3II3A

Structure of orf157 from acidianus filamentous virus 1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
SVVEYEVVSKNLTSKMSHELLFSVKKRWFVKPFRHDRQLGKLHYKLLPGNYIKFGLYVLKNQDYARFEIAWVHVDKDGKIEERTVYSIETYWHIFIDIENDLNCPYVLAKFIEMRPEFHKTAWVEESNYSIAEDDIQMVESIKRYLERKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Putative uncharacterized protein
publication title ORF157 from the archaeal virus Acidianus filamentous virus 1 defines a new class of nuclease
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Dna binding protein
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2009-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11646 DUF3258 Protein of unknown function DUF3258
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ii3A00
3VB8A 3ILEA 3ILDA 3II2A 3II3A
chains in the Genus database with same CATH superfamily
4P2OA 4XTRC 4LDCA 5JNYA 3P2TA 1CB4A 1G7QA 2ZXEB 5IKCB 4WEUD 2B1HH 4FQHB 4LLUA 4S1SH 2DQEL 3N2JA 3KDMB 5ICZA 1XWVA 4H1LH 1IGJB 3TV3H 1XTMA 2YA1A 1HXYB 3RPIB 3U1SH 1MF2H 4TTDC 1YG9A 1H3PL 3RIFF 2A9CA 4MB4A 3K71A 4Q0XL 1F86A 3BUIA 2WUCL 5KVEH 2SODB 4IRJA 3OKDB 4XXCC 1JN6A 3D08A 5CD3B 2QQQA 3LKQB 4Z0XA 4TLKA 2VDOH 3U7WH 1JK8B 5CSBA 4RAUA 3BLBA 3ZZSA 4IMKA 2Y7NA 3OJDA 4K15A 4WVRA 2J88H 5D93B 3DYOA 4M1DL 4KI1A 2AKRA 4U3CA 2A38A 3Q5YA 1XH1A 3D85A 5EMYA 4JANB 5KS9A 3A3YB 3S36H 3SYPA 2B15A 2VSMB 1U91B 3CFDB 3F7KA 2UZIL 5I0WA 3L3DB 3GJFK 5C07A 5DLML 4ONGL 2FL5A 2UVFA 3AY2A 2Y4SA 4Y1AE 4LPXA 4KJQD 5CJBA 2SEBA 3MRGB 3D4CA 1O7DC 2AXWA 3H6JA 1YAZA 3RLSA 5KW9H 3DV6A 3CLFH 1HCFX 2E86A 3SDAC 3QIBC 4L8DB 1NTDA 3L81A 3FTGB 3U6RB 3IF1A 3G6JE 3ULUE 4GRLD 3HZYA 1T21A 4OBSA 1BD2D 3IDUA 1URZA 4LCWD 4NRYA 4HXAL 4Q58C 3SDDB 1ZMYA 2HXAA 4XE0A 4ELDA 4GG6B 1UACL 4LCUB 3TYGL 2I24N 1HJCA 4YSAA 4ANVA 3QQ4A 4BRVA 4TQEH 5F96H 4HT1H 3SGEI 1UC6A 1IM9A 1SFDA 2NNAB 2A9NH 1NLBH 3A67H 1LDSA 2YWZA 4Z95L 1MPAL 3V55A 5FECA 4WGWB 3BPNB 1XZ0B 1HSBA 5JQHC 2JFCA 3FBKA 3H42H 2BJML 4RAVB 2VDQH 2W95A 3EKCA 3KYOB 3TO2B 1UT1A 4LGPB 4JX0A 1ESOA 2CD0A 4XRCA 2BY2A 1E8ZA 3MA7B 3JV4B 4D3CL 1T2XA 1R33A 4P4KA 1TVBA 2UVEA 2WXIA 5B4MC 1DO5A 1EA9C 1ULVA 1BQUA 2IQ9L 1BFOB 4PS8A 3QQXA 1ADWA 5LN8A 2WB7A 3MVSA 4FXGB 5B22A 3HE7B 4OIFA 4POZD 3VWKA 1XH3B 1RKRA 4Y1TA 4L37B 5DHYA 3R0MA 3QARA 2NR6C 3B3BA 3B9KB 3N50A 4OI8A 4K23H 3CSYB 2XQYG 2BFGA 2MCAA 4BQCA 4M5SA 1MCJA 3PHOB 5D7LE 4TMPA 1IO4C 2V5TA 1CICD 3BT2H 4Z3TA 2IF7A 5DZLA 1KT2B 1Q9OA 3SO3B 4ZTPH 4FADA 4F33A 1X5ZA 4ONOA 3O3DA 5CP7B 1MLCB 2YUZA 3V5KB 3V52H 1AQMA 5J9PA 3CV5A 3J2PA 2O5ZL 4FCAA 4NQVA 4XAWH 4JHBA 3WHE0 4Y4FB 2ICWI 1HXMA 3JVGC 1YMMD 1Z5LB 2IAAC 1CDUA 2ITEA 1IBGH 1Z3RA 1FNEA 5E6SB 2V33A 3DGGA 3FFCD 4LSSH 3OR7A 4YEFA 4F1ZA 1IFGA 2JKTM 3C60A 5DJAB 5AB1A 4NUQA 3MFGB 1PIFA 2AF2A 4AEHH 2LLNA 2NXYD 2D3LA 1GMIA 3HI5L 3EYOB 4WFHE 3PQYB 2X1XR 3RX9A 1JXGA 3QDMB 2ARJQ 3N40F 2ZCLH 3VYPA 5J57B 4FL4C 1OAXH 1AZZC 3QDJA 5DD6A 1WGVA 4N5ED 1T2QL 4AKOA 3D8MA 3QWOA 1ZLUH 4ZFOL 4ODHL 5F93C 3GSRA 4XCCH 3T5WA 2Y3NA 3A6CL 4V1DB 4YEEA 1YYML 5GZOA 3EF4A 5EU6B 2IPUK 5IT2L 2E27H 4TTGA 1GL4B 4M29A 4GRWE 1C1EL 2ZPKL 2YKLH 2LU7A 4LSVH 5F6IB 3RFZC 4ZG1A 3W82A 1MCIA 5GPRA 1LNUB 3NG5A 3AAZA 3DBSA 5CR1A 1LO2L 5BO1L 2IANB 3ULUH 4P5TA 3OPUA 5ANMB 2Z35B 4K9EH 1TYJA 3PYCA 2J6EL 4A2GA 2P44B 3UAJA 1SXBA 3ULUC 1G7PA 3PP4L 4U6HB 1GW0A 2VN4A 4YIQA 4JPWH 3KW7A 2BVPB 3JTBA 4ANXA 1B0RB 3SPIA 1G87A 2EH8H 3V7MA 3E80A 1ONQA 1SN5A 2MNJB 1T1WA 2R69H 2NQDA 3T2NH 1R3HA 1FF5A 3KM1A 5IVZA 5B39B 5IESH 1BCIA 4BCXA 1HNYA 4LPWA 2BIMA 3T9WA 3G5YA 3EOBB 3QK0A 1NDGB 4YC2C 3POHA 5DMKA 4ZMXA 1UWGL 4PS4L 1P6WA 1JZDC 3NUKA 3SY6A 3WKNA 5D8JL 4X80H 1KYAA 2X4SA 1MFEH 2FGWL 3KPSB 1GYVA 1QFPA 3PAUA 2VGLM 4H4NA 4OZFA 3ZBMA 3LRKA 4P3WA 3C2AH 1AQKL 3K72B 1YNTF 1N18A 2H6UA 3DRTA 2HWZH 1HILA 4DK5A 4BZ1H 4U0RC 4EDXB 1GOGA 3QPXL 5T33H 3IDGA 1A6AA 2V2WA 1BPLB 3VI4F 1MUJB 2FSDA 2D0FA 4WKXA 3WKYA 3UTTB 1I9RH 4L3CA 5ERWA 1I75A 1OARH 2AAAA 4GO8A 4W9ZA 5ENWA 4QT5A 3HMXH 4PAZA 4UZGA 4YBLB 3AW5A 4TOYH 1QWHA 1GCFA 4M00A 1GGTA 2PP8A 5CEZL 1P9MC 4JBSA 4M03A 5DC4B 4U1KA 1NFDA 2JIXD 1H15B 