3II3A

Structure of orf157 from acidianus filamentous virus 1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
b'SVVEYEVVSKNLTSKMSHELLFSVKKRWFVKPFRHDRQLGKLHYKLLPGNYIKFGLYVLKNQDYARFEIAWVHVDKDGKIEERTVYSIETYWHIFIDIENDLNCPYVLAKFIEMRPEFHKTAWVEESNYSIAEDDIQMVESIKRYLERKI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title ORF157 from the archaeal virus Acidianus filamentous virus 1 defines a new class of nuclease
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Dna binding protein
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2009-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11646 DUF3258 Protein of unknown function DUF3258
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ii3A00
3ILEA 3II3A 3ILDA 3II2A 3VB8A
chains in the Genus database with same CATH superfamily
2JF1A 1TFHA 1O7DC 4GW4B 1BYNA 4O2EB 1FZJA 1F5WA 4J5VA 3VXRB 3D51A 4M56A 3ZZ1A 3QI9C 3RWHB 5FDWA 2CKBA 1T20B 2VZSA 1JMXA 2V2TB 3V4VB 2YUVA 4F5CE 3P0GB 1SOXA 5DLMH 4PWKA 4X9HA 1OKEA 3KLHD 3PDOB 1NMAL 3M1CA 5DK0A 5D2NB 3HE7B 5FHAL 3SDYL 3GJFA 1YJDL 4UV7L 4XVOA 2NCEA 3QUYC 3L7FB 3TWCH 4M4PA 3UC0H 4CJ0A 2MWCA 2DTSA 4WI4A 4LQFH 1MREH 4PYGA 2YK1H 1X9RA 5AVXB 1BA9A 3FB6A 4S1DD 3ILDA 1UKTA 1QD0A 1XBRA 2H6OA 2IALB 4WTZG 1ZTMA 2EXSA 1C08A 5FIEA 5EU5A 3QG7H 2GT9B 2UVFA 3QEQB 4LU5H 4WRLA 3KPLB 3F7YB 4QHMB 5CJOL 1M2VB 3KYMB 4XCCH 1RVFL 3VXRE 4K5NA 3IJHB 1UWGL 1IB5A 2EH8H 4NB7A 2R2CA 4KOCA 2A9ML 5GZOC 2XTLA 3CDYA 1P1ZB 4XGZA 3FDWA 4L0ZA 4GEJA 3EF7A 2BSEA 4HBCL 4PJEA 3AUVA 5I30H 2R0LL 3KEHA 2F8IA 3MUHL 5EBMB 2G4GA 4C56B 3DETD 2CO2A 4RA3A 4K8RC 2ZE0A 3IPEA 3NJXA 2OJZH 4XNXL 5F3HB 1N0XH 4U4BA 4YK4B 2FECL 2HJLB 4QUOA 3O0RH 3EF4A 3EW3B 5LBSL 5CGYC 4R6UA 1DQLL 1V7NL 5IROD 4V1DA 4EJ1C 2AK4D 3ZE0E 2F54B 1CDCA 3DK0A 3BRDA 5JDSB 3Q8BA 3QEQE 3GIVB 4HT1H 4L9LB 3RX9A 1INEL 1N18A 3E8VA 5SV4A 4LLYA 3R8QA 3FN9A 1DANT 3FU7B 1U8PA 4N8VA 2MOQA 3INUH 2GTZB 5DC0A 4NHCL 4CL7A 1WZLA 4GW5B 2LGNA 4KHXH 3O9WC 5CZVH 4BZ1A 4DESA 1BZ8A 3NJVA 2C9UA 4MJ6A 4ZPVB 3CXHK 4PWGA 4X6FB 1WWWX 3WO3B 4YE4L 2L3BA 3QZMA 4C56E 1CICB 3SHSA 3MUGA 4TUJA 1O6TA 1DUZA 2AJYH 2QQQA 3EOYG 1CTOA 1Y1DA 3T2NL 3U1SL 2EKSB 3V0WH 1OXYA 1NGXA 5HGHA 5B21A 4AENB 3STLA 3QDJE 4LDLB 4MMXA 5F3BB 4E42A 1I3GH 3SN6N 3OVUB 4TUOB 2B08A 4W93A 4JX0A 4EVNB 4DEPC 4LQ1A 4HPOL 4APQD 5C0FA 3ESMA 2I07A 4B0MM 4MA1B 2WINA 4FA7B 2F54E 4KO9A 4K3JL 2W0KA 1EDYA 2F53D 4ALAC 3EHBC 2WQWA 2KI6A 4NQEB 4P9HH 4B9JA 3SCMC 2LAGB 3R0MA 1OZUA 1KC5H 5EU7C 5F96H 4GO9A 2C9XA 4BKSC 2I69A 2JB6A 4Q58C 3X13B 4A7QA 2IPTL 4XP5L 3O3EA 5FO8B 1R6VA 3UYOD 1GR7A 1UA6H 2HLEB 2QKIA 3IFNH 2X1WL 3PNRB 1HN1A 4KKRA 1HNFA 1QLRB 3GMRB 4LLQA 4E9QA 1PL3A 4M5ZL 3ES6A 1ZLVH 1S2EA 2Z92A 5F9WB 5CZRA 4QRUA 2M1KA 1WHOA 3UG4A 1XH0A 2APSA 2HFTA 1TVBB 1HZHH 3JUYA 4UQ9A 4AQ1C 4PGZA 2VDLB 2XA3A 3VB8A 2HT3D 3FTWA 2ZXDA 4X6BA 2R56H 3CFUA 2YZ1A 1TETH 2HWZH 2YLHA 4AE1A 4QNPF 3QIBB 4D0CA 1BMWA 2ED8A 4G6ML 4NERA 1U3HC 3T3PB 5ISZB 5I1DB 4X5XB 1SJEA 1ZDSA 5AUMA 5FYKH 1ODAA 3BP6B 1IQWH 2H32H 3S98A 3S3SA 2P8PA 4PMFA 1RD6A 2Z64C 4PJ9C 5CCKL 4M7ZB 3ULVF 1SJHB 2JKTM 2CKNA 2FJHB 3GXTA 4Y5YA 3CZFA 4G6KL 4JFTA 3VTAA 5IESH 1N6QL 5JPMC 1XIWC 3EDEA 1JRHH 2GC7C 3PAZA 3V2AR 4AEFA 4E41A 7PCYA 2YD7A 3NP4A 3PQYB 2EIKB 1VEPA 3GZOA 5F97E 3UL4A 1AO7D 1LO5B 1MLBA 2DLIA 4TQHA 1M7DB 5F71A 4PGJA 1HAUA 1K8DA 3ECUA 2WWKO 4O00A 4G3YL 5F7FA 2NY2C 5F7DB 3HC0B 4UTBH 3CH1B 2ILLA 4JRWA 1PNDA 4LSSH 4U1IB 1BVOA 3CIQA 4N2EA 4Z7UB 1TQBC 4FD0A 3T3PE 5ISZE 1QPXA 1AYOA 5B1BB 5FWQA 3K4DA 1AGDB 4M3HA 2C9SA 3LAFA 3KPMB 3IFLH 5I1HH 1YAIA 2EC8A 2ZNXA 1VAHA 3BQUA 3MX0A 4HIXH 5LQBL 2LT9A 2VUKA 4HGWA 3QQXA 2O61A 4MZ2A 4K3DL 4ODXA 4F58L 2ZWZA 4HGKC 1SF5A 5T1LB 1FL5B 2IADA 3SDCD 1LDPH 4BFBD 1GSMA 3O2WL 4MLIA 1UXSA 4MA8L 3L5WB 5INCA 3ZRSA 1SQMA 5F0MB 5C0BB 4NO3B 5KSAA 1SBSL 2WXGA 3LKNA 1GS7A 1NBVH 5AB9A 2M2DA 1DVYA 1ADQL 3U2IA 3IKCA 2IV9A 1V55B 1QHOA 4Z7UE 4OFIA 5FB8B 4OSUL 4NNYB 4ORGA 5IHUL 5KVGH 2LLLA 1J5OH 2EO1A 4TSBH 4M9PA 3SKUD 3WG7B 3LDBB 1HDMA 2OK0H 4DK3A 4JGJA 3PHAA 4B95C 1WG3A 2VDPB 2I60L 3A6BH 3ARGC 4LL1A 4Q9RH 3WIAA 3WKMH 1BEXA 1NA8A 3JT2A 4UTCA 5LN4A 3WMQA 5CJXA 3E80A 2I7SA 1UVQA 4JDZB 5I1EL 4MWFB 2QLVB 5F1NA 3V6BR 3NP3A 2ZD0A 5L4JA 2A9NH 2L04A 4GAFB 4S1SH 5DUPH 5C0BE 4AKQA 5IEKA 5LXGL 4WI9A 4AGOA 1BFOA 4O02L 4WO0A 2DF3A 3MGTA 4WV1B 2PTTA 3RWEB 1IC4H 4AK1A 4BD4A 5ETUA 1WAEA 1A21A 1IC1A 1ZSDB 5CSGA 1JGDB 4AXWA 4QTHA 1AR2A 4AZ8A 2QJDA 1T2QH 3O9WA 3RDTD 5ANMB 1BQHB 1QNIA 4D9RE 3MRGB 3UMNA 3PWPA 3MCKA 1UWEH 4JKPH 5DA4A 1CURA 4BRJA 3LN9A 1ZGLM 3IVKB 3EH4B 3NESA 4BZ2A 4WI0A 2OL3H 4Y4KD 2FYYB 2IDSA 2JJSC 3FOLA 4V2BA 1SMOA 4M1CD 2VZUA 5IJVB 3QULA 4ZW5A 1P4IH 4Y1AD 1SHWA 1T0NA 1FZMA 2VM9A 3UDWC 3WFCH 1MJ7H 5B7EA 3SKJH 2ZCLL 3SPIA 1OSYA 5L9DL 4CVZA 4OZIF 4P5TD 5TPWH 4W9ZA 4U7MA 2D9QB 3VH8A 3IDMA 1KACB 3DRTB 4Q0XH 2FNBA 1JD7A 3NZHL 3VFWA 1E90A 3G6JB 2I7OA 2NY1C 4RESB 1BQRA 4IMKC 2FWUA 1IBGH 2FB4H 4BKLA 3T2QA 5DD5L 2VT0A 5EU6E 4L4VD 2JKRM 3S37X 3HBZA 4WHYG 3AG4B 2YEQA 5CLTA 5AD0A 2VDMH 3L2MA 5IM7B 3KYKL 2PPFA 4XP9L 1CC3A 3N6YA 4OF0A 3AS0A 3OJDA 5D6CA 4YSDA 2F7RA 4YPGB 