3IHRA

Crystal structure of uch37
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
Knots found
sequence length
305
structure length
282
Chain Sequence
EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFAAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural characterization of human Uch37.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Ubiquitin carboxyl-terminal hydrolase isozyme L5
total genus 83
structure length 282
sequence length 305
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
A PF18031 UCH_C Ubiquitin carboxyl-terminal hydrolases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ihrA02
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 3ihrA01
3TB3A 4JKJA 4UEMA 4UELA 2ETLA 3IHRA 1UCHA 3KVFA 4I6NA 4IG7A 1CMXA 3IFWA 3KW5A 2LENA 3IRTA 1XD3A 3A7SA 3RISA 4DM9A 3RIIA
chains in the Genus database with same CATH superfamily
1UX4A 2K9AA 5JDQA 1BR2A 1E2AA 2XQAA 4QKNA 1UGOA 2Y48B 4QX8B 5CJ5A 3TB3A 3N5LA 3UUXB 2CLYC 3RC3A 1KNPA 2LSGA 3I0OA 2FJEA 3Q5WA 3N2OA 3ZC0A 2OA5A 2WSSV 2E8IA 5L3EB 4PJJA 4UIGA 1S35A 3NWIA 3OPCA 4GK0E 5J0ZA 2E5LT 3CPZA 2WZIA 3PURA 2V6XA 4K0UA 4WW0A 3KV6A 5AQPB 3U78A 2BZBA 4DR6T 2WU5A 4AKIA 3AE2A 4EYUA 5LJMA 3N9OA 4DIDB 3AEEA 2CM0A 3QK6A 4EEBA 2WS3A 2D0UA 4FI5A 1Z0PA 4L9IA 3KV4A 5IUXA 2KINB 2NOXA 2YK0A 4MALA 3LK42 3UU4A 5L3DB 4IDNA 4ZXLA 4PK5A 2Q9QB 4YSYA 2H7OA 2VURA 2R6GF 4IDPA 3LDQB 5EK3A 2VQFT 3F2EA 2RP4A 2XUEA 3C50A 2YEVC 4IE4A 4KHZF 4X5TA 5KX5E 2DHRA 2E2AA 3TLTA 4AQFC 2KMFA 3RQWA 4LF6T 2NW8A 2WDRA 5L3CB 3L39A 2E9XB 3T1YT 1N36T 4CN4A 5LHIB 2ODUA 2PJQA 3HKCE 2V6YA 3KINB 5JDFA 4C90A 2UXBT 1XZYA 3C4XA 1KEYA 4JI1T 2XQ7A 4EOZB 5H6QB 1CHUA 2V7KA 2XM1A 2BS3A 2DI4A 3PE0A 4PFPA 3OTOT 4ZOLE 3N9MA 4CQIA 4YXDA 1WR0A 3AAIA 3AA6B 5LGNB 3LK2B 3SRZA 1YKEB 2XQYA 3K3OA 3KVBA 5F8PA 5LBQB 2PBIA 3QNUA 4GIWA 3AAEB 5LOVE 1Z8UA 4HFEA 2CPTA 1FIOA 3A8YC 3A5XA 4O2AE 4QH1A 4LMKA 3EVYA 2WBLA 3JAFA 2X51A 3TLWA 3ZT7A 1WYCA 3KDSE 3PU3A 2WDVA 1G8XA 3O1HA 1MNDA 3MZKB 1LVKA 4U3CA 1HS7A 5HXRA 4U72A 2Z6EA 4BJMA 4JI0T 2QYWA 2XQ4A 1XD3A 2V7MA 3Q2MA 2KNDA 4IGUA 4JEHB 4JUYA 3RYCE 4F8HA 5L2LA 1KF6A 2L8KA 4E7ZA 4U33A 5HWYA 2X68A 3EI0A 2CE7A 5HEJA 4AKLA 2XQ6A 2FJDA 5J2UE 4DV1T 3NKZA 2BS2A 3Q5EA 1LVFA 4LMLA 1J5ET 1T98A 2WAUA 2J47A 3O4XE 3E0ZA 4ZEYA 1FJGT 3J7Yq 3AE9A 5HEGA 4A97A 2BBHA 3RIAA 2NP9A 3ETUA 2DLRA 3K1SA 4TV9E 1BR0A 1B7TA 2ACZA 4LMJA 4ZZBA 2PFVA 2HPLA 1MIYA 2X9HA 4HWCA 4Z90A 4EV6A 3PU8A 2LJLA 2LM2A 2W4XA 4HWHA 3HI2A 4X1YE 3P4RA 2J62A 2RA1A 4EZ4A 2BS4A 4AKRB 3OYXA 3QB5K 2RPAA 4HE8A 2Q9QD 3PUYF 4KX6A 4UVAB 3I0QA 5JDLA 2IC9A 2LOPA 2V1DB 4YHJA 3NBXX 5FXVA 5LA6E 1H7CA 4AQFA 4DV6T 4QXHB 4YTPA 3ONJA 4XBFB 2BDEA 1UCHA 3RRCA 1M7KA 5JDHA 4K0KT 4YTNA 3VKGA 4LF7T 4NUVA 4HGAA 2UXNB 5AQRB 5DQVA 4CXXA 3HKDE 4LF9T 3RYIE 5HCMA 5HEHA 1U5PA 2V26A 2BKPA 3FBLA 2XAHB 2W0GA 4ZS3A 4XZCA 3RKGA 4ZI7E 1YW0A 4H9PC 1X79A 3K8PC 3QB5A 4PK6A 4PJNA 3SWHA 2XQ9A 4I6NA 4UELA 2LT3A 1D1CA 3P50A 3IFWA 2JIWA 1T7SA 1J5WA 1WLXA 2IHR1 3EDVA 3MK7C 1HX1B 1MIWA 5L3BB 5EZYE 3CQGB 5LYJE 1KNZA 5AQHB 1HX8A 4CXYA 2HHHT 2NTYA 1SE7A 4X1KE 5AQOB 5L3FB 4H9QC 3OKQA 3OVUA 3FBZA 5LNKA 2K24A 3K3NA 2YDSA 4A5XA 4PFOA 3KFWX 3ZT5A 4IE7A 4AIUA 1WYBA 2UUCT 5HAXA 3RYHE 1JNRA 5JVDE 2V8SV 2JRKA 1IBLT 1U4QA 4ZI2D 2BBJA 4NUUA 1OXZA 2LSYA 3AVRA 1VCTA 3LFMA 2C5JA 2Y6XA 1ZKEA 5HEUA 4JI6T 4U7IA 4LFCT 2EHOC 3SFEA 3UQ4A 3HKBE 2IC6A 4IDZA 1LKXA 3EHZA 4U7YA 4DR7T 4JKJA 3R84B 3AE5A 3NZQA 2WWVA 2D2SA 2W00A 1L0VA 3HL6A 2SPCA 1QUUA 3RQUA 4BA9A 1ZOYA 4TUYE 3LSVA 4GKJT 4GYRA 5HXCA 3S4UA 2PTFA 4IREA 2DL1A 2X0HA 4ILAA 1ZEEA 3ZJ1A 4QH4A 2H7VC 4B3TT 2DCFA 3ZMSB 2QVAA 2EHOB 2IDOB 4DMWA 4AKHA 4HFCA 2V6YB 5LB7B 1HNZT 3MA9A 4U31A 4YFSA 2XZEA 3RF1A 2JQQA 1X9BA 2HN2A 4WBOA 2KT9A 4AI6A 4YSXA 3C98B 5ABFA 4LF4T 2YINA 4JI8T 2OV9A 3CK6A 3V5UA 4PJLA 4QWNB 3RYFE 2JPFA 3ONLC 2DWKA 5JDMA 3B5MA 2YN6A 3NRXA 5CFBA 5HXHA 5AQTB 4ZZCA 1XWMA 5BR8T 3AE8A 5AQJB 4EXTA 2V7IA 3LK3B 3E22E 4DR5T 3IA3A 2YDRA 4CN1A 2XAJB 2WY2A 2I59A 3EAMA 3H3MA 2BG9E 2B1EA 3AE4A 2JQHA 3JAEA 3ZCIA 4NXMT 4OX9T 5L4HA 5LGUB 4YSZA 2W62A 3AEDA 2C5KT 3OBVE 2VK9A 4PNIA 4ZI3C 4ZI3D 2NWBA 3KBTA 1XMQT 1AJ3A 1G73A 4UV8B 2UUAT 2IMLA 4Q25A 3U3IA 3B57A 5FY0A 2ZM2A 2ZM0A 2KWIB 1N34T 2A9UA 4AISA 4WZXA 2I6HA 4CN6A 2F4VT 2XM2A 3P4WA 3AEBA 3EDUA 3PUXF 4TZ4C 3UTKA 2WM9A 1HTJF 1OEDB 2LEHA 3G06A 4MBQA 4UEMA 2MTQA 3ZYLA 3P4PA 