3OAZK 3S36X 2PTUA 4G6ML 1L7TH 3RP1A 1NIDA 2B59B 1K5WA 3H9SB 1VPOL 1FAKT 1KGCD 4QAWA 4F8QA 1U92B 2JTYA 4Z7WA 2K9FB 5L88L 4FTDA 4JFDE 4BSWA 2X28A 1MHEA 3NSXA 3WEBA 3BQUA 4G7VH 1NPNA 5JIIA 1TJGL 5DD5L 4Z7QB 4PHZA 5FHAL 2ZP9A 4N0FB 4PI0A 2HT3C 3IE9A 3FH7A 4MXWH 4I0CC 4J3SA 4WNJA 3VAEA 4PGJA 3SGEH 5EBWB 3P4NA 1OF0A 4TQEL 1E5BA 1MCKA 4IJ3B 1HHGA 4FQQB 4H26B 1TQBB 3RVUD 4ECNA 5DRNA 3O81A 1KCRH 1RUAH 4NHUB 2WXKA 1M7IA 5LXVA 5HI5C 3HE6A 2O5YL 4X6DA 4WO4D 2ADJA 3GSUA 5JXED 2C1OB 3H42L 1BIHA 2WVVA 4IGBD 2OMZA 4GRWH 1KEGH 4JR9H 3KMDA 1JGVH 3IFLH 4FXKB 3JWNE 1ZGLB 3EBIA 1SOKA 4FFVC 1GC1H 2VMEA 3T4AB 4NKIH 1T7YA 4Y19B 1RL1A 4JFFD 5DXWA 3U36B 2FEDD 4YZFE 3RNKA 4S1RL 1GC1C 4HFWB 5KZCD 1D3CA 1Z3GL 2HFTA 2JV6A 4X9BA 3C08L 3VD9A 3BYTA 4B96A 4UU9A 4BH8A 1QYGL 1A6ZB 2AHIA 2Y23A 1VFAB 5IQ9A 2HRPL 2X4NA 4K2UL 4BKLA 3BEVB 1NGWA 4FXLA 3CZKA 2YN5A 2HB0A 2Q6WB 5EIIA 3KHOA 1FZKA 4LLAA 4XP4H 3DOSA 4XMKH 3QH3B 1QLRB 3O6MH 2GIMA 1ZHLA 4KK9C 4NN5C 5I0DA 4Y9GA 2ZKHH 4QRSB 4S11A 2DI7A 4Q4IA 3T0EB 1BYNA 4YHZH 4DEUA 3PV6A 1VEPA 3IDIA 4YR6A 2ERJC 1SHMA 4GS7B 3AREC 3O3EB 4PTUA 5ADOH 4RCAA 4Y8DC 4XBEL 2WVUA 4WDIA 4AK2A 2R1XB 1W15A 1U8HA 1YUHA 3NCWA 1UB6A 1GKEA 1N8OE 1VF5C 2G5BA 3PL6A 1FZOA 1N64H 4MA7H 2FCBA 4LVNB 4GAGL 3T77A 5IB5A 4DOHB 1ZPLA 1KGJA 3NJXA 1NDTA 4YSUA 1RHHB 4KKPA 3SIKA 4L8SC 3HNTH 5ICYA 2CHNA 1ZCRA 2PWFA 3L5WB 3SSGA 4A2FA 3IMWA 2R29H 3MV01 3OD3A 5C0ND 4ZSOB 5BV7H 3RY6C 2DWYA 4KKQA 1WZ1L 1MCDA 3STZA 3MLXH 3CPUA 4GBXB 1HHIB 4OV5B 5C08D 5J8OA 4WU7B 2X10A 1UCBH 3P0YL 4JO1L 3SQRA 4UUJB 3RX7A 4F93B 3QRFM 2Z3FA 1QHPA 1XF4B 5DQJA 3IRZA 3ZYIA 5TPWL 2AQ1A 2MPAH 2WN2A 2KLRA 4YE0A 1C5BH 1DQDH 1FJ1B 4D0CB 3WLBA 2OXHA 5K1JA 5HVHC 1U8NB 3L1GA 3RTQA 1VFBB 4ONHA 1AXIB 2Z1KA 5MEPB 2QHLA 2AQRA 3MKGA 4LPTA 2OMWB 3D3VD 2ISDA 4Z3JA 4KJYA 2J4WL 4P5RA 4DERA 3Q05A 2Y69B 3QISA 2J20A 4Y5XA 1GSMA 1X5GA 4XBGA 4X6CA 3F04A 5DRXB 2DQUH 3HZVA 2Y2WA 5FUOH 3TCTA 1PSKH 2EH8L 1HQRB 3OVUB 1G5GA 1ZXKA 4FN0A 4QO1B 3V5DB 3O6FC 2CUMA 5DLLA 4EIZC 4J1UA 3UG4A 2GI0A 4TSAH 1PY0A 4N3UA 3PABB 1EHLL 2DLGA 3IKCB 5D1QB 1NEZG 2R1WB 2J8UE 1AZUA 1NANI 3QUMH 4GXVL 3N0PB 3PP3K 3V79C 1KJMB 5DHVA 4ZAKD 2VUKA 4KXZI 1G7IA 2QV2A 1MLBB 4XNQB 2HLFD 3SODB 5I73B 3WFDH 1YEGL 2C8NA 4XMVA 1WFTA 8CGTA 1DZBA 2AGJH 5E2WH 3ZT7A 1LP9E 4OCYL 2YD3A 3SKNB 1MNUL 3CN4A 4RWYH 2CCLA 1QZ1A 2VAAA 4KNSA 3FTVA 4JCLA 2FJGA 1F11B 2JJTA 3LZPA 4HH9A 1UUNA 3CVHB 3DJSA 2CIIB 4TVPD 4ABUA 1ETA1 3OWEA 4F37F 4AIEA 2NY1D 3C75A 3X11A 3UTSD 3HFFA 4P23B 3RAJH 2EDMA 3MRDA 3TX4A 5B7EA 2QQLL 4MXQD 3ZRFC 1JZ5A 2EUZA 5CBEA 3BIKB 2VN7A 4ZUTA 5FKPB 1QA9A 2EIZB 1OOWA 4HBCH 4PJBE 5DEFA 5JHLH 2B9BA 5DJ8B 1MZZA 3QJTB 4FULA 3UMNA 1AYOA 4CA4A 4TL5A 5E9DB 1MHHA 1M6OA 3FONA 5DHMC 1PGRB 2VXTL 3BWSA 2BOCB 1FSKB 2FX9H 1R5VB 5GRVL 3SKUD 1PNCA 4PR5A 1L7TL 3QDAA 5E6RB 2DAVA 2CKNA 3GSNA 5LDUA 1X5XA 4Y9CA 3B7RL 4AYEC 3VWJD 1JGDB 5DU7A 5IMMB 2D3NA 3BKCL 4YGAB 5IHZA 3QS3A 1E5YA 3ML8A 4N9OB 3QNXB 3QEHB 1OB0A 5DJ2B 3GMNA 1IGMH 1WZMA 1DSYA 3JSSA 2UWEE 5CZVL 3ZUCA 3GSOB 3P3TA 5KVGH 5EU5B 1G7JB 3KPRA 2JCWA 1SN2A 4KKLD 4TNFA 5LGJB 3ZHKA 4ANWA 3V10A 1CVSC 4KXCA 1OGAE 3TT3L 2IPKB 2LQRA 1VACA 4PLJD 3SDCC 3S88L 1FN4A 4N87A 4TV3A 3TPUA 5JYLA 1A22B 1OSYA 4P2OD 2CLRA 5DFAA 3RKDD 4M7KL 3O3BB 1V7MH 2WB1A 3HMWH 2VL5B 4G6JL 4YDIH 4ZFQA 5F7UA 5TK2A 1DANU 2XWBA 1XQ4A 4PJXE 4LKCA 5AW3B 1NCIA 4RGNE 3VVVA 4IKIA 4XN5A 4PREA 1QFHA 1YYCA 1Z0NA 2K70A 2VITB 4KV5E 5TDNB 4YXHH 2PXYC 4X5WB 2A2QT 2OQJB 4HKBA 4KI5F 4MYPA 2F18A 4JQIL 4K8RC 4M7ZC 2YR3A 2FO1A 4I77H 4GKOA 5KOMC 3QRGL 5AALA 5I5RA 2P8PA 1G6RH 1XT5A 3Q0HA 3SE9L 3HFML 1A1MB 1WAAF 3HLAB 1QPKA 4M5TA 1OSZA 1KLUB 3EJYD 1QZNA 3CGTA 1PJWA 3OSVA 2EUVA 4PJCE 4A6YA 2NY3B 5CJXC 2JI2A 1QUPA 4IK7A 5BQ7A 2DWDA 3IDYB 1B9ZA 2VZOA 15C8H 2NZIA 1IE4A 4JDTH 1KXQE 1KY6A 3NPSC 4DVRL 3D7PA 1DUYA 1OE3A 4LCIL 2QQNH 3NBNA 3LKOA 1DQML 1PZAA 3KYNA 3JTTB 2DIJA 2R23B 3MFFB 3T2PA 5E1HB 2R2EA 3CSFA 4XHQA 3MX0B 3ABLB 4OFPA 5D2NA 4W93A 4M5ZH 3HHRB 4EBQL 3GLDA 2YOCA 2ICES 2Q8BH 2CCVA 1N64L 4ZMTA 3DX9B 1PAZA 2GHWB 3UJTH 1QO3A 1AHWB 5D7IF 3X1GA 4IJTA 3U4EB 3OZ9H 4AYSA 