2YBGA 1QTSA 3CVIL 1YYLL 5I6LA 1I8LC 1G7IA 1QBBA 4M7KH 4N9OB 4TSCH 1CLYH 2V2WA 2DQFB 1HTYA 1LVEA 4LASH 4NNPL 2PO6A 3EO0A 2JKXA 1GGIL 4KK9C 5TH2A 3P02A 3S5ZA 2FH6A 5KG9B 3QORC 4K3EH 4EI5C 3DVGA 3P4LA 5D4QA 3HG3A 2ENYA 3P4NA 2NUTB 5F7MC 3D4YA 2GJ6D 3KDPB 3D18B 5C09D 3RUGF 5AQ0A 4DKTA 2ZPKL 2Q86B 3G6JE 5JOPE 1WZ1H 5E9NA 3VM7A 3K46A 4FTDA 5CR1A 2QKSA 2X40A 4JJ5B 5LKNA 5JOEA 2ZWLT 3B83A 4KQ4L 4X5WB 5H37A 2CMRL 4N86A 3CX2A 3BVUA 1YUKB 3C8DA 3L7EB 1AXTH 2WWMC 3VFGL 4NZDA 1MUJA 4G2AA 4GRMA 4PRPD 1PZ2A 4FQJH 5BOZG 3DHPA 1LD9A 2P80D 4ODSH 4HP5A 2QZ5A 1FNGB 3CQQA 1CDJA 1JV5B 3SGEI 5FX3A 5F1SA 3T4AB 4HJGA 1TKWB 2GIXA 4KI5F 3ARED 1H3XA 4ZNEE 1Q9LB 3VFSA 3LXBA 2Z7UA 3UAEA 2JV6A 2X2JA 3IK2A 4ZRGA 2HFEA 3MV8A 3MLYL 3HB3C 1SDDA 4JANB 1A6UH 1YNLH 5CBAB 2OMZA 4WGKA 4XBEL 3QBTB 2QPUA 3LKPB 2QHRL 4GSQA 3KPSD 4N68A 2DJMA 3GTTA 4E9YA 1WF5A 5IHWA 1AS8A 2OR9H 1KBKA 3TNNA 3VW3L 1NBYA 3MRLA 4P59L 1AZRA 2NMSA 3VGHA 2R51A 1A4KB 4AKOA 4YDLC 5IB2A 1KB5A 12E8H 2EDLA 5E5UB 4DQAA 1GGCL 5IKCB 3TA3A 3B3BA 5J3HC 5HPMB 4FL4C 4QHLB 4PRDA 2EDTA 4O58L 4EN2A 4FLOA 1HQRB 3NCYP 2YKKA 1ASOA 1N8ZA 2G2PA 3P3UA 4R26L 1NCNA 1W9XA 4QHNA 1MI5B 1YEKH 2BK8A 1HINL 4M6OL 1VSCA 1H3UA 3MRQB 2R2HB 3T2PA 4IRZA 3FSZA 2W60B 1QFUH 2VDQB 3O3BB 3QUZB 3ULVH 2AXFA 2WQ8A 4W4NA 2J72A 1NOLA 2DICA 4RA0C 5DJ8B 5FGRA 5ESQA 3TPUA 3ARGA 5B1JC 3IPFA 2EYRB 4Y9GA 4KZCA 3QQ9D 4N2AA 2VAJA 5IUSA 4XOEA 3QNXB 4RGND 1PPIA 1TEYA 2BMKB 2WQXA 3KVQA 2ZP9A 3LZRA 4RMSA 3DV6B 3V0HA 3HC2A 3ZHNA 4UOJA 4HMEA 2XBTA 4K0OA 4PJCB 3VFVA 4HWNA 5D1ZI 2X1XR 4OM1L 1XF1A 3J8F7 5DWPA 1PF3A 4BFKA 1FSKC 5J7CC 2NXZC 3HCVB 3O41A 3AQYA 1NMAH 2HLFD 1AY1L 1ORSA 3LYRA 1LK3L 2NR6C 1QKZL 4FQLL 4FMKA 3OLEA 1KXQA 4Y8DC 2E6QA 3FZUC 2H26B 2G2RA 1YJDH 3DBXB 5FHAH 4ZW6A 3SDYH 3V9EA 1VADA 3VG9C 5ID1A 3K80A 2W65A 5CP7A 5IJBC 1VACB 3X12A 4JQXA 2QVTA 4NO0D 3FO2B 4MA7L 1G94A 1QFWI 3QAZC 1S3KH 4FXKC 1NZRA 1ZHBA 3JUZA 4F91B 2X4NB 1JOIA 4UMSA 4P05A 1IVLA 3DVNB 1OK8A 5MERA 3UJTH 5I8CB 2BP0B 5FA4A 3OB8A 1V10A 4FFVC 5C0AD 5ITFA 4MMZB 3R4RA 4FG6D 4B41A 2N01B 4M03A 3TO4C 5EBWB 3OKEB 4LPYA 3MYZA 3JVGA 1RVFH 4JN2A 3A22A 1UWGH 4G9FD 2Y5QA 5C0EA 4NWTL 4PJCE 1JAEA 2A9MH 4A2HA 3VA2C 3VVWA 4ATTA 1Z9SB 3GRBA 5IFHL 1E65A 2DYSB 2X4SB 4F7EB 2DH3A 4NQVA 3NZ8A 3L9YA 4GEIA 2W0FA 2ICEC 4JQIL 3SE9L 3T65A 3V95A 3W2DL 4PY8J 2XXFA 2A5UA 2CBOA 5ILTL 3GJEB 3CFNA 1BM3L 3G9AB 4FERA 2ITEA 3L08A 1T6WA 4K8RL 1HKLL 2PP7A 3RL1B 4XXDB 5LBSH 3RPBA 2XVLA 4Y89A 1XGRB 1T04A 1DQLH 1TR7A 3BPCA 3BUQA 1JTTA 3FOMB 3EJCA 3D50A 4HIIB 4WTQA 3AY4C 3L3JA 4IHOA 3D34A 5MEPA 3DBSA 1G6VK 1INEH 1JJUA 1WFNA 2NLJA 3UBXI 1A9VA 4XHJC 2ZOLB 1HCFX 1F1DA 5AG9A 3OXSB 2WZ6A 5E5MB 4P04A 1TZHB 2IH8A 2W07A 5I1KL 2ZWNA 4NHCH 4FOMA 2N7SA 4PP2A 3OGCA 3L4VA 2WQSA 3OAWA 4P3CL 1KTCA 3AWGA 1FV1A 2QL1A 1QLFB 4QY8A 2CA4A 3LMJL 4ODBD 2HP4A 4F7MB 2AF2A 4YE4H 2OMNA 4CBZA 5EEVA 1W72L 4XMTA 5I15L 5FF6B 5C0JA 2TSAA 3T2NH 3U1SH 3EH5B 3H55A 5DZOA 1Q1PA 2XIBA 4IBTA 4MAUL 2Q6WA 1SPDA 1BD2A 1HT6A 3K1DA 3SYQA 3WELA 3V6OE 4HPOH 4J1UB 4K7PX 5GRVK 5E23A 1T1WB 4PWFA 3V5DA 4RZKA 1R3KA 2DI8A 5C97A 2H3XC 4PD4K 4K3JH 4H2AA 3PF2A 3VX1A 2ZOUA 3ZJAA 1D6VL 1QHPA 1B0WA 2FGWL 5KANI 1IGML 4ALAL 1MKFA 3TFBA 1CYXA 1F1AA 1T89C 5B38G 3R8BB 1NEZB 1W80A 1YDPB 2YD1A 3SEPA 2IPTH 4XP5H 1EHKB 3FQXB 4NUJA 5I73B 3NCBB 2VE6A 3S34L 4TQPA 5EEZA 5MENA 1Q72H 4EN3D 2P47B 5F6HJ 5F6IC 1QOKA 3VI4E 4X98B 3RAJH 1Z5LB 3RZWA 5J12C 4AWJC 1MFEL 1XSKA 1MCHA 1M57B 1F56A 1N0LA 2YD8A 4R4ND 4Z7VE 2D7TL 3F01A 3KWUA 3CHXA 3WFEL 4U1KB 5DUBA 1NUDA 1N59A 3D85D 3OPZL 1T2JA 1JK8A 3DETC 3UP6A 2CBQA 1XZ0B 3RGHA 3AG2B 1MCKA 3OX8A 5E9DB 1U6AL 1DVFB 5HI3C 3AAZB 4HWEL 3BGMA 4ZFOB 3QH3B 3KNBB 4G6MH 2QSQA 3C6EA 3GI8H 4HIEB 5CEXA 1C7TA 5DF0A 3L4WA 3WEMA 5A6MA 4X8GA 5CP3H 5IROC 4M93B 3N1QC 4MXQC 1TQCC 5KJRL 1XH3B 3BZFB 4BM7A 3T77A 2B4CC 3G5YA 1P4LB 1UD8A 1GW6A 5CCKH 1BECA 5JIDA 3TU6A 1VZIA 4O5LL 5FOBA 1WTGT 3CIAA 2F5BH 3EFOA 4G6KH 1YPZB 1N6QH 1OOAA 3QG6B 4EO5A 5KYWA 5H94A 5MEQA 4HF5L 4P2RB 2DEWX 2FX8H 1AVAA 3AXLB 3VWKB 3BUDA 5L8JB 4UOQA 1UZ8B 2X3CA 2OP4L 2PCFA 3IDXL 3S3PA 5B1JA 1X5LA 2CG9X 4D9LH 3GF8A 1XAUA 4IBLT 4G3YH 1DJHA 3Q8FA 5DVLA 4X6DB 3E6FA 1ES0A 5IBTL 5ACLA 2P7TB 3DOSA 5E9DE 3TC9A 2HUEA 4LLWA 2VLRD 4OZGB 4U1MB 1JIBA 4XP6H 3HI5L 5DMGC 5E6SB 3WNLA 3BP5B 4DP6X 4FQXB 1GZPB 2YPLD 4H8UA 2OMWB 5HDQL 1IKNC 2XPYA 3FUEA 2C26A 5HTSA 3MNZB 5DJDA 5BZZA 5LNGA 2DQIL 2CALA 3UBXG 3CG8A 4NZRL 3BGAA 5LQBH 2O72A 3QQ4A 1FDLL 1MFDL 3I2CL 5GZND 2NX5B 1NDGB 2CGYA 4K3DH 2QQLL 3ZDYE 5I1AA 1Q1JL 3VJ6B 1QLEL 4F58H 1ITCA 4P2RE 4Z6AT 1R9FA 3CDZA 5AL0A 4HJ0D 2CLVA 2HLAB 5AALA 1ZMYA 3O2WH 3HW7A 1NWPA 2G5RA 4MA8H 3LY6A 4NBYB 2H4EA 4C8XA 3UAJD 2HG0A 1SBSH 1EZSA 5E7FA 1XL6A 5BO0D 3QO0B 1ADQH 1U95A 2E6JA 3EO9L 4IK7A 4X6DE 3S96B 3M07A 3O3DA 2QPFA 4LIQL 4OZGE 1OIOA 4G8FA 4IRSB 2H32B 1SHMA 4LHUB 3MBEB 1MIML 3B56A 3L48A 1K8IA 3EFFA 4G80B 3T6QC 2HT3C 4OSUH 2BP3A 4GRWB 4N8VG 3HKZA 5TDOA 3CFEA 2X6BA 2RJMA 2GG1A 3QE5A 4MD0A 5IF0A 5KANG 1LJMA 3MNMA 4QMEA 3H6AA 1S7QB 5KS9B 4QO1A 1G6RL 1BVLA 5BZWB 2NX5E 2I60H 2EE9A 4I88A 2XY1A 1KZYA 3S5LG 1TDQA 2ZOKB 4JFSA 3IXTB 