2CXDA 1V9DA 2E5VA 5LG3A 3ABVA 3NZPA 3I9WA 2ACXA 4O4IE 3FZHB 3KV9A 2K3WA 2BG9A 5FXZA 4I50E 3RX6A 4OFZA 1FMVA 1HFAA 4U2ZA 4HFVA 4NIQA 3VKHA 3KW5A 4H9OC 5AQMB 2X9XA 4G63A 5CB4E 2WWUA 5JDGA 1MNEA 2MBGA 4TWFA 3OJAA 4DBRA 2D0TA 2VVSA 3ZKRA 5FXXA 4YJ2E 2MOZA 3D0TA 4XAXB 4YTMA 3IBPA 3AB3B 1D1AA 2HH7A 3O1JA 5L3GB 4DV2T 4YY3T 3RIIA 2X9YA 3AXJB 2XSAA 4GOUA 2LKHA 1UX5A 3BQKA 2LHNA 3CVRA 3H3AA 3Q5DA 4KUMB 4UR9A 3BQLA 3ZLIA 3C4WA 4JI2T 3N2KE 3CX6B 4A56A 2XQ5A 4H63V 3RLFF 3ZEFB 2LHRA 3EUHA 3Q9DA 1NEKA 3J9X1 5JRCB 4DV3T 5FNVE 2V5CA 1KNRA 1UK5A 5ADXL 1SA0E 2WB5A 3HR0A 3IEEA 3KVAA 4YLHA 1YQ3A 3IRTA 2CA5A 4HEAA 2ZM8A 5FVLA 3GN5A 4IL4A 1GQEA 5HEOA 2IW5B 4HWFA 2CHNA 1YQ4A 2LLYA 4U2YA 3QC9A 4ISSA 1IBKT 3N9QA 2LE8A 2V7LA 2LRLA 4KHPT 3L8RA 2CBIA 1SUMB 5JQGE 2IAKA 4DR4T 2XQ8A 2MAWA 3RRWA 4ANJA 1R8IA 4CXWA 2NW7A 3PUVF 2WMNA 2PG8A 2MPKA 2VL0A 2VL8A 3P4QA 3C4ZA 4IE6A 4QXCB 5LBMA 3TLSA 3ZJ2A 4WYVA 4ASKA 4EZHA 3CX8B 3JADA 1OEDA 3LBXB 4P0BA 4V1Av 5C3JA 2CXLA 2YOEA 5CA0E 4CI1B 4H9SE 3TLVA 4PAGA 5JREA 2LSJA 4OYKA 3A7MA 1XDOA 3MXZA 4IDOA 5C8YE 2BVMA 2MYSA 3ZMZB 4M1PA 3UUMA 4KBMB 5AQUB 1CUNA 3AEGA 1W0AA 1VRBA 2ES0A 4I0UA 4MFRA 5HYAA 1FMWA 5L4EA 2CEAA 1XMOT 2D9DA 2NR4A 4G2AA 4QXBB 4PK4A 3ZMUB 3PUWF 4DR1T 4LF5T 2YU2A 5FY7A 2VVNA 4H9NC 1XNQT 3AEFA 2EHOD 2KXPB 4B3RT 1HNWT 2X9WA 3RIFA 4X64T 2XPKA 4DV4T 3GMIA 4EAHA 1BR1A 3UUNA 2BG9C 2VB6A 1UUSA 2DWGA 2LM9A 2YU1A 3ZT6A 4ADZA 1OEDE 4JI4T 3RPUA 1MMGA 3PUAA 5HXEA 2IIUA 4OK0A 4CI3B 3K3QC 2QRXA 3O9XA 4MLKA 4UF0A 3UFEA 2CRBA 1ZP0A 3PTRB 3TLUA 3ZPOA 4E7SA 4IIJE 1IBMT 2UXXB 5AQSB 4H63H 3AE6A 3RIUC 2I0MA 3MKDA 4JEUB 5FKYA 3CQXC 5AQVB 3PUSA 5LP6E 4DUYT 4QHOA 2ZMAA 4HTEA 2ETLA 5FVKA 5DQWA 5AQNB 1VCSA 2W61A 3AE7A 3HKEE 3P4SA 2A2FX 4HN9A 3H37A 1WR6A 4L0RA 1CMXA 1WRDA 1YXRA 2FJAA 2LSIA 2QGSA 1OEDC 3JCFA 2KLQA 1D0XA 4CZZB 2NW9A 4C91A 3T1HT 4TV8E 3RC8A 3I1AA 2VKDA 3SOLA 5JR9B 3A7SA 4HFDA 2ZM6T 4IDQA 1XNRT 3ANWB 1O3XA 5FL1A 3DJBA 5FP3A 1EZ3A 4IHJE 2DNXA 3VRBA 3VR9A 5LG4A 2UUBT 2VKJA 2CCQA 1QLBA 1MIVA 4TNVA 2LRKA 3RKOA 5JH7E 3FXEB 2K48A 4HWIB 3TKLB 2X0LB 1HG2A 2HN1A 4YJ3E 1ZHCA 3QOFA 5JR9C 2W2UA 5HCJA 2UXDT 3UUBA 1IAPA 2C5IT 3UULA 2KWHA 3UU3A 5EK4A 4Z8XA 2CWYA 2XTLA 4NPPA 1E7PA 2N2NA 3ANWA 5LGTB 1KK7A 3UU5A 5FY1A 4WNKA 3VRAA 2AXDS 3F57A 3P8CD 4COFA 2N1GA 3CIRA 2EHOA 3FZLB 3QUJA 3UU8A 4F6RC 1MMNA 4EEDA 1US7B 4KI0F 4ZHQE 4AKGA 1NWMX 2KZ7B 2M6BA 4DR3T 3ESLA 4AQGA 4H9RC 5ETWA 4O4HE 2VKHA 2CBJA 1Y01A 3GWHA 3M65A 4BJNA 3FB2A 3AEAA 4WBNE 4ZI2C 4X65T 2W67A 5AQIB 2VASA 5CA1E 4GKKT 2HPJA 3FZKB 5CGMA 4DM9A 4IE5A 2CHOA 2LKGA 2P9BA 4UV9B 4LF8T 5IYZE 3FZMB 3O1IA 5A1LA 4FJOA 1XDPA 5JDNA 4EB6E 5HWXA 5LJNA 3GA8A 3RISA 1W0BA 2JMKA 4O4JE 3PUQA 3JC6D 2X66A 4I4TE 4X66T 3ONXA 2XJ7A 5IWAT 1LRZA 2WU2A 4DVDA 5J2TE 4GYSA 5J1GA 5KDMC 5F5WA 1N33T 4ERRA 5DABA 3JC6C 3ZYKA 1IJ5A 3CX7B 3UU6A 3ZN0B 3N9PA 2L3LA 1MMAA 4QX7B 1HF8A 2E9XD 2XAGB 5ABEA 3KVFA 3DP7A 4DUZT 2VKOA 3LJCA 4P1NA 3RHWA 3UFGA 2X0YA 4DMVA 4I55E 5JR9A 3AA7B 4UVCB 3X1DA 3WAJA 1BR4A 5FXWA 1J1JA 4B3MT 2BKNA 5JRCA 3PV0F 3T8OA 3FHNA 3V5SA 1W9RA 2XSBA 3FZFB 1JNZA 3MJXA 4O4LE 4HFIA 4TNWA 2CMRA 2M6IA 3FXDB 2L9QA 5EK2A 4YHHT 2XQ3A 2LENA 2Q9QC 1D0YA 2WMOA 1NENA 3LG7A 4X1IE 5FMNA 3EABA 4IE0A 4ILCA 3ETVA 1UCUA 1M62A 3OYZA 4ILUA 4PJMA 4ZS2A 2NTXA 5IHYA 3UT5E 1HNXT 4JI7T 4MHCA 3NVOA 1IZNB 2A3DA 2WDQA 4OHFA 4TWHA 3BK9A 1IJ6A 4AXPA 4TX5A 5AFUL 3M3ZB 2M67A 3UQ7A 1DU2A 2G0UA 3L3PA 3RH3A 4O2BE 2BKOA 3I9YA 5LMUT 1NAFA 4HKAA 4EGWA 1UURA 2VWAA 2JMHA 4GK5E 5LCYA 5LXTE 3AE3A 4L5GA 3E08A 4B3ST 4EIWA 2KSRA 5AQLB 1VOMA 5JTGA 1WCRA 1HG5A 2FUPA 3L09A 4TWDA 4UXNB 4JV5T 5LHHB 2OLTA 1HCIA 3SFDA 4B6XA 3VR8A 2E9XC 2H89A 4O8SA 2WZHA 2Y8DA 3ZMVB 4DBQA 4JBWF 4JLEA 5ABGA 2XASB 2JQKA 1Y64B 3N9NA 5AQFB 4LFAT 3PDYA 4BAYB 2B76A 5FYMA 4QH5A 3AXJA 3KV5A 4UF0B 4Z91A 5HXSA 3PUGA 2J4GA 3LBXA 3CQCB 3N2GE 4UVBB 3DTOA 2ZLYA 3Q5XA 4A98A 3RI5A 2V7JA 1I94T 4X62T 2CLYB 1N32T 3IF8B 4HFHA 2X67A 4KP3C 2GK9A 3HA4A 3WI3A 4N78D 3CMLA 5AQGB 1HR0T 1T72A 2Q9QA 3ZSSA 3AA1B 4DV5T 3AE1A 2C0SA 2QA7A 4HWDA 1WFDA 4ILBA 4P09A 1D0ZA 5AQQB 4OYJA 2WP9A 3R6NA 4IG7A 5DJQC 2YKSA 1D1BA 5BMVE 2W63A 5M4YA 3WAKA 3ZC1A 3C64A 2CXFA 3W15B 1YD8G 4JI5T 4U74A 1FEWA 4I43B 5AQKB 5GONE 5H6RB 4P0AA 2JQ9A 5FL0A 3AAAB 1W09A 1KFYA 3GN5B 3ZMTB 4DNDA 4DV7T 1SHZC 4LFBT 5TAOA 2UU9T 2N9DA 4DO0A 2BVLA 3SS1A 3ZYMA 4JYAT 3CKDA 3MACA 4TN7B 5KMGP 1QSDA 2XAQB 2XHEB 3C51A 2XAFB 3BQIA 3B13A 3AECA 2LSKA 3P7IA 3ZSTA 4HFBA 3PJAJ 2XY8B 3VHLA 3KBUA 2E9XA 4IT4A 2CWOA 4YT0A 2AE9A 3AA0B 3CWZB 4PW8A 4JI3T 2WQYA 2UXCT 4KMCA 2J1DG 1YKHB 2WCAA 3ZN1B 2YDQA 4AQYT 4NXNT 3RGLA 3NRYA 2A72A 5LMNT 3N9LA 3F31A 5E0OA 3AVSA 2D5UA 4J2CA 4X20E 5ABHA 1S94A 1OWAA 1T8BA 4EYYR 4DV0T 2W66A 1I6ZA 4IL9A 3VU7H 2BG9B 5ABFB 5KXJA 2ODVA 2H88A 5LHGB 5C2TA 3ZCJA 4CI2B 5L47A 2LOSA 3PJAA 1MMDA 2FJBA 5F3JA 4ISTA 3PUZF 2IUBA 3IHRA 2VQET 2H3RA 1ZV4X 4DR2T 1E1HB 2V5DA 2JJ9A 2K5BB 2FBWA 3RIUA
