGU B;  3U78 A;  2E9X C;  4AQG A;  2KWI B;  4EYU A;  2JMH A;  2WWU A;  1MIV A;  1QSD A;  4HEA A;  4GIW A;  1S94 A;  2LE8 A;  3RC3 A;  4H63 V;  1ZHC A;  4P0A A;  3CWZ B;  4IE4 A;  3HR0 A;  3LJC A;  1WYC A;  2N2N A;  5LXT E;  3UT5 E;  2W63 A;  5J2U E;  2X9H A;  5FXZ A;  2SPC A;  3FXD B;  4MBQ A;  1H7C A;  1YW0 A;  5LCY A;  5L3F B;  2XAQ B;  4ZS2 A;  2WM9 A;  1NWM X;  2NTX A;  2ODV A;  5FY1 A;  3ZC1 A;  4YHJ A;  5J2T E;  2X9X A;  5JRE A;  1E1H B;  2K24 A;  3C4Z A;  4CI1 B;  3OBV E;  2KLQ A;  2EHO C;  3OKQ A;  4UXN B;  2WBL A;  4XZC A;  4HKA A;  3ZMZ B;  4DBQ A;  2KT9 A;  2D5U A;  4ERR A;  5BMV E;  2XAS B;  3D0T A;  4GYS A;  3ZYL A;  4ANJ A;  4DND A;  1CMX A;  3VKG A;  3GN5 A;  3CQC B;  3RYH E;  3DTO A;  4X1Y E;  1YD8 G;  4DVD A;  3C4W A;  3AB3 B;  2KZ7 B;  3H3A A;  2VKD A;  2J1D G;  3M65 A;  1CUN A;  2Z6E A;  3ZCI A;  5JR9 C;  4ADZ A;  3N9L A;  3QC9 A;  3CX6 B;  4K0U A;  3ZJ2 A;  4CI2 B;  1MIW A;  5LJN A;  4ILU A;  1MNE A;  2X9W A;  4YFS A;  4BAY B;  3HL6 A;  4QHO A;  2JMK A;  2X51 A;  4CZZ B;  4IIJ E;  1HG5 A;  4QXH B;  1UCH A;  1NAF A;  4PK5 A;  5HXC A;  4WBN E;  3FB2 A;  3BK9 A;  5HXR A;  3RKO A;  3KV4 A;  3UTK A;  1EZ3 A;  2DLR A;  4G2A A;  4TUY E;  5FXX A;  3R6N A;  3PUQ A;  4NUU A;  3QK6 A;  1YKH B;  5F8P A;  2CLY B;  4ZI3 C;  5CB4 E;  2ZM0 A;  2L9Q A;  4H9O C;  3I9W A;  1YKE B;  3DP7 A;  2K48 A;  4HFV A;  5DQW A;  3R84 B;  3O9X A;  2ODU A;  4X1I E;  1Y64 B;  2MYS A;  2Y8D A;  4CQI A;  4UVB B;  3CVR A;  3RPU A;  3NZP A;  4L5G A;  3UUL A;  3KW5 A;  5LNK A;  4OYK A;  4C90 A;  4YJ3 E;  1D1A A;  2UXN B;  3S4U A;  3IFW A;  4M1P A;  4ZI2 D;  3RYI E;  2W0G A;  3CQG B;  2EHO B;  3MA9 A;  2ZM2 A;  3IEE A;  1MMA A;  4FJO A;  1LVK A;  5LGT B;  5E0O A;  5LA6 E;  3N9O A;  5DQV A;  3ZN0 B;  4AKI A;  4PFP A;  2E8I A;  2WAU A;  4B6X A;  3MKD A;  1LRZ A;  3ZMS B;  2XTL A;  2GK9 A;  4JKJ A;  3RRW A;  2ES0 A;  2BVL A;  3NZQ A;  3LBX A;  3Q5W A;  3SOL A;  4NUV A;  4IG7 A;  5JR9 B;  3RII A;  3ONX A;  3BQK A;  5AFU L;  4BJM A;  2L8K A;  3FXE B;  4GK0 E;  4P09 A;  2LT3 A;  2VKH A;  3PUG A;  3HI2 A;  3ZC0 A;  3UUN A;  2IW5 B;  1U4Q A;  1IJ5 A;  3I0O A;  3V5U A;  5TAO A;  2IAK A;  4PK6 A;  3WI3 A;  3ZMT B;  5JRC A;  2LSG A;  3PUR A;  3O1H A;  1UX4 A;  1US7 B;  2D0T A;  2RA1 A;  2A2F X;  2Y48 B;  2YU2 A;  3LFM A;  5IHY A;  2VWA A;  4PK4 A;  4DMW A;  2HPJ A;  4AKL A;  2LHR A;  3FBL A;  4L0R A;  5L3D B;  3KV6 A;  4E7Z A;  2CWO A;  1ZEE A;  2Q9Q B;  2PBI A;  3IRT A;  3AVS A;  4AQF A;  3HKE E;  3PUA A;  3I9Y A;  2L3L A;  2W00 A;  3IBP A;  4O2B E;  3LK4 2;  4O4I E;  5JH7 E;  1IAP A;  2LSK A;  4PAG A;  4MHC A;  3C50 A;  3AA1 B;  