1T5XA 3HMXA 4Y5VA 1I9IL 5CEZD 1F4XL 3X11A 2ADFL 5I1EH 1L9PA 1JFQH 2XETA 3V5HA 5DRWB 3U2JA 2VB5A 2QVFB 3PWLA 4HK0B 4NUMA 2NXYB 1K4CB 4RMTA 4A7UA 4YDJB 3S4SB 2XG5A 4GSRA 4O02H 2OTUA 4QT5B 1FO0A 3D39A 4HSQA 4GKSB 1CBJA 3ZSTA 1RK0B 4N9GA 4QXUL 4HUVA 3EZ8A 3GUTA 3ZVVA 1J10A 4J3VA 4GRWE 1ASPA 2F08A 4WW2C 4QWWD 2UWEB 1L6XA 2QMJA 1QPPA 4F2MB 2J8UE 4XNMB 2NQDA 4JHUA 3W1ZA 1FFNB 2BSSB 2Q7YA 4KX7A 5CCGE 5KS9E 1XR9A 4Y19B 2NNFA 3ASWA 2BVQA 4MX7A 4PRHD 4JFDD 4PJXE 1E8ZA 3HS8A 5IMOB 4WWKB 2L7UA 3HAEB 4XB3A 1PZCA 3ZR6A 1KULA 1ORQB 3EO1B 4G9DB 4WNQA 4KO5A 2ZCLH 5EDSA 3UP1A 5L9DH 1T3FA 3HFMH 2QQNL 1KJ2A 3LS4L 4A6YH 3G6DL 4JO4H 1WIUA 1NDTA 4KJQD 4OQTL 2DMKA 3K0WA 3SDCC 3U36B 3FT4B 3MV8D 1LGVA 4F1SA 3STZB 3POHA 2UY6B 4TPRL 3OHXC 1T89A 1ZV5A 5I18L 4DPCX 1XF4B 4CNIB 2EACA 5DS2A 5DD5H 3WS6C 1L0YA 3S3JA 4XVTL 5KBNC 3KPPA 5FGBC 3ZDXF 4L8CA 3RY4A 2YJLA 3KYKH 1ETA1 2J4WL 3U6RA 1RULL 2VDKL 3MJ8B 4NAJA 1FG2A 2AFNA 2NY3B 1COBA 3V10A 2ITCB 4LESA 2NW3A 1WQVT 4BK5A 4FFYL 1HI6B 2Z31D 3VXUA 2XX1A 5DHXB 3CVIH 1YYLH 1J11A 3FU6A 2BC4A 4Z3JA 4N22A 3B2VL 2VLKA 2VCOA 1U91A 4YIQA 2DQGL 4NNPH 1VRSA 1GGIH 3VSQA 3BP7B 2B1HL 2BVPB 3C60D 1LO0L 5DZPA 3VRLE 4Y7MA 3ARXA 3OZ9L 3FK3A 1DVUA 3VXSA 2H3NB 3ARRA 1TTFA 2ADGB 2IXQA 3K5RA 2ZPKH 1ECYA 1MLCA 2E4TA 4GNKB 3DTUB 1KFAL 4ZZKA 5KVGE 1JPFB 1ZIAA 3FTZA 5I28A 3DI3B 4WI8A 4I77L 1ZV2A 2CMRH 4AYGA 2FT8A 2O1AA 4YZFF 1ASQA 2NTFB 1OEZW 5E4OA 3VFGH 4PGBA 5AB0A 1FPTL 1L7TL 3WUWB 4J6RL 1BWMA 2SEBB 3O2DA 5FM8A 2OM5A 4HJSA 4UT9L 4URKA 5IOPB 3CVHL 4P5MB 4RAUA 3TPKA 1UT9A 5DQ9B 3FCTB 3RDTC 3SYPA 2IMMA 3VTTA 2KERA 1OTUD 3ABKB 3GIZL 5DO2D 3VGEA 3F7VA 5DRZA 5B3JF 1I1AA 3F04A 3GHEH 3E2HB 3JWNG 3JZ7A 4PGDA 4PWIA 5FCUH 5ICZA 3NCXA 4U1NA 2DRUA 4Y4KC 2WO3B 3H9HB 2EDQA 2VYRE 2QEJA 4PJHA 4IOFC 3RB5A 1BG9A 3F7RA 4WFED 3L3HA 4KAQL 4M6ML 3N04A 1BF2A 5JHBA 1N4XL 4XBEH 5BS0B 1DCLA 2AKRB 2QHRH 3C5SA 3L4XA 4R0LC 5K93A 3ZO0A 4EPSA 4P5TC 3HG0A 3TVMA 3P4MA 4PJDA 4Z7IA 3VW3H 4JFED 3BWUC 4P59H 4BQBA 5KYYA 2HAZA 3RFZC 2DS4A 1O5PA 3KJ4B 4R4FL 5F7NC 4YEEA 3CGTA 2XTJD 2ZX5A 5CD5D 3NCJL 1EEZB 3OSVA 3WL9A 2AITA 1KELL 1GGCH 3U7YL 3QHZL 5D5MF 2BP5M 3WAJA 4PWEA 2PW1B 4X9FA 4JKNA 4O58H 3NJGA 3TZVC 4OFYA 4TNVK 2EC9T 4PVBA 2H1XA 2W9EL 4PJAB 1T2XA 4ELKB 4J23A 5T5FL 1DLHB 2EYSA 4R26H 5C0CB 3CPLA 4LOUD 4RNRB 4JUTA 5AB2A 4Q6KA 1OE2A 4LNRB 2FO4B 1KFGA 4OUOA 3VFRB 1HINH 2GJPA 5IQ9A 4M6OH 3FU0A 5AW5B 2EDMA 1OHQA 2WXFA 4LLMB 4YDIL 3U7WH 5BS0E 1NFKA 1DTUA 4D2NA 5IB3B 4L4TD 1VGKA 4WDIA 5TDPB 2JKJA 4IKNA 2EDRA 3DGCR 3UFIA 2I25N 4H26A 4HS3A 2EVFA 3GSOB 3FTSA 1EBAA 4AIZA 1WT5A 2RQ8A 3E9UA 4JDEA 1CLCA 2JKIS 3VXOB 3U9PL 2B3IA 4YSSA 4EI6B 4DIXA 3CX5J 1J1OH 3RHWK 3KDMA 1D9KA 5LGJB 1HS6A 3NIGB 4OM1H 3UTTD 5G5DA 5SX5H 4YDVB 5IWLC 3GLDA 3W9DA 1GOFA 2FZ3B 5C0CE 2L0DA 4R96A 1LK3H 2DV6A 4FQLH 4WUUB 3D69A 4PTTA 1BVKB 2F8VA 4LEBA 1NM9A 4Z3GA 4DZBB 3AREC 4M1GL 5AW7B 2ZXBA 4K15A 4MA7H 2EIZA 1UADC 2ZKXA 5KZCD 5E8OB 3OF6D 3I9IA 3A6OA 5BQ7A 3BO8B 1UWXH 2R23B 3U4BL 2V2XB 4JRXB 5TGBA 4DP0X 3KWXA 4OH2A 1U4EA 5F1IA 4WI3A 5EORL 2W94A 5DRNB 1AZBA 2YXMA 5JW4Q 4DVBB 4UDTA 1HHGA 4ABQA 3ARFA 5C0GB 3C9NA 1HFUA 3EOBA 4NWTH 5J1AA 1W6WA 2KH2B 2VZ1A 3NIGE 5IUCA 3OAZH 3IFPB 3OR6B 4TVPE 5IFHH 3MRBA 5GSRB 2ZICA 2D3VA 2QGCA 1A6VL 2LTQC 2YUWA 3SE9H 1EBPA 4JQIH 1N3NB 4HOZA 3W2DH 3ARDD 4R7DA 2CBTA 2HPOA 4IQHA 3HBQA 5T3XL 3VXTB 5ILTH 4RMVA 5IGXL 4WWNA 2YD3A 4K8RH 1D2PA 1HKLH 2PPAA 2C9VA 4XI5C 4O4YL 4FG4A 1XB8A 2YC1A 3U0TB 4Y2DB 5SWSA 1I7UB 1JZIA 3U25A 3B2MA 3GM8A 4E2OA 4EIGB 1UB5B 3QIWA 1TF4A 3BAWA 3EBIA 3HZMA 3QJSB 5FYKU 1DBJL 4UNVA 2Q0ZX 4X9GA 4QRBA 5I1KH 4A2LA 4KXBA 4AEIH 3ECWA 4JFXB 1JWSA 5T1JA 1O9WA 4E5XA 4HLEA 2Q9OA 3QQ9C 1ZK9A 4P3CH 3W56A 4KUCF 2V7NA 4PIRF 1E7VA 2DYPD 3JTTA 4U0RC 4DN4L 2BPBA 1GJWA 3LMJH 2BDNH 4K9EC 4XO4A 1KBVA 1W72H 5I15H 3N3EA 4GP8B 4JPWL 5BRZA 2JKWA 1SYSA 3ULVE 3ROLB 4Y4HB 4HCRA 5E7BA 2KT6A 3TH3T 4NRYA 3P2TA 3TBYB 1P5VB 3NN8B 1MHHA 4F8NA 1K5WA 3LQAL 4MAUH 2HLFC 1OO2A 4YUEL 1QBLH 4P4RB 3V6FB 1BQ5A 3ZBMA 2MPVA 3UTZB 1XCTA 4GOSA 5EFIB 1HU8A 4AGMA 2P3YA 3IGUA 1YEGL 2F1EA 1EFXD 3SPHA 3UX9B 1ZK5A 2LVCA 2TAAA 3MRPB 1NIFA 4FTVA 3ULUD 3M1BA 1D6VH 4C4BA 5ESAA 1OL0A 2FGWH 1IGMH 4ALAH 4AUYA 3F2LA 3HG4A 3RU8L 2KHAA 2EDKA 2CHZA 3HZYA 4HJ1A 4LRIC 4ZFFB 3SJVA 5AYQA 2WIIB 2JWYA 3KHQA 4FG6C 5F6HI 3S34H 3UADA 1RP8A 3FHEA 3HHRB 1I3RB 4FNQA 3KS0H 4I3RH 3BUYA 1WHPA 1OP9A 1J5HA 1MFEH 5E8NA 1RLWA 2TRHA 4M8UA 3ULSA 4HW6A 2D7TH 5F88B 3U30B 4IOSA 3WFEH 3RFZA 3R7RA 4I0PB 1F8TL 1HCVA 3T08A 5JZ7D 3BWZA 1ZHKA 3C2AL 4PVNA 5DR5L 5KYUA 3SKOB 4QRPA 3EBGA 4NO5B 1U6AH 3BHBA 2PP9A 4HWEH 1T1XB 1F13A 2J5LB 4W6XB 3KXFE 1L5GB 4MB3A 3OHMB 3TZVA 1IFRA 1XFPA 4JDTL 1KTDA 5EZIL 3T8XA 5FEBA 5KJRH 3B2PA 4I2XA 5AKRA 1NCOA 2VLJD 1MEXL 3OMNB 3AS3A 4P0DA 3B2UD 3D0VB 2Y06L 2B4CL 4O5LH 4W9IC 5H37H 3TJPA 2UYLB 4IKIA 1EJ6A 4HF5H 3K6IA 2BIHA 3IMBA 4PG2C 2OMUB 2PTUA 2WNXA 3DX1A 4KRMB 4N0UE 3TBVB 1N10A 4LLUA 2Q8BH 1FL3A 2OP4H 3IDXH 3IGAB 2B9AA 4KRPB 2EE6A 4OGXH 2NSMA 4UQ2B 3WXVL 3ZGHA 4ZFGL 5IW1A 4FQHA 1PY0A 4M8QB 5IBTH 3QR1A 2OJ1A 4F1ZA 4MDRA 2D4FA 4PTUA 2CIKA 3ZTJH 1UD2A 3HI6H 