3IHRA

Crystal structure of uch37
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
Knots found
sequence length
305
structure length
282
Chain Sequence
b'EWCLMESDPGVFTELIKGFGCRGAQVEEIWSLEPENFEKLKPVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHLGETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFAAFHFVSYVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQKYSEGEIRFNLMAIVSDRKMIYEQKIAELQRQLAEEPMDMLSAIQSEVAKNQMLIEEEVQKLKRYKIENIRRKHNYLPFIMELLKTLAEHQQLIPL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquitin carboxyl-terminal hydrolase isozyme L5
publication title Structural characterization of human Uch37.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 83
structure length 282
sequence length 305
other databases KnotProt 2.0: K -52 -31 -31
ec nomenclature ec 3.4.19.12: Ubiquitinyl hydrolase 1.
pdb deposition date 2009-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01088 Peptidase_C12 Ubiquitin carboxyl-terminal hydrolase, family 1
A PF18031 UCH_C Ubiquitin carboxyl-terminal hydrolases
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.860 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 3ihrA02
3.40.532.10 Alpha Beta 3-Layer(aba) Sandwich Ubiquitin C-terminal Hydrolase UCH-l3 Peptidase C12, ubiquitin carboxyl-terminal hydrolase 3ihrA01
4DM9A 4IG7A 4UEMA 2ETLA 3A7SA 3RIIA 4JKJA 3KW5A 1XD3A 2LENA 3TB3A 4UELA 3IHRA 1CMXA 3IRTA 3IFWA 4I6NA 3RISA 3KVFA 1UCHA
chains in the Genus database with same CATH superfamily
4GIWA 1Z0PA 4AIUA 4CXWA 3BQKA 2X0YA 2VQET 4Q25A 3IA3A 4JI2T 1N36T 3GN5A 1FEWA 5EK2A 3AE1A 5HEUA 3RYFE 1KF6A 4JUYA 4PJLA 3AEAA 2BVMA 2UXNB 1VOMA 4TV8E 2WMOA 4KX6A 2BS2A 4QH5A 2XTLA 2V26A 3AE3A 2XM2A 2KWIB 2NP9A 3WAKA 5FXWA 5KMGP 5C2TA 3H37A 4WW0A 3EHZA 4YY3T 1XNQT 2VL0A 2KINB 3C4WA 3ZMUB 2FJBA 1Y01A 2YDSA 3UFGA 1YKEB 4IE5A 3KW5A 1Z8UA 3LK2B 2DCFA 4YXDA 2NOXA 3WI3A 1HX8A 5LJMA 3J7Yq 3ZJ2A 4DR4T 3VR9A 2YEVC 3RQWA 2V6YB 5L4HA 5AQUB 1IBMT 4AQFA 2W2UA 1MMDA 5BR8T 3DTOA 4KBMB 4UXNB 4I4TE 3VU7H 4IDNA 3N2OA 2UXXB 2FJDA 3UUBA 1BR0A 1HG2A 1E2AA 2DHRA 1SUMB 1BR4A 2M6IA 2WZHA 3KVFA 5JH7E 4X1IE 5L2LA 2KNDA 2NWBA 2W67A 2W4XA 3RYCE 2ZMAA 2LHRA 4DV5T 5FXZA 5FMNA 2V7MA 4CN4A 5L3DB 4JBWF 1HNZT 4AKIA 2X9WA 4DUYT 5JDMA 5AQIB 2UXBT 3TLWA 3AEFA 3KVAA 4O8SA 3QB5K 1LKXA 3E22E 4X66T 3AA7B 3ZSSA 2QRXA 2CXDA 3JAFA 5LBMA 3KV9A 5DJQC 5E0OA 4I43B 2LM9A 4ILAA 3P4SA 4DNDA 3ZN0B 2XQ3A 5LHGB 1UCHA 3P4WA 4ISTA 2Q9QC 3U3IA 3LK3B 4ASKA 5AFUL 1YXRA 4HGAA 3PV0F 4JKJA 3H3AA 5L3FB 4ZZCA 3L09A 3CQGB 2A2FX 3RIUC 3ZPOA 1KNZA 2XQAA 5EK3A 2E9XA 3G06A 5EK4A 4JI5T 2WCAA 4IE0A 4JEUB 3PUSA 2FJEA 2I6HA 5HXRA 4TN7B 5IWAT 4KMCA 4PJNA 2ACZA 2XJ7A 4LF4T 2JQ9A 4JI0T 1N32T 4UEMA 4V1Av 2LSKA 5HEGA 3RKOA 1YQ3A 4GYRA 2IIUA 3AVSA 3AE5A 4NUVA 1G8XA 2OV9A 2C5IT 4LF7T 3UU5A 1LRZA 4U7YA 3MACA 3A5XA 2N9DA 2MPKA 4Z91A 4CZZB 1MMGA 2LE8A 2A9UA 4DMVA 1SE7A 2CXFA 2LM2A 2CWYA 1U5PA 3HA4A 3RH3A 4GK5E 1MMAA 4N78D 5C3JA 1BR1A 3PU3A 3BK9A 3FZLB 5HXSA 5ABFA 2PFVA 3QK6A 5J1GA 5LP6E 4YJ3E 4XAXB 2MYSA 5FL1A 3ZYLA 2FJAA 2I59A 2WB5A 2VWAA 1DU2A 3ZEFB 3NZQA 3RIIA 2BVLA 2CM0A 3NWIA 3QNUA 1CHUA 2L9QA 5JDGA 3PUVF 1D1BA 2V8SV 5JR9B 4GKKT 2BKNA 4PAGA 3ZYKA 2QGSA 3CQXC 3DJBA 3X1DA 3V5UA 5FP3A 1IZNB 3OPCA 4YTMA 2BKOA 2V7JA 4MHCA 1AJ3A 3ANWB 3EUHA 2RP4A 2WBLA 3LJCA 3MKDA 4I50E 2X51A 4EXTA 4IG7A 4EZ4A 3KDSE 5FNVE 4PFOA 2WQYA 4JI3T 2K5BB 1HF8A 4K0KT 4UIGA 2AE9A 2YINA 5JDQA 2WDVA 4I6NA 3N9MA 2MOZA 3ZT7A 2XM1A 2VURA 4P1NA 3GA8A 2AXDS 4E7ZA 2XZEA 5FL0A 3NKZA 3AE4A 2R6GF 4LF5T 5HXCA 4QWNB 4HKAA 3ZKRA 2IAKA 4O2BE 4ILCA 4WBOA 3RISA 2XQ8A 3F31A 4X1YE 3Q5XA 5AQQB 5AQOB 2XQYA 3L8RA 5JDLA 4OYKA 3EABA 4YTPA 5H6RB 3RPUA 3IEEA 3EI0A 4ZI3D 2D2SA 1S35A 4ZS3A 3IF8B 2XAJB 2LSGA 4LMKA 4CI3B 4HWHA 3PURA 2H88A 5IHYA 4P09A 3D0TA 3RRWA 2XUEA 2MBGA 2WM9A 4AI6A 3EAMA 3CIRA 4KHPT 2D5UA 2JMKA 4ZI2D 4DV3T 1NAFA 5JR9C 4Z8XA 1T72A 3UU3A 4YSXA 4C91A 3ZMVB 1IBLT 5HWYA 3TLTA 3UQ4A 2IUBA 2KMFA 2YOEA 3OJAA 3ZLIA 1MNEA 3K8PC 4ZOLE 4BA9A 4ZZBA 2NW9A 2DLRA 1EZ3A 4QXBB 4QKNA 4O4LE 2L8KA 4U31A 4HFDA 4PK6A 2CBIA 1WFDA 2V7LA 3GMIA 2VASA 4JV5T 4UV8B 2JQQA 2DNXA 3Q5DA 3FB2A 2X9HA 2K48A 2Y6XA 5JTGA 4HFCA 2X0HA 2H7OA 3MZKB 3AEEA 4IDZA 3UUMA 2W00A 1UX4A 2E2AA 3W15B 2QYWA 2XQ6A 4KHZF 1YQ4A 2BS4A 2XAHB 1MNDA 4IGUA 3SRZA 4WZXA 1KNRA 5KX5E 3F57A 4HFIA 1NWMX 4AQYT 2LEHA 1T98A 2E5LT 2PTFA 3CPZA 3RYIE 4DM9A 1WYBA 4IT4A 3O1HA 2LRKA 2W63A 4AXPA 1J1JA 3TLVA 2WDQA 