chains in the Genus database with same CATH topology
1UX4A 2K9AA 5JDQA 1BR2A 4QKNA 4QX8B 2Y48B 3N5LA 3UUXB 2CLYC 3RC3A 3ZC0A 2LSGA 3I0OA 3Q5WA 3N2OA 2OA5A 2WSSV 2E8IA 5L3EB 4PJJA 4UIGA 1S35A 4GK0E 3CPZA 3PURA 4K0UA 4WW0A 3U78A 3KV6A 2BZBA 4AKIA 4EYUA 5LJMA 3N9OA 3QK6A 2CM0A 4FI5A 2D0UA 1Z0PA 4L9IA 3KV4A 5L3DB 2KINB 2NOXA 2YK0A 4MALA 3LK42 4PK5A 2Q9QB 2H7OA 5EK3A 3F2EA 2RP4A 2XUEA 3C50A 2YEVC 4IE4A 5KX5E 2DHRA 4AQFC 2KMFA 2NW8A 2E9XB 5LHIB 2ODUA 2PJQA 3HKCE 3KINB 5JDFA 4C90A 3C4XA 4EOZB 5H6QB 2V7KA 2DI4A 3PE0A 4PFPA 4ZOLE 3N9MA 4CQIA 3AAIA 3AA6B 5LGNB 3LK2B 3SRZA 1YKEB 2XQYA 3K3OA 3KVBA 5F8PA 5LBQB 2PBIA 4GIWA 3AAEB 5LOVE 1FIOA 3A5XA 4O2AE 4UF0B 3EVYA 2WBLA 2X51A 1WYCA 3KDSE 3PU3A 1G8XA 3O1HA 1MNDA 3MZKB 1LVKA 1HS7A 5HXRA 4U72A 2Z6EA 4BJMA 1XD3A 2V7MA 3Q2MA 2KNDA 4IGUA 4JEHB 4JUYA 3RYCE 5L2LA 2L8KA 4E7ZA 5HWYA 2X68A 2CE7A 5J2UE 4AKLA 1LVFA 1T98A 2WAUA 3O4XE 3E0ZA 3J7Yq 1BR0A 2NP9A 3ETUA 2DLRA 4TV9E 1B7TA 2PFVA 2HPLA 1MIYA 2X9HA 3PU8A 2LJLA 4X1YE 3HI2A 2RA1A 4EZ4A 4AKRB 3OYXA 4HE8A 2Q9QD 4UVAB 3I0QA 5JDLA 2IC9A 2LOPA 2V1DB 4YHJA 3NBXX 5FXVA 5LA6E 1H7CA 4AQFA 4XBFB 4QXHB 2BDEA 1UCHA 3RRCA 5JDHA 3VKGA 2LENA 4NUVA 4HGAA 2UXNB 4CXXA 5DQVA 3HKDE 3RYIE 1U5PA 2V26A 3FBLA 2XAHB 2W0GA 4ZS3A 4XZCA 4ZI7E 1YW0A 4H9PC 1X79A 3K8PC 4PK6A 4PJNA 3SWHA 4I6NA 4UELA 2LT3A 1D1CA 3IFWA 1WLXA 3EDVA 3MK7C 1MIWA 5L3BB 5EZYE 3CQGB 5LYJE 1KNZA 1HX8A 4CXYA 2NTYA 5L3FB 4X1KE 4H9QC 3OKQA 5LNKA 3FBZA 2K24A 3K3NA 4PFOA 3KFWX 4IE7A 1WYBA 5HAXA 3RYHE 5JVDE 2JRKA 1U4QA 4ZI2D 4NUUA 1OXZA 2LSYA 3AVRA 3LFMA 2C5JA 2Y6XA 1ZKEA 2EHOC 3HKBE 2IC6A 4IDZA 1LKXA 4JKJA 3R84B 3NZQA 2D2SA 2W00A 4BA9A 3HL6A 2SPCA 1QUUA 4TUYE 4GYRA 5HXCA 3S4UA 1ZEEA 3ZJ1A 2H7VC 2DCFA 3ZMSB 2EHOB 4DMWA 4AKHA 3MA9A 4YFSA 2JQQA 4WBOA 2KT9A 4AI6A 3C98B 2YINA 3V5UA 4PJLA 4QWNB 2JPFA 2DWKA 5JDMA 3NRXA 5HXHA 4EXTA 2V7IA 3LK3B 3E22E 2XAJB 2I59A 3ZCIA 2B1EA 5LGUB 2W62A 2C5KT 3OBVE 2VK9A 4PNIA 4ZI3C 1AJ3A 2NWBA 3KBTA 1G73A 4UV8B 3U3IA 3B57A 5FY0A 2ZM2A 2ZM0A 2KWIB 3EDUA 4TZ4C 3UTKA 2WM9A 1HTJF 2LEHA 4MBQA 4UEMA 3ZYLA 2MTQA 2CXDA 1V9DA 3NZPA 4O4IE 3I9WA 2ACXA 3KV9A 5FXZA 4I50E 3RX6A 4OFZA 1FMVA 1HFAA 4HFVA 3VKHA 3KW5A 4H9OC 2X9XA 4G63A 5CB4E 2WWUA 5JDGA 1MNEA 2MBGA 4DBRA 3OJAA 3TB3A 2D0TA 4YJ2E 5FXXA 2MOZA 3D0TA 4XAXB 3IBPA 3AB3B 1D1AA 2HH7A 3O1JA 5L3GB 3RIIA 2X9YA 4GOUA 1UX5A 3BQKA 2LHNA 3CVRA 3H3AA 4KUMB 3BQLA 3ZLIA 3C4WA 3N2KE 3CX6B 4A56A 4H63V 3ZEFB 2LHRA 3EUHA 3Q9DA 3J9X1 5JRCB 5FNVE 5ADXL 1SA0E 3HR0A 3IEEA 3KVAA 4YLHA 3IRTA 2CA5A 4HEAA 2ZM8A 3GN5A 2IW5B 3QC9A 4ISSA 3N9QA 2LE8A 2V7LA 5JQGE 2IAKA 3RRWA 4ANJA 4CXWA 2NW7A 2WMNA 2PG8A 2VL8A 4IE6A 3C4ZA 4QXCB 5LBMA 3ZJ2A 4EZHA 4ASKA 3CX8B 4P0BA 3LBXB 4V1Av 2CXLA 5CA0E 4CI1B 4H9SE 4PAGA 5JREA 2LSJA 4OYKA 3MXZA 5C8YE 2BVMA 2MYSA 3ZMZB 4M1PA 3UUMA 4KBMB 5L3CB 1CUNA 5HYAA 1VRBA 2ES0A 4MFRA 1FMWA 2CEAA 4G2AA 4QXBB 4PK4A 3ZMUB 2YU2A 5FY7A 4H9NC 2EHOD 2KXPB 2X9WA 3GMIA 4EAHA 1BR1A 3UUNA 2VB6A 2DWGA 2LM9A 2YU1A 4ADZA 3RPUA 1MMGA 3PUAA 5HXEA 4OK0A 4CI3B 3K3QC 3O9XA 4MLKA 4UF0A 3UFEA 3PTRB 3ZPOA 4E7SA 4IIJE 2UXXB 4H63H 3MKDA 4JEUB 3CQXC 3PUSA 5LP6E 4QHOA 2ZMAA 4HTEA 2ETLA 5DQWA 3RYFE 3HKEE 2W61A 4HN9A 1CMXA 2A2FX 3H37A 1WR6A 4L0RA 1WRDA 2LSIA 2QGSA 2KLQA 1D0XA 4CZZB 2NW9A 4C91A 4TV8E 3RC8A 3I1AA 2VKDA 3SOLA 5JR9B 3A7SA 3ANWB 1O3XA 3DJBA 5FP3A 1EZ3A 4IHJE 2DNXA 5LG4A 2VKJA 2CCQA 1MIVA 3RKOA 5JH7E 3FXEB 2K48A 3TKLB 2X0LB 1HG2A 4YJ3E 1ZHCA 5JR9C 1IAPA 2C5IT 3UULA 2KWHA 2K5BB 5EK4A 4Z8XA 2CWYA 2XTLA 2N2NA 3ANWA 5LGTB 1KK7A 5FY1A 4WNKA 3F57A 3P8CD 2N1GA 3QUJA 2EHOA 4F6RC 1MMNA 4ZHQE 1US7B 4AKGA 1NWMX 2KZ7B 3ESLA 4AQGA 4H9RC 5ETWA 4O4HE 4BJNA 4ZI2C 3GWHA 3M65A 3FB2A 4WBNE 2VASA 5CA1E 2HPJA 4DM9A 4IE5A 4UV9B 2P9BA 5IYZE 3O1IA 5A1LA 4FJOA 5JDNA 4EB6E 5HWXA 5LJNA 3GA8A 3RISA 2JMKA 4O4JE 3PUQA 3JC6D 2X66A 4I4TE 3ONXA 1LRZA 4DVDA 5J2TE 4GYSA 5J1GA 5KDMC 