3D39D 2H2PD 3HI5H 1DN0B 3WNKA 4KDWA 2APFA 4BHUA 2ROYA 3K91A 5HDQH 4PJ7A 3IWUA 4K5LA 4ZXBB 2ATPB 3QDMA 5IWLA 3MC0A 2DQIH 2V9TA 3W0WD 4S1QL 3DX8A 4ILDA 4NZRH 3LJ3A 2AV1A 2F19L 3ROOA 1I8IB 4LCWA 1W6LA 2WKOF 1MFDH 1EVTC 3BE1L 3O6ML 4G1MB 4PCYA 5EN3A 2A38A 4LEXH 1BPVA 1Q1JH 2FEDC 1QLEH 1MHEA 2CLZA 2X9WA 1KYDA 4RIRB 3UROR 3BUBA 4EOWL 4PSRA 5IVOA 4WHTA 2YEZB 1QI3A 2QADD 1KB5H 4HWBA 3GMLA 5JQ6L 3RNQA 4EN3C 1AZZC 3I74A 4YHML 4KH2A 5D1XA 2DY2A 4OUUA 3ZMNA 1T0PB 4UUJB 1X5KA 1K4DB 3EO9H 3SQBA 5HYQA 1QAWA 4R4NC 3VGAB 4LIQH 2R0WL 3BZDA 5EEYA 4OZIE 1MIMH 3CU1A 5CIPH 1FH5L 1S7RB 2VKWA 3DSFL 5D9SB 4ZMTA 3RUGB 3SY0B 2Z4QA 5HYSG 3KLDA 4FEIA 4WVRA 1UEYA 4M4RA 4P2OD 3B9KB 4HZLB 3AU1B 5C3IA 1G6RH 3NQIA 1I9EA 3MRCA 3NG5A 3WO4C 5A6LA 4AIEA 3N2JA 4BFIA 1UQSB 4C4KO 3D2UA 1RHHA 4G1EB 2CR6A 1I9IH 2ADIB 2DEXX 1F4XH 1SEBB 4H1LH 2ADFH 3DGGA 5A2IH 5AKSA 2FD6L 4C55A 2CCVA 1NEUA 1IM9D 4LOVA 4NKDB 1HXKA 2WK2A 1JDCA 4DQOL 1EZVY 2MHAA 2C1OB 4JZJC 3H3PL 1L3WA 3MKKA 1IUZA 1JZ4A 3EDKA 5EF3A 3AUWB 3GSXB 3BN9D 1QUNA 2BOCA 4HUXB 3UGEA 3OQ3B 5A2BA 4WO4A 4QXUH 2ZUQC 1SM3H 3DWTA 4J3UA 4W9FC 2WXRA 3RUGE 4AUJA 4AQAA 1TZAA 4ZUTB 4POYA 2JQZA 3LN5A 1MCFA 1CMOA 1HVXA 2UZXB 3CN2A 4JPKL 2X7LB 3ZE2F 2JKSA 3Q7JA 3X1NA 3Q1EA 2KZWA 5AW6B 5IMLB 1BVNP 5IMKA 1CL7I 3QXUA 3UTQB 1Y0LA 2E46A 2IBBA 1Z9LA 4W9GC 1YC8A 4HZAA 1CFSA 5GZNC 4H7VA 4H5SA 3GBML 3BAYA 1DBAL 5C07B 3GNML 1L6ZA 3QIUC 3G6DH 4L3EA 5B8CC 2VC2B 4HEME 4OQTH 1OGAE 4HJ0C 1A6AB 4OI9A 4GLRI 1IEAA 4XAKE 4KI5E 4YHIB 1NC2B 5DYFA 3U9UB 4TPRH 4UM9A 5E6UB 3SE4A 1X7QA 5I18H 2C1PA 2M8XA 1TMQA 3EYFA 2FJGA 1Z9NA 4X4ZA 3UAJC 3ZQ9A 3D25A 4AQOA 4P4KA 4XVTH 4TNFA 3AU0A 1FYHB 4EZJA 5K5YA 1HZKA 4FP8L 5FCSH 3TN0D 3KYOA 3QEUB 1RULH 2VDKH 3OG6B 3ZO9A 1WBZB 3CSFA 4TLTA 1C8PA 1PKQA 1NGQH 4FFYH 3RTQB 4AYFA 1PU0A 5E4EC 3UBHA 5C86A 2IAMB 4BQCA 3DYMA 3H3BC 1FZJB 2APBA 3O4LA 4K5MA 5TTRA 2CR3A 3B2VH 4UT6L 3SE8H 3AC0A 1E4KC 3SPJA 5FDWB 2CKBB 3G08B 2LW3A 3CVCA 1RV6X 2R4RL 4M9OA 5T5NG 5EF1A 2B1HH 4DVRL 3FRPG 1S7UA 3KR3H 4AQZA 3CZUB 5DK0B 4MZ3A 3UC2A 3GJFB 1KFAH 4FC3E 1B6DA 3IDYC 4NQCB 4I77H 5ERWA 2HFGL 1BJ1J 3BGFB 1HEJC 4W4OC 5I8EA 3CZLA 3FAXA 3FCBA 1FPTH 2R7EA 1A7NL 3EXLA 4WTWA 1F02I 4UT9H 1A7RL 1HJBC 3CVHH 3HOGA 1ITBB 1G43A 5EU5B 3SBRA 1Q94A 3MRNB 3F6LA 4IU2B 2XDHA 5FA3A 3EYOA 3GIZH 2EH7L 4PJHF 3EYQD 3WE6B 4EDWL 2HYMA 2XWXA 2XTSA 3ISWA 4A6YB 4ORZC 1ZEAL 5J4MA 2WZ0A 1UASA 1DBBL 1KBPA 6PCYA 3PG2A 3QUKA 5HGDB 2YHGA 1UD4A 3HG5A 5GIRB 4KAQH 4QOKB 2VO5A 5ENWB 5C0DB 2CRYA 1N4XH 1RIVH 2J3SA 1TO5A 1MRCL 4NQCE 3DMMA 2FX7L 3MRIA 1FZOA 2UY7A 4KJQC 4BCYA 4UANA 2AZUA 2A4ZA 5DEGA 4XWOD 1KT2B 4R4FH 1JPST 4V1DB 4DJMA 4MJHA 4X9BA 1WD8A 3NCJH 5CWSA 1AGBA 2EVIA 3AFLA 1KELH 4KU1A 3WTYA 3QDGB 3KLQA 4JO5A 1FFQA 1FC1A 2WLNA 4TSAL 3U7YH 3U4AA 3QHZH 5I2IA 1D5RA 4LLYB 4LSUL 1L9RA 3PL6A 5T1MA 4HG4K 1U8PB 2W9EH 2DQMA 2WXLA 1QRNA 2Z31C 1FBIH 2OSXA 1KYFA 5T5FH 1A5FL 2V7HA 2EUWA 3U0PB 5EIIA 2GITB 1X4XA 4GO6B 1EXGA 3LRKA 1RUPL 1REIA 2OW6A 2C3VA 4ODTL 4QOKE 5DHVH 4OGYL 1IAMA 3QARA 3H3KA 2ZP0T 4YDIH 4TUJB 1DUZB 1VB9A 5GGQL 2V8LA 2IQAA 3C60C 5D7JD 1NGXB 4PCKA 1AFVL 1PY9A 5DJYA 5HGHB 1CLOL 3STLB 2ENSA 2BY3A 4MMXB 5CD3A 1WAAA 2PWDA 4PLNC 5LVEA 2EIJB 3P9MA 4L8BA 3D3VA 4V1DE 4Z0XA 2I07B 4X7TB 5SWSD 2FYVA 2WINB 5L7XL 3DECA 2AXJA 3U9PH 3QDGE 1OGSA 2DQUL 5T1KD 3B7RL 3QIWD 4PHZA 4X6CF 3ZTNL 5KSBA 3D09A 3WS3A 3FSOA 3DI2B 4JZJA 4ADIA 4BSWA 2JB6B 4HLZG 4CJ1A 5IW6B 1Z66A 2HXAA 4QKXB 1WWBX 3O3EB 1CDHA 2WBJA 4LLQB 5C0IA 3QJVB 1ZVHA 5I71C 1NANH 2RFXA 5DO2C 5DD0L 3K6SA 4XZ4A 3ES6B 4WW2F 1LILA 5I17B 5DJXA 4M1GH 5SWZA 1MCBA 2Z92B 4YLBA 1A6TB 2JK5A 5ELIA 4QRUB 4N90E 4HFWA 3NTCL 1SHXA 5CF3A 1H8NA 5JXED 3RP1A 3GI9L 4JMXA 3FULA 3UJJL 3U4BH 4NXKA 3L81A 1BYOA 2EXTA 2KLSA 5EORH 4JFYB 3BUPA 1I3VA 2FBRA 2N7BA 3CBKB 2K3HA 1CJYA 3KL5A 1Q0XH 2DQ6A 1MSPA 2AV7A 4HX1A 5C0NC 5ECGA 2ZXEB 2CUMA 4CW1A 5AUMB 1OW0C 2WXJA 3KYAA 2D3LA 1OSPH 1G7QA 1BZDA 4KKCC 4RBPH 2EVJA 5E00B 5IV2A 3QIUA 4F3FA 5E2TL 5CD5C 2D2OA 2VAAA 2P8PB 3E38A 2QPDB 4YXKL 2W95A 3FUJA 2CE6A 1A6VH 3SJVD 3CZFB 1KIQA 5T3XH 2XT1B 4N6RA 3BRGC 1M1XB 3QXVA 1YMMA 3ETSA 3AACA 3DROA 2KYIA 4RFEA 2J8OA 4R9HA 4Y1TA 5G4OA 4XNQA 2JI2A 4O2CA 4O4YH 1HIML 4IOSD 5KYXA 3MNWA 3MV7D 1CZ8L 1GXEA 3BKYL 2V3DA 1SJVA 3S3BB 1K8DB 5IB5A 5CCJA 5IFJA 1QQDB 3P30L 2NY6D 5EU4A 1ZLWK 3ZKQD 4HH9A 1YLBB 2FGZA 2IANA 3CLFL 4TM9A 4F7CB 2EUVA 3QI9B 4JFPA 1QFWM 1R3JB 1EJOL 4D7BA 1DBJH 4TKWA 3OG4B 3H0TB 3T0DA 1YZZA 3ARSA 1QABA 2AANA 2AAAA 2FJUB 3Q2WA 3KGRA 2GBVA 3BQUB 3MX0B 4DN4H 5C2BL 2AABL 1DFXA 3MRDB 4HGWB 2HJFA 4NWUL 4QTFA 4D0BA 1N19A 1T6BX 2O61B 1X5FA 4K9EL 4JPWH 4ODXB 2VISA 3I6LD 1OARL 4U6XB 1CFMA 3TLRA 2IADB 3LQAH 3SO3B 1BZEA 2OMYB 3T0ED 3TH2T 1EXHA 1UM4L 4ANUA 5JXAL 1UXSB 4IEFA 3GPEA 5KSAB 4B9IA 1AZVA 1LXMA 3MACL 2CU9A 1O7DE 4J3BA 4OFQA 2ZKYA 3IMSA 1KJ2H 2ZXCA 4QXVA 1G1CA 3HNSL 3IKCB 4GAAA 5HVHB 1DZ0A 3RU8H 2RALA 4L1HA 5B22A 4BH7B 1GYVA 2PTVA 3RI5K 4UIKL 4ORGB 1A3RL 3QDMD 2D8KA 4YAQA 1UH4A 3WCYA 1U58A 4YFLF 3RX8A 3PY9A 3NJJA 3P9LA 3OV6A 3KYNA 3BWUF 2VIRA 1XV8A 3BI9X 2BHZA 4QIRA 3BZ4B 2FT7A 2ZUWA 1W2KT 43CAA 3P4OA 1JZJA 4K9JA 