3RQUA 2V6XA 1X9BA 5LHIB 1CUNA 3IHRA 3ZMTB 4HFBA 4JI8T 1WYCA 3VKGA 1FMWA 5CFBA 1YKHB 2ETLA 3HKEE 4HWIB 2EHOC 3A7SA 1E7PA 3UULA 3T1YT 3ZJ1A 2XQ9A 5ABGA 3T8OA 3P4QA 4MBQA 2LRLA 3OYXA 1LVKA 3CX7B 3N9OA 5ABHA 5FYMA 3N9PA 3WAJA 5IUXA 2YU2A 4MLKA 1US7B 2XAQB 4PK5A 3O4XE 3BQLA 4DBQA 4UELA 4LF6T 3ZMZB 2WS3A 4LF9T 4KI0F 2XQ4A 5HWXA 2HN1A 4AISA 1M7KA 1SA0E 1QSDA 3RLFF 2E9XD 4U2YA 4DR7T 2A3DA 2UUAT 4UVBB 4ZS2A 4YFSA 2CLYC 3ONLC 4YLHA 3PTRB 2E5VA 2Q9QA 1HX1B 4TV9E 3C51A 4ILBA 3MXZA 1L0VA 3RIUA 4JEHB 4PJMA 5DQWA 2CRBA 3TLSA 1W0AA 3CWZB 4ZI7E 1HR0T 3HI2A 4DR6T 3P8CD 4UR9A 2CEAA 3FZMB 3AECA 3U78A 1HG5A 4ZXLA 1UUSA 1ZP0A 4EEBA 4MALA 4ZHQE 4TWFA 2V6YA 3AE6A 2D0UA 3FHNA 2D9DA 5ETWA 1CMXA 3CMLA 4H9QC 3AA0B 1R8IA 4O4HE 5LG4A 2G0UA 3RF1A 3MJXA 2CBJA 2SPCA 1U4QA 2BBJA 4NXNT 2CPTA 4PJJA 1OWAA 4ADZA 4JYAT 3B57A 4LFAT 1D0YA 5L3EB 3NRYA 4QX8B 5LMNT 5CB4E 4QH4A 2P9BA 5AQFB 5M4YA 4IE4A 3AA6B 4YHHT 5LB7B 3IFWA 4XZCA 2NW7A 1WCRA 4WNKA 5HXHA 2NR4A 2QVAA 4AKRB 2HPJA 4I55E 2JIWA 2C5KT 3SWHA 3TKLB 2YU1A 4CI1B 1GQEA 4NPPA 2JRKA 3RX6A 3ZSTA 2W66A 3O1IA 2K24A 3KV6A 2YDRA 4FJOA 2ACXA 3HKDE 3KBUA 4C90A 3OVUA 3ZT6A 1OEDB 2WWVA 4G2AA 5JRCB 5LHHB 3ESLA 5LMUT 2WAUA 4IL9A 1XNRT 2KXPB 2YN6A 2VVNA 1D1CA 5A1LA 2W62A 5LGNB 5CA0E 4HTEA 4IDOA 1J5ET 2WU5A 5AQTB 4B3RT 5L4EA 1UURA 2HPLA 3JAEA 1IJ6A 2YK0A 2WY2A 3LG7A 3ZN1B 2CXLA 3ZCIA 1UCUA 1LVFA 5GONE 2ZM6T 3K3NA 4YT0A 1ZHCA 3C4ZA 4DV4T 4QX7B 3JC6D 4ZEYA 1HS7A 3AEDA 4TZ4C 3HL6A 4CI2B 2VB6A 4DIDB 5C8YE 2UUBT 3AA1B 3N9LA 2IHR1 5HEOA 2XAGB 4DV6T 2MAWA 2HH7A 3LK42 1OEDE 2XPKA 3BQIA 5HXEA 2DWGA 4TNVA 3I9YA 3FZFB 3LBXB 1OEDC 2VKOA 5JR9A 4DO0A 4IDPA 2BG9B 3TB3A 3JADA 5KXJA 4PW8A 5AQVB 4LMJA 3MA9A 4ANJA 2DI4A 1JNRA 4IHJE 1NEKA 4DR2T 1T7SA 1XDPA 4L0RA 3L39A 3SFDA 3RIAA 1Y64B 2X66A 4PFPA 4COFA 4JI1T 5CGMA 3QUJA 4AKHA 4OHFA 2QA7A 3AVRA 5FXVA 3QOFA 3UT5E 3KFWX 2CE7A 2LKGA 2LSIA 2X68A 5AQNB 3AEBA 4CQIA 3JCFA 3EDUA 5DABA 3UUNA 4B3TT 2V5DA 3FZHB 2VQFT 1KK7A 4YSYA 1WLXA 5JQGE 3HKCE 2X67A 4OYJA 3K3QC 2OLTA 3Q5WA 2PG8A 2VKDA 5LXTE 2BDEA 4J2CA 1XZYA 4TWHA 5CJ5A 1FIOA 2IC6A 3FXEB 5DQVA 4ILUA 3I1AA 5H6QB 4EYUA 3CK6A 5HCMA 1S94A 4X20E 3PJAJ 3SOLA 4E7SA 2EHOA 1VCSA 4WYVA 3AXJA 2IMLA 4YJ2E 1YD8G 2KLQA 4LMLA 1N34T 2FBWA 2LLYA 2CHNA 2Q9QD 1SHZC 4AKLA 4P0AA 3KVBA 2BS3A 5J0ZA 4M1PA 4X64T 4EZHA 3SFEA 3P4PA 4JI7T 1G73A 4EB6E 1HNXT 3ETVA 2IC9A 4DR3T 2WWUA 4JLEA 3VKHA 4IREA 2LKHA 4UF0B 4L9IA 3FBLA 1YW0A 3GN5B 2DL1A 4Z90A 4B6XA 4JI4T 2XASB 4KP3C 1ZV4X 2XSAA 2UXCT 3A7MA 4NUUA 2Z6EA 4O2AE 3CKDA 3LDQB 3UQ7A 2W0GA 2B76A 4IE6A 2V5CA 1UX5A 3UU4A 2A72A 2LJLA 2NTXA 3CX6B 3L3PA 2LSYA 1UGOA 5AQHB 2J47A 4GOUA 4WBNE 5BMVE 5J2TE 4A98A 3AB3B 5J2UE 5F8PA 2ZM0A 3MK7C 4H63V 2KZ7B 4CXXA 2NTYA 2X9XA 3KV4A 2JJ9A 1QLBA 4HE8A 3CVRA 3NRXA 5LGUB 3UU6A 2Q9QB 3ONJA 5AQJB 4AKGA 4BJMA 3PUWF 4GK0E 4H9SE 2RA1A 1HCIA 4U72A 3UTKA 1WR0A 2LOSA 1MIWA 3A8YC 3TLUA 4ISSA 2V7KA 2IDOB 2CWOA 2LSJA 4H9RC 1QUUA 2BKPA 4HFVA 1IJ5A 3NBXX 1KNPA 2I0MA 4OK0A 3RHWA 3AAAB 4TNWA 1BR2A 4X62T 3R6NA 4ZI3C 2ZM2A 4YSZA 3N2KE 3ZYMA 3Q2MA 1D1AA 4XBFB 4DMWA 2PJQA 1D0ZA 3N9NA 2JQKA 2C0SA 1HFAA 1HTJF 4EIWA 2OA5A 3B5MA 1W9RA 2WDRA 1MMNA 4DR1T 3RYHE 1J5WA 3HKBE 4ZI2C 5CA1E 4HWDA 3ZC1A 3OYZA 3PUZF 4UVCB 4YHJA 2J1DG 3VHLA 3FZKB 1IBKT 2UXDT 3PJAA 4F8HA 4UV9B 4FI5A 3LSVA 2IW5B 4UVAB 3AE8A 4HFHA 2CCQA 5AQRB 2XSBA 2V7IA 4A56A 2VL8A 3KINB 3N9QA 5L3BB 5JVDE 1IAPA 1KEYA 2Y8DA 4A97A 5HEJA 1V9DA 1B7TA 5LA6E 2VKHA 4QXCB 4DBRA 4IDQA 3AE2A 4EGWA 4QH1A 3RRCA 3M3ZB 2HN2A 2E9XB 2H3RA 3CQCB 2WU2A 5HAXA 3RKGA 2YKSA 3EDVA 3PUGA 4U2ZA 2H89A 1FJGT 2VKJA 5FXXA 4AQFC 1E1HB 1ZOYA 5FVLA 2CA5A 3F2EA 2XHEB 3S4UA 2V1DB 4OX9T 5LOVE 3HR0A 4GKJT 2LENA 4EV6A 2PBIA 5LGTB 3O9XA 4HN9A 1WRDA 4H9OC 4X65T 5JDHA 3E08A 2ZLYA 4LF8T 5AQGB 4HEAA 5LG3A 5AQKB 2BBHA 2FUPA 4IL4A 1OEDA 3K1SA 5HYAA 2WP9A 5ABFB 4X1KE 2ES0A 4DV7T 3SS1A 5JRCA 3M65A 1N33T 2LOPA 3C98B 5EZYE 4LFCT 2XQ7A 3VRBA 4H63H 1OXZA 3PUXF 3J9X1 3P4RA 5L47A 3OBVE 3ZT5A 1NENA 3N5LA 1T8BA 2VK9A 4TUYE 4DR5T 3RC8A 5AQPB 3QC9A 4ERRA 2K9AA 1I94T 5FVKA 5AQLB 4X5TA 1W0BA 2E9XC 5AQSB 3DP7A 4U33A 1VRBA 4U3CA 3FBZA 2ODVA 2CMRA 5FKYA 3QB5A 4NIQA 3GWHA 1XMQT 4P0BA 1XD3A 5JDFA 1XDOA 4F6RC 3PDYA 2N1GA 4AQGA 3OTOT 1XWMA 3ZMSB 4H9PC 2L3LA 3ETUA 2EHOD 4MFRA 1FMVA 4O4IE 4TX5A 3R84B 2DWKA 1H7CA 2RPAA 2E8IA 2KT9A 2M67A 2X0LB 3Q5EA 4PK4A 5JDNA 2B1EA 4EAHA 3OKQA 3C50A 4HFEA 3ONXA 3UUXB 2J4GA 1VCTA 2BZBA 2M6BA 3B13A 2NW8A 5HEHA 3UU8A 4B3ST 1JNZA 2N2NA 3ANWA 2XQ5A 3FXDB 