4ERRA 5DABA 3JC6C 3ZYKA 1IJ5A 3CX7B 3ZN0B 3N9PA 2L3LA 1MMAA 4QX7B 1HF8A 2E9XD 2XAGB 3KVFA 3DP7A 2VKOA 3LJCA 4DMVA 4I55E 5JR9A 3AA7B 4UVCB 3WAJA 1BR4A 5FXWA 5JRCA 3T8OA 3FHNA 3V5SA 3MJXA 4O4LE 2CMRA 3FXDB 2L9QA 5EK2A 2Q9QC 1D0YA 2WMOA 3LG7A 4X1IE 5FMNA 4IE0A 3ETVA 1UCUA 3OYZA 4ILUA 4PJMA 5IHYA 4ZS2A 2NTXA 3UT5E 4MHCA 1IZNB 2A3DA 4OHFA 3BK9A 1IJ6A 4AXPA 4TX5A 5AFUL 2M67A 2G0UA 3L3PA 3RH3A 4O2BE 3I9YA 1NAFA 4HKAA 2VWAA 2JMHA 4GK5E 5LCYA 5LXTE 4L5GA 3E08A 4EIWA 1VOMA 1HG5A 3L09A 4UXNB 5LHHB 1HCIA 4B6XA 2E9XC 4O8SA 2Y8DA 3ZMVB 4JLEA 2XASB 1Y64B 3N9NA 3PDYA 4BAYB 5FYMA 5HXSA 3KV5A 3PUGA 3LBXA 3CQCB 3N2GE 4UVBB 3DTOA 2ZLYA 3Q5XA 2V7JA 2CLYB 3IF8B 4KP3C 2X67A 2GK9A 3HA4A 3WI3A 4N78D 3CMLA 2Q9QA 3AA1B 2C0SA 2QA7A 4P09A 3R6NA 1D0ZA 4OYJA 5DJQC 5M4YA 1D1BA 5BMVE 2W63A 3WAKA 3ZC1A 3C64A 2CXFA 3W15B 1YD8G 4U74A 1FEWA 4I43B 5GONE 5H6RB 4P0AA 4IG7A 3AAAB 3ZMTB 3GN5B 4DNDA 1SHZC 5TAOA 2N9DA 4DO0A 2BVLA 3SS1A 3ZYMA 3CKDA 3MACA 4TN7B 5KMGP 1QSDA 2XAQB 2XHEB 3C51A 2XAFB 3BQIA 3B13A 2LSKA 3P7IA 4ZI3D 3VHLA 3KBUA 2E9XA 2CWOA 3AA0B 3CWZB 4PW8A 4KMCA 2J1DG 1YKHB 3ZN1B 3NRYA 2A72A 3N9LA 3F31A 5E0OA 3AVSA 2D5UA 4J2CA 4X20E 1S94A 1OWAA 4EYYR 3VU7H 2ODVA 5LHGB 3ZCJA 4CI2B 2LOSA 1MMDA 5F3JA 4ISTA 3IHRA 2H3RA 1ZV4X 1E1HB 4DBQA 2JJ9A 2VKHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TB3 A;  4JKJ A;  4UEM A;  4UEL A;  2ETL A;  3IHR A;  1UCH A;  3KVF A;  4I6N A;  4IG7 A;  1CMX A;  3IFW A;  3KW5 A;  2LEN A;  3IRT A;  1XD3 A;  3A7S A;  3RIS A;  4DM9 A;  3RII A; 
#chains in the Genus database with same CATH topology
 1UX4 A;  2K9A A;  5JDQ A;  1BR2 A;  1E2A A;  2XQA A;  4QKN A;  1UGO A;  2Y48 B;  4QX8 B;  5CJ5 A;  3TB3 A;  3N5L A;  3UUX B;  2CLY C;  3RC3 A;  1KNP A;  2LSG A;  3I0O A;  2FJE A;  3Q5W A;  3N2O A;  3ZC0 A;  2OA5 A;  2WSS V;  2E8I A;  5L3E B;  4PJJ A;  4UIG A;  1S35 A;  3NWI A;  3OPC A;  4GK0 E;  5J0Z A;  2E5L T;  3CPZ A;  2WZI A;  3PUR A;  2V6X A;  4K0U A;  4WW0 A;  3KV6 A;  5AQP B;  3U78 A;  2BZB A;  4DR6 T;  2WU5 A;  4AKI A;  3AE2 A;  4EYU A;  5LJM A;  3N9O A;  4DID B;  3AEE A;  2CM0 A;  3QK6 A;  4EEB A;  2WS3 A;  2D0U A;  4FI5 A;  1Z0P A;  4L9I A;  3KV4 A;  5IUX A;  2KIN B;  2NOX A;  2YK0 A;  4MAL A;  3LK4 2;  3UU4 A;  5L3D B;  4IDN A;  4ZXL A;  4PK5 A;  2Q9Q B;  4YSY A;  2H7O A;  2VUR A;  2R6G F;  4IDP A;  3LDQ B;  5EK3 A;  2VQF T;  3F2E A;  2RP4 A;  2XUE A;  3C50 A;  2YEV C;  4IE4 A;  4KHZ F;  4X5T A;  5KX5 E;  2DHR A;  2E2A A;  3TLT A;  4AQF C;  2KMF A;  3RQW A;  4LF6 T;  2NW8 A;  2WDR A;  5L3C B;  3L39 A;  2E9X B;  3T1Y T;  1N36 T;  4CN4 A;  5LHI B;  2ODU A;  2PJQ A;  3HKC E;  2V6Y A;  3KIN B;  5JDF A;  4C90 A;  2UXB T;  1XZY A;  3C4X A;  1KEY A;  4JI1 T;  2XQ7 A;  4EOZ B;  5H6Q B;  1CHU A;  2V7K A;  2XM1 A;  2BS3 A;  2DI4 A;  3PE0 A;  4PFP A;  3OTO T;  4ZOL E;  3N9M A;  4CQI A;  4YXD A;  1WR0 A;  3AAI A;  3AA6 B;  5LGN B;  3LK2 B;  3SRZ A;  1YKE B;  2XQY A;  3K3O A;  3KVB A;  5F8P A;  5LBQ B;  2PBI A;  3QNU A;  4GIW A;  3AAE B;  5LOV E;  1Z8U A;  4HFE A;  2CPT A;  1FIO A;  3A8Y C;  3A5X A;  4O2A E;  4QH1 A;  4LMK A;  3EVY A;  2WBL A;  3JAF A;  2X51 A;  3TLW A;  3ZT7 A;  1WYC A;  3KDS E;  3PU3 A;  2WDV A;  1G8X A;  3O1H A;  1MND A;  3MZK B;  1LVK A;  4U3C A;  1HS7 A;  5HXR A;  4U72 A;  2Z6E A;  4BJM A;  4JI0 T;  2QYW A;  2XQ4 A;  1XD3 A;  2V7M A;  3Q2M A;  2KND A;  4IGU A;  4JEH B;  4JUY A;  3RYC E;  4F8H A;  5L2L A;  1KF6 A;  2L8K A;  4E7Z A;  4U33 A;  5HWY A;  2X68 A;  3EI0 A;  2CE7 A;  5HEJ A;  4AKL A;  2XQ6 A;  2FJD A;  5J2U E;  4DV1 T;  3NKZ A;  2BS2 A;  3Q5E A;  1LVF A;  4LML A;  1J5E T;  1T98 A;  2WAU A;  2J47 A;  3O4X E;  3E0Z A;  4ZEY A;  1FJG T;  3J7Y q;  3AE9 A;  5HEG A;  4A97 A;  2BBH A;  3RIA A;  2NP9 A;  3ETU A;  2DLR A;  3K1S A;  4TV9 E;  1BR0 A;  1B7T A;  2ACZ A;  4LMJ A;  4ZZB A;  2PFV A;  2HPL A;  1MIY A;  2X9H A;  4HWC A;  4Z90 A;  4EV6 A;  3PU8 A;  2LJL A;  2LM2 A;  2W4X A;  4HWH A;  3HI2 A;  4X1Y E;  3P4R A;  2J62 A;  2RA1 A;  4EZ4 A;  2BS4 A;  4AKR B;  3OYX A;  3QB5 K;  2RPA A;  4HE8 A;  2Q9Q D;  3PUY F;  4KX6 A;  4UVA B;  3I0Q A;  5JDL A;  2IC9 A;  2LOP A;  2V1D B;  4YHJ A;  3NBX X;  5FXV A;  5LA6 E;  1H7C A;  4AQF A;  4DV6 T;  4QXH B;  4YTP A;  3ONJ A;  4XBF B;  2BDE A;  1UCH A;  3RRC A;  1M7K A;  5JDH A;  4K0K T;  4YTN A;  3VKG A;  4LF7 T;  4NUV A;  4HGA A;  2UXN B;  5AQR