3V4PL 1IFGA 3LPPA 3S0PA 4EKXA 2BWDA 2ZUXA 4W9JC 1F8TH 1ROCA 4M8VA 1NCIA 2R2EA 2XZQL 3C2AH 3CSTA 3PDGA 3ARDC 4ZTOL 1BFOB 1BX2B 4A2FA 4WWID 1TTUA 1FNEA 4KVCL 2BSTA 3SDDC 4GP5B 3ZKXB 4JM0A 3LD8B 1GGTA 4N2DA 4HWUA 4OF7A 5ETUB 1WRFA 5TFSL 4AXWB 3AW5A 5EZIH 4QTHB 2DJSA 4AZ8B 5HGAA 3VXME 5CZXD 3O9WB 3IGFA 1KY6A 4WK2B 1JCVA 2CDFA 4MD5B 3PWPB 3CSPA 3MCKB 1MEXH 5KAQG 2Y06H 2B4CH 3KBFA 1S5IL 1HOCA 2GSGA 1JG9A 3Q13A 3Q6FA 4H8VA 3FN0L 4MMYA 4WI0B 4XXCC 4N8UA 5GGTL 4MJ2A 1EDQA 4Q56A 5D1QD 1LE9A 3NCMA 2BX5A 3MTRA 3FOLB 4WK4B 1BPLB 3I6GA 3QULB 3BFWA 2DL2A 2EILB 5TE7L 1ZRUA 1KENL 1WPCA 3K8KA 3X14A 3WTTA 4OBSA 3J07A 4BSVB 2D7PA 1T0NB 1C5BL 5DTFA 4WHYH 4AL8C 4ZFGH 1M7UA 3WXVH 4YJZL 4F8PA 2R69L 3JTBA 3ZGIA 4DZ8B 4JY6B 1JK9A 1AI1H 1S7TA 2HKFL 4NKMB 1T66D 2ROXA 3PYCA 5EUOF 3T5WA 1EERB 2PYEB 3VH8B 4PJ7F 1MXGA 2VUOA 4OF5A 4GH7B 1L0XA 3MRFB 4FAAB 1LP9A 2Y2WA 3O4OC 4BKLB 3MV9E 4WO4D 5DCCA 4F5CA 2QPEB 4LK4A 4S1QH 2PXYD 3WTWA 3FXIC 2HG5B 1O6SA 5LG1A 5AD0B 3K72B 3ULUC 1DSWA 3BE1H 4XPGL 4WFHD 3O6MH 3RBSA 1PZ5B 2VJ8A 1USQA 1IAOA 1TPXC 2WO2B 4Y4FD 1AGEA 5ICXB 3TT3L 1P7QD 3OJDB 1HOEA 5D6CB 1I1FA 4NIKB 4EOWH 2R4SL 2E9GA 4B9PA 1G7IB 2AJ3B 4GRLA 3EJQA 2H5UA 5JQ6H 3PGDB 1CG9A 4E0RB 2PO6B 3EO0B 3LNDA 4YHMH 4Z0BL 2C8NA 4BHUI 4M7LT 4ZO8A 3SDXF 2JI1A 2PYEE 3VSUA 3IJ7A 4N0FB 3LKOB 1NTDA 3WD5L 3PNWB 3P4NB 5L2KB 4Z7QF 4IKKA 1U3HB 2R0WH 1DBKL 5DC4B 5IQNA 3NGBB 3RWHA 5A7BA 5HJGA 3L4TA 1FH5H 3DSFH 4I3GA 2OXHA 4P2QD 5EU7E 5JZ7C 3L3GA 3MRHA 5E2VL 2CM6A 2FR4B 2W38A 2VLLB 1XCXA 2YAHA 3UH8A 4JO2L 3JVFC 3RJOA 5JQHC 2XZAL 1CTNA 1ESOA 4GRMB 2VDOH 5JPMB 1XIWB 2OZ4A 3OKKA 3ZDXE 2YN5A 5DMIL 3L7FA 4JHZA 4MD4A 4NZ8A 1QBML 4NPYA 1H3TA 1URIA 4ZMZA 2FD6H 3B2UC 3C09C 5HD8D 4HJGB 1EH9A 1M1SA 4N2MA 3V7AG 4X7EC 4DQOH 2IALA 3VFSB 2ZSVA 1J1PL 3H3PH 3F7PC 2IDFA 3I3BA 2HFEB 3KPLA 1T4WA 3EG9A 3L13A 3F7YA 5L2KE 1SDDB 3PABA 5A1AA 1GVIA 1M2VA 1LO4H 3NCCB 1TQBB 1HHJA 2OMZB 1F3DJ 2E75C 2BNQE 5JIHA 5D7HA 3TEYA 2FATL 3FBQA 2DQHH 3FUMA 2HKHH 2WVVA 2OTPA 3QWRA 1OLLA 2X9YA 1PCSA 1NBYB 3MRLB 1N8OE 4JPKH 4OT1H 2WXIA 4XNZC 5AOMA 2JB5L 4XX5A 1DVZA 3TURA 3IYLW 1G7PA 5IB2B 1KB5B 1GRWA 4IJ3B 5H35B 5F3HA 3ATFA 3QDJA 4KITB 4JNXA 1IEBA 4CU6A 4NSKB 5GRYA 1DL7L 3VDCA 4PRDB 5LG6A 1IBDA 4KTYA 1BOGB 3GBMH 3GJFK 4UAOC 3GNMH 5JLZB 2AEQL 1J0JA 1TENA 1X44A 3PWJA 3NFNA 2NQ3A 5B3JE 2JIXD 1VFMA 4FF9A 1ETJA 2WSKA 4QHNB 1IZJA 4FLSA 2QADC 4XN9A 1R17A 2R0ZL 2BVUA 2KZBA 3PP4L 4XNYL 2GTZA 1VF5C 2KLTA 3FO1B 3C8KB 1VKXB 5K33A 2FBOJ 3TX4A 3UACA 1Y1UA 4FP8H 4TUUA 3ZK0A 4ZPVA 1UYWL 4KXAA 3ETTA 4X6FA 5ESQB 3TPUB 1XCQA 3ARGB 1NIDA 3WU1A 4H1LB 1BCIA 3IDIA 2BHYA 1G0YR 3DJRA 2XWTB 4UT6H 4P2OC 3TJEL 5F3BA 1LMKA 3WHE1 4TUOA 2XIIA 5E51A 4EVNA 2N4IA 4XTRD 2P44B 4OJEH 3QRLA 4H0GA 4Z3EA 4DVRH 4J4PA 4MXVF 5D5ME 4ZODA 3SDDA 2BW5A 4R2GB 1QRND 3I50L 3O41B 3S36L 3GYRA 1ORSB 1HJCA 1E4XL 3OAYK 2P4AB 2I9LA 3GSVA 1X4ZA 2G2RB 3TYGL 3BLKA 5CEZL 1EHXA 3TIEA 1VADB 1C5DA 1F42A 1E7UA 2W65B 5CP7B 4N26A 3TV3L 3VYOA 2O26U 1XGYH 4CVXB 3W5NA 3SYCA 3X13A 3HR6A 4DF9A 2CCLA 1CGUA 4JY5H 3TEZA 1ZHBB 3C5XA 3BN9C 1QLRA 4ZPTA 1DE4B 4GAYA 1KCVL 4GPVA 3AJ7A 1A7NH 2X70B 1YEWA 3PAVA 1A0QL 1A7RH 2QQKL 4BUHA 3G5XA 2IGFL 3WNOA 1X3DA 4NFBA 4HKXB 3RGBA 2BVTA 2EH7H 4J12A 1FNSL 4JFFE 4EDWH 4JN2B 2VSDA 2JJVA 2XWJB 1USZA 5C0EB 4F24A 1YSOA 3LEYL 3GDBA 3A3YB 3T3MF 1DBBH 3FSWA 5EO9A 4CKQA 1GA2A 1YQVL 4ZJ9A 5JHDD 1EHLL 1SVCP 2QVKA 1Z2KA 3QIBA 1BSIA 1HNYA 3VQ1C 2NY1B 5CBEA 5GRZA 4X5XA 2HJKA 3NZ8B 2WBJD 2W0FB 1KXQE 3T65B 4XMUA 4K73A 4N8CH 3BP6A 5GGVH 2VDKB 3FTYA 2FX7H 2E7LC 1WCBB 4NQSB 4XN7A 4B9ZA 5JNYA 1T04B 3MR9A 4LMQE 4UYPA 1YO4A 3H53A 3L3JB 4IHOB 2HTKD 3MBXL 5MEPB 4NO2A 1A8JH 4NN5C 4TSAH 1Q9WB 5DC2A 2YA2A 1EK3A 1PFCA 1INQA 1VESA 1W16A 3TN0C 1U3NA 4LSUH 2PPDA 4J28A 5F2FA 2K6YA 2V3FA 2Y72A 1M7DA 2W07B 1RZ8B 3QORB 5FW6A 1A5FH 3FCSA 1YYML 3VWJD 1V3JA 1Y6KR 3DX7A 4QY8B 1R24B 1RUPH 3CH1A 4BWUA 3UBFA 4ODTH 4OGAD 1KPRB 3HNTL 4OGYH 1FZKA 1I85C 5F21B 3EDJA 1QVOB 4F15C 5GGQH 3QCVL 4H0HB 2YPVL 3KPMA 1CLOH 15C8L 1MCIA 2DJUA 1BD2B 2GBTA 2YAOA 5CJQL 5FUCC 3VD2A 4NN6C 3DXAE 5GRWA 1R3KB 4PJ8C 5L7XH 1YEIH 4YDZA 1KWKA 2FT6A 3DLQR 3FRUB 5FHBL 2D3JA 3BSZL 3ZTNH 1A1OA 4LCUB 3WYRA 2JXMA 5DVOA 5IHZA 3P3SA 3VG0L 3VFNA 1CDYA 1F41A 4NO3A 2KC0A 3QDHA 4Q9QL 4ZD3L 4ZMWA 4NUJB 4ZO7A 3WHXA 2VE6B 4KZEH 3I9PA 5BUPA 5DD0H 3BAXA 5MENB 3BPNB 3EYQC 5AB1A 4NNYA 4MS6A 5F7LB 3EJYD 4PJ6A 4OY9A 2GB2A 3GKZA 2ICWA 3NTCH 2XFGB 3B43A 3GRWA 3TM6A 3GI9H 4J8RA 4PJ5A 5DUBB 3UJJH 1N59B 2OJEA 1XHHA 3O6LL 1EANA 3GD1C 1EAPB 2Y22A 4W9DC 3VMOA 5LGHL 3ZL2A 4DEUA 3OX8B 5BJTB 4CVWA 4OZFG 2X2UA 1YQ2A 3BGMB 3TWYA 2AEOA 3KWWA 5CEXB 4MWFA 3FS9A 4XWOC 1W0VB 2EIBA 3CJJA 4XMWA 2LHAA 5IOKA 4YSUA 5E2TH 5EA0L 3TIDA 4IJTA 3HVDA 3VI3F 1J0YA 3T77B 2QSVA 3H9YA 3W39B 5EEUA 4ZUWA 1R19A 2I9TA 4PY7B 1TNNA 3RWEA 3N0AA 2D2CC 3WNIA 5MENE 5FUZL 4X7SL 1JGDA 5ABAA 1PX4A 5KYWB 5MEQB 5EU6A 1XGTB 3TA4D 2ICWJ 4BFOA 3L3OC 1MPAL 3MRGA 4LVOB 5EO0A 2LAAA 3W37A 2GI7A 2PCFB 1E2ZA 1CZ8H 1MHPL 3BKYH 4AKPA 2DM3A 2FYYA 5E1GA 2XQYA 3LH8A 2E7BA 5IJVA 3CHPA 3MHZA 3E6FB 1ES0B 5D7JC 3DOSB 2GY7B 4LLWB 3CLFH 3ECQA 3ZDWA 