4G63A 5LJNA 3AEGA 4DV1T 3PUAA 3I0QA 1ZKEA 3LBXA 2WZIA 2D0TA 4HWCA 1WR6A 2ZM8A 5ADXL 3RI5A 5LBQB 2BG9A 2LT3A 2KSRA 4DUZT 2F4VT 4U74A 3IBPA 3VRAA 5JREA 4LFBT 3AE9A 4H9NC 4EOZB 4NXMT 2UUCT 1MIVA 4A5XA 5FY0A 2YDQA 1KFYA 3PUYF 3P50A 4IIJE 3NVOA 2KWHA 1O3XA 3ABVA 3E0ZA 4GYSA 2C5JA 3RGLA 1ZEEA 1XMOT 3T1HT 2JMHA 4DVDA 3IRTA 1M62A 3V5SA 4DV2T 2GK9A 4CXYA 5IYZE 3LFMA 4DV0T 4EYYR 1D0XA 3RIFA 5F3JA 2EHOB 4PNIA 4BAYB 2J62A 4YTNA 4OFZA 2BG9E 3PUQA 3AXJB 1MIYA 5LCYA 2UU9T 5FY7A 4KUMB 4JI6T 4B3MT 3PU8A 3UFEA 5L3CB 2XAFB 2X9YA 4QXHB 3PE0A 3ZC0A 2BG9C 4EEDA 3ZCJA 3I0OA 4K0UA 3KBTA 2W61A 3I9WA 5LNKA 5ABEA 5L3GB 3AAIA 3C4XA 4I0UA 4TWDA 2Y48B 2XY8B 4U7IA 3NZPA 3H3MA 4QHOA 2CHOA 5KDMC 4L5GA 3CX8B 3C64A 2CLYB 1UK5A 3N2GE 3VR8A 5F5WA 2K3WA 2VVSA 3P7IA 3K3OA 3O1JA 1I6ZA 4IE7A 5AQMB 5FY1A 3AE7A 4HWFA 2ODUA 3KV5A 2WSSV 3Q9DA 2H7VC 2LHNA 2JQHA 4O4JE 2JPFA 3AAEB 3JC6C 2HHHT 5LYJE 2MTQA 1X79A 4CN1A 1HNWT 1W09A 4UF0A 3RC3A 5HCJA 3EVYA 4CN6A 2WMNA 4BJNA 5TAOA
chains in the Genus database with same CATH topology
4GIWA 1Z0PA 1LVFA 5GONE 4CI3B 3PURA 2CCQA 4CXWA 3BQKA 5IHYA 4P09A 3D0TA 2V7IA 2XUEA 3K3NA 2VL8A 3KINB 3N9QA 2MBGA 3RRWA 4A56A 5L3BB 3GN5A 1IAPA 5JVDE 2Y8DA 2WM9A 1V9DA 1ZHCA 1FEWA 4AI6A 1B7TA 5EK2A 3C4ZA 2D5UA 2JMKA 5LA6E 4QX7B 4ZI2D 2VKHA 1NAFA 4QXCB 3JC6D 4DBRA 5JR9C 4Z8XA 3RRCA 3CQCB 2E9XB 2H3RA 4C91A 1HS7A 3RYFE 3ZMVB 4JUYA 4TZ4C 5HWYA 3HL6A 4CI2B 2KMFA 2VB6A 4PJLA 5C8YE 3AA1B 3N9LA 3OJAA 2BVMA 5HAXA 3ZLIA 2UXNB 1VOMA 4TV8E 2XAGB 1MNEA 2WMOA 3EDVA 3K8PC 3PUGA 4ZOLE 4BA9A 2NW9A 2DLRA 2HH7A 3LK42 1EZ3A 2VKJA 2XTLA 4QXBB 5FXXA 2V26A 4AQFC 4QKNA 4O4LE 2KWIB 1E1HB 2L8KA 2NP9A 3WAKA 5FXWA 5KMGP 3H37A 4WW0A 3BQIA 5HXEA 2CA5A 4PK6A 3F2EA 2DWGA 2XHEB 2V7LA 3GMIA 3I9YA 3S4UA 2KINB 2VASA 3C4WA 3LBXB 3ZMUB 4UV8B 2V1DB 2JQQA 2DNXA 3FB2A 2X9HA 2K48A 2Y6XA 2VKOA 5JR9A 4DO0A 2H7OA 3MZKB 1YKEB 4IE5A 4IDZA 5LOVE 3LK2B 2DCFA 3HR0A 2NOXA 3KW5A 3WI3A 2LENA 3TB3A 1HX8A 3UUMA 5LJMA 2W00A 1UX4A 2PBIA 5LGTB 3J7Yq 3ZJ2A 4PW8A 3O9XA 4HN9A 3W15B 3MA9A 1WRDA 4H9OC 4ANJA 2YEVC 2DI4A 5JDHA 3E08A 2ZLYA 4IHJE 4AQFA 2XAHB 1MNDA 4IGUA 1MMDA 3DTOA 3SRZA 4KBMB 4UXNB 4HEAA 4I4TE 4L0RA 3VU7H 5KX5E 3F57A 3N2OA 1NWMX 2UXXB 1Y64B 2X66A 2LEHA 1BR0A 4PFPA 1HG2A 2DHRA 1T98A 5HYAA 1BR4A 4X1KE 2ES0A 3KVFA 3QUJA 5JH7E 3CPZA 4X1IE 3SS1A 5JRCA 3M65A 3RYIE 4AKHA 4DM9A 1WYBA 2LOPA 4OHFA 2QA7A 3AVRA 5L2LA 3C98B 3O1HA 5FXVA 2KNDA 5EZYE 3UT5E 2NWBA 3KFWX 3RYCE 2CE7A 2ZMAA 2LHRA 2W63A 5FXZA 5FMNA 4H63H 2V7MA 4AXPA 2LSIA 5L3DB 1OXZA 2X68A 4AKIA 2X9WA 5LHIB 1CUNA 3J9X1 3IHRA 3ZMTB 3OBVE 4CQIA 5JDMA 1WYCA 3EDUA 5DABA 3UUNA 3VKGA 1FMWA 1YKHB 2ETLA 3KVAA 3N5LA 4O8SA 2VK9A 3HKEE 4TUYE 3RC8A 1KK7A 2EHOC 3A7SA 1WLXA 3QC9A 5JQGE 1LKXA 2K9AA 3HKCE 3E22E 4ERRA 3AA7B 3UULA 2E9XC 2CXDA 2X67A 5LBMA 3ZJ1A 3KV9A 3T8OA 5DJQC 5E0OA 3DP7A 4OYJA 3K3QC 4I43B 2LM9A 3Q5WA 4MBQA 4DNDA 3ZN0B 2PG8A 2VKDA 3OYXA 5LHGB 5LXTE 1VRBA 1LVKA 3CX7B 3N9OA 1UCHA 4ISTA 3FBZA 2BDEA 2ODVA 5FYMA 2Q9QC 3U3IA 3LK3B 4J2CA 2CMRA 3N9PA 4ASKA 3WAJA 1FIOA 5AFUL 2IC6A 2YU2A 4HGAA 4MLKA 3GWHA 4JKJA 1US7B 2XAQB 3H3AA 4PK5A 3FXEB 5L3FB 4P0BA 3O4XE 3L09A 3BQLA 5JDFA 1XD3A 3CQGB 5DQVA 2A2FX 4ILUA 4F6RC 4DBQA 3I1AA 4UELA 5H6QB 4EYUA 3ZPOA 1KNZA 3PDYA 2N1GA 1S94A 4X20E 3ZMZB 4AQGA 3ZMSB 4H9PC 2L3LA 3ETUA 3SOLA 4E7SA 2EHOA 2EHOD 5HWXA 4MFRA 1FMVA 1SA0E 4O4IE 4TX5A 2DWKA 3R84B 5EK3A 1H7CA 1QSDA 2E9XA 2E9XD 5EK4A 2A3DA 4YJ2E 1YD8G 2E8IA 4IE0A 2KLQA 2KT9A 4JEUB 4UVBB 4ZS2A 4YFSA 2M67A 3PUSA 2X0LB 4PK4A 5JDNA 2B1EA 4TN7B 2CLYC 5HXRA 4EAHA 3OKQA 3C50A 4KMCA 3ONXA 4YLHA 4PJNA 3PTRB 3UUXB 2Q9QA 2Q9QD 2BZBA 3B13A 2NW8A 1SHZC 4AKLA 4P0AA 3KVBA 4TV9E 3C51A 2N2NA 3ANWA 4UEMA 3FXDB 4M1PA 3MXZA 4G63A 4V1Av 2LSKA 5LJNA 3RKOA 4JEHB 4PJMA 5DQWA 3PUAA 4EZHA 3I0QA 4GYRA 1ZKEA 3CWZB 3LBXA 3AVSA 4NUVA 1G8XA 1G73A 4ZI7E 3HI2A 2C5IT 4EB6E 2D0TA 3ETVA 1WR6A 1LRZA 3P8CD 2IC9A 2CEAA 2WWUA 2ZM8A 4JLEA 5ADXL 3VKHA 5LBQB 3MACA 3A5XA 2LT3A 2N9DA 4CZZB 3U78A 1HG5A 1MMGA 2LE8A 4UF0B 4DMVA 4U74A 2CXFA 3IBPA 4MALA 4ZHQE 5JREA 2CWYA 1U5PA 3HA4A 4H9NC 3RH3A 4L9IA 4EOZB 2D0UA 4GK5E 3FBLA 1MIVA 3FHNA 5ETWA 1MMAA 5FY0A 4N78D 1YW0A 1CMXA 1BR1A 3CMLA 4H9QC 3AA0B 3GN5B 3PU3A 4IIJE 4O4HE 4B6XA 5LG4A 2XASB 4KP3C 1ZV4X 2G0UA 2KWHA 3BK9A 3MJXA 5HXSA 1O3XA 4NUUA 2SPCA 2Z6EA 3E0ZA 4O2AE 2PFVA 3QK6A 3CKDA 1U4QA 4GYSA 5J1GA 2C5JA 5LP6E 4YJ3E 1ZEEA 4XAXB 2W0GA 4IE6A 1OWAA 4PJJA 2MYSA 2JMHA 4ADZA 4DVDA 1UX5A 3IRTA 3B57A 3ZYLA 1D0YA 2A72A 