B;  5DQV A;  4CXX A;  3HKD E;  4LF9 T;  3RYI E;  5HCM A;  5HEH A;  1U5P A;  2V26 A;  2BKP A;  3FBL A;  2XAH B;  2W0G A;  4ZS3 A;  4XZC A;  3RKG A;  4ZI7 E;  1YW0 A;  4H9P C;  1X79 A;  3K8P C;  3QB5 A;  4PK6 A;  4PJN A;  3SWH A;  2XQ9 A;  4I6N A;  4UEL A;  2LT3 A;  1D1C A;  3P50 A;  3IFW A;  2JIW A;  1T7S A;  1J5W A;  1WLX A;  2IHR 1;  3EDV A;  3MK7 C;  1HX1 B;  1MIW A;  5L3B B;  5EZY E;  3CQG B;  5LYJ E;  1KNZ A;  5AQH B;  1HX8 A;  4CXY A;  2HHH T;  2NTY A;  1SE7 A;  4X1K E;  5AQO B;  5L3F B;  4H9Q C;  3OKQ A;  3OVU A;  3FBZ A;  5LNK A;  2K24 A;  3K3N A;  2YDS A;  4A5X A;  4PFO A;  3KFW X;  3ZT5 A;  4IE7 A;  4AIU A;  1WYB A;  2UUC T;  5HAX A;  3RYH E;  1JNR A;  5JVD E;  2V8S V;  2JRK A;  1IBL T;  1U4Q A;  4ZI2 D;  2BBJ A;  4NUU A;  1OXZ A;  2LSY A;  3AVR A;  1VCT A;  3LFM A;  2C5J A;  2Y6X A;  1ZKE A;  5HEU A;  4JI6 T;  4U7I A;  4LFC T;  2EHO C;  3SFE A;  3UQ4 A;  3HKB E;  2IC6 A;  4IDZ A;  1LKX A;  3EHZ A;  4U7Y A;  4DR7 T;  4JKJ A;  3R84 B;  3AE5 A;  3NZQ A;  2WWV A;  2D2S A;  2W00 A;  1L0V A;  3HL6 A;  2SPC A;  1QUU A;  3RQU A;  4BA9 A;  1ZOY A;  4TUY E;  3LSV A;  4GKJ T;  4GYR A;  5HXC A;  3S4U A;  2PTF A;  4IRE A;  2DL1 A;  2X0H A;  4ILA A;  1ZEE A;  3ZJ1 A;  4QH4 A;  2H7V C;  4B3T T;  2DCF A;  3ZMS B;  2QVA A;  2EHO B;  2IDO B;  4DMW A;  4AKH A;  4HFC A;  2V6Y B;  5LB7 B;  1HNZ T;  3MA9 A;  4U31 A;  4YFS A;  2XZE A;  3RF1 A;  2JQQ A;  1X9B A;  2HN2 A;  4WBO A;  2KT9 A;  4AI6 A;  4YSX A;  3C98 B;  5ABF A;  4LF4 T;  2YIN A;  4JI8 T;  2OV9 A;  3CK6 A;  3V5U A;  4PJL A;  4QWN B;  3RYF E;  2JPF A;  3ONL C;  2DWK A;  5JDM A;  3B5M A;  2YN6 A;  3NRX A;  5CFB A;  5HXH A;  5AQT B;  4ZZC A;  1XWM A;  5BR8 T;  3AE8 A;  5AQJ B;  4EXT A;  2V7I A;  3LK3 B;  3E22 E;  4DR5 T;  3IA3 A;  2YDR A;  4CN1 A;  2XAJ B;  2WY2 A;  2I59 A;  3EAM A;  3H3M A;  2BG9 E;  2B1E A;  3AE4 A;  2JQH A;  3JAE A;  3ZCI A;  4NXM T;  4OX9 T;  5L4H A;  5LGU B;  4YSZ A;  2W62 A;  3AED A;  2C5K T;  3OBV E;  2VK9 A;  4PNI A;  4ZI3 C;  4ZI3 D;  2NWB A;  3KBT A;  1XMQ T;  1AJ3 A;  1G73 A;  4UV8 B;  2UUA T;  2IML A;  4Q25 A;  3U3I A;  3B57 A;  5FY0 A;  2ZM2 A;  2ZM0 A;  2KWI B;  1N34 T;  2A9U A;  4AIS A;  4WZX A;  2I6H A;  4CN6 A;  2F4V T;  2XM2 A;  3P4W A;  3AEB A;  3EDU A;  3PUX F;  4TZ4 C;  3UTK A;  2WM9 A;  1HTJ F;  1OED B;  2LEH A;  3G06 A;  4MBQ A;  4UEM A;  2MTQ A;  3ZYL A;  3P4P A;  2CXD A;  1V9D A;  2E5V A;  5LG3 A;  3ABV A;  3NZP A;  3I9W A;  2ACX A;  4O4I E;  3FZH B;  3KV9 A;  2K3W A;  2BG9 A;  5FXZ A;  4I50 E;  3RX6 A;  4OFZ A;  1FMV A;  1HFA A;  4U2Z A;  4HFV A;  4NIQ A;  3VKH A;  3KW5 A;  4H9O C;  5AQM B;  2X9X A;  4G63 A;  5CB4 E;  2WWU A;  5JDG A;  1MNE A;  2MBG A;  4TWF A;  3OJA A;  4DBR A;  2D0T A;  2VVS A;  3ZKR A;  5FXX A;  4YJ2 E;  2MOZ A;  3D0T A;  4XAX B;  4YTM A;  3IBP A;  3AB3 B;  1D1A A;  2HH7 A;  3O1J A;  5L3G B;  4DV2 T;  4YY3 T;  3RII A;  2X9Y A;  3AXJ B;  2XSA A;  4GOU A;  2LKH A;  1UX5 A;  3BQK A;  2LHN A;  3CVR A;  3H3A A;  3Q5D A;  4KUM B;  4UR9 A;  3BQL A;  3ZLI A;  3C4W A;  4JI2 T;  3N2K E;  3CX6 B;  4A56 A;  2XQ5 A;  4H63 V;  3RLF F;  3ZEF B;  2LHR A;  3EUH A;  3Q9D A;  1NEK A;  3J9X 1;  5JRC B;  4DV3 T;  5FNV E;  2V5C A;  1KNR A;  1UK5 A;  5ADX L;  1SA0 E;  2WB5 A;  3HR0 A;  3IEE A;  3KVA A;  4YLH A;  1YQ3 A;  3IRT A;  2CA5 A;  4HEA A;  2ZM8 A;  5FVL A;  3GN5 A;  4IL4 A;  1GQE A;  5HEO A;  2IW5 B;  4HWF A;  2CHN A;  1YQ4 A;  2LLY A;  4U2Y A;  3QC9 A;  4ISS A;  1IBK T;  3N9Q A;  2LE8 A;  2V7L A;  2LRL A;  4KHP T;  3L8R A;  2CBI A;  1SUM B;  5JQG E;  2IAK A;  4DR4 T;  2XQ8 A;  2MAW A;  3RRW A;  4ANJ A;  1R8I A;  4CXW A;  2NW7 A;  3PUV F;  2WMN A;  2PG8 A;  2MPK A;  2VL0 A;  2VL8 A;  3P4Q A;  3C4Z A;  4IE6 A;  4QXC B;  5LBM A;  3TLS A;  3ZJ2 A;  4WYV A;  4ASK A;  4EZH A;  3CX8 B;  3JAD A;  1OED A;  3LBX B;  4P0B A;  4V1A v;  5C3J A;  2CXL A;  2YOE A;  5CA0 E;  4CI1 B;  4H9S E;  3TLV A;  4PAG A;  5JRE A;  2LSJ A;  4OYK A;  3A7M A;  1XDO A;  3MXZ A;  4IDO A;  5C8Y E;  2BVM A;  2MYS A;  3ZMZ B;  4M1P A;  3UUM A;  4KBM B;  5AQU B;  1CUN A;  3AEG A;  1W0A A;  1VRB A;  2ES0 A;  4I0U A;  4MFR A;  5HYA A;  1FMW A;  5L4E A;  2CEA A;  1XMO T;  2D9D A;  2NR4 A;  4G2A A;  4QXB B;  4PK4 A;  3ZMU B;  3PUW F;  4DR1 T;  4LF5 T;  2YU2 A;  5FY7 A;  2VVN A;  4H9N C;  1XNQ T;  3AEF A;  2EHO D;  2KXP B;  4B3R T;  