4KFMA 1VIWA 4X6EA 3AWFA 3NCYS 4L1TA 1EJOH 4MJ5A 1NJ9A 3B7UX 3ISRA 2WQRA 1MJ8L 5DJDB 1NH6A 1FSKB 1X6LA 4FCHA 2NXZB 3A4EA 2XQBL 2V5MA 4MAYA 3CXDH 5C2BH 2AABH 2C3WA 3QQ4B 4HOMA 4P9ML 1GYAA 5I9QB 5I1AB 5DZLA 5D93C 3S6CA 4K9EH 2A73A 1PD1A 1XMEB 1W8NA 1HL9A 3BH9B 3C6LD 5CJ8A 5EOCL 3HBGA 2N59A 1AE6L 1OARH 4FFWD 4LE8A 4QRRB 3CDZB 1HE7A 3VXPB 4JZOA 3V52L 4XNAA 5FFLA 2BH0A 3NT0A 4X8JB 1ZWIA 1A02N 5KBPA 1UM4H 5JXAH 3LZOA 3IEAA 1Y18B 3BPLB 4ELMA 3JWOC 2K1MA 1A1NB 4LL4A 1ETB1 2KUTA 3L3KA 3MACH 3WNJA 2Q76B 1URZA 4NUGL 1RMFL 4WJ5B 1D3CA 2BHFA 3ARWA 2IO5A 3B37A 1S7SA 2B15A 3TO4B 3O11A 5IB4B 3MNVA 3O3DB 3HNSH 5JXEC 3B9EA 4G8FB 1SXCA 3F7KA 4KROD 4PH8A 1K8IB 4ZNEA 2VDRL 5BUAA 2X41A 3L2NA 3UEQA 1A3RH 2A1WL 3GSQA 2K8QA 4MBOA 4WHDA 5TDOB 3CFEB 4IBVA 3UPRA 4MD0B 5IF0B 3TCTA 1O7VA 1ZTXH 5EIIG 5EC2A 5FW8A 4DAGH 1M9SA 1QSEB 2Q86A 3SPGA 3UPCA 4B53A 3HR5B 4OFPA 1CLZH 2NNAB 4GG6A 3EH1A 1MCOL 4QRRE 3V4PH 3UTSB 3L7EA 1JF1B 4HXBL 3PIQB 2H2SD 3QCUL 3V5HB 5FOJA 3PWLB 3KMDA 2XZQH 4ZTOH 1AHKA 3SBQA 2OTUB 3KPQA 1FNGA 4PB9L 4ES9A 4M48L 1H3GA 3A67L 1JV5A 5FGSA 3SD2A 3DIVA 1MZYA 2ZCZA 2ZKHL 4ZSOB 3VXRD 1TKWA 4G70B 5TFSH 3GUTB 4JKKA 4ENEC 1EUTA 4EXPX 3AWEA 4LDEB 4POZD 1GCFA 2NY6C 1H3WM 1U4FA 4R84A 4U1SB 4DOHB 1C9SA 1XXFC 4QRSA 2IV8A 4OGZA 1S5IH 5KOVC 2PW2B 3FN0H 5T3XE 1QSEE 4IGBA 4ONGH 5GGTH 4ELDA 5ECJE 3HE7D 4XMKL 3LKPA 1ILSA 4ZT1A 1B0IA 4MX7B 3ZE2B 4B5ZA 5TE7H 1KENH 4BFFA 3UTSE 3LEVL 3MRJA 2W80C 5HXMA 2R69H 3LIZL 4KC3B 5EDXA 3WFDL 5J6GA 1T3FB 4PJ8A 4QHUA 4LGRB 2HKFH 4AL8L 1KJ2B 1LP9F 3IAQA 4NQQA 1XSIA 5IKCA 5FKAA 4Y16D 3QEQD 1RH8A 3CBJB 5SWQA 5D96B 4QHLA 4A7TA 3T0EC 1FHNA 4WAFA 2YR3A 4ZSOE 4UU9A 4S0TD 4OZ4B 2G5BB 3EYUL 1KTJA 1F4YH 3QUML 4FMFA 1KXVA 2DWDA 4L8CB 1UOVA 3WN5A 4XVSL 1N5AA 4OZHF 4OD1L 4XPGH 4DOHE 3TT3H 1FVDB 4RWYL 5F6IB 4WK0B 2NW3B 3ULUL 3MRQA 4HETA 3VXUB 2R2HA 4C56D 1GYUA 2R4SH 3WDHA 1KZQA 3V55A 3HRZC 3ZE2E 3O3BA 2BC4B 2DIJA 2IDCA 5JIMA 1U91B 4YIQB 1OP4A 1R75A 5DJ8A 3VXNA 3KD4A 1IGYA 5D70L 2EDHA 1I7ZA 4TL4A 3DO3A 5HGBB 2F54D 3VXSB 5E99L 1XR8A 3KBHE 3AM8A 4XXWA 3DV6A 5CSBA 4PJGA 1X9QA 3RX7A 1G4MA 1PZSA 3IDNA 4JREC 2YXWA 2JKLA 1SOKA 3EYSL 1TQCB 4JKMA 5E2VH 5E94A 2YGOA 1KB9J 1L3NA 2CJUL 4DETA 2JJTA 1IGCL 3I3DA 1D5MB 3HCVA 2FUQA 4JO2H 4PGBB 2XZAH 3TESA 4J27A 1AANA 4FQQA 3DBXA 3U83A 1RZKC 1VACA 5DMIH 5LDSA 3VXUE 1CICD 5CZXC 3WENA 2B1AL 1EV2E 1QBMH 3DJ9A 4TNWK 1NCBL 3NBNA 4GSUA 5KUMA 2TSBA 5EF2A 3QHFH 1I1AB 1UXLA 4PW9A 5ICZB 3DVNA 4PGDB 2IBGA 1D7FA 1JXGA 5D1QC 1G7MB 4U1NB 1J1PH 3BAIA 3PJSB 3P69A 4PJHB 4CVZB 4Z7NF 3JTSA 1J9SA 3CC5B 1AQMA 2IH3A 2F1BA 4KDTA 4FDWA 3FQNA 1DVXA 2F8OA 3AB0C 4NQED 1BZQK 3EBHA 1T66C 5GJSL 3FSVA 3P4MB 4A7SA 4L05A 3PREA 5I16B 2ICCA 3F65A 5KYYB 4ZO9A 3A6CL 4F7EA 5AVWB 1TU2A 3MLTA 3S2AA 1E28A 2JB5H 4JZNA 1WV7T 4NQDA 2DBLL 3UYRL 7PAZA 1KYUA 3D52A 3WL9B 2OULB 3GJEA 3MLUL 2PXYC 3DHUA 4XOBA 3RL1A 1EEQA 1DL7H 3NSFA 3WKQA 2Z8VC 2VXVL 1XGRA 2XKUA 3V6OA 5FK9B 1QSFD 1GKOA 4Y4FC 5B4MD 4KMQA 4HEPA 3B1UA 3D48R 2K7QA 3FU5A 2XVKA 5GGRA 2AEQH 5DVMA 4OGQC 4DN3L 1P0SE 1MELA 3E0GA 4PJHE 2DYRB 2EYSB 3VFMA 1J88A 4KZ0A 4Q6IC 1XAKA 1OCCB 3QIBD 4MNQA 4RRPA 3BPOC 5AW2B 3VCLB 4B96A 5ISZD 3WEOA 1A8ZA 3ILQD 3PP4H 3N5AA 5F8QC 3WLWC 3ZTEA 3KL3A 4HA1A 3AT0A 3MLZL 2BNRA 4H8WL 2VDOB 1VGKB 4K7PY 1UYWH 1AKPA 4AI7A 3SBWA 4WDIB 5CLYA 3T6XA 4F9LC 4PJIA 3VI4A 4HS3B 4H26B 1BLNB 5FF6A 2VZVA 4AIZB 1G87A 1TYEB 4Z7VA 1SXNA 1CE6A 3QJHB 4G6FB 2CPCA 2ZCHL 2MFNA 1KCUH 2CJSA 2ZUSA 3TJEH 5HYEA 1VGEL 1D9KB 2EXYD 3FYEB 3PQYD 4J1UA 5BW7A 3BH4A 1T1WA 5G5DB 5LAPA 1U8HB 4AC4A 1HZLA 2WIMA 3HE6A 1U8JB 3BWAB 3S36H 4X7DC 2NZ9D 5IBUG 3X1EA 4DW2L 1E4XH 2YAFA 4U2YA 2E47A 3D69B 4PTTB 4ZS7L 2VMJA 3GHBL 3TYGH 5CEZH 1AO7B 5HD8C 1LWRA 5I75C 2C3HA 1BQKA 3TV3H 1P5UA 1NEZA 2FO8A 2ORBL 1P6AB 1YDPA 2EIZB 4QRFA 4CSTA 5FGCE 1RIUH 4O2FB 5BQ7B 1O75A 1U8LA 2V17L 3GZPA 1KCVH 5HVFB 3NUKA 1I3UA 2F74B 5B39G 3AGWA 2BZDA 1A0QH 5F1IB 1H15A 1Y7VA 2QQKH 4CMMA 2F61A 2IGFH 3RVWD 1GYWA 3CTTA 4UDTB 2WP3T 3BLPX 4L5FL 1HHGB 3CFCL 1FCCA 3FFCA 2Z4TA 4JE4B 5T1LD 3ARFB 5I6MA 3C9NB 5FO7A 1N6VA 3EOBB 4TQEL 3LEYH 5EWIL 1Y6MR 3CN4A 5J1AB 2AJZA 1UCBL 4ODHL 5C0BD 2A4EA 1YQVH 5FKPA 2WYTA 2ERJC 3CBRA 5E9DA 1EHLH 1WGVA 3MRBB 4X6CE 1OP3H 3SDCB 4ZFOA 1AQKH 2L7JA 3QH3A 2VXUL 3N50A 4HIEA 4KTGA 3WJMA 1JZFA 1NINA 3OHXB 1F3RB 2EDYA 1AO7E 4R7DB 1XH3A 1K2DB 4HULB 4N2FA 4AIXA 3QFGA 3K1KC 3MPCA 4NLHA 4P46C 4D9RD 1CXEA 2PCXA 3GFUA 3ZDZF 1WBXA 4RAHA 2VABA 1ZKAA 5E8EB 1K85A 2YC1B 1LHZA 2K6ZA 3HS0A 5AKTA 5EZOL 3QG6A 3U1PA 5I6OA 2YMXH 3I84A 3MBXH 3WIHH 2IOIA 3AXLA 3VWKA 2C3XA 1UZ8A 3BDXA 3DDGA 3HZMB 5E4AA 1T1YA 3E6HA 3RIAF 2B1OA 4P99A 1T6VN 3BMVA 2FSEA 4ABUA 1J8KA 2VN4A 4WW1A 4E5XB 1YYMH 1J8SA 2BM3A 1ETZB 3QQNA 2V7NB 3EYVA 3HPJB 4OZGA 2CO1A 4TOYL 4YHOL 3BP5A 5KN5A 1GZPA 3QXAA 2AQ2A 2OMWA 4P23C 1IL1A 1NL0L 5BRZB 3MNZA 3QCVH 1SYSB 2YPVH 3KPOB 4NRYB 5C70A 3ARQA 5E70A 1MHHB 3HN8A 1CFQA 1ACXA 5CJQH 2AJVH 3POCA 1UWYA 3QUXC 1NDGA 1O6VA 2NX5A 3AT8A 1ND0B 1SHSA 4NZJA 4GFXA 2DMCA 2O5YH 1TUPA 3Q2LA 4JW3A 2WQUA 4I7ZC 3MFGB 1CXHA 4LF3A 1BREA 1JP5A 3M1BB 1EO8L 4MASA 5FHBH 1IGTA 3BSZH 4TUKL 4E9TA 