2LJLA 2NTXA 3V5SA 5L3EB 3CX6B 3L3PA 3NRYA 2GK9A 4CXYA 2LSYA 4QX8B 5IYZE 2I59A 4GOUA 4WBNE 3LFMA 2VWAA 4EYYR 5CB4E 5BMVE 2P9BA 5J2TE 1D0XA 3ZEFB 3AB3B 3NZQA 5J2UE 3RIIA 2BVLA 5M4YA 5F3JA 4IE4A 3AA6B 2EHOB 4PNIA 2CM0A 5F8PA 4BAYB 4OFZA 2L9QA 2ZM0A 5JDGA 3MK7C 3PUQA 3IFWA 1D1BA 4XZCA 1MIYA 4H63V 5LCYA 2NW7A 2KZ7B 5JR9B 4CXXA 5FY7A 4PAGA 3ZYKA 4WNKA 2QGSA 2NTYA 4KUMB 5HXHA 2X9XA 3CQXC 3KV4A 2JJ9A 4HE8A 3PU8A 3CVRA 3NRXA 3UFEA 4AKRB 5L3CB 5LGUB 2XAFB 2HPJA 2Q9QB 2X9YA 3DJBA 3PE0A 4I55E 4QXHB 3ZC0A 3V5UA 1IZNB 5FP3A 2C5KT 3I0OA 2V7JA 4MHCA 3SWHA 3ZCJA 3TKLB 4AKGA 2YU1A 4BJMA 1AJ3A 4CI1B 4K0UA 4GK0E 3RX6A 2JRKA 4H9SE 3ANWB 2RA1A 3KBTA 1HCIA 3EUHA 2RP4A 4U72A 3UTKA 2LOSA 1MIWA 2WBLA 2W61A 3I9WA 3O1IA 2K24A 5LNKA 3LJCA 3MKDA 4I50E 3KV6A 4ISSA 2X51A 2V7KA 4EXTA 2CWOA 2LSJA 4FJOA 1QUUA 2ACXA 4H9RC 4EZ4A 4IG7A 3HKDE 4HFVA 3KBUA 5L3GB 3AAIA 1IJ5A 3KDSE 3C4XA 5FNVE 4PFOA 4C90A 3NBXX 2Y48B 3NZPA 4QHOA 4G2AA 5JRCB 5LHHB 2K5BB 4OK0A 3ESLA 5KDMC 1HF8A 3AAAB 4UIGA 2YINA 1BR2A 4L5GA 5JDQA 3CX8B 3C64A 2CLYB 4I6NA 3N9MA 3R6NA 2WAUA 2MOZA 4ZI3C 2ZM2A 3N2GE 3N2KE 3ZYMA 3P7IA 3K3OA 3Q2MA 1D1AA 4XBFB 2KXPB 4DMWA 3O1JA 2PJQA 3GA8A 4IE7A 5FY1A 1D0ZA 1D1CA 5A1LA 2W62A 2ODUA 4E7ZA 5LGNB 5CA0E 4HTEA 3KV5A 3N9NA 2WSSV 3Q9DA 2C0SA 2H7VC 2LHNA 1HFAA 1HTJF 4EIWA 5HXCA 4QWNB 4HKAA 2OA5A 2IAKA 4O4JE 4O2BE 4WBOA 3RISA 2JPFA 1MMNA 3RYHE 3HKBE 3F31A 4ZI2C 4X1YE 3Q5XA 3AAEB 3JC6C 5CA1E 3ZC1A 5LYJE 2XQYA 3OYZA 2HPLA 2MTQA 4UVCB 5JDLA 1X79A 1IJ6A 4OYKA 2YK0A 4YHJA 5H6RB 2J1DG 3VHLA 3LG7A 3RPUA 3ZN1B 3IEEA 4ZI3D 2D2SA 1S35A 4UF0A 2CXLA 3IF8B 4ZS3A 3ZCIA 4UV9B 4FI5A 2IW5B 3RC3A 2XAJB 3EVYA 2LSGA 2WMNA 4BJNA 4UVAB 5TAOA 1UCUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DM9 A;  4IG7 A;  4UEM A;  2ETL A;  3A7S A;  3RII A;  4JKJ A;  3KW5 A;  1XD3 A;  2LEN A;  3TB3 A;  4UEL A;  3IHR A;  1CMX A;  3IRT A;  3IFW A;  4I6N A;  3RIS A;  3KVF A;  1UCH A; 
#chains in the Genus database with same CATH topology
 4GIW A;  1Z0P A;  4AIU A;  4CXW A;  3BQK A;  2X0Y A;  2VQE T;  4Q25 A;  3IA3 A;  4JI2 T;  1N36 T;  3GN5 A;  1FEW A;  5EK2 A;  3AE1 A;  5HEU A;  3RYF E;  1KF6 A;  4JUY A;  4PJL A;  3AEA A;  2BVM A;  2UXN B;  1VOM A;  4TV8 E;  2WMO A;  4KX6 A;  2BS2 A;  4QH5 A;  2XTL A;  2V26 A;  3AE3 A;  2XM2 A;  2KWI B;  2NP9 A;  3WAK A;  5FXW A;  5KMG P;  5C2T A;  3H37 A;  4WW0 A;  3EHZ A;  4YY3 T;  1XNQ T;  2VL0 A;  2KIN B;  3C4W A;  3ZMU B;  2FJB A;  1Y01 A;  2YDS A;  3UFG A;  1YKE B;  4IE5 A;  3KW5 A;  1Z8U A;  3LK2 B;  2DCF A;  4YXD A;  2NOX A;  3WI3 A;  1HX8 A;  5LJM A;  3J7Y q;  3ZJ2 A;  4DR4 T;  3VR9 A;  2YEV C;  3RQW A;  2V6Y B;  5L4H A;  5AQU B;  1IBM T;  4AQF A;  2W2U A;  1MMD A;  5BR8 T;  3DTO A;  4KBM B;  4UXN B;  4I4T E;  3VU7 H;  4IDN A;  3N2O A;  2UXX B;  2FJD A;  3UUB A;  1BR0 A;  1HG2 A;  1E2A A;  2DHR A;  1SUM B;  1BR4 A;  2M6I A;  2WZH A;  3KVF A;  5JH7 E;  4X1I E;  5L2L A;  2KND A;  2NWB A;  2W67 A;  2W4X A;  3RYC E;  2ZMA A;  2LHR A;  4DV5 T;  5FXZ A;  5FMN A;  2V7M A;  4CN4 A;  5L3D B;  4JBW F;  1HNZ T;  4AKI A;  2X9W A;  4DUY T;  5JDM A;  5AQI B;  2UXB T;  3TLW A;  3AEF A;  3KVA A;  4O8S A;  3QB5 K;  1LKX A;  3E22 E;  4X66 T;  3AA7 B;  3ZSS A;  2QRX A;  2CXD A;  3JAF A;  5LBM A;  3KV9 A;  5DJQ C;  5E0O A;  4I43 B;  2LM9 A;  4ILA A;  3P4S A;  4DND A;  3ZN0 B;  2XQ3 A;  5LHG B;  1UCH A;  3P4W A;  4IST A;  2Q9Q C;  3U3I A;  3LK3 B;  4ASK A;  5AFU L;  1YXR A;  4HGA A;  3PV0 F;  4JKJ A;  3H3A A;  5L3F B;  4ZZC A;  3L09 A;  3CQG B;  2A2F X;  3RIU C;  3ZPO A;  1KNZ A;  2XQA A;  5EK3 A;  2E9X A;  3G06 A;  5EK4 A;  4JI5 T;  2WCA A;  4IE0 A;  4JEU B;  3PUS A;  2FJE A;  2I6H A;  5HXR A;  4TN7 B;  5IWA T;  4KMC A;  4PJN A;  2ACZ A;  2XJ7 A;  4LF4 T;  2JQ9 A;  4JI0 T;  1N32 T;  4UEM A;  4V1A v;  2LSK A;  5HEG A;  3RKO A;  1YQ3 A;  4GYR A;  2IIU A;  3AVS A;  3AE5 A;  4NUV A;  1G8X A;  2OV9 A;  2C5I T;  4LF7 T;  3UU5 A;  1LRZ A;  4U7Y A;  3MAC A;  3A5X A;  2N9D A;  2MPK A;  4Z91 A;  4CZZ B;  1MMG A;  2LE8 A;  2A9U A;  4DMV A;  1SE7 A;  2CXF A;  2LM2 A;  2CWY A;  1U5P A;  3HA4 A;  3RH3 A;  4GK5 E;  1MMA A;  4N78 D;  5C3J A;  1BR1 A;  3PU3 A;  3BK9 A;  3FZL B;  5HXS A;  5ABF A;  2PFV A;  3QK6 A;  5J1G A;  5LP6 E;  4YJ3 E;  4XAX B;  2MYS A;  5FL1 A;  3ZYL A;  2FJA A;  2I59 A;  2WB5 A;  2VWA A;  1DU2 A;  3ZEF B;  3NZQ A;  3RII A;  2BVL A;  2CM0 A;  3NWI A;  3QNU A;  1CHU A;  2L9Q A;  5JDG A;  3PUV F;  1D1B A;  2V8S V;  