1HNW T;  2X9W A;  3RIF A;  4X64 T;  2XPK A;  4DV4 T;  3GMI A;  4EAH A;  1BR1 A;  3UUN A;  2BG9 C;  2VB6 A;  1UUS A;  2DWG A;  2LM9 A;  2YU1 A;  3ZT6 A;  4ADZ A;  1OED E;  4JI4 T;  3RPU A;  1MMG A;  3PUA A;  5HXE A;  2IIU A;  4OK0 A;  4CI3 B;  3K3Q C;  2QRX A;  3O9X A;  4MLK A;  4UF0 A;  3UFE A;  2CRB A;  1ZP0 A;  3PTR B;  3TLU A;  3ZPO A;  4E7S A;  4IIJ E;  1IBM T;  2UXX B;  5AQS B;  4H63 H;  3AE6 A;  3RIU C;  2I0M A;  3MKD A;  4JEU B;  5FKY A;  3CQX C;  5AQV B;  3PUS A;  5LP6 E;  4DUY T;  4QHO A;  2ZMA A;  4HTE A;  2ETL A;  5FVK A;  5DQW A;  5AQN B;  1VCS A;  2W61 A;  3AE7 A;  3HKE E;  3P4S A;  2A2F X;  4HN9 A;  3H37 A;  1WR6 A;  4L0R A;  1CMX A;  1WRD A;  1YXR A;  2FJA A;  2LSI A;  2QGS A;  1OED C;  3JCF A;  2KLQ A;  1D0X A;  4CZZ B;  2NW9 A;  4C91 A;  3T1H T;  4TV8 E;  3RC8 A;  3I1A A;  2VKD A;  3SOL A;  5JR9 B;  3A7S A;  4HFD A;  2ZM6 T;  4IDQ A;  1XNR T;  3ANW B;  1O3X A;  5FL1 A;  3DJB A;  5FP3 A;  1EZ3 A;  4IHJ E;  2DNX A;  3VRB A;  3VR9 A;  5LG4 A;  2UUB T;  2VKJ A;  2CCQ A;  1QLB A;  1MIV A;  4TNV A;  2LRK A;  3RKO A;  5JH7 E;  3FXE B;  2K48 A;  4HWI B;  3TKL B;  2X0L B;  1HG2 A;  2HN1 A;  4YJ3 E;  1ZHC A;  3QOF A;  5JR9 C;  2W2U A;  5HCJ A;  2UXD T;  3UUB A;  1IAP A;  2C5I T;  3UUL A;  2KWH A;  3UU3 A;  5EK4 A;  4Z8X A;  2CWY A;  2XTL A;  4NPP A;  1E7P A;  2N2N A;  3ANW A;  5LGT B;  1KK7 A;  3UU5 A;  5FY1 A;  4WNK A;  3VRA A;  2AXD S;  3F57 A;  3P8C D;  4COF A;  2N1G A;  3CIR A;  2EHO A;  3FZL B;  3QUJ A;  3UU8 A;  4F6R C;  1MMN A;  4EED A;  1US7 B;  4KI0 F;  4ZHQ E;  4AKG A;  1NWM X;  2KZ7 B;  2M6B A;  4DR3 T;  3ESL A;  4AQG A;  4H9R C;  5ETW A;  4O4H E;  2VKH A;  2CBJ A;  1Y01 A;  3GWH A;  3M65 A;  4BJN A;  3FB2 A;  3AEA A;  4WBN E;  4ZI2 C;  4X65 T;  2W67 A;  5AQI B;  2VAS A;  5CA1 E;  4GKK T;  2HPJ A;  3FZK B;  5CGM A;  4DM9 A;  4IE5 A;  2CHO A;  2LKG A;  2P9B A;  4UV9 B;  4LF8 T;  5IYZ E;  3FZM B;  3O1I A;  5A1L A;  4FJO A;  1XDP A;  5JDN A;  4EB6 E;  5HWX A;  5LJN A;  3GA8 A;  3RIS A;  1W0B A;  2JMK A;  4O4J E;  3PUQ A;  3JC6 D;  2X66 A;  4I4T E;  4X66 T;  3ONX A;  2XJ7 A;  5IWA T;  1LRZ A;  2WU2 A;  4DVD A;  5J2T E;  4GYS A;  5J1G A;  5KDM C;  5F5W A;  1N33 T;  4ERR A;  5DAB A;  3JC6 C;  3ZYK A;  1IJ5 A;  3CX7 B;  3UU6 A;  3ZN0 B;  3N9P A;  2L3L A;  1MMA A;  4QX7 B;  1HF8 A;  2E9X D;  2XAG B;  5ABE A;  3KVF A;  3DP7 A;  4DUZ T;  2VKO A;  3LJC A;  4P1N A;  3RHW A;  3UFG A;  2X0Y A;  4DMV A;  4I55 E;  5JR9 A;  3AA7 B;  4UVC B;  3X1D A;  3WAJ A;  1BR4 A;  5FXW A;  1J1J A;  4B3M T;  2BKN A;  5JRC A;  3PV0 F;  3T8O A;  3FHN A;  3V5S A;  1W9R A;  2XSB A;  3FZF B;  1JNZ A;  3MJX A;  4O4L E;  4HFI A;  4TNW A;  2CMR A;  2M6I A;  3FXD B;  2L9Q A;  5EK2 A;  4YHH T;  2XQ3 A;  2LEN A;  2Q9Q C;  1D0Y A;  2WMO A;  1NEN A;  3LG7 A;  4X1I E;  5FMN A;  3EAB A;  4IE0 A;  4ILC A;  3ETV A;  1UCU A;  1M62 A;  3OYZ A;  4ILU A;  4PJM A;  4ZS2 A;  2NTX A;  5IHY A;  3UT5 E;  1HNX T;  4JI7 T;  4MHC A;  3NVO A;  1IZN B;  2A3D A;  2WDQ A;  4OHF A;  4TWH A;  3BK9 A;  1IJ6 A;  4AXP A;  4TX5 A;  5AFU L;  3M3Z B;  2M67 A;  3UQ7 A;  1DU2 A;  2G0U A;  3L3P A;  3RH3 A;  4O2B E;  2BKO A;  3I9Y A;  5LMU T;  1NAF A;  4HKA A;  4EGW A;  1UUR A;  2VWA A;  2JMH A;  4GK5 E;  5LCY A;  5LXT E;  3AE3 A;  4L5G A;  3E08 A;  4B3S T;  4EIW A;  2KSR A;  5AQL B;  1VOM A;  5JTG A;  1WCR A;  1HG5 A;  2FUP A;  3L09 A;  4TWD A;  4UXN B;  4JV5 T;  5LHH B;  2OLT A;  1HCI A;  3SFD A;  4B6X A;  3VR8 A;  2E9X C;  2H89 A;  4O8S A;  2WZH A;  2Y8D A;  3ZMV B;  4DBQ A;  4JBW F;  4JLE A;  5ABG A;  2XAS B;  2JQK A;  1Y64 B;  3N9N A;  5AQF B;  4LFA T;  3PDY A;  4BAY B;  2B76 A;  5FYM A;  4QH5 A;  3AXJ A;  3KV5 A;  4UF0 B;  4Z91 A;  5HXS A;  3PUG A;  2J4G A;  3LBX A;  3CQC B;  3N2G E;  4UVB B;  3DTO A;  2ZLY A;  3Q5X A;  4A98 A;  3RI5 A;  2V7J A;  1I94 T;  4X62 T;  2CLY B;  1N32 T;  3IF8 B;  4HFH A;  2X67 A;  4KP3 C;  2GK9 A;  3HA4 A;  3WI3 A;  4N78 D;  3CML A;  5AQG B;  1HR0 T;  1T72 A;  2Q9Q A;  3ZSS A;  3AA1 B;  4DV5 T;  3AE1 A;  2C0S A;  2QA7 A;  4HWD A;  1WFD A;  4ILB A;  4P09 A;  1D0Z A;  5AQQ B;  4OYJ A;  2WP9 A;  3R6N A;  4IG7 A;  5DJQ C;  2YKS A;  1D1B A;  5BMV E;  2W63 A;  5M4Y A;  3WAK A;  3ZC1 A;  3C64 A;  2CXF A;  3W15 B;  1YD8 G;  4JI5 T;  4U74 A;  1FEW A;  4I43 B;  5AQK B;  5GON E;  5H6R B;  4P0A A;  2JQ9 A;  5FL0 A;  3AAA