2HVJA 2PETA 4RX4A 3ARZA 2K45A 4Y4KB 4S0SD 1BEYL 4H20L 1UTDA 4Q9QH 1UCTA 4ZD3H 1MRFH 3S96A 4Y1AB 3IDJB 4L8SC 5F8RC 2BRQA 4QXWA 4KZDL 2H32A 3RIKA 1DSYA 3H4FA 3BUYB 5JOPD 1MWAA 4P5TB 5E8NB 4K23L 1A7BA 2J1XA 5BRZE 4PI2A 3ULSB 1Q4NX 4EQ3A 4C59B 5J6HB 4OD3L 4Y5XC 3PFUA 3M6DA 4W1TA 1IKOP 3RFZB 2DIAA 2WBWB 2JQMA 3O6LH 5IJDC 2J8UA 1S7QA 3UYPB 5BZWA 5LGHH 5D7KE 3HC4L 5PAZA 3QNYB 1SJXA 5KYUB 1DEEA 5A7EA 4L4VB 3I75A 2ZOKA 4DKEL 1SN0A 4PJXA 2AC0A 4XP1L 1IRAY 4HKZA 4PV9A 3TZVB 1BXAA 5DRWA 3K5SA 5KEZA 1IJ9A 3TJHD 1DLFL 2E7CA 2DBJA 2DIBA 5EA0H 4M29A 3T8XB 1TLKA 3BLBA 2HTKC 4UTBA 4LGPB 4I0CC 1SFHA 3IMWA 4GKSA 4Y1AE 1FYTD 2Y7LA 5I76B 1RK0A 2XJLA 5FUZH 2ICWI 4X7SH 2AXWA 4JO3L 1AKJA 5JW5B 1HC1A 1MPAH 3VWJC 4ZMVA 4TS6A 2W0PA 5C09B 3BT0A 3F12A 1FL3B 2GTQA 4FEMA 4OGAC 3QJFB 1J9CT 1MHPH 1FFNA 2BSSA 4MCYB 4FQHB 3M8OL 5IW1B 4AYSA 1MDTA 4L4VE 4KK5C 1YHPA 3UO8B 2CIKB 3O6FA 4MDJA 2DWEB 4WWKA 4BEIA 3Q5TA 1CE1L 4GXUN 5EUOB 5AVYB 2TRYA 4LSVL 4PJ7B 2X6MA 3BSGA 1MJ8H 3FQUA 4EBQH 2W1NA 2AQ1A 2WJ5A 2XQBH 3O3UN 4G72B 3EUDA 4EI0A 2AV1B 4U1HA 6FABL 3AITA 1DJYA 5M7QA 3ROOB 4LCWB 4WNQB 3U36A 1AH1A 1ZHNB 5ANHA 2UY6A 1XF4A 2HRPL 2HVKA 1HCZA 4L2LA 5E95B 5EOCH 2CLZB 1AE6H 2CWRA 4ELMF 5HYIA 3PGFL 3V52H 3U7AA 2ZOOA 5C09E 3GMLB 3DX0A 3L1OL 3RNQB 3EJUA 3CN3A 5BV7C 3OBAA 2R1WA 5D1XB 4OUUB 1OP5H 2XXMB 3ZE1B 3KPSB 3JWOL 3O81A 4NUGH 3EJYC 3SQBB 1RMFH 3ZYZA 2O5XH 1ZA3A 4AYBA 2PF6A 5F89A 2B2XH 1G5GA 4YMPA 4PGEA 5AVVB 3SDXB 3B5HA 2J20A 3QGVA 1ZSHA 5EUOE 3NJMA 1OPOA 2VDRH 5DYOA 4PJ7E 3BP7A 4BBWA 2BVPA 1P7KA 3BX7C 2OYPA 2CH8A 4Z7QB 2A1WH 1MCLA 1HE8A 4WI5A 4IIQC 3T1FB 4M4RB 4NDMA 4PV1C 4YSPA 1XSOA 3ALWA 5FO2A 2G75A 5TDNA 4G11A 5HHMD 4GG6F 2PWGA 1NUFA 3QZWA 4N0RA 5AWNL 3UCQA 1KSRA 1MI5D 3ETBJ 1TYJA 1A66A 4BFIB 2IDUA 2YXVA 3P54A 4AQ8A 1MCOH 2A9DA 3D2UB 4GMTL 1RHHB 1G84A 3T1WA 2FJFB 2NTFA 3EGXA 3VAEA 2OL3A 3DGGB 4HXBH 4NGHL 3QCUH 1CQKA 3KCPB 3QUZD 3WUWA 5DFTA 2MHAB 5IOPA 5D1XE 2J56A 1RUAL 3KL0A 3KPSE 4PB9H 3WEXB 4M48H 2FLRT 1XL4A 1PZDA 3O8XD 4CMHB 2XRAL 1QUNB 1OAYL 2ZKHH 2FIRT 5F9AC 2MJWA 3SDXE 5DURB 1LE5B 2Z65C 2Q3ZA 4LPCA 4I18C 4Z7QE 3H9HA 4AQAB 4DERA 3LN5B 4UTAL 1DCEA 1EZVX 1LYQA 1WGOA 1LLAA 1UWFA 2K4AA 1MCJA 1KBGL 1IBBA 4P23A 3NEOA 5BS0A 1W15A 4I9WD 2AKRA 4XMKH 5HP5A 4Q2ZA 5A16A 1OT4A 2Z9TA 2DLFL 1Y0LB 4RFNC 3LEVH 1CGTA 1HYSD 3QUXA 2YAPA 1OM3L 2NSXA 3LIZH 3T0VA 3WFDH 1E3ZA 4H5SB 3CMOL 4AL8H 4QDGA 2X2HA 3C6LC 1BWWA 4L3EB 1XF3B 3VGDA 1NAML 4X50A 1IEAB 1PJ9A 1FH2A 2PW1A 2JSFA 4UQDA 3NYKA 3BZEA 4UM9B 1X7QB 3BVNA 3EYUH 3EYFB 2FJGB 5GGRY 3ML9A 3D25B 4P4KB 4QKTA 3QUMH 3NEEA 4HDIB 1DLHA 3KPRA 5C0CA 4FG0A 3QS2A 3KYOB 4XVSH 4OD1H 4UV4H 2EEDA 4RWYH 4G9FB 4N2CA 1PKQB 2OMBA 5KAQF 2DAVA 3ULUH 4WNSA 5KVDL 4AYFB 4DGUA 1GC1C 1IGIL 1I8MA 3O3AA 5J56B 5JHLL 2YA1A 2WYHA 1NC4A 1PEZA 1BQHG 4ZW3A 1HWGB 1KF9B 5TDPA 3TBBA 1KEML 2Q3AA 5ABZA 3WTVA 4Z3IA 1C12A 3GSOA 4PJGF 5CO1A 1AHWC 1SBBA 5D70H 3QISA 4L3EE 5E6IC 4E9LA 2XQYG 4P8QA 5E99H 2DIEA 2YMTA 5T33L 4OF8A 5AVRB 1J9TA 2H2SC 2Q2EB 2XPZA 1FFRA 2J12B 2UZPA 3MNDA 5KOMC 4JJOA 5LGJA 3EYSH 3SDAA 1KMGA 5JDJA 2CJUH 2XCMC 5ERWB 1ZTXE 2FLMA 1IGCH 2V0AA 3RB7A 2RBLA 2HZHA 3LB6D 3MCYA 2R7EB 3QYNA 1BVKA 5KVEL 4IRJA 4G9FE 4OIIL 4FZ8L 3CX5K 3TBTA 2J57A 3U0WL 1ACZA 1CU4L 4MRBA 1Q94B 1RZKL 2B1AH 2EDJA 5E8OA 1NCBH 1SLVA 3L54A 5FA3B 1LWJA 1XQ4A 1GY2A 3QWQB 4D0DA 2A77H 5DUMH 2C9RA 5D2NC 1KXTA 5DRNA 3US0A 5IJKA 4MKMA 4DVBA 4FXGA 3QUKB 2BLFA 1MW1A 4QHKJ 3X3GL 3L3DA 2EEXA 3V0AC 4A04A 3T3MB 4AM0B 4MXVE 4PHXA 3UIYA 2F8XC 1SN5A 2Q1EA 3GTVA 1TJMA 1UB6A 2EINB 3QFDA 4MCZA 1OT1A 5GJSH 3N43F 4FQ1H 1UENA 3IFPA 1AD0A 1WFJA 3MRIB 3V0VB 1HEZA 2UY7B 4CBPA 3A6CH 4PSPA 4Y16C 5EULV 1QACA 4PI0A 5DMKA 3UYRH 2DBLH 1WTLA 5CWSB 1AGBB 4U1GB 4AYEC 3MLUH 5EB9A 4CC4C 2EXWD 2RA1A 3NA9L 4ZAKA 1UXWA 4QYOB 1OTSD 1OLZA 5DJZA 3U0TA 3PL6B 5T1MB 4Y2DA 1DEDA 4G82A 3NJLA 1KGIA 1ZPUA 2JELL 3W82A 2H7WA 2V7HB 4F7PA 2MSPA 1CN4A 2JMRA 5GJTH 3A4AA 2OFQA 3FONB 3OZKA 4MYWB 1DVFD 4YK4C 3T3ME 4ODUB 1ZLSL 1U8NA 3EADA 1NFAA 4JFXA 1ONQB 2IQAB 1NMCB 4PJIF 2ED7A 3MLZH 5DJYB 3ZYIA 2VW4A 3FQ2A 1Y6NR 5CD3B 4HLZH 1X5XA 1J7VR 3P9MB 4L9LC 4L8BB 3JV0A 3D3VB 4YFEA 3WO4B 5FFOA 4Z0XB 1U21A 1A47A 1DQIA 1OM9A 3B9VA 4NQXA 3S2CA 3ROLA 2YARA 4OVUA 3DJSA 1P9MC 1W91A 3KGTA 4P2RD 4IDLA 4WFGE 4WEUD 3PJNA 3PGCB 3RIFF 1SGKA 4PRIA 1D5IL 1VGEH 5AAMC 5KSBB 3GSNL 3V6FA 3WS3B 5D7LD 3UTZA 1TZOA 4WEEA 2W0LA 3HI1B 1T4KA 2WNWA 4JZJB 3BUTA 4BSWB 2VSCA 3GXUB 1CICC 4XVUD 3MRPA 2OAAA 4DW2H 3KXFA 2CA3A 3LNFA 3QW9A 4LPTA 3RWFA 1M9WA 2RFXB 4ZS7H 3K6SB 2E56A 2ZUQB 3GHBH 5I8OL 5C1MB 4NX0A 1FORL 3K2IA 5DJXB 5SWZB 4FQXD 2ORBH 4ZQKA 5DRXB 2JK5B 4XN8A 1G9NC 1ZJAA 5A3ID 1LO3L 4GAJL 8FABA 7CGTA 1KGCD 2WIIA 3EXJA 1E6OL 3F64A 2V17H 4B9KC 2QGEA 1F6FB 1I3RA 2FHCA 4NT6A 3D3VE 4CC0A 4OI8A 3FQ1A 3QCTL 5LBSA 4ZMLA 4N0UA 2HMID 3P3TA 5EUKB 3A47A 3PP3K 2AV7B 4L5FH 3G6AB 5KJ4A 3CFCH 1SY6L 5B1AB 4RAVA 1PBYA 1S7WA 1WEJH 1G7QB 4TQEH 3H85A 4NP9A 5EWIH 3HKFA 3RY6A 5IV2B 3QIUB 4F3FB 1BIHA 4ODHH 4Z7AA 5B8CB 1NCAL 2VAAB 4Z77A 4NO5A 4U33A 3TF4A 5JW4N 2EC9U 5JO5A 1Q90A 1ZT7B 2P52A 3MA9L 2YN3A 4M1DH 1L5GA 3ILPA 4U49A 4L0PB 