5JR9 B;  4GKK T;  2BKN A;  4PAG A;  3ZYK A;  2QGS A;  3CQX C;  3DJB A;  3X1D A;  3V5U A;  5FP3 A;  1IZN B;  3OPC A;  4YTM A;  2BKO A;  2V7J A;  4MHC A;  1AJ3 A;  3ANW B;  3EUH A;  2RP4 A;  2WBL A;  3LJC A;  3MKD A;  4I50 E;  2X51 A;  4EXT A;  4IG7 A;  4EZ4 A;  3KDS E;  5FNV E;  4PFO A;  2WQY A;  4JI3 T;  2K5B B;  1HF8 A;  4K0K T;  4UIG A;  2AE9 A;  2YIN A;  5JDQ A;  2WDV A;  4I6N A;  3N9M A;  2MOZ A;  3ZT7 A;  2XM1 A;  2VUR A;  4P1N A;  3GA8 A;  2AXD S;  4E7Z A;  2XZE A;  5FL0 A;  3NKZ A;  3AE4 A;  2R6G F;  4LF5 T;  5HXC A;  4QWN B;  4HKA A;  3ZKR A;  2IAK A;  4O2B E;  4ILC A;  4WBO A;  3RIS A;  2XQ8 A;  3F31 A;  4X1Y E;  3Q5X A;  5AQQ B;  5AQO B;  2XQY A;  3L8R A;  5JDL A;  4OYK A;  3EAB A;  4YTP A;  5H6R B;  3RPU A;  3IEE A;  3EI0 A;  4ZI3 D;  2D2S A;  1S35 A;  4ZS3 A;  3IF8 B;  2XAJ B;  2LSG A;  4LMK A;  4CI3 B;  4HWH A;  3PUR A;  2H88 A;  5IHY A;  4P09 A;  3D0T A;  3RRW A;  2XUE A;  2MBG A;  2WM9 A;  4AI6 A;  3EAM A;  3CIR A;  4KHP T;  2D5U A;  2JMK A;  4ZI2 D;  4DV3 T;  1NAF A;  5JR9 C;  4Z8X A;  1T72 A;  3UU3 A;  4YSX A;  4C91 A;  3ZMV B;  1IBL T;  5HWY A;  3TLT A;  3UQ4 A;  2IUB A;  2KMF A;  2YOE A;  3OJA A;  3ZLI A;  1MNE A;  3K8P C;  4ZOL E;  4BA9 A;  4ZZB A;  2NW9 A;  2DLR A;  1EZ3 A;  4QXB B;  4QKN A;  4O4L E;  2L8K A;  4U31 A;  4HFD A;  4PK6 A;  2CBI A;  1WFD A;  2V7L A;  3GMI A;  2VAS A;  4JV5 T;  4UV8 B;  2JQQ A;  2DNX A;  3Q5D A;  3FB2 A;  2X9H A;  2K48 A;  2Y6X A;  5JTG A;  4HFC A;  2X0H A;  2H7O A;  3MZK B;  3AEE A;  4IDZ A;  3UUM A;  2W00 A;  1UX4 A;  2E2A A;  3W15 B;  2QYW A;  2XQ6 A;  4KHZ F;  1YQ4 A;  2BS4 A;  2XAH B;  1MND A;  4IGU A;  3SRZ A;  4WZX A;  1KNR A;  5KX5 E;  3F57 A;  4HFI A;  1NWM X;  4AQY T;  2LEH A;  1T98 A;  2E5L T;  2PTF A;  3CPZ A;  3RYI E;  4DM9 A;  1WYB A;  4IT4 A;  3O1H A;  2LRK A;  2W63 A;  4AXP A;  1J1J A;  3TLV A;  2WDQ A;  3RQU A;  2V6X A;  1X9B A;  5LHI B;  1CUN A;  3IHR A;  3ZMT B;  4HFB A;  4JI8 T;  1WYC A;  3VKG A;  1FMW A;  5CFB A;  1YKH B;  2ETL A;  3HKE E;  4HWI B;  2EHO C;  3A7S A;  1E7P A;  3UUL A;  3T1Y T;  3ZJ1 A;  2XQ9 A;  5ABG A;  3T8O A;  3P4Q A;  4MBQ A;  2LRL A;  3OYX A;  1LVK A;  3CX7 B;  3N9O A;  5ABH A;  5FYM A;  3N9P A;  3WAJ A;  5IUX A;  2YU2 A;  4MLK A;  1US7 B;  2XAQ B;  4PK5 A;  3O4X E;  3BQL A;  4DBQ A;  4UEL A;  4LF6 T;  3ZMZ B;  2WS3 A;  4LF9 T;  4KI0 F;  2XQ4 A;  5HWX A;  2HN1 A;  4AIS A;  1M7K A;  1SA0 E;  1QSD A;  3RLF F;  2E9X D;  4U2Y A;  4DR7 T;  2A3D A;  2UUA T;  4UVB B;  4ZS2 A;  4YFS A;  2CLY C;  3ONL C;  4YLH A;  3PTR B;  2E5V A;  2Q9Q A;  1HX1 B;  4TV9 E;  3C51 A;  4ILB A;  3MXZ A;  1L0V A;  3RIU A;  4JEH B;  4PJM A;  5DQW A;  2CRB A;  3TLS A;  1W0A A;  3CWZ B;  4ZI7 E;  1HR0 T;  3HI2 A;  4DR6 T;  3P8C D;  4UR9 A;  2CEA A;  3FZM B;  3AEC A;  3U78 A;  1HG5 A;  4ZXL A;  1UUS A;  1ZP0 A;  4EEB A;  4MAL A;  4ZHQ E;  4TWF A;  2V6Y A;  3AE6 A;  2D0U A;  3FHN A;  2D9D A;  5ETW A;  1CMX A;  3CML A;  4H9Q C;  3AA0 B;  1R8I A;  4O4H E;  5LG4 A;  2G0U A;  3RF1 A;  3MJX A;  2CBJ A;  2SPC A;  1U4Q A;  2BBJ A;  4NXN T;  2CPT A;  4PJJ A;  1OWA A;  4ADZ A;  4JYA T;  3B57 A;  4LFA T;  1D0Y A;  5L3E B;  3NRY A;  4QX8 B;  5LMN T;  5CB4 E;  4QH4 A;  2P9B A;  5AQF B;  5M4Y A;  4IE4 A;  3AA6 B;  4YHH T;  5LB7 B;  3IFW A;  4XZC A;  2NW7 A;  1WCR A;  4WNK A;  5HXH A;  2NR4 A;  2QVA A;  4AKR B;  2HPJ A;  4I55 E;  2JIW A;  2C5K T;  3SWH A;  3TKL B;  2YU1 A;  4CI1 B;  1GQE A;  4NPP A;  2JRK A;  3RX6 A;  3ZST A;  2W66 A;  3O1I A;  2K24 A;  3KV6 A;  2YDR A;  4FJO A;  2ACX A;  3HKD E;  3KBU A;  4C90 A;  3OVU A;  3ZT6 A;  1OED B;  2WWV A;  4G2A A;  5JRC B;  5LHH B;  3ESL A;  5LMU T;  2WAU A;  4IL9 A;  1XNR T;  2KXP B;  2YN6 A;  2VVN A;  1D1C A;  5A1L A;  2W62 A;  5LGN B;  5CA0 E;  4HTE A;  4IDO A;  1J5E T;  2WU5 A;  5AQT B;  4B3R T;  5L4E A;  1UUR A;  2HPL A;  3JAE A;  1IJ6 A;  2YK0 A;  2WY2 A;  3LG7 A;  3ZN1 B;  2CXL A;  3ZCI A;  1UCU A;  1LVF A;  5GON E;  2ZM6 T;  3K3N A;  4YT0 A;  1ZHC A;  3C4Z A;  4DV4 T;  4QX7 B;  3JC6 D;  4ZEY A;  1HS7 A;  3AED A;  4TZ4 C;  3HL6 A;  4CI2 B;  2VB6 A;  4DID B;  5C8Y E;  2UUB T;  3AA1 B;  3N9L A;  2IHR 1;  5HEO A;  2XAG B;  4DV6 T;  2MAW A;  2HH7 A;  3LK4 2;  1OED E;  2XPK A;  3BQI A;  5HXE A;  2DWG A;  4TNV A;  3I9Y A;  3FZF B;  3LBX B;  1OED C;  2VKO A;  5JR9 A;  4DO0 A;  4IDP A;  2BG9 B;  3TB3 A;  3JAD A;  5KXJ A;  4PW8 A;  5AQV B;  4LMJ A;  3MA9 A;  4ANJ A;  2DI4 A;  