1X5HA 5C0CA 3N44B 4XCYB 3FT0A 3OQ3B 4FDWA 4PJDA 3EFOA 2QSQA 3M1BB 3VH8G 4UZUA 1NMCB 3FQRA 5JDJA 1OGPA 3M46A 5E0FA 3TWCL 1HYSC 4MAYC 2ZYIA 1DFXA 2XZQL 1F4HA 3RWHB 1BZEA 4PW4A 3MRBB 2OMNA 1NEZA 1WTLA 2YK1L 4R4FL 1IM9D 1IGTB 4PJ8C 4C83A 3BDBA 1OCZB 4FL4B 4M9PA 3UMTA 1IL1B 2BERA 1S7TA 4KDTC 1E4JA 4H0IA 3GD1C 3FO1A 4JPKL 3RB5A 3QC5X 4DQAA 4UT7L 2V7NB 1LO5A 1IUZA 3T0BA 2EDWA 4MA3B 5GRVK 1RUKL 3LKSB 5E8EA 4NN7C 3TBSB 1Y18A 3RGVD 4HIJA 1XGZA 1CG9A 1A4KA 2KI6A 5CO1A 1P53A 4HCRL 1AG0A 2CO7A 5H37G 3CQPA 5I17B 3KLAB 3NFNB 2HRLA 4KNUA 5GS2D 4BGLA 4NYLB 2GJPA 2ITDB 4GRMA 3N9GL 3P30H 4H2AA 4JFVA 2X9YA 5B38G 4BFBD 4FQXA 1JG9A 2VM3A 4Z76A 2WBWB 4NBZB 3D1MC 3WFEH 2QMJA 1CF8H 5F7EH 5AAWA 1EGJA 3TJPA 1BAGA 3VD5A 2A6JB 2GW5A 3HHMA 4J3OD 4N8VG 3TO4A 3ZPDA 1J0HA 5ABDE 3TN0D 3MLUH 2WCGA 1J0JA 3V8OA 4NFBA 2VQ1B 5KG9B 1M1XB 1H19A 2YXFA 1AHMA 2F1AA 5H2BA 1DO6A 5GS1C 1J8HB 4KTGA 5KSAC 2K4AA 4PRAB 3GXDA 3R18A 1M6UA 4GH7B 4CVZA 1FL6B 4X6EB 4GT7A 3LPPA 2K3HA 2X05A 1U95A 4DPBX 2JB5H 1MFDH 5K5YA 2OK0L 1DCEA 3C60D 4L4VB 4R26L 2XCMC 1AZNA 1EANA 3HS9A 4JHAL 5DMIH 5HPOA 4N2FA 4NKOB 4U0RB 2CMRL 4EXPX 4QXGL 2P8MB 3QDJD 1U3HA 2K78A 4JFQB 2N7BA 5HP5A 3X1BA 4CNIB 2DQTH 3FO0H 1CE6A 3DUHA 3MO1B 4YBHA 4PV1C 1E67A 1F4WH 4C56B 4Y2DA 1I3GH 4HHWA 1BLNA 3BN9D 5GZOD 1KULA 2VLKE 1UZ8B 1OD7A 3MRHB 1E7UA 4GFTB 1WBXB 4MAZA 4MJ6A 5SWZB 3LHPH 4G82A 4TQ8A 3L7EB 4G7SB 3QXDB 3DX6B 4KQ0A 3VU2A 1ZPUA 3HG5A 2ZYSA 3E8UH 2EE2A 1JXDA 2M8XA 4LEXL 5JO5A 2XWRA 2Z9TA 2X6VA 2RTTA 1AACA 3X14A 4U1IB 5D6CA 4APXA 5JHDA 4JO3L 1TMCB 4AYID 4JY6B 3AXLB 1TU2A 2CO2A 4NQSB 3UAJD 3V6FA 2JMRA 5FKAA 1HK6A 1JNHB 3I6LE 1C9SA 3BUYA 1GKOA 1J1PL 5C0GA 4YDLB 5IWLA 1E3ZA 1Z9SA 3OKKA 2GT9B 2ZICA 4H44C 2FIKA 4BDVB 1CQYA 3P9LB 1OPGH 3BZ4A 1NJ9A 2AJUH 1PY9A 2JKJA 1B9KA 4WU5B 4R7NB 4MJIB 3TZVA 2VN6A 4HS3B 1V7ML 4TXVB 4UILL 2IAMA 2YD2A 1QRNE 1IC7L 3EOTH 4J6RL 4MCMA 3WJMB 4ODWA 3ARZA 2XZCH 2FD6H 1WBZA 2NOYA 3AMKA 4UTBH 4ZUWB 2IFGA 4NN6B 2F19H 4XNXL 1IAIM 3T4YA 1TIUA 4IQHA 3OKOB 1U8KB 1KCUL 3KGSA 3HPLA 4FTVB 2Q9OA 1DVFB 3PQYE 5FGBA 4XPAH 1UM4H 3L9BA 3NRQA 4LEBA 2IH1A 3NIFE 5SWQB 4RX4D 3WN6A 2BOBB 4MDRA 4YHLH 3T6XA 2ADIB 3G04A 5FYKH 4CSZA 1DLHB 1NCCL 4V1DE 4G43A 4XP6H 3SQBA 3B2PA 2XZAH 4LIQH 4JHUA 1I7RB 3VXNA 4N2OA 5L2KB 3G6DH 4HC1A 2IANE 1HSAA 5T1MA 5B1CA 3NGBB 1FO0H 4WW2B 3BVNB 4BBWA 1BSIA 3UTZB 3DBXA 5EU7E 1JHKL 5ANME 1E4HA 1QKZH 2I9TA 3FB6A 4YDZA 2YSSB 5B21A 1GYWA 4FX5A 4M8VA 3R1GL 3GSQA 4IDLA 3FU0A 3RWDA 4PWGA 4BSVA 2OS7A 3RL1A 1V55B 5DD3H 4HU8A 2YPVA 4XMPH 2OJZH 2Y9RT 4ODBD 4R5XA 2ICWB 3CK0L 1OQOA 1UKQA 3VFGH 2HKHH 3BQUD 3D9AH 4JE4B 1XAKA 2GI7A 5H37A 2CU9A 3I3EA 2JSFA 3TASA 1FGVL 3QFJD 3L5HA 3ZR5A 1QOKA 3A23A 3ILEA 4FHKA 4GAAA 4CMMB 3MNVA 4ZO6A 3DOHA 5B38A 2JJWA 1YMME 1SXCA 5E9AA 4M5YH 4ZZFA 5EDXA 1FYTB 1SYSA 2F1EA 5F9AC 4QRPB 1GTFA 1W91A 4KPHH 5I1EL 4HUWB 2WC7A 3RZCC 2APVA 3HE6D 3O0RH 4HH8A 3QS2A 1NAMA 3WNJA 1N0LA 3CSGA 3Q9PA 1HL8A 3QUYC 1FRGL 35C8L 4L3EB 4XHJC 3W0WB 2BVEA 4IW4C 4AL8H 2OJEB 1HHJA 5F1NA 3UTTE 3OX8B 1AG6A 1FVEA 5DYFA 3Q2CA 4AL8C 2NX5D 4BQ8A 1NC2B 2V9TA 1KIRA 2ZOTA 5BPPA 2OMUB 2WUBL 2XKUA 2D7MA 2FJHA 3IGAA 3MJ9L 4OBRA 4Z3GA 4H8HA 3BOVA 3PAYA 1LO0H 4LLYA 4EAEA 3BKYH 2P24A 3AWGA 2G3NA 4ZMNA 1G7LB 1YN6A 2AJZB 2E7BA 3ZJAA 5K9KB 4JDEA 1OM3L 4GG8A 5ACLA 3C5SB 1FIGL 4KJQC 2Z8SA 3ULSA 4MQTB 1M2VB 4CGTA 5TDOA 1QSVA 5I23A 3L3KB 1ZVYA 4KKAD 1DQQA 3H8NA 4K5LA 1AIFA 1DVTA 1ES0B 1X9LA 3VD7A 3ZW3A 4Z7QE 2DV6A 4I5BB 3N6YA 3L3JA 1YQVL 4FNQA 4RH4A 4ZUVB 3GXUB 4HDIA 1YNKH 3IAGC 1U8LA 2ZWYA 2GCYA 4MRBA 3MTRA 3KYMA 4OQTL 2IGTA 2LU5A 3P4MB 2OX5A 4ZT1A 4QHLB 5CSZB 1PG7H 2X89A 2FQGA 4TF4A 3LRSA 2NZ9C 3EDFA 4C4UA 4Z7VA 4IK6A 2MH4A 4L0PB 2C4FT 1NUDA 1UHVA 1UWEH 1BXXA 3ZLQC 2E9IA 2V5RA 1QPXA 5I1KL 2VDLB 1CI3M 2VWEE 3SGJA 2CLVB 2ZONA 1T89C 1DJIA 4TNGA 1UZ6E 4AX3A 3PWLB 1DQVA 1F1DA 3TVMB 5I74C 4CC1A 5C71A 4Z77B 3IK2A 5F0LB 4OCWL 3LKPB 2EVJA 3GXTA 1BGXL 5GHWL 3MLRH 1P69B 1J86A 5ITFB 1IKFL 1HVXA 2JQZA 1ZA3B 4L9LB 5ESVA 2Q8AL 2G0KA 1YEHH 1SQ2N 1D7BA 3MROB 4I48A 5HD8C 4JFYA 5JIHA 4JZJA 1K5NA 1OF2B 3O41B 4JKNA 3SGKA 2W9DL 1F3RB 