4N78 D;  1QUU A;  2X67 A;  2HPL A;  2WMO A;  4QX8 B;  2QA7 A;  1O3X A;  1D1C A;  4IST A;  3CX8 B;  4UF0 A;  2CM0 A;  5H6R B;  5DAB A;  4PJL A;  3C4X A;  5ADX L;  2LHN A;  3C64 A;  3MXZ A;  4KMC A;  2XAF B;  3SWH A;  5LHG B;  4AKH A;  2VKJ A;  3KV9 A;  4IE0 A;  2JRK A;  5LOV E;  5JDH A;  2VAS A;  3IHR A;  2LEH A;  4JEH B;  4EOZ B;  1HX8 A;  1LKX A;  1WR6 A;  3KDS E;  3MJX A;  4FI5 A;  4KUM B;  2A72 A;  4O8S A;  1IJ6 A;  4UVA B;  5FP3 A;  4DMV A;  4A56 A;  2B1E A;  3LG7 A;  4EAH A;  4EZH A;  4MFR A;  2NOX A;  3AA6 B;  4KBM B;  2YEV C;  3N9M A;  2DCF A;  2LOP A;  3LK3 B;  5FNV E;  3GN5 B;  2YK0 A;  4E7S A;  2BDE A;  5FXV A;  5JDF A;  2BVM A;  1FMV A;  5EK3 A;  4PFO A;  2MOZ A;  3J7Y q;  3C51 A;  2DI4 A;  3F31 A;  3FHN A;  2RP4 A;  4QXC B;  5EK2 A;  2XAH B;  5LJM A;  3TB3 A;  3WAJ A;  3N2O A;  2DNX A;  3K8P C;  5LHI B;  4ZI2 C;  2PG8 A;  1VOM A;  2C5I T;  2VKO A;  2YIN A;  2LM9 A;  4PNI A;  3CQX C;  5FXW A;  2E9X B;  3ZEF B;  4BA9 A;  1WLX A;  4DBR A;  4IGU A;  5JDN A;  5LP6 E;  5LBQ B;  3RYF E;  3L09 A;  4ZS3 A;  4UV8 B;  3AVR A;  4AKG A;  2JPF A;  1MMG A;  3N5L A;  2HH7 A;  3ZYK A;  3K3Q C;  4WNK A;  1G8X A;  3BQL A;  3KV5 A;  2NTY A;  3A7S A;  3I1A A;  5LBM A;  2V26 A;  4HE8 A;  4EIW A;  1BR4 A;  4ZOL E;  1G73 A;  2V1D B;  3SS1 A;  2XAJ B;  3V5S A;  4AQF C;  5HWX A;  2DWK A;  3WAK A;  3ZCJ A;  2UXX B;  2VL8 A;  4HN9 A;  2NWB A;  3UUM A;  3AA0 B;  2ACX A;  3N2K E;  1HG2 A;  3Q9D A;  1D0Y A;  5C8Y E;  4PJM A;  2ZLY A;  4UIG A;  1D1B A;  5LG4 A;  4YLH A;  5GON E;  3B57 A;  3EUH A;  3T8O A;  3N9N A;  4CXY A;  3P8C D;  3PUS A;  3EDV A;  3NBX X;  2V7K A;  2DHR A;  4ZI7 E;  1BR2 A;  1MMN A;  2XUE A;  4HTE A;  3VU7 H;  3ZLI A;  1ZKE A;  4I6N A;  4TZ4 C;  2NP9 A;  2QGS A;  3HKB E;  1X79 A;  3PDY A;  5HYA A;  4KP3 C;  5EZY E;  1OXZ A;  2M67 A;  2C5J A;  4PJJ A;  3ZN1 B;  1UX5 A;  4CXW A;  5ETW A;  1VRB A;  4IDZ A;  2D2S A;  3OJA A;  4XBF B;  2XQY A;  2JJ9 A;  3I0Q A;  2Y6X A;  3KFW X;  5M4Y A;  2N1G A;  4GYR A;  3TKL B;  4EYY R;  3EDU A;  1D0Z A;  4V1A v;  3RIS A;  2Q9Q D;  5FMN A;  3ANW B;  1KNZ A;  4H9S E;  1B7T A;  2ZM8 A;  4IE5 A;  3CX7 B;  3C98 B;  3LK2 B;  4I4T E;  3ETV A;  3NRY A;  2XAG B;  5EK4 A;  3ZYM A;  4TX5 A;  3Q2M A;  3H37 A;  3JC6 D;  2IC6 A;  2I59 A;  1IZN B;  1SHZ C;  3F57 A;  3KVA A;  4IE7 A;  3ZMU B;  3HKD E;  5JDL A;  2CWY A;  3QUJ A;  4J2C A;  1KK7 A;  3A5X A;  5LHH B;  5LGN B;  2JQQ A;  3E22 E;  1AJ3 A;  3B13 A;  3MK7 C;  3ZMV B;  3O4X E;  3U3I A;  1OWA A;  2BZB A;  2LOS A;  2Q9Q A;  3GMI A;  4EZ4 A;  4WBO A;  3O1J A;  4X20 E;  4UF0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...