1JNR A;  4IHJ E;  1NEK A;  4DR2 T;  1T7S A;  1XDP A;  4L0R A;  3L39 A;  3SFD A;  3RIA A;  1Y64 B;  2X66 A;  4PFP A;  4COF A;  4JI1 T;  5CGM A;  3QUJ A;  4AKH A;  4OHF A;  2QA7 A;  3AVR A;  5FXV A;  3QOF A;  3UT5 E;  3KFW X;  2CE7 A;  2LKG A;  2LSI A;  2X68 A;  5AQN B;  3AEB A;  4CQI A;  3JCF A;  3EDU A;  5DAB A;  3UUN A;  4B3T T;  2V5D A;  3FZH B;  2VQF T;  1KK7 A;  4YSY A;  1WLX A;  5JQG E;  3HKC E;  2X67 A;  4OYJ A;  3K3Q C;  2OLT A;  3Q5W A;  2PG8 A;  2VKD A;  5LXT E;  2BDE A;  4J2C A;  1XZY A;  4TWH A;  5CJ5 A;  1FIO A;  2IC6 A;  3FXE B;  5DQV A;  4ILU A;  3I1A A;  5H6Q B;  4EYU A;  3CK6 A;  5HCM A;  1S94 A;  4X20 E;  3PJA J;  3SOL A;  4E7S A;  2EHO A;  1VCS A;  4WYV A;  3AXJ A;  2IML A;  4YJ2 E;  1YD8 G;  2KLQ A;  4LML A;  1N34 T;  2FBW A;  2LLY A;  2CHN A;  2Q9Q D;  1SHZ C;  4AKL A;  4P0A A;  3KVB A;  2BS3 A;  5J0Z A;  4M1P A;  4X64 T;  4EZH A;  3SFE A;  3P4P A;  4JI7 T;  1G73 A;  4EB6 E;  1HNX T;  3ETV A;  2IC9 A;  4DR3 T;  2WWU A;  4JLE A;  3VKH A;  4IRE A;  2LKH A;  4UF0 B;  4L9I A;  3FBL A;  1YW0 A;  3GN5 B;  2DL1 A;  4Z90 A;  4B6X A;  4JI4 T;  2XAS B;  4KP3 C;  1ZV4 X;  2XSA A;  2UXC T;  3A7M A;  4NUU A;  2Z6E A;  4O2A E;  3CKD A;  3LDQ B;  3UQ7 A;  2W0G A;  2B76 A;  4IE6 A;  2V5C A;  1UX5 A;  3UU4 A;  2A72 A;  2LJL A;  2NTX A;  3CX6 B;  3L3P A;  2LSY A;  1UGO A;  5AQH B;  2J47 A;  4GOU A;  4WBN E;  5BMV E;  5J2T E;  4A98 A;  3AB3 B;  5J2U E;  5F8P A;  2ZM0 A;  3MK7 C;  4H63 V;  2KZ7 B;  4CXX A;  2NTY A;  2X9X A;  3KV4 A;  2JJ9 A;  1QLB A;  4HE8 A;  3CVR A;  3NRX A;  5LGU B;  3UU6 A;  2Q9Q B;  3ONJ A;  5AQJ B;  4AKG A;  4BJM A;  3PUW F;  4GK0 E;  4H9S E;  2RA1 A;  1HCI A;  4U72 A;  3UTK A;  1WR0 A;  2LOS A;  1MIW A;  3A8Y C;  3TLU A;  4ISS A;  2V7K A;  2IDO B;  2CWO A;  2LSJ A;  4H9R C;  1QUU A;  2BKP A;  4HFV A;  1IJ5 A;  3NBX X;  1KNP A;  2I0M A;  4OK0 A;  3RHW A;  3AAA B;  4TNW A;  1BR2 A;  4X62 T;  3R6N A;  4ZI3 C;  2ZM2 A;  4YSZ A;  3N2K E;  3ZYM A;  3Q2M A;  1D1A A;  4XBF B;  4DMW A;  2PJQ A;  1D0Z A;  3N9N A;  2JQK A;  2C0S A;  1HFA A;  1HTJ F;  4EIW A;  2OA5 A;  3B5M A;  1W9R A;  2WDR A;  1MMN A;  4DR1 T;  3RYH E;  1J5W A;  3HKB E;  4ZI2 C;  5CA1 E;  4HWD A;  3ZC1 A;  3OYZ A;  3PUZ F;  4UVC B;  4YHJ A;  2J1D G;  3VHL A;  3FZK B;  1IBK T;  2UXD T;  3PJA A;  4F8H A;  4UV9 B;  4FI5 A;  3LSV A;  2IW5 B;  4UVA B;  3AE8 A;  4HFH A;  2CCQ A;  5AQR B;  2XSB A;  2V7I A;  4A56 A;  2VL8 A;  3KIN B;  3N9Q A;  5L3B B;  5JVD E;  1IAP A;  1KEY A;  2Y8D A;  4A97 A;  5HEJ A;  1V9D A;  1B7T A;  5LA6 E;  2VKH A;  4QXC B;  4DBR A;  4IDQ A;  3AE2 A;  4EGW A;  4QH1 A;  3RRC A;  3M3Z B;  2HN2 A;  2E9X B;  2H3R A;  3CQC B;  2WU2 A;  5HAX A;  3RKG A;  2YKS A;  3EDV A;  3PUG A;  4U2Z A;  2H89 A;  1FJG T;  2VKJ A;  5FXX A;  4AQF C;  1E1H B;  1ZOY A;  5FVL A;  2CA5 A;  3F2E A;  2XHE B;  3S4U A;  2V1D B;  4OX9 T;  5LOV E;  3HR0 A;  4GKJ T;  2LEN A;  4EV6 A;  2PBI A;  5LGT B;  3O9X A;  4HN9 A;  1WRD A;  4H9O C;  4X65 T;  5JDH A;  3E08 A;  2ZLY A;  4LF8 T;  5AQG B;  4HEA A;  5LG3 A;  5AQK B;  2BBH A;  2FUP A;  4IL4 A;  1OED A;  3K1S A;  5HYA A;  2WP9 A;  5ABF B;  4X1K E;  2ES0 A;  4DV7 T;  3SS1 A;  5JRC A;  3M65 A;  1N33 T;  2LOP A;  3C98 B;  5EZY E;  4LFC T;  2XQ7 A;  3VRB A;  4H63 H;  1OXZ A;  3PUX F;  3J9X 1;  3P4R A;  5L47 A;  3OBV E;  3ZT5 A;  1NEN A;  3N5L A;  1T8B A;  2VK9 A;  4TUY E;  4DR5 T;  3RC8 A;  5AQP B;  3QC9 A;  4ERR A;  2K9A A;  1I94 T;  5FVK A;  5AQL B;  4X5T A;  1W0B A;  2E9X C;  5AQS B;  3DP7 A;  4U33 A;  1VRB A;  4U3C A;  3FBZ A;  2ODV A;  2CMR A;  5FKY A;  3QB5 A;  4NIQ A;  3GWH A;  1XMQ T;  4P0B A;  1XD3 A;  5JDF A;  1XDO A;  4F6R C;  3PDY A;  2N1G A;  4AQG A;  3OTO T;  1XWM A;  3ZMS B;  4H9P C;  2L3L A;  3ETU A;  2EHO D;  4MFR A;  1FMV A;  4O4I E;  4TX5 A;  3R84 B;  2DWK A;  1H7C A;  2RPA A;  2E8I A;  2KT9 A;  2M67 A;  2X0L B;  3Q5E A;  4PK4 A;  5JDN A;  2B1E A;  4EAH A;  3OKQ A;  3C50 A;  4HFE A;  3ONX A;  3UUX B;  2J4G A;  1VCT A;  2BZB A;  2M6B A;  3B13 A;  2NW8 A;  5HEH A;  3UU8 A;  4B3S T;  1JNZ A;  2N2N A;  3ANW A;  2XQ5 A;  3FXD B;  4G63 A;  5LJN A;  3AEG A;  4DV1 T;  3PUA A;  3I0Q A;  1ZKE A;  3LBX A;  2WZI A;  2D0T A;  4HWC A;  1WR6 A;  2ZM8 A;  5ADX L;  3RI5 A;  5LBQ B;  2BG9 A;  2LT3 A;  2KSR A;  4DUZ T;  2F4V T;  4U74 A;  3IBP A;  3VRA A;  5JRE A;  4LFB T;  3AE9 A;  4H9N C;  4EOZ B;  4NXM T;  2UUC T;  1MIV A;  4A5X A;  5FY0 A;  2YDQ A;  