3MLWL 5EEYA 1CICC 2CCWA 4MQXD 1UG9A 2DWTA 2Z34A 4YHNB 1H5BA 2X41A 1ORSB 3OKNA 4JRXB 4LBEA 4PJAB 4UNIA 5BXFA 4I0KA 4PRIE 4RDQG 4BK8A 1A1NA 1NGZA 3JXAA 4LSTH 2UZYB 3ELQA 3MV9B 1TQWA 3HHSB 5INDA 1NFDF 4F7TB 1N5AB 4JCMA 2EDKA 1AJ7H 3QDGD 4PN6A 4MNGB 3TFKC 5C09A 3RWIA 4HJGB 4CMHC 5EUKB 3WXWH 1IC0A 3DRQA 3F58L 4JFEE 3DX0A 1R0AL 2WQ8A 3TIEB 3HG1A 2O61B 3N1FC 3U25A 3QAZC 2UV3A 3S4SG 4QTHA 4H8QA 1M7DA 2XV0A 3EJRA 1VZHA 4QXWA 3T3PB 1KYUA 1MY5A 4Y8AA 1MCQA 1M57B 2G75B 2NY4D 5TGBB 2BIHA 4NZJA 3MRJA 3BP5A 2DB8A 4N20A 4N5EC 1SHWA 1Z32X 2AJYH 5KTEL 4PJEA 4GB9A 5I6XB 3QA3A 5FUZH 4AIZA 1KN4H 1CGVA 2VLRA 2B9AA 2DQFA 5LWYH 1P1ZB 4K94C 2P4AB 2Q2EB 4LASL 1U9KA 4X6DF 3KPLB 4L8BA 1HZHL 1L6PA 1SXAA 1MHPH 3MOAH 3DVFA 3FF7A 4OM0H 3IRCA 2GIXA 4PBXA 1QUNA 5CBAB 1XF5A 3LH2L 5DS2A 5IJVA 4N2MA 1A47A 3HNVH 3IU3B 5EU3B 4CDGC 4NUGL 5E8PA 2DWEA 3VRLF 3RUGF 2NNRA 1MY7A 5AZ2L 1RSFA 2ZUTA 4ZNEA 4LMQE 1WYJA 1VERA 3QJSB 3NPSB 1WT5A 3CBKB 5L6YL 4W9FC 2BMKA 1SDDB 4LBAA 3WFBL 2HMID 1V54B 1EVTC 4KY1L 3KPPA 1QNIA 3I74A 2H2SD 4AQ8A 4KRPC 3DSFL 2IWGA 2YO3A 3PJSB 1EHXA 3MTXA 4JPSA 5EOCJ 3LVEA 3MLYL 3VRJB 1MWAH 2XWXA 3EO9H 1VKXB 4XMXA 2NNCA 3IXTA 5LCVA 2EQDA 3T6ZA 4S1QH 3H3PL 1D2PA 5MP6L 3IDXH 4MA1C 2HVKB 3KPRD 4LU5L 3TTSA 5K1NA 2H3NB 4J6IA 5K33A 1A7RL 1ZT7B 1ASPA 2GJRA 2P47B 2EVHA 3PJNA 3SGDI 1DN2A 2A73A 4IU3B 5BQDA 1F4XH 1JD7A 2ID5A 1FH5H 1QI4A 4HD5A 4TUOA 3UC2A 1QSEE 4N90E 4NKDA 3CVBA 2ODIA 2EACA 3N85H 4NUPA 3Q8EA 3FQUA 4PJ8B 4FA8A 5IB4B 3WEMA 3PNWB 5B3NA 2IVFC 3QIUC 3T0DA 3IWUA 3KEHA 4AMXA 4U1GB 4PD4J 2BSCA 2XWJA 4NNYB 1CWVA 2AK1L 1ET8A 1TZGL 2OMTB 4QYOA 1ROWA 5JHAA 2VR3A 5E9DE 1Q9WA 3V6OA 1F00I 5HVFB 2ORBH 1HJBC 1FFTB 5A3ID 3U83A 1INEH 3HRZC 3BVWA 2XTJE 1FAIH 2JK5A 2YUXA 4MLSA 3ZU8A 1X5AA 4NWTH 2WLHA 4FFZL 4N6RA 4UT6L 3VG0H 1VDGA 3ECQA 4P5KA 5CLTA 4YFLI 3SO5A 2Y6SD 5HHPA 4PYHA 4P04A 1IBDA 1E3XA 2YMXL 4G8FA 3N91A 5DZNA 5JW4M 1ACYL 4HLJA 4HLZH 1XAUA 1GZQA 1SEBA 2WAQA 1OCCB 5BZDB 1OSPL 2F58L 5KYXB 4KITB 5EU4B 4PJHE 5BUGA 5BMFH 3NQIA 5HDQL 4N2KA 4X9IA 5IF0A 1IAMA 1JYNA 1F3JB 2X4PB 1JK9A 5AYQA 3F7YB 4OGXH 5FM8A 2A74C 1JZ8A 2PYEE 4LL1A 5HGHB 2WQWA 3F5WB 5BUPA 3HJEA 3EJQA 4X6CF 4R7VA 4CC4A 2X4TA 3RVUC 1T83C 2ZKYA 1J9CT 5C0CD 3C5XA 4X4XB 2ED7A 3UOAB 2AJXL 1KCKA 3AXHA 1CU4L 2AZAA 3HAEG 3B2MA 4WI5A 4H8PA 4WO4C 2XIIA 3J07A 1KACB 5JXEC 4G42A 2OMYA 1ZVSA 3NFSL 4IGBC 1HT6A 2QGBA 2WWMD 3HG2A 5KVFL 4ENED 4U1JA 1PZSA 2BNQA 4KO9A 5JR1L 3D33A 2DBLH 4NQDE 4TVPE 3FCSA 4DTGL 2FEDC 2YPKA 3K6OA 2P5EB 1RZIA 3TBVB 4Y5VC 1PZ2A 3DX2A 3PWVA 2X1PA 4KKZA 3CCHA 3CZFA 4FQLL 4I0PA 1QR1A 4L0ZA 3D25B 4M8UA 4BQ9A 5E08H 3DVGA 3S4SA 1ACCA 3R19A 5HHMB 4U0QB 3ZQ9A 4HSQA 3DETC 4BH7A 1K8DB 4MWFA 4WI6A 2VW6A 3DXAA 1GZPA 1Q1JH 3IB4A 3OXRA 1S7SB 4HUUB 2ZUWA 2WMPB 4BK5A 5I8CB 3KWTA 3STBA 4PEEA 4E41B 1WAEA 1CK0L 3BP7B 1LEIA 5T3ZE 1DBAH 3M07A 4ADGA 2MCMA 4WFFD 1C5CL 2QMKA 3OLDA 2GK0B 3CZGA 2NNXA 1A66A 1GPOH 5C0IA 2MEJB 1P4BH 3B7SA 3D39B 2D8KA 4MCZA 2DPKA 4M62H 5FYJE 3HBPA 1Z66A 2EYSB 1ZS8B 3BVUA 4OM1H 4XVUD 5F2FA 1JGLL 1CR9H 3WLWD 3N3EA 3GTTA 4NO3B 2IMMA 2B1AL 2I7OA 2VH5L 1ZV2A 1LEKB 2ZYRA 4I88A 1ECYA 4AYBA 2ADGA 3BJ91 2NW3B 1FFOB 1UD3A 2V6HA 1ZT4A 3QFDB 1OAZH 2PPCA 1WZLA 3ARUA 4WNQA 4JREC 5C7ZA 2KDYA 5FK9A 1F3DJ 3ZE2F 5I8EA 2WWNA 1DSFL 1JHLH 5E6YA 4APQD 5EEXA 2HP4A 3VUAA 3E38A 1KLGB 1OV8A 3G6AB 4P3DA 3UBXB 2BSSA 3UEQA 1S5IL 3GMMA 1AD0A 1JTTA 2F53B 5C0NC 3ARFA 4M6ML 4C4BA 1MFAH 3ZE0F 4ZTOL 4MB1A 1B90A 3WNMA 2WOBA 3VFUB 1TZHA 4HEPG 4NT6A 3VXOA 1D5BA 4O2FB 4NIYE 1NUNB 4WV1A 3GRWA 1NGYA 3X1FA 4TQIA 4XC1H 3CHRA 3WUWG 3CFBB 1Q1PA 5L4IA 2WLLA 2XTJC 4G6KH 2CJUH 2H8PB 3GSWA 4IRSC 4OKVA 1OAYH 1U3HD 1A7QL 2R2CA 4KKCD 1YY8B 1DJWA 3NAAL 3ARDB 4L1LA 1WAPA 3K6IA 5CJQH 4UV4L 3TBTB 1JI1A 3AS1A 4P2QB 1A25A 5CF3A 2Z31D 4XVJL 3ZKNC 1AGFA 5LAXB 4QRTA 4WUUB 4XR8C 1KOAA 4HK0B 3SKOA 1XXDC 5HBBA 2QVTA 2R2HB 4X6FA 4S0TD 3O3AA 1JZFA 1SLWA 1W72B 3QUZB 5KYYA 4XPHL 3ILPA 5KBNC 1RPKA 1T4KA 1UXSB 5H94A 5FOJA 2NMSA 4Y4HB 3HTLX 3FB7B 4GAJH 4FKEA 4TSCL 5JHDD 4BWUA 4YK4B 1MEXH 1MJUL 5JHMA 1S9WB 3UYRL 4ZAKC 2W0FA 4PUBL 1T5XB 5E1IA 5JOFB 3CFTA 