3VI3B 3Q06A 4IRSD 4LHUD 1KIQB 4Z5RB 1DQDL 3MBED 4N6RB 3X1BA 1YMMB 3BH8B 4X99A 3T4YA 4RFEB 1OE1A 1GOGA 2R59A 4XNQB 3MV01 4O2CB 1DYZA 1VENA 2VLRE 1KYOJ 4R8WL 5D4HA 5D7EA 3WJJC 2ZUYA 2Y7QB 3MNWB 1MCDA 4C57C 5EZOH 4F20A 5E4EB 3ILQC 4NJ9L 2WUCL 3GSRA 2IJ0C 3M1OA 5IFJB 1AXIB 2HT4D 3ERXA 3S7GA 4KXCA 4EEEA 4KWUA 2IANB 4JVWA 3TBVA 3BDYL 4JFPB 7FABH 1Z9OA 3OMAB 4GQRA 4PRBB 4UQ2A 2NRDA 3CCHB 5IQOA 4M7ZC 2P5WD 3FQWA 4LCYA 1UFGA 1MAKA 2VQ1A 4IBSA 4KH9A 2VN3A 1TZGL 2NXYD 1ICTA 4FS0A 4I0KA 4X0KA 3LV3B 4Z3HA 1UD5A 3A4DA 2LU7A 4YC2B 3HLAA 4YHOH 4DP9X 4TOYH 4OZIA 3FO0L 3IDYB 2EXYC 2MTPA 2PYFB 3VI3E 1EPFA 2VZ3A 1NL0H 2ATPA 2VISB 4D7PA 1K9TA 3KHOA 5BNXD 4G7SB 1YMME 1IAIL 1M7IB 3GLZA 2BZ7A 4GUOA 1E9QB 1NDMA 1XMWA 2FBJL 1H5BC 2NZ9C 3F05A 3W3BA 1E50A 3DUUB 4LCCA 4Y0GA 3US9A 5GS2H 5CN2A 4S0HA 4BCZA 2XV6B 3FT3A 4ZG1A 4NRXA 3B8YA 5AAWC 4Y19D 3I02B 2YEZA 1EO8H 2CHXA 2I5YH 2AQRA 4TUKH 4P3DA 2DLGA 1LQSR 4WWKD 4IDJL 1E5ZA 4NS0A 1BEYH 3DPDA 4HEPG 4JFDB 5LNEA 4YAQB 2GK2A 3RVWC 2C3GA 3CMGA 5CEZE 1IX2A 3N42B 4WKZA 4RDQF 5CP3A 5AVUB 2CK2A 2D73A 2G3MA 4KZDH 3R1GH 3P9LB 3EJTA 1KCKA 3FU9A 2WYZA 1A6PA 1S7RA 4DHLA 4RRPG 4Y2NA 1AG0A 4TL5A 4K23H 43CAB 3P4OB 2X6UA 1X5IA 3IS0X 2R2BA 2QDVA 2VLMD 3S9DB 3G04A 2BXYA 4DO5A 2KLRA 3HC4H 5D4IA 2NY3D 5D2LA 4ZUUA 1EGJL 3E9TA 4OLUL 4XP1H 2BSTB 2CBMA 2IGLA 2P5ED 3PDDA 5JIQA 1CGYA 3HHMA 3VQMA 2BWQA 3FUNA 1I1YB 2BOLA 2KL6A 3LKRB 1X5GA 3H1ZA 1R1CA 4NKDA 3DX3A 2G60L 5HGAB 3IS1X 4JY4A 5DZVA 2CDFB 1OGAA 4MGXA 1IAIM 4JFDE 4LL9A 3JBG7 4U6VL 1GGYA 2QZQA 4XN2A 5IREA 2P5PA 4HUXA 2GSGB 1HOCB 4RMBA 3Q6FB 4AT6B 4A63A 2P24B 1LE9B 1QSZA 2A9CA 4F33B 2GABA 5F1KC 4DP2X 3I6GB 3HBPA 4QGYA 1ZS8B 5LNDA 1JRHI 1NEZG 4ZUTA 5TK2A 3SOBL 5DHMC 2UZXA 2YOAA 5DTFB 2X7LA 2A6IB 4UOW0 4KKLD 4WU7B 4WV1C 4UILH 4QHPA 2E76C 2XV2A 4A55A 3RZCA 1ZGLA 1ZT4B 3QQ3B 4CAGA 1OCWL 2FO1A 1WISA 1CE1H 1P6WA 2GUOA 4FFZL 4LSVH 1UA7A 1LP9B 1ADQA 5AOLA 3WJLC 5BUGA 5GQBA 4AOFA 2RQEA 2FEEI 6FABH 5I71B 3GRGA 1H6TA 3CXFA 5D7IF 1U3JA 1PKOA 1IAOB 1Z3RA 1DQJA 1AQHA 1YG9A 1YNKL 2HRPH 2X0UA 4HS8L 3EOAA 3PGFH 4OZHB 4ANKA 1AS7A 4XX1E 2WD0A 1OGTB 4K2UL 2A3TA 4QRQA 2DKUA 2P1YA 3QEUA 2XICA 3IN0A 1TMCB 3L1OH 1UXMA 1CCZA 1CG9B 1G9HA 2CGRL 1Z0MA 4UZSA 2DQEH 3C6SB 4AMXA 4FQIL 5LBVA 2B3RA 2IAMA 3JWOH 5BV7L 4GIPD 1SXZA 2IQ9L 2CAKA 1LO2L 4EUPH 5IHHA 1JF5A 3D0LA 5JIKA 3MA7A 4JFUA 4DK5A 2WZPD 4O02A 3G08A 2OXHB 1LP9E 4GKOA 3L3GB 3MRHB 3RWJB 4L3FA 2NTSP 3NDZE 4QRTA 4RWHA 3B1TA 1SUJA 4BDVA 5C8JA 4WFFD 5TE6L 3VA6A 5DSCA 1F3JA 5AWNH 2WP3O 3K71B 3FCUB 2Y7NA 3ECBA 5C9KA 3OKKB 4NQCA 3TJHC 4N3UA 4YNYA 3IRCA 5TE4H 2KKQA 2Y69B 4GMTH 4MD4B 4OZHE 5AZ2L 3MROB 4NPYB 1LDSA 3AG1B 4NGHH 2ESVD 4WFEE 1L0QA 2FCBA 1TJHL 1ZV9A 1ZVNA 5MEOA 2XOTA 4Q6YA 3ZE0B 2BIOA 2ZSVB 5CGTA 1RUAH 3MRNA 4ZMYA 4IU2A 3EG9B 3CK0L 4NP4L 5A6IA 1SOQA 2XRAH 4GUPB 5K1JA 4L4TB 3PABB 1OAYH 5C0RL 4JFEE 5KSUA 2XZCL 3WE6A 1DUYA 1HHJB 4A6YA 5I23A 4N1HB 1YN7B 4Z7NB 2RCSL 2OYMA 2WVVB 2WC7A 4UTAH 5HGDA 2BXZA 4TVPD 4ZDHB 4XB7A 5GIRA 4QOKA 3KH4A 1KBGH 5ENWA 5C0DA 3V9FA 3IBEA 2O6PA 2Y6SD 3HN5A 4WUUD 2GKIA 4LHUG 1B0GB 2YD5A 4IM8A 3HUJF 3T4AC 5TF1L 1G7PB 1E2WA 2NYYD 1OAKH 1PAZA 4F80A 2DLFH 2X1OA 3PUCA 3QDJB 2CQVA 1B0RA 1IEBB 3UPAA 3EJJX 3GMQA 1OM3H 1KT2A 3UZEA 3N1PC 2HTLD 1FIGL 2I85A 3CMOH 4GBXA 4JRXD 1B4TA 4PD4J 43C9B 2WUBL 3PWJB 3QDGA 4K94C 6CGTA 3KM1A 3NFNB 1NAMH 4OIAA 3LNIA 4WNJA 2Y23A 4ESKA 4L18A 4L4TE 4LRNL 3O2VL 1WO2A 2AW2A 3QXWA 4Z7NE 3DO4A 1QATA 1HXYA 3U0PA 1N64L 1NCGA 3S4SG 5KBDA 4AQEB 2GITA 3AQXA 4B9FA 5IG7B 1I1CA 3S37L 4GXUM 5E1HB 2CO7A 1E4WL 2XYBA 2R9HD 1XCQB 3QJQB 2CIIB 5KVDH 3KWTA 2DWXA 2Y3AA 1KPVB 1KN2L 4N8PA 2E4FA 3IDIB 5JHLH 4G5AA 3MOQA 4HU8A 1GC1L 4U3HA 2ZCKL 3ZMEA 3PLYA 1SYVA 3IU3B 1KEMH 3WTXA 3ARDB 4P57A 1YUHB 1ZLUH 4X7TA 1KG0A 4AGLA 5E6ZA 4JO1L 1CVRA 1WIPA 4X5PA 3SDDB 1DQQB 4JHWL 5T33H 5JMRA 4PIBA 2F18A 4S10A 2I9LB 3GSVB 3QUZC 4X4ME 3ZN6A 3HAEG 3TIEB 1C5DB 1A7OL 1TJIL 4YE0A 3NPSC 3BVXA 4DGIL 5IW6A 1JYNA 4JKWA 4FFTA 3NIFF 3O8XC 1AJ7L 4ZPTB 4GAYB 3ARBD 5KVEH 4LPWA 4PPTA 4PJBF 2XVGA 4FZ8H 4FYTA 5I17A 2Z8RA 1WVZA 1T0OA 3U0WH 1CU4H 3CFKA 1A6TA 3S5YA 1WSST 1RZKH 3G5XB 1NM4A 5FPIA 5A2FA 1EEYB 1MFCH 2G9KA 4Y4HD 1I9JL 2DYPB 3DHJA 3B9AA 3V4VL 3UJIH 4KKZA 3JWDC 5JPNA 3WOVA 1V3LA 4QHKI 4JFYA 5EO9B 4I1NB 3LQZA 2UZIL 3H7BA 5CBEB 1HYSC 2HJKB 1IKFL 3GXDA 5E00A 4DKAA 3VM5A 4ZFZB 4B7LA 4LKXB 1YEFH 2WLIB 3LRSA 4JM2A 1MWAH 3BAEL 4KKNA 5JNYB 2WNKA 3K6OA 3MR9B 4M5YL 4F9PC 4Z7WF 4HC1H 2MNUA 4M7JH 4UINL 5IT2H 1PVHA 3M17A 1M1XA 3ZDZB 3HJEA 3L4CA 2JQAA 3P77A 4NO2B 1Z7JA 3OLDA 3NA9H 3UGUA 5LCVL 1GCYA 3WSQL 1Z3GL 4RQQB 1INQB 4QAWA 5HDLA 4XBMA 1NOAA 3CUPA 4N20A 5ACMA 4JL2A 3BEWB 2D7OA 2GJZA 4E36A 4I0PD 3WUWG 4W9CC 2JELH 3WV0A 1BP3B 5BCAA 1QQDA 3BMWA 3FCSB 3MJ9L 3SGKC 5JA8B 2XWDA 3HEIB 3IGLA 3DX7B 4YX2L 3WDJA 3VRIA 4Q4IA 5C9JA 4F7CA 1B4RA 2IWGA 4UCFA 3QI9A 1R3JA 4X83A 3RWGB 1FZKB 2YD4A 3ET9F 3H0TA 5D7SL 1ZLSH 2ZTBA 4YHLL 1J1XL 3B7YA 4OW6A 5AZEL 2RACA 3QPQD 2FE0A 4IBWA 4APXA 2MOVA 1A6ZA 3ASNB 2G9HA 3RGVC 5CILL 4F2FA 3QEHA 5HJDA 2PCYA 3MRDA 4N87A 4AW4A 3PHQA 1HILA 4NI6A 3QUYA 1PDKA 2XPGB 5DS8B 3S36X 2LQRA