1KFY A;  3PUY F;  3P50 A;  4IIJ E;  3NVO A;  2KWH A;  1O3X A;  3ABV A;  3E0Z A;  4GYS A;  2C5J A;  3RGL A;  1ZEE A;  1XMO T;  3T1H T;  2JMH A;  4DVD A;  3IRT A;  1M62 A;  3V5S A;  4DV2 T;  2GK9 A;  4CXY A;  5IYZ E;  3LFM A;  4DV0 T;  4EYY R;  1D0X A;  3RIF A;  5F3J A;  2EHO B;  4PNI A;  4BAY B;  2J62 A;  4YTN A;  4OFZ A;  2BG9 E;  3PUQ A;  3AXJ B;  1MIY A;  5LCY A;  2UU9 T;  5FY7 A;  4KUM B;  4JI6 T;  4B3M T;  3PU8 A;  3UFE A;  5L3C B;  2XAF B;  2X9Y A;  4QXH B;  3PE0 A;  3ZC0 A;  2BG9 C;  4EED A;  3ZCJ A;  3I0O A;  4K0U A;  3KBT A;  2W61 A;  3I9W A;  5LNK A;  5ABE A;  5L3G B;  3AAI A;  3C4X A;  4I0U A;  4TWD A;  2Y48 B;  2XY8 B;  4U7I A;  3NZP A;  3H3M A;  4QHO A;  2CHO A;  5KDM C;  4L5G A;  3CX8 B;  3C64 A;  2CLY B;  1UK5 A;  3N2G E;  3VR8 A;  5F5W A;  2K3W A;  2VVS A;  3P7I A;  3K3O A;  3O1J A;  1I6Z A;  4IE7 A;  5AQM B;  5FY1 A;  3AE7 A;  4HWF A;  2ODU A;  3KV5 A;  2WSS V;  3Q9D A;  2H7V C;  2LHN A;  2JQH A;  4O4J E;  2JPF A;  3AAE B;  3JC6 C;  2HHH T;  5LYJ E;  2MTQ A;  1X79 A;  4CN1 A;  1HNW T;  1W09 A;  4UF0 A;  3RC3 A;  5HCJ A;  3EVY A;  4CN6 A;  2WMN A;  4BJN A;  5TAO A; 
#chains in the Genus database with same CATH homology
 4GIW A;  1Z0P A;  1LVF A;  5GON E;  4CI3 B;  3PUR A;  2CCQ A;  4CXW A;  3BQK A;  5IHY A;  4P09 A;  3D0T A;  2V7I A;  2XUE A;  3K3N A;  2VL8 A;  3KIN B;  3N9Q A;  2MBG A;  3RRW A;  4A56 A;  5L3B B;  3GN5 A;  1IAP A;  5JVD E;  2Y8D A;  2WM9 A;  1V9D A;  1ZHC A;  1FEW A;  4AI6 A;  1B7T A;  5EK2 A;  3C4Z A;  2D5U A;  2JMK A;  5LA6 E;  4QX7 B;  4ZI2 D;  2VKH A;  1NAF A;  4QXC B;  3JC6 D;  4DBR A;  5JR9 C;  4Z8X A;  3RRC A;  3CQC B;  2E9X B;  2H3R A;  4C91 A;  1HS7 A;  3RYF E;  3ZMV B;  4JUY A;  4TZ4 C;  5HWY A;  3HL6 A;  4CI2 B;  2KMF A;  2VB6 A;  4PJL A;  5C8Y E;  3AA1 B;  3N9L A;  3OJA A;  2BVM A;  5HAX A;  3ZLI A;  2UXN B;  1VOM A;  4TV8 E;  2XAG B;  1MNE A;  2WMO A;  3EDV A;  3K8P C;  3PUG A;  4ZOL E;  4BA9 A;  2NW9 A;  2DLR A;  2HH7 A;  3LK4 2;  1EZ3 A;  2VKJ A;  2XTL A;  4QXB B;  5FXX A;  2V26 A;  4AQF C;  4QKN A;  4O4L E;  2KWI B;  1E1H B;  2L8K A;  2NP9 A;  3WAK A;  5FXW A;  5KMG P;  3H37 A;  4WW0 A;  3BQI A;  5HXE A;  2CA5 A;  4PK6 A;  3F2E A;  2DWG A;  2XHE B;  2V7L A;  3GMI A;  3I9Y A;  3S4U A;  2KIN B;  2VAS A;  3C4W A;  3LBX B;  3ZMU B;  4UV8 B;  2V1D B;  2JQQ A;  2DNX A;  3FB2 A;  2X9H A;  2K48 A;  2Y6X A;  2VKO A;  5JR9 A;  4DO0 A;  2H7O A;  3MZK B;  1YKE B;  4IE5 A;  4IDZ A;  5LOV E;  3LK2 B;  2DCF A;  3HR0 A;  2NOX A;  3KW5 A;  3WI3 A;  2LEN A;  3TB3 A;  1HX8 A;  3UUM A;  5LJM A;  2W00 A;  1UX4 A;  2PBI A;  5LGT B;  3J7Y q;  3ZJ2 A;  4PW8 A;  3O9X A;  4HN9 A;  3W15 B;  3MA9 A;  1WRD A;  4H9O C;  4ANJ A;  2YEV C;  2DI4 A;  5JDH A;  3E08 A;  2ZLY A;  4IHJ E;  4AQF A;  2XAH B;  1MND A;  4IGU A;  1MMD A;  3DTO A;  3SRZ A;  4KBM B;  4UXN B;  4HEA A;  4I4T E;  4L0R A;  3VU7 H;  5KX5 E;  3F57 A;  3N2O A;  1NWM X;  2UXX B;  1Y64 B;  2X66 A;  2LEH A;  1BR0 A;  4PFP A;  1HG2 A;  2DHR A;  1T98 A;  5HYA A;  1BR4 A;  4X1K E;  2ES0 A;  3KVF A;  3QUJ A;  5JH7 E;  3CPZ A;  4X1I E;  3SS1 A;  5JRC A;  3M65 A;  3RYI E;  4AKH A;  4DM9 A;  1WYB A;  2LOP A;  4OHF A;  2QA7 A;  3AVR A;  5L2L A;  3C98 B;  3O1H A;  5FXV A;  2KND A;  5EZY E;  3UT5 E;  2NWB A;  3KFW X;  3RYC E;  2CE7 A;  2ZMA A;  2LHR A;  2W63 A;  5FXZ A;  5FMN A;  4H63 H;  2V7M A;  4AXP A;  2LSI A;  5L3D B;  1OXZ A;  2X68 A;  4AKI A;  2X9W A;  5LHI B;  1CUN A;  3J9X 1;  3IHR A;  3ZMT B;  3OBV E;  4CQI A;  5JDM A;  1WYC A;  3EDU A;  5DAB A;  3UUN A;  3VKG A;  1FMW A;  1YKH B;  2ETL A;  3KVA A;  3N5L A;  4O8S A;  2VK9 A;  3HKE E;  4TUY E;  3RC8 A;  1KK7 A;  2EHO C;  3A7S A;  1WLX A;  3QC9 A;  5JQG E;  1LKX A;  2K9A A;  3HKC E;  3E22 E;  4ERR A;  3AA7 B;  3UUL A;  2E9X C;  2CXD A;  2X67 A;  5LBM A;  3ZJ1 A;  3KV9 A;  3T8O A;  5DJQ C;  5E0O A;  3DP7 A;  4OYJ A;  3K3Q C;  4I43 B;  2LM9 A;  3Q5W A;  4MBQ A;  4DND A;  3ZN0 B;  2PG8 A;  2VKD A;  3OYX A;  5LHG B;  5LXT E;  1VRB A;  1LVK A;  3CX7 B;  3N9O A;  1UCH A;  4IST A;  3FBZ A;  2BDE A;  2ODV A;  5FYM A;  2Q9Q C;  3U3I A;  3LK3 B;  4J2C A;  2CMR A;  3N9P A;  4ASK A;  3WAJ A;  1FIO A;  5AFU L;  2IC6 A;  2YU2 A;  4HGA A;  4MLK A;  3GWH A;  4JKJ A;  1US7 B;  2XAQ B;  3H3A A;  4PK5 A;  3FXE B;  5L3F B;  4P0B A;  3O4X E;  3L09 A;  3BQL A;  5JDF A;  1XD3 A;  3CQG B;  5DQV A;  2A2F X;  4ILU A;  4F6R C;  4DBQ A;  3I1A A;  4UEL A;  5H6Q