1WHOA 3L6FB 2I32A 2NPLX 2X70B 5MENA 1U8OA 2MNWA 4MDJB 5EZIL 1D9KD 2BVYA 4HIIA 5JXAH 1U2CA 3WGVB 4TVPH 2VMCA 3V7AE 4L1BA 3TZVD 4P57B 3TBYA 1JVKA 2IAMD 4EDWH 5D71H 4QCIB 5C0FA 3L1FA 2J72A 3NCBB 1FNGA 1SF5A 2WIIA 4ZW5A 4J3TA 5LAPA 2JCCE 2OCFD 2I60L 4N26A 1QQDB 3FO2A 1IEAA 5FV1L 4MXQC 4G8IA 3LQAL 4FABH 1Y7VA 1DN0A 1QAWA 2ENPA 2GSIB 2NUPA 3QHFL 5T3ZH 2ORBL 1BZ9B 1A1OA 1HH6A 4XXDA 3HZKA 3AABA 2B8OT 4JY4B 4C56E 5KEZA 1X9RA 4YAQB 1EZSA 4X7DC 5FYJH 5TQ2H 1IZKA 1HINL 2ZUQC 2IPUG 3OMAB 5SWZE 5I16A 4YQXL 1OTSD 2HFGL 3VWJC 4U7KA 1PKQB 1VHPA 1AQ8A 3IJHB 3X13A 2VC2H 2OMBA 1NGPL 4MD4A 2V5SA 2APWA 4IBTA 1KIPB 2H9GA 4R7XA 1CFQB 4HW6A 4WHTB 2IDTA 3L4VA 3B7TA 3AU0A 2WWKO 4XWGH 5FEBA 3QEUB 4XNUH 5TE6L 1UXWB 3ECBA 4BZYA 1ANUA 3CN3A 5KJ7E 1YDPB 5DD1H 1IM3A 2ZOLB 4GRLB 3ZMRA 1PFOA 5DQDH 4KKLC 1BD2B 4WK0B 1RUQH 4LCWB 4PJFA 5DZVA 5E2JA 4PLJC 5CHNA 1ZA6A 3L2LA 1YNTB 2AXHA 2VISB 2Z65C 3FYIB 1P7KA 3V4PB 3BN3B 5I6OA 3M17B 4P2OC 2NXZB 4HWZB 5D72L 3NCJH 3IGKA 4G8EB 1U30A 4MAUH 4JG0H 1OAKH 4QY8A 4P46A 1CVRA 1XGQB 1OALA 2AJ3A 3GRGA 3RQ3A 5K59E 1OM9A 5GIRB 3UZQB 2A5UA 2DQGH 4U49A 2DIBA 4DKTA 2VDKB 2DBLL 1WFUA 2AFNA 1AS8A 2BP3A 2MOGA 3BH9A 4OUUA 4XAKD 3ZZQA 4QGTA 1ZWIB 1BIIB 3LZOA 1A9VA 1CLYL 3NCEB 1DJHA 3IXAA 1U93A 4MMXC 1BQKA 4ZW8A 2ICWJ 3CDGA 3GQFA 2A77H 5FA3A 2MKLC 2VZTA 5HJDA 4GNKB 5C8JA 5E6ID 3K4DA 4AGPA 3T0VA 4J5VA 3UG5A 5A2AA 1ZHKA 5LGHL 3EJYC 5F97E 5J11B 5C6TL 2ZWKA 2GJZB 3A6BL 2CKBB 1GOHA 2YQGA 2HVJB 2VDPH 1MFVA 2VO5A 1PZ5A 4LOUD 4N9GA 2PCFB 4YDMA 2VB5A 5ICXB 2WBJD 2HJKB 3FB5A 1S7WB 3MA9L 5E00B 4K7PL 4X8JB 3WUWA 1UT9A 43C9B 1FNSH 4F80A 1CICB 4TVSa 4K7PX 1VB9A 4AC2A 5CP3A 2CE6A 2FJFB 1T66C 4UIMA 4QRRB 4ZZKA 1XH0A 5C0JB 3RU8H 4KJWD 1IJNA 3GPSA 3PWUB 2VSCA 1YJDH 3CVHL 3Q48A 2HG0A 5HDBF 4H88H 2DJ4A 4LXFA 3NRFA 2CR0A 4DK3A 2AV7B 4ZX5A 1EAOA 4ELKB 2OCCB 5EC1B 2J73A 4HKJB 4JQVA 1M3IA 4ODSH 4MNQE 4CMHB 2O5XH 1TYEB 1Z5HA 4O2CA 1WC7A 3F65A 4W9KC 5F9OH 1JZEA 3NEXA 3K5SA 1KXHA 2B3RA 1CF1A 3FFCB 4B9PA 3NZ8B 3T2QA 2NQ3A 2JJSC 6FABH 3KE0A 3NN8B 4LPUA 2NXYB 5J1TC 3CXHK 3TT1H 4QOKB 3AG1B 1IQWL 1G1CA 4HKZA 4AG4H 5EOCL 1A7PL 1SY6H 3LIZL 1NAKL 3DC0A 3F64A 3Q5TA 1K3IA 3IETB 2XLLA 3L17A 3SCMC 2X89D 2Q86B 2IGFL 4C58B 3OL2A 2XWEA 1OIOA 3IBEA 5BZZA 2WQRA 5FDWA 2V8MA 2GVYA 5F7MC 2CJUL 2NY6C 3UAAA 1KLFB 5FM4A 5F89A 1OAYL 4PBDA 4X4ZA 5AB2A 3CHXA 1FL5B 2KC0A 1IKOP 1SM3H 4X0KB 4RA3A 4E9LA 3IU4H 1LWRA 3RGVC 4MXVE 1R9FA 3WU1A 2EH7L 1ADQL 4OZHA 5GZNA 1RP8A 2UUDK 4HFUH 5CUSH 5IMOA 1GGIL 3S35H 4DO4A 5IR1A 3W56A 4E9TA 1W0VA 5AG9A 5HGAA 5B1BB 5FO7B 2X6AA 1WFNA 2LHAA 2XWCA 4R97C 5BZWA 1FLRL 1Z7JA 2I85A 5D7SL 4GYBA 4OJFL 3MBWB 4QPEA 2WV3A 5EBMB 3QZLA 4GAJL 2Z91A 2YBGA 2DKSA 1JWMA 1PVHA 3NACL 2DMBA 3RGHA 1JMXA 4J3OC 1NIBA 5JPMB 2NTFA 3TN0C 5D70H 3T65A 4HBQA 3IE4A 4GEIA 1RPUA 4KX9A 1T1XB 3OSKA 3SOBH 1IRAY 1BOGA 3M45A 3MLSL 2PPEA 4EUPB 4E5XB 3ARVA 4WCYH 3V6ZB 2QKIC 3QNYA 4NC2B 5D71L 1ORQB 5DVKA 4GQ9H 2CNZA 1TLMA 3HG1D 4AENA 4NX0A 1P7QA 2AEQL 4OGQC 3ZDZE 2X0VA 3C60C 2L7JA 3FSVA 1I9IL 3ZGHA 4AC4A 4F7CB 2K7PA 4HEME 1NQBA 3OHXB 3X1NA 2XKSA 3ZQWA 3O8XA 4ZMPA 3U4AA 2FK9A 2BHYA 2ED9A 4ETQB 1XL6A 3CXDL 3EO0A 2VXQL 2L7EA 1RLBA 4OSUL 2EE6A 1XBRA 3U4BL 3L4CA 3WS6C 3FH8A 1Q9LB 5CLZA 5DURD 4LT7A 4F7MA 2G3XA 5DCCA 3BWUF 2OTUA 3ALXA 3AT8A 4LSUL 3BN9C 4X4MA 3MRMB 5GZOC 2NT1A 4IEFA 2CA4A 3NJFA 4GFXA 4H20H 2VLRD 3CDZB 2IH9A 2PCPB 3IEAA 4JAMA 3WIHL 5JORB 3L3OA 2V3DA 1G7MA 3ABKB 4KKBD 5GS0L 4G9DB 3BP6A 3KYKL 2JIXB 3IJ7A 4N2IA 2X7LB 3NH7L 1F02I 3O9WB 4ZJ9A 1CBJA 3MODH 2FWOA 5F7LB 1A9BA 3MAWA 4PRHA 3RDTA 5JOPD 1N68A 1HN1A 4KX8A 3VXUA 1TCRA 4H5SB 5LDSA 3OHMB 3GK8H 2C34A 2WNKA 2X2UA 2BXZA 2C5DC 4KUZL 4JRXE 5DUBA 3GZQA 3SB3A 3CD4A 4HV8A 3EJJX 5CIPH 4D9LL 4UWQB 1DDTA 2P5WD 3MV9E 5E4EC 1EWHA 3VXRA 5KJ4A 2EDTA 5I76B 3QIWD 1IILE 2WXPA 3EYSH 5D1ZB 1RZGA 3BSZA 4MNGE 3BJLA 3VFMA 2C1PA 3DO7B 5ABZA 3H2WA 2FZ3A 3V0JA 1D5IH 1HL9A 1T7XA 4OH2A 4PW3A 3KYAA 4Q7DA 3S3SA 3ULVF 4OFYA 2OSYA 5HYQB 1SJXA 1QLEB 5DEZA 4OTXL 1T20B 4I3RL 4WO4B 3T3PE 5KYUB 4XNMA 2OP4H 2H7WA 4MJHA 3F62A 1NMAL 1ZLVK 5FCUL 2DQDH 3BPLC 4U6VH 1CUOA 4YHPB 5E4OA 5SV3A 1AO7A 3MRPB 1N2RA 4QRBA 4B9IA 4DVBB 4PRNA 4AT6B 4JFFB 2E47A 5BS0D 3QEQE 2GUOA 2ZCHH 2DD8L 5HDWA 3L9YA 3U46A 3D48R 5FFLA 1W2KT 5I66A 4JM4H 3NA9L 4ZTEA 4Y5VB 5CWSA 3EXLA 3FUDA 4YUEL 1PX8A 2AXJA 2GB2A 3DX7A 2CWRA 3WL9A 3V0VB 1JDAA 1CD1A 1JZHA 1NFIB 4KTEH 4OGYL 4KHTL 3IS1X 3Q7JA 4PY7B 3EO1A 5CEXB 2EUXA 3CHPA 5T3XE 1FBIL 1I8LC 3JVFC 2EKJA 4PD4K 3DVNB 4LFHG 2XPGB 4D2NA 3NTCH 2EYTA 1J1XL 5JMRA 4N8UA 5FOBA 1KCSL 4QGYA 4ELMA 3GRBA 3ZHNA 4X4YA 4F57H 2DLFH 4O02H 4OT1L 5GSRB 3FNKA 3KVDD 1RZFH 3UPCA 1PQZA 2C9UA 3EH4B 1J05B 4LCCA 1O75A 4LRIA 3BQUC 1OK0A 2OSLB 4ODSL 5D7KD 2PPFA 3VFNB 2BFVH 2VLME 5JA8B 4FA7B 2WLIB 4PHXA 4R84A 4F2FA 4UBDD 3FUEA 3RVTC 1ZK9A 3HG4A 1RXLA 1OB1B 5LXGH 4HWBL 2XTLA 4LLQA 4XX5A 1YEDB 3IDJB 3U2SA 2FO4A 2CA3A 4JZNA 1GS7A 3HR5A 4ALAL 4WKZA 4MMZB 3Q2WA 2G2NA 2YBRA 4EIBA 2C7UA 1AXSB 3NCYS 5LQBL 2R0LH 2Y36H 3R4RA 2X1QA 1PD1A 1FYHB 2CO6A 3MGTB 4ZPTB 1DBML 4Y1SA 1J5OH 4PJ9A 3CE1A 5SWSE 2BNQD 1SJHA 3BWAA 1BAFL 3O4OB 3H3BC 1BV8A 4HS6A 2XN9E 2EXWC 3HC0B 5CZXD 4H1LA 3WHE1 5CUSL 2FR4A 5LBSL 2ZG2A 3ZYJA 4I0PD 2HAZA 4UB0L 2CHDA 3ARBA 5IB3A 2R4RH 5DJDB 3ZKSD 3S35X 5T1JA 5IB1B 3MGOB 1QEWB 4PJEF 1NPJA 3FQXB 2W60B 2QFRA 2KPWA 3J7HA 2IQAA 3VFSB 5DZAA 4Q6IC 4R7DB 5D7IB 3ZDXF 1XGUB 1HL4A 1RPQA 2OMVA 3K8LA 4KKAC 4N2EA 2QTVA 4OD3H 3GJEA 2EDJA 4F9LA 2BRRH 5I1AA 2KZ1B 4GW5A 4KROD 1AFVL 2P28B 4G5ZH 5B7FA 2LVCA 4H8WL 2DW5A 4LOVA 3L3HB 3V5HB 2R1YB 3TNMA 4QNPE 1L6ZA 1A7OL 3P3UA 5AKSA 3IM1A 1CN4A 4CUCA 1HIMH 4U3HA 1WD8A 1HKLL 4XN8A 1U58A 1HHKB 4FHBD 5F9JB 4P2RD 2EC9T 3SDAA 3QIBA 2AJSL 4AMKL 3RJQB 4TS6A 1MCOH 2PWDA 2XBZA 3PWPE 4PGBB 2YQ2A 4GSUA 1J7VR 1KJ3L 2NY1B 2DIEA 2OL3H 5IVXA 4KZDL 5JPNB 1WHPA 1BJ8A 3FQ2A 3UTSB 5I6NA 1N5YL 2Y5TA 5JIDA 2E76C 1WVZA 3TA3A 2BSRA 1LXMA 1NICA 1NCNA 2DI8A 4O4YH 5T3XH 5MEQB 2P5EE 5DMYA 1E4XL 5M7QA 1PLBA 3HS0B 1MFNA 2NY7H 3MLZL 1KDJA 3PDDA 1EEUA 4WWNA 2RFXA 2FBJH 2JKLA 2QPEB 1E42A 3CN1A 2QFPA 2UY7A 3LAFA 5E1GA 4DETA 2VTFA 3T8XA 1JVOA 5IHUL 3P73A 1X5LA 3KR3L 4XNBA 1NUFA 3L3GA 3ZL4L 1AD9B 1PD6A 5IHWA 1Z9NA 4JM2C 3ZRCC 3KXFE 3U79A 3NPZB 2XA3A 4E41E 4QF1B 2UXTA 3VWJB 3X12B 5K9OB 4NRXB 1S9VA 5D7JB 3OKEA 2E7MA 5INCB 1D5XA 2BNUA 1QABA 1IC4L 1RFDL 4MQXC 4RIRB 1FG2A 4NM4H 4Y5XC 1NMBH 1E6JL 2PW2A 4NZUL 3D39E 4TUKH 4UINL 1IGYA 1KJ2B 3CLEL 4B3VA 4F24A 3T1FB 2DTSA 4F2MB 1N7MH 1ASQA 1SFHA 2EVFA 3EHBD 1NL0H 3EYSL 3B83A 4U05A 5SX5K 3O6LL 4RFNB 2NR6A 2YMOA 1R47A 3VXSE 5T5FL 1E27A 5HHXL 5CJOH 5EF2A 1B0GA 4YPGB 2HN7A 5FF6B 2FO8A 4P2OB 2APFA 3VXMD 3D69B 5I26A 5JNYB 1L7IH 1G7QB 2AK4A 2WM0A 4PRPB 4LLUB 1CZ8L 1I82A 2YAMA 5ICZB 2DQDL 1TTUA 2F53E 3FOMA 2NY4C 4LO9A 3H7BA 2ATPA 2JJTC 4UM9D 5HHQA 3V0IA 1L9OA 3ILQD 3CMGA 4GMTH 4HPYH 3WN5A 1NGQL 3H53A 3AG3B 3I6SA 4KH9A 4DEWA 3K71B 2C26A 5A7EA 3F7VA 4IRJB 3W9EA 1EAJA 4UDUA 2AQPA 1PMYA 5I8OH 2ITFA 1SJMA 1FZMB 5DRWA 3MZTA 1JN6B 2VDRL 2NY0D 2YZ8A 3VTAA 5D4HA 2WYHA 1V10A 4RDQF 4Z0XB 1P6FA 4FF9A 1AI1L 1AP2A 4RAUB 4A67A 3WTUA 3Q01A 5IJDC 2ESVD 3OJDB 1SJVA 2GSGA 2XPYA 3D34A 3U6XA 4E9RA 5I8KL 1T22A 3NRPA 2WZ5A 3D85B 4WUUE 5IEHB 4XNYL 1MVFA 3DUUA 3GEWB 3ZO0A 1K6QH 4UQ9A 5HHOA 1QMUA 2EP6A 2R59A 1INQA 1MG3C 2HMIC 5C07B 2FWSA 3I2CH 3RFZA 2FL5B 2QADD 5D1XD 2H2SC 2E4FA 2I5YH 2SEBB 3JV5A 3K80A 1ZANH 6PCYA 2ZJSH 4Y1AA 3IDNA 1IGFL 3DV6B 2BSDA 5J56B 3W57A 3FMGL 3LD8C 1NZRA 1UXLA 3AU1A 3F2LA 3IF1B 4HU2A 3HZYB 3ZYZA 1T21B 4HZLA 1WD9A 3G6JA 2WN3A 2VDLL 2XTSA 4E68A 2P1YA 4NRYB 2XACC 1WITA 1S7UA 3LPFA 1AZVA 4AV5A 1S9XB 2OPCA 1KWKA 2J44A 3QQ4B 3VNZA 4GKNA 5FA4A 5EA0L 2HRGA 4QD2E 1T3FA 1B4TA 2FE0A 1A6VL 1P5UB 4XGZA 1IM9B 5EEVA 2IADA 2R69A 4M1GL 3FH5A 4GKSA 5EEUA 1BVNP 4XMWA 3LZFL 5FECB 5E8NA 4F7PA 5JZ7D 1H8NA 3ZL2A 3MACH 3N5AA 4PY8I 3QG7H 1PNDA 3MHZA 3DJTA 1FGNL 5K39A 2Y5QA 3TV8A 4IRZH 3EJCA 5A3IC 4XRCB 2KT6A 2LTQB 3QG6A 5CMAA 5L7XH 3LX9A 5C3LD 3T2LA 5KBMA 2RH0A 5CGBA 1DDHA 4P4KB 2NT0A 1TVBB 2WZ0A 2DQHL 2VJ8A 4BZ1A 5EBGA 2MNUA 4NZTL 3SQOL 2WJ5A 4JN1L 4UQDA 4DEPB 1MI5B 4NJ9H 1WFJA 3I9AA 5AW2B 3EFDH 2Q1EA 1U42A 3VWKB 4OD3L 1YEKL 4EVNA 3FCTB 5DHYB 4M93B 2X0UA 3A47A 2H3XC 1QLFA 3V4UL 1Q38A 5DK2A 1P9MA 3QWNA 2FHBA 5E5LA 5A2LH 3HMXA 1A0QL 3SBPA 5DS1A 1Z9PA 3EH5B 1Q9OB 2EECA 3ZOAA 4F33B 1ZHBA 3FRPG 2F54E 3A0OA 1UOVA 3O3DB 2FYVA 2O93L 3I02A 5EN3A 5EO9A 5J9PB 4J3WA 4KK6D 4GAYA 4NRZA 5GJSL 3RWFA 4NQVB 3RY5A 3MBXL 2K8QA 3DTDA 4AM0A 1HXMB 3AG2B 2MPVA 3FO9A 3JWNG 5EZPA 4A7QA 1AR1C 1O9ZA 4OCXL 1JOIA 5LNEA 1HH9A 3VI4E 1JGUL 3LVTA 1JZ2A 4GQPH 4K8RL 3RPKA 1FNEB 3KJ6H 3KM2A 1ZEAH 4K3DL 5F21B 2WWMC 2KYIA 3CHOA 1FFNA 1NCDH 4FNTA 3OR7B 4G7YL 5T1DH 3HRPA 3U9UA 4DF9A 4XPFL 3C60B 1QBML 3Q8AA 2QJDA 3W5NA 2AEPL 4B9CA 1A3ZA 3E1ZA 4NPJA 3SHSA 1LM8V 1D5MA 2VN3A 3X3FL 2FNBA 2ZOOA 1O6VA 4KTYA 5DD6B 4DKEL 3IVKA 5L2JA 2FBJL 1VADA 3VTTA 4TLUA 3QWOB 3FFDA 3MV8D 3GSRB 5F9DC 2WXRA 1A8ZA 2F7OA 5JUEH 5T5NG 5JQ6L 1JRHI 2E7DA 2TRYA 3CX2A 4Q4EA 2IDFA 3BUQA 5L0QC 5GZND 5TK4A 5IFJA 3QE5A 4ZO9A 3AAZB 3EJSA 1OLZA 3VXTA 2GTQA 2WLJA 1I3UA 1MRCH 4OIIH 1C16B 1CLOL 4P5TB 3V0GA 4XMUA 3GXMA 4XVUC 5D96B 3WTSA 1NEPA 1XCQB 2AABH 2XUWA 3AGWA 1EO8H 4QRRE 1J8SA 1G7PB 3L2MA 3GBNH 3OZLA 4KTDH 2W5PA 4MHHI 4YIQB 3TONA 4HOZA 4LHQB 4GW4B 1S9YB 5AOZA 3UAFA 1ONQB 4OZGE 1T1WB 5F7KC 1R3HB 4HS8H 5IHLB 1PPIA 5IVZB 4APQC 4P9HC 3WYRA 4MX7A 4RAHA 3BAIA 4JL2A 1TENA 3AREA 4RMSA 1CGSH 4FYQA 3WD5L 5DMKB 5TTRA 2DH2A 2BPBA 4OLYL 3PLYA 3LEVL 4NNPL 5BVJA 2XXCB 1G9ML 3U1QA 3VFOA 3FHEA 2R2BA 2V2XB 1AANA 4QOKE 2X4SB 4AUJA 5F88A 1MW1A 4OZFB 4PJFF 1P7QD 2BSTA 1M2OA 3BPLB 3DK0A 1LTXA 4U1LA 3AG4B 1CIUA 3DRTB 1HILB 2IC2A 1E4KA 1ETZA 3O8XD 3IDGB 1A6AB 2V2WB 5DSCA 4HUXA 5J3HD 3V0WL 2ILLA 3FN0H 4FQ2H 3BIBX 1QPPA 4L8SA 4KKCC 2P7TA 4NPYA 5E2VH 3SJVE 3C8KB 4L3CB 3INUH 4YNYA 5ERWB 4ZD3H 1X4ZA 4G3YL 1I9JL 5FFGA 2B0SH 3K2UL 2WCSA 3VG9B 4HF5L 2OJ1A 1FL3B 4L29A 2LABA 3W2DL 3WJJC 2R29A 2Z31C 4QT5B 4Q8BA 5ENWB 4Z7AA 5EZJA 5J12C 2EDHA 2N7AA 3LRLA 5GGRB 3ESPA 2DYRB 2VR9A 3LNEA 4LRNL 1NFDB 1BDYA 4U1KB 1N10A 3L9RA 4F15B 5M94B 2BC4A 4GLRI 4UAOB 3DURB 3V4PH 1FVCA 4PRHD 1J0IA 5TQ0H 2Q5BA 3P0VH 1PCSA 4Z7WB 4HJ0C 1ITBB 4EJ1C 4BSWB 4HHAA 5LG6A 4DZ8A 4IM8A 1MHEB 3M88A 1OAUL 3BQUB 4N1EA 4PM1A 4JFDA 3THMH 1AOHA 1RULL 1KTBA 3QZNA 3BLPX 1D9KC 3VGDA 1EMTH 1G43A 2PTVA 3TZVC 2XA8L 3O6FA 4Y0GA 3P4NB 1JPSL 4UYPA 2BSBA 3BE1L 2AJVL 3RI5F 4AV4A 4YXKL 1HHGB 3GIZL 1JI2A 1XF1A 3KWVA 4FNUA 4WJG3 5DC2A 3JWOH 5DRNB 1NBCA 4ZQTA 4AK1A 2CM5A 1M7IB 3F05A 3JWOC 3HE6B 3O6KL 3QUMA 4X6DB 2IPTL 5A16A 4KRLB 3U0WL 2ADJB 3GSUB 3RIKA 2WVVB 2R83A 5ABAA 2OMZB 2GY5A 3CQFA 4IMLA 2HVBA 3FPXA 5DEJA 3CZSA 4N0RA 1U6AL 4A38A 4FE9A 1L0YA 1XGYL 4OLWL 1JSYA 3K2IA 4AOFA 3NJJA 1M3JA 2P49B 3ETBF 3ESMA 4WSGA 3RNKB 5J13B 5IM7A 1YN7A 5TE4L 1SPDA 1IT9L 12E8H 2IDQA 4BH8B 2ATKA 4OLZL 2DMKA 4UU9B 1OTSC 4YDNA 4AW4A 2OA9A 5IQ9B 3LXAA 2ETWA 2X4NB 1NSNL 4BKLB 1NGWB 4HK3J 2X44D 4KGLA 5EIIB 1FZKB 2OSWA 1JZ6A 2BHZA 3DOSB 4TL4A 4KK5D 1ZHLB 5JHLA 3IJ9A 4H7VA 3PNRB 2Z92A 4R4ND 4PJ5A 2E5EA 3DK2A 3PV6B 4OZHF 2CH8A 2FYYA 4YR6B 3RX5A 1ZGLM 1ID2A 1I85C 2HX9A 2QLYA 5KBKA 5E8OA 4NO0A 4PTUB 3KLHD 1JV2A 4EN3A 1RZ7L 3VW3H 3HR6A 4OCNC 4WDIB 2X5PA 4DP2X 3DGCR 5FYKU 1TQSA 1DEDA 1U8HB 1YUHB 1UB6B 2WTOA 2EIEA 3EGSA 3PL6B 2G5BB 2WGXA 1GIGL 1FZOB 2GUYA 1F4YH 4XOCA 2VN5A 3T77B 3LDBC 3FT4A 4DGWC 5CLWA 1RMFH 3ROOA 1J9TA 4M61A 4R6UA 1IE5A 2CSPA 2ENJA 1ZXQA 3BKML 5MI0B 5ICYB 4KXBA 3RX8A 1A3RL 5DMGD 3BFOA 1IQDA 4L4TA 4TQPA 3STZB 5HYJE 1SN0A 1OKEA 5EPMB 1BX2A 1Q9KA 4DHLA 1FCCA 4YLBA 4OCRL 3QUKB 5E6IC 3B37A 4PV8A 1VGEH 2AQ3A 3DIFA 3QCUL 4PJ9D 4B3EA 5KWYC 3IMSA 5JW4N 3BRFA 1W72L 3NEEA 3WS3A 2PW1A 5DYOA 4NZFA 4U1NA 2OZ4H 4GI8A 5DQJB 5KANG 1RUPL 3WO4C 4AYFA 2Y06L 1KDIA 1CFNA 2OXHB 4W70A 3WLBB 3BH4A 3Q2VA 5FYLE 3RTQB 2PXYA 2WBJC 3B9EA 4JO4L 3ARBD 4LHUA 4ONHB 4Z7NF 3FTWA 5JW5A 4ZOEA 3ASOB 4BK4A 2NUTA 1KPRA 4KJYB 3AQYA 4B60A 5FLUA 5HYSG 1DHKA 2R51A 5C2UB 3KW8A 4NI6A 2RBLA 1CYWA 3FS9A 1TETL 3IPBA 4PWEA 4XBGB 1EAQA 2EO9A 4X6CB 5AWNL 2WZPA 2ZXDA 3HZVB 1G6RA 4RMVA 5TF1L 2ICEC 5CJXA 3QNFA 4J1UB 2F74A 3S5LA 2NCMA 4A2EA 3FJTA 1NLDH 2PO6D 3F7RA 3HKFA 2R0ZH 4M8QA 1R3JA 1ZHNA 2G4GA 3FDWA 4OCLC 5DHVB 1MIEH 2J8UA 1CDCA 1HOCA 2H6OA 1G7IB 5IZ7A 4P07A 4G8GA 4NFCA 3O2DH 1UM5H 4NKQB 5G5DA 3KNBA 1A6WH 4KI5E 1LP9A 3SDYL 2VAAB 3KGRA 5BOZG 1MCPL 