B;  1W09 A;  1KFY A;  3GN5 B;  3ZMT B;  4DND A;  4DV7 T;  1SHZ C;  4LFB T;  5TAO A;  2UU9 T;  2N9D A;  4DO0 A;  2BVL A;  3SS1 A;  3ZYM A;  4JYA T;  3CKD A;  3MAC A;  4TN7 B;  5KMG P;  1QSD A;  2XAQ B;  2XHE B;  3C51 A;  2XAF B;  3BQI A;  3B13 A;  3AEC A;  2LSK A;  3P7I A;  3ZST A;  4HFB A;  3PJA J;  2XY8 B;  3VHL A;  3KBU A;  2E9X A;  4IT4 A;  2CWO A;  4YT0 A;  2AE9 A;  3AA0 B;  3CWZ B;  4PW8 A;  4JI3 T;  2WQY A;  2UXC T;  4KMC A;  2J1D G;  1YKH B;  2WCA A;  3ZN1 B;  2YDQ A;  4AQY T;  4NXN T;  3RGL A;  3NRY A;  2A72 A;  5LMN T;  3N9L A;  3F31 A;  5E0O A;  3AVS A;  2D5U A;  4J2C A;  4X20 E;  5ABH A;  1S94 A;  1OWA A;  1T8B A;  4EYY R;  4DV0 T;  2W66 A;  1I6Z A;  4IL9 A;  3VU7 H;  2BG9 B;  5ABF B;  5KXJ A;  2ODV A;  2H88 A;  5LHG B;  5C2T A;  3ZCJ A;  4CI2 B;  5L47 A;  2LOS A;  3PJA A;  1MMD A;  2FJB A;  5F3J A;  4IST A;  3PUZ F;  2IUB A;  3IHR A;  2VQE T;  2H3R A;  1ZV4 X;  4DR2 T;  1E1H B;  2V5D A;  2JJ9 A;  2K5B B;  2FBW A;  3RIU A; 
#chains in the Genus database with same CATH homology
 1UX4 A;  2K9A A;  5JDQ A;  1BR2 A;  4QKN A;  4QX8 B;  2Y48 B;  3N5L A;  3UUX B;  2CLY C;  3RC3 A;  3ZC0 A;  2LSG A;  3I0O A;  3Q5W A;  3N2O A;  2OA5 A;  2WSS V;  2E8I A;  5L3E B;  4PJJ A;  4UIG A;  1S35 A;  4GK0 E;  3CPZ A;  3PUR A;  4K0U A;  4WW0 A;  3U78 A;  3KV6 A;  2BZB A;  4AKI A;  4EYU A;  5LJM A;  3N9O A;  3QK6 A;  2CM0 A;  4FI5 A;  2D0U A;  1Z0P A;  4L9I A;  3KV4 A;  5L3D B;  2KIN B;  2NOX A;  2YK0 A;  4MAL A;  3LK4 2;  4PK5 A;  2Q9Q B;  2H7O A;  5EK3 A;  3F2E A;  2RP4 A;  2XUE A;  3C50 A;  2YEV C;  4IE4 A;  5KX5 E;  2DHR A;  4AQF C;  2KMF A;  2NW8 A;  2E9X B;  5LHI B;  2ODU A;  2PJQ A;  3HKC E;  3KIN B;  5JDF A;  4C90 A;  3C4X A;  4EOZ B;  5H6Q B;  2V7K A;  2DI4 A;  3PE0 A;  4PFP A;  4ZOL E;  3N9M A;  4CQI A;  3AAI A;  3AA6 B;  5LGN B;  3LK2 B;  3SRZ A;  1YKE B;  2XQY A;  3K3O A;  3KVB A;  5F8P A;  5LBQ B;  2PBI A;  4GIW A;  3AAE B;  5LOV E;  1FIO A;  3A5X A;  4O2A E;  4UF0 B;  3EVY A;  2WBL A;  2X51 A;  1WYC A;  3KDS E;  3PU3 A;  1G8X A;  3O1H A;  1MND A;  3MZK B;  1LVK A;  1HS7 A;  5HXR A;  4U72 A;  2Z6E A;  4BJM A;  1XD3 A;  2V7M A;  3Q2M A;  2KND A;  4IGU A;  4JEH B;  4JUY A;  3RYC E;  5L2L A;  2L8K A;  4E7Z A;  5HWY A;  2X68 A;  2CE7 A;  5J2U E;  4AKL A;  1LVF A;  1T98 A;  2WAU A;  3O4X E;  3E0Z A;  3J7Y q;  1BR0 A;  2NP9 A;  3ETU A;  2DLR A;  4TV9 E;  1B7T A;  2PFV A;  2HPL A;  1MIY A;  2X9H A;  3PU8 A;  2LJL A;  4X1Y E;  3HI2 A;  2RA1 A;  4EZ4 A;  4AKR B;  3OYX A;  4HE8 A;  2Q9Q D;  4UVA B;  3I0Q A;  5JDL A;  2IC9 A;  2LOP A;  2V1D B;  4YHJ A;  3NBX X;  5FXV A;  5LA6 E;  1H7C A;  4AQF A;  4XBF B;  4QXH B;  2BDE A;  1UCH A;  3RRC A;  5JDH A;  3VKG A;  2LEN A;  4NUV A;  4HGA A;  2UXN B;  4CXX A;  5DQV A;  3HKD E;  3RYI E;  1U5P A;  2V26 A;  3FBL A;  2XAH B;  2W0G A;  4ZS3 A;  4XZC A;  4ZI7 E;  1YW0 A;  4H9P C;  1X79 A;  3K8P C;  4PK6 A;  4PJN A;  3SWH A;  4I6N A;  4UEL A;  2LT3 A;  1D1C A;  3IFW A;  1WLX A;  3EDV A;  3MK7 C;  1MIW A;  5L3B B;  5EZY E;  3CQG B;  5LYJ E;  1KNZ A;  1HX8 A;  4CXY A;  2NTY A;  5L3F B;  4X1K E;  4H9Q C;  3OKQ A;  5LNK A;  3FBZ A;  2K24 A;  3K3N A;  4PFO A;  3KFW X;  4IE7 A;  1WYB A;  5HAX A;  3RYH E;  5JVD E;  2JRK A;  1U4Q A;  4ZI2 D;  4NUU A;  1OXZ A;  2LSY A;  3AVR A;  3LFM A;  2C5J A;  2Y6X A;  1ZKE A;  2EHO C;  3HKB E;  2IC6 A;  4IDZ A;  1LKX A;  4JKJ A;  3R84 B;  3NZQ A;  2D2S A;  2W00 A;  4BA9 A;  3HL6 A;  2SPC A;  1QUU A;  4TUY E;  4GYR A;  5HXC A;  3S4U A;  1ZEE A;  3ZJ1 A;  2H7V C;  2DCF A;  3ZMS B;  2EHO B;  4DMW A;  4AKH A;  3MA9 A;  4YFS A;  2JQQ A;  4WBO A;  2KT9 A;  4AI6 A;  3C98 B;  2YIN A;  3V5U A;  4PJL A;  4QWN B;  2JPF A;  2DWK A;  5JDM A;  3NRX A;  5HXH A;  4EXT A;  2V7I A;  3LK3 B;  3E22 E;  2XAJ B;  2I59 A;  3ZCI A;  2B1E A;  5LGU B;  2W62 A;  2C5K T;  3OBV E;  2VK9 A;  4PNI A;  4ZI3 C;  1AJ3 A;  2NWB A;  3KBT A;  1G73 A;  4UV8 B;  3U3I A;  3B57 A;  5FY0 A;  2ZM2 A;  2ZM0 A;  2KWI B;  3EDU A;  4TZ4 C;  3UTK A;  2WM9 A;  1HTJ F;  2LEH A;  4MBQ A;  4UEM A;  3ZYL A;  2MTQ A;  2CXD A;  1V9D A;  3NZP A;  4O4I E;  3I9W A;  2ACX A;  3KV9 A;  5FXZ A;  4I50 E;  3RX6 A;  4OFZ A;  1FMV A;  1HFA A;  4HFV A;  3VKH A;  3KW5 A;  4H9O C;  2X9X A;  4G63 A;  5CB4 E;  2WWU A;  5JDG A;  1MNE A;  2MBG A;  4DBR A;  3OJA A;  3TB3 A;  2D0T A;  4YJ2 E;  5FXX A;  