B;  4EYU A;  3ZPO A;  1KNZ A;  3PDY A;  2N1G A;  1S94 A;  4X20 E;  3ZMZ B;  4AQG A;  3ZMS B;  4H9P C;  2L3L A;  3ETU A;  3SOL A;  4E7S A;  2EHO A;  2EHO D;  5HWX A;  4MFR A;  1FMV A;  1SA0 E;  4O4I E;  4TX5 A;  2DWK A;  3R84 B;  5EK3 A;  1H7C A;  1QSD A;  2E9X A;  2E9X D;  5EK4 A;  2A3D A;  4YJ2 E;  1YD8 G;  2E8I A;  4IE0 A;  2KLQ A;  2KT9 A;  4JEU B;  4UVB B;  4ZS2 A;  4YFS A;  2M67 A;  3PUS A;  2X0L B;  4PK4 A;  5JDN A;  2B1E A;  4TN7 B;  2CLY C;  5HXR A;  4EAH A;  3OKQ A;  3C50 A;  4KMC A;  3ONX A;  4YLH A;  4PJN A;  3PTR B;  3UUX B;  2Q9Q A;  2Q9Q D;  2BZB A;  3B13 A;  2NW8 A;  1SHZ C;  4AKL A;  4P0A A;  3KVB A;  4TV9 E;  3C51 A;  2N2N A;  3ANW A;  4UEM A;  3FXD B;  4M1P A;  3MXZ A;  4G63 A;  4V1A v;  2LSK A;  5LJN A;  3RKO A;  4JEH B;  4PJM A;  5DQW A;  3PUA A;  4EZH A;  3I0Q A;  4GYR A;  1ZKE A;  3CWZ B;  3LBX A;  3AVS A;  4NUV A;  1G8X A;  1G73 A;  4ZI7 E;  3HI2 A;  2C5I T;  4EB6 E;  2D0T A;  3ETV A;  1WR6 A;  1LRZ A;  3P8C D;  2IC9 A;  2CEA A;  2WWU A;  2ZM8 A;  4JLE A;  5ADX L;  3VKH A;  5LBQ B;  3MAC A;  3A5X A;  2LT3 A;  2N9D A;  4CZZ B;  3U78 A;  1HG5 A;  1MMG A;  2LE8 A;  4UF0 B;  4DMV A;  4U74 A;  2CXF A;  3IBP A;  4MAL A;  4ZHQ E;  5JRE A;  2CWY A;  1U5P A;  3HA4 A;  4H9N C;  3RH3 A;  4L9I A;  4EOZ B;  2D0U A;  4GK5 E;  3FBL A;  1MIV A;  3FHN A;  5ETW A;  1MMA A;  5FY0 A;  4N78 D;  1YW0 A;  1CMX A;  1BR1 A;  3CML A;  4H9Q C;  3AA0 B;  3GN5 B;  3PU3 A;  4IIJ E;  4O4H E;  4B6X A;  5LG4 A;  2XAS B;  4KP3 C;  1ZV4 X;  2G0U A;  2KWH A;  3BK9 A;  3MJX A;  5HXS A;  1O3X A;  4NUU A;  2SPC A;  2Z6E A;  3E0Z A;  4O2A E;  2PFV A;  3QK6 A;  3CKD A;  1U4Q A;  4GYS A;  5J1G A;  2C5J A;  5LP6 E;  4YJ3 E;  1ZEE A;  4XAX B;  2W0G A;  4IE6 A;  1OWA A;  4PJJ A;  2MYS A;  2JMH A;  4ADZ A;  4DVD A;  1UX5 A;  3IRT A;  3B57 A;  3ZYL A;  1D0Y A;  2A72 A;  2LJL A;  2NTX A;  3V5S A;  5L3E B;  3CX6 B;  3L3P A;  3NRY A;  2GK9 A;  4CXY A;  2LSY A;  4QX8 B;  5IYZ E;  2I59 A;  4GOU A;  4WBN E;  3LFM A;  2VWA A;  4EYY R;  5CB4 E;  5BMV E;  2P9B A;  5J2T E;  1D0X A;  3ZEF B;  3AB3 B;  3NZQ A;  5J2U E;  3RII A;  2BVL A;  5M4Y A;  5F3J A;  4IE4 A;  3AA6 B;  2EHO B;  4PNI A;  2CM0 A;  5F8P A;  4BAY B;  4OFZ A;  2L9Q A;  2ZM0 A;  5JDG A;  3MK7 C;  3PUQ A;  3IFW A;  1D1B A;  4XZC A;  1MIY A;  4H63 V;  5LCY A;  2NW7 A;  2KZ7 B;  5JR9 B;  4CXX A;  5FY7 A;  4PAG A;  3ZYK A;  4WNK A;  2QGS A;  2NTY A;  4KUM B;  5HXH A;  2X9X A;  3CQX C;  3KV4 A;  2JJ9 A;  4HE8 A;  3PU8 A;  3CVR A;  3NRX A;  3UFE A;  4AKR B;  5L3C B;  5LGU B;  2XAF B;  2HPJ A;  2Q9Q B;  2X9Y A;  3DJB A;  3PE0 A;  4I55 E;  4QXH B;  3ZC0 A;  3V5U A;  1IZN B;  5FP3 A;  2C5K T;  3I0O A;  2V7J A;  4MHC A;  3SWH A;  3ZCJ A;  3TKL B;  4AKG A;  2YU1 A;  4BJM A;  1AJ3 A;  4CI1 B;  4K0U A;  4GK0 E;  3RX6 A;  2JRK A;  4H9S E;  3ANW B;  2RA1 A;  3KBT A;  1HCI A;  3EUH A;  2RP4 A;  4U72 A;  3UTK A;  2LOS A;  1MIW A;  2WBL A;  2W61 A;  3I9W A;  3O1I A;  2K24 A;  5LNK A;  3LJC A;  3MKD A;  4I50 E;  3KV6 A;  4ISS A;  2X51 A;  2V7K A;  4EXT A;  2CWO A;  2LSJ A;  4FJO A;  1QUU A;  2ACX A;  4H9R C;  4EZ4 A;  4IG7 A;  3HKD E;  4HFV A;  3KBU A;  5L3G B;  3AAI A;  1IJ5 A;  3KDS E;  3C4X A;  5FNV E;  4PFO A;  4C90 A;  3NBX X;  2Y48 B;  3NZP A;  4QHO A;  4G2A A;  5JRC B;  5LHH B;  2K5B B;  4OK0 A;  3ESL A;  5KDM C;  1HF8 A;  3AAA B;  4UIG A;  2YIN A;  1BR2 A;  4L5G A;  5JDQ A;  3CX8 B;  3C64 A;  2CLY B;  4I6N A;  3N9M A;  3R6N A;  2WAU A;  2MOZ A;  4ZI3 C;  2ZM2 A;  3N2G E;  3N2K E;  3ZYM A;  3P7I A;  3K3O A;  3Q2M A;  1D1A A;  4XBF B;  2KXP B;  4DMW A;  3O1J A;  2PJQ A;  3GA8 A;  4IE7 A;  5FY1 A;  1D0Z A;  1D1C A;  5A1L A;  2W62 A;  2ODU A;  4E7Z A;  5LGN B;  5CA0 E;  4HTE A;  3KV5 A;  3N9N A;  2WSS V;  3Q9D A;  2C0S A;  2H7V C;  2LHN A;  1HFA A;  1HTJ F;  4EIW A;  5HXC A;  4QWN B;  4HKA A;  2OA5 A;  2IAK A;  4O4J E;  4O2B E;  4WBO A;  3RIS A;  2JPF A;  1MMN A;  3RYH E;  3HKB E;  3F31 A;  4ZI2 C;  4X1Y E;  3Q5X A;  3AAE B;  3JC6 C;  5CA1 E;  3ZC1 A;  5LYJ E;  2XQY A;  3OYZ A;  2HPL A;  2MTQ A;  4UVC B;  5JDL A;  1X79 A;  1IJ6 A;  4OYK A;  2YK0 A;  4YHJ A;  5H6R B;  2J1D G;  3VHL A;  3LG7 A;  3RPU A;  3ZN1 B;  3IEE A;  4ZI3 D;  2D2S A;  1S35 A;  4UF0 A;  2CXL A;  3IF8 B;  4ZS3 A;  3ZCI A;  4UV9 B;  4FI5 A;  2IW5 B;  3RC3 A;  2XAJ B;  3EVY A;  2LSG A;  2WMN A;  4BJN A;  4UVA B;  5TAO A;  1UCU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...