1UB5A 2NY4B 2FJGB 1P4IL 3OAUH 2FNWA 2WLNA 4R2GB 5F8RC 4HH9B 4L23A 3C6EA 3SDAD 3UTPD 4LSDA 4BRJA 1DVQA 4UTAH 1LDPH 3CH8A 3OF6D 2OTPA 1WAAE 2X2JA 3FU9A 4N2HA 4W4OC 1IGCL 4PRBA 3DIDA 1YEJL 3GZKA 1KCWA 1N3NA 3MRDB 3TA3D 2VSDA 3SGJC 3MXWL 5CBEB 1OAJA 4ZUTB 1QA9B 5DEFB 4LNVA 2JQMA 4DH2A 4MAYA 2ZT9C 1H0DA 4PJBA 1QFUL 2AI0H 4U6XA 4M7LH 1MHHB 4EOWL 1M6OB 3FONB 3A4AA 1D6VL 3CU1A 3WSQL 4CJ1A 2VABA 1TCMA 2X3AA 3ZMEA 1BEYH 2LVEA 2R56H 4PR5B 4KDTA 4FQJL 4XN4A 1WWCA 4IIZA 3GSNB 4X5QA 2BP5M 2DQCL 4JZJC 5TQ0L 2PUQT 5D7IE 1S78D 3ZE2B 2H6PA 4LPYA 2IMNA 1KENL 4HJUA 5IHZB 1EK3A 3CLWA 2Q76A 2OR9H 4G70B 1XSJA 4JKPH 4Y2NA 5IUCA 2QHRH 4NM8L 3GMNB 2VDKL 4Y16B 5FUCE 2Y7QA 4J3BA 5KSVA 2UWEA 1M71A 3ZE0B 3QDHA 1COBA 2DQ6A 1MQKL 3KPRB 2EIDA 2CHWA 4P59H 1AGBA 4FQIH 4AVIA 4ELMF 4XWOC 5FGRA 2F5BH 2NNFA 2JB6A 2NR6D 4K3GA 2A9ML 4LFHD 1VACB 4XX1E 1XGTA 2X09A 4FQCL 4B6ZA 1OGAA 4X6BA 3TPUB 1TKWA 2CLRB 4IIQC 3REVA 2CXKA 2CKBL 1KB9K 4H8VA 5CNHA 2XWBB 4BCYA 1CFVL 2C9AA 1XR8A 4LKCB 5CINH 3BZEA 2GEQA 1XVSA 1IU1A 2H45A 3HB3B 4PJXA 4QJ3B 4UTCA 1B4JL 1A14H 1H3TA 3DHUA 4PREB 4R90H 4PVBA 3KL0A 6TAAA 5GS1A 1HEJC 1F1GA 5AENA 1X7QA 2VXSH 4XP9H 1SOQA 3MJ8A 1XL4A 3QEGL 1BBDL 3C5ZD 4H40A 4HKBB 2LLGA 3MBED 1AMYA 3EAKA 3T8VA 1U8JA 4KBPA 4KKBC 3CFCL 3TEYA 1GTNA 4GAFB 2P8PB 2Y7SA 3T3MF 3D50A 4JMNA 5AEAA 1KTLA 1OSZB 5J6HA 4M4RA 4EN2A 3F7LA 4N0YL 4Q52A 3I50H 5TFSH 4A6YB 5ILTH 3UBHA 2Z7YA 4PJCA 5BQ7B 2G0LA 2DWDB 3B3IA 4HSCX 4EXKA 1AE6H 2IALA 2ZXCA 3U1PA 4BE5A 3GBEA 5DUPH 4DGVL 1W0YT 4LPVA 1F4AA 3UJJL 1A7NH 1DUYB 3LKOB 1ZD6A 2ZAGA 3FRUB 2MWCA 3KYNB 1INDL 4GSDL 4F2ME 1PZBA 2IO5A 5IG7A 2MQ0A 2R2EB 4E9SA 3NYKA 3QIWC 5D2NB 1RJYA 3KPMA 1DQTA 3OAYK 1UA6H 4ODVH 4Y1AD 2FB4H 4M48L 5C0RH 5GISL 4JFZL 5E9NA 2XWTA 4WK2B 1GGYA 1QO3B 2Y72A 4GPVA 1S8DA 5C0CB 5HYSA 4JRYE 1Q8MA 3ULUD 4PRPE 3MRLA 4PJDB 3GS0A 4B0MM 3EFOB 3JWDL 1DE4B 4K94L 4XO5A 4TULH 4E9XA 3FQRB 4P2RE 3SE3A 4U3SB 1XD1A 3L5IA 1ZK5A 4PSRA 4A37A 1TTAA 1N4XL 1NEZB 4C83B 1LD9B 5H8DA 5HDLA 2DZEA 1L5GA 1RZ8A 3FOLA 1E3FA 1KEML 1S7TB 5LB1A 1W8EA 2X6UA 5I1HL 1QHQA 2DM4A 3CC1A 3FO1B 4NKMA 2HSIA 1DQLH 1MAMH 4UTBA 3V6OC 1LO5B 1I7ZA 3TFBA 3BDXA 3PV7A 5I1JH 2IG2H 1HCYA 2QZ5A 5E8EB 3DX8A 3PFQA 1TJHH 1Y18B 4HIJB 3ROLA 4KZEH 5F72S 3TYFA 1CG9B 5J6GA 4NI3A 1A4KB 1UURA 1MNNA 4FI7A 4KZ0A 4NQTA 1A5FH 2CO7B 5B39G 5C3IA 5ICUA 1HL5A 3S8GB 1GXEA 5IQ7L 4DUXA 1UD5A 1FH2A 5EO0A 5C07E 4GRMB 3W11D 1NCAH 2CR6A 2GG1A 2MKWA 4FQXB 4Q9RH 5KJRH 4Z76B 5GGTL 2Q2LA 4UBDC 1ZLEA 1OEZW 3OB0K 3CN2A 5D7LD 3LYRA 3TO4B 4WEBH 4KKNA 1FO0A 2HA1A 2MQCA 2BK8A 4N1CA 4ZFGL 3MRNA 1UWXK 5IVOA 3QO1A 3L1OL 5H2BB 3P11H 3N1PC 4X7SL 5GGRY 3UCQA 3K46A 5I16B 1FFRA 4HWEL 4HJJH 5IV2B 3P69A 1TJXA 4CVZB 5D5MA 1GGBH 1ITCA 3VXMA 4LLMA 4F2EA 1U95B 2A7BA 3GBMH 1EHNA 3KLQA 4FXTA 1RIVL 2ZXWB 4L3AA 1BFVH 2MHAA 4O58H 3TA4D 4BZ2H 4LCYA 3BISA 2RB8A 5CZXC 4YDKH 4DGIH 4WFHD 3O2VL 2P80D 4RZKA 1U3HB 4I0PC 3GKWL 5IOPA 4LQFH 4IS6A 4RZCA 4B97A 4IBWA 2IBZY 4O51A 2FTAA 1CE6B 4BA0A 5CKGA 3RZCA 2YD9A 2LAAA 4Y2DB 3OJVC 3HI6H 4JPVH 1A9EB 2CALA 4I18C 2E6PA 4A7SA 5CFAA 3DLQR 1S7RA 4FFYL 3FT1A 3QUYA 3D18A 3FYEB 4MJ6B 2XFGB 2J8HA 2ESVE 2VLKA 5HDBB 4WTZG 4PG2C 2OBGA 5E4AA 1JFQH 2WP3O 1MI5E 3V4VH 1HNFA 5I30H 5B1AB 4HXBH 5JO5B 4Y9EA 3X14B 4APXB 5D6CB 4BD4A 4XPTL 5JHDB 1QLEL 5BW7C 4I3GA 1TU2B 2BNRE 1IAOA 1U8CA 4AH2A 3DKHA 3V6FB 1GY1A 5FC9A 5DHXB 3BUYB 5C0GB 1MWOA 4DGUA 5DGQA 3VGAC 5I19L 1Z9SB 2ZCKL 3OKKB 3PDOA 4P2YA 1MOEA 3MMEA 4YBQD 1S3KH 3DYPA 4KK9D 2VXVH 3BZ4B 3QJFA 3KLDA 4UIKL 2GHZA 1NJ9B 4CRPA 2D0GA 4Q9QH 3OKLA 3TZVB 1T80A 4Y4FA 1H3VA 3B2VH 2DMHA 2IAMB 4EI6A 3ARED 1EBPA 4YSCA 4M7LT 5I9QB 5IHHA 1EDQA 5LVEA 5IFAH 1QRNA 1WBZB 5ITBL 3T4YB 2WQAA 2ZWZA 1S4IA 5FYLL 3AADB 1CGWA 2DDQL 2CBPA 4Y4KD 3T8MA 1MIMH 4F7EA 1DBBH 3HPLB 5E6ZA 1JCKA 3ZKMD 2EILB 5C0BE 4JEGB 3G6JF 3IAQA 3ULUF 1H8LA 2TRHA 4LCVA 3PQYA 2IH1B 1CXFA 3MOQA 4XVSH 1E2ZA 4ZS7H 4P3CH 1XF2A 1EAPA 3G04B 1RZJC 4EZKA 3NJMA 4W4NA 5I1IL 2ALAA 1KG0A 4G43B 3SQBB 1R5WA 3CHSA 3QZPA 4NO5A 3UH8A 2XKNA 3DI2B 4RVBA 1MW3A 3O45B 5EUOA 4EI5A 3CVDA 3GI9H 1T89A 4ZMWA 5CZRA 1CPUA 1HSAB 1W6WA