2MOZ A;  3D0T A;  4XAX B;  3IBP A;  3AB3 B;  1D1A A;  2HH7 A;  3O1J A;  5L3G B;  3RII A;  2X9Y A;  4GOU A;  1UX5 A;  3BQK A;  2LHN A;  3CVR A;  3H3A A;  4KUM B;  3BQL A;  3ZLI A;  3C4W A;  3N2K E;  3CX6 B;  4A56 A;  4H63 V;  3ZEF B;  2LHR A;  3EUH A;  3Q9D A;  3J9X 1;  5JRC B;  5FNV E;  5ADX L;  1SA0 E;  3HR0 A;  3IEE A;  3KVA A;  4YLH A;  3IRT A;  2CA5 A;  4HEA A;  2ZM8 A;  3GN5 A;  2IW5 B;  3QC9 A;  4ISS A;  3N9Q A;  2LE8 A;  2V7L A;  5JQG E;  2IAK A;  3RRW A;  4ANJ A;  4CXW A;  2NW7 A;  2WMN A;  2PG8 A;  2VL8 A;  4IE6 A;  3C4Z A;  4QXC B;  5LBM A;  3ZJ2 A;  4EZH A;  4ASK A;  3CX8 B;  4P0B A;  3LBX B;  4V1A v;  2CXL A;  5CA0 E;  4CI1 B;  4H9S E;  4PAG A;  5JRE A;  2LSJ A;  4OYK A;  3MXZ A;  5C8Y E;  2BVM A;  2MYS A;  3ZMZ B;  4M1P A;  3UUM A;  4KBM B;  5L3C B;  1CUN A;  5HYA A;  1VRB A;  2ES0 A;  4MFR A;  1FMW A;  2CEA A;  4G2A A;  4QXB B;  4PK4 A;  3ZMU B;  2YU2 A;  5FY7 A;  4H9N C;  2EHO D;  2KXP B;  2X9W A;  3GMI A;  4EAH A;  1BR1 A;  3UUN A;  2VB6 A;  2DWG A;  2LM9 A;  2YU1 A;  4ADZ A;  3RPU A;  1MMG A;  3PUA A;  5HXE A;  4OK0 A;  4CI3 B;  3K3Q C;  3O9X A;  4MLK A;  4UF0 A;  3UFE A;  3PTR B;  3ZPO A;  4E7S A;  4IIJ E;  2UXX B;  4H63 H;  3MKD A;  4JEU B;  3CQX C;  3PUS A;  5LP6 E;  4QHO A;  2ZMA A;  4HTE A;  2ETL A;  5DQW A;  3RYF E;  3HKE E;  2W61 A;  4HN9 A;  1CMX A;  2A2F X;  3H37 A;  1WR6 A;  4L0R A;  1WRD A;  2LSI A;  2QGS A;  2KLQ A;  1D0X A;  4CZZ B;  2NW9 A;  4C91 A;  4TV8 E;  3RC8 A;  3I1A A;  2VKD A;  3SOL A;  5JR9 B;  3A7S A;  3ANW B;  1O3X A;  3DJB A;  5FP3 A;  1EZ3 A;  4IHJ E;  2DNX A;  5LG4 A;  2VKJ A;  2CCQ A;  1MIV A;  3RKO A;  5JH7 E;  3FXE B;  2K48 A;  3TKL B;  2X0L B;  1HG2 A;  4YJ3 E;  1ZHC A;  5JR9 C;  1IAP A;  2C5I T;  3UUL A;  2KWH A;  2K5B B;  5EK4 A;  4Z8X A;  2CWY A;  2XTL A;  2N2N A;  3ANW A;  5LGT B;  1KK7 A;  5FY1 A;  4WNK A;  3F57 A;  3P8C D;  2N1G A;  3QUJ A;  2EHO A;  4F6R C;  1MMN A;  4ZHQ E;  1US7 B;  4AKG A;  1NWM X;  2KZ7 B;  3ESL A;  4AQG A;  4H9R C;  5ETW A;  4O4H E;  4BJN A;  4ZI2 C;  3GWH A;  3M65 A;  3FB2 A;  4WBN E;  2VAS A;  5CA1 E;  2HPJ A;  4DM9 A;  4IE5 A;  4UV9 B;  2P9B A;  5IYZ E;  3O1I A;  5A1L A;  4FJO A;  5JDN A;  4EB6 E;  5HWX A;  5LJN A;  3GA8 A;  3RIS A;  2JMK A;  4O4J E;  3PUQ A;  3JC6 D;  2X66 A;  4I4T E;  3ONX A;  1LRZ A;  4DVD A;  5J2T E;  4GYS A;  5J1G A;  5KDM C;  4ERR A;  5DAB A;  3JC6 C;  3ZYK A;  1IJ5 A;  3CX7 B;  3ZN0 B;  3N9P A;  2L3L A;  1MMA A;  4QX7 B;  1HF8 A;  2E9X D;  2XAG B;  3KVF A;  3DP7 A;  2VKO A;  3LJC A;  4DMV A;  4I55 E;  5JR9 A;  3AA7 B;  4UVC B;  3WAJ A;  1BR4 A;  5FXW A;  5JRC A;  3T8O A;  3FHN A;  3V5S A;  3MJX A;  4O4L E;  2CMR A;  3FXD B;  2L9Q A;  5EK2 A;  2Q9Q C;  1D0Y A;  2WMO A;  3LG7 A;  4X1I E;  5FMN A;  4IE0 A;  3ETV A;  1UCU A;  3OYZ A;  4ILU A;  4PJM A;  5IHY A;  4ZS2 A;  2NTX A;  3UT5 E;  4MHC A;  1IZN B;  2A3D A;  4OHF A;  3BK9 A;  1IJ6 A;  4AXP A;  4TX5 A;  5AFU L;  2M67 A;  2G0U A;  3L3P A;  3RH3 A;  4O2B E;  3I9Y A;  1NAF A;  4HKA A;  2VWA A;  2JMH A;  4GK5 E;  5LCY A;  5LXT E;  4L5G A;  3E08 A;  4EIW A;  1VOM A;  1HG5 A;  3L09 A;  4UXN B;  5LHH B;  1HCI A;  4B6X A;  2E9X C;  4O8S A;  2Y8D A;  3ZMV B;  4JLE A;  2XAS B;  1Y64 B;  3N9N A;  3PDY A;  4BAY B;  5FYM A;  5HXS A;  3KV5 A;  3PUG A;  3LBX A;  3CQC B;  3N2G E;  4UVB B;  3DTO A;  2ZLY A;  3Q5X A;  2V7J A;  2CLY B;  3IF8 B;  4KP3 C;  2X67 A;  2GK9 A;  3HA4 A;  3WI3 A;  4N78 D;  3CML A;  2Q9Q A;  3AA1 B;  2C0S A;  2QA7 A;  4P09 A;  3R6N A;  1D0Z A;  4OYJ A;  5DJQ C;  5M4Y A;  1D1B A;  5BMV E;  2W63 A;  3WAK A;  3ZC1 A;  3C64 A;  2CXF A;  3W15 B;  1YD8 G;  4U74 A;  1FEW A;  4I43 B;  5GON E;  5H6R B;  4P0A A;  4IG7 A;  3AAA B;  3ZMT B;  3GN5 B;  4DND A;  1SHZ C;  5TAO A;  2N9D A;  4DO0 A;  2BVL A;  3SS1 A;  3ZYM A;  3CKD A;  3MAC A;  4TN7 B;  5KMG P;  1QSD A;  2XAQ B;  2XHE B;  3C51 A;  2XAF B;  3BQI A;  3B13 A;  2LSK A;  3P7I A;  4ZI3 D;  3VHL A;  3KBU A;  2E9X A;  2CWO A;  3AA0 B;  3CWZ B;  4PW8 A;  4KMC A;  2J1D G;  1YKH B;  3ZN1 B;  3NRY A;  2A72 A;  3N9L A;  3F31 A;  5E0O A;  3AVS A;  2D5U A;  4J2C A;  4X20 E;  1S94 A;  1OWA A;  4EYY R;  3VU7 H;  2ODV A;  5LHG B;  3ZCJ A;  4CI2 B;  2LOS A;  1MMD A;  5F3J A;  4IST A;  3IHR A;  2H3R A;  1ZV4 X;  1E1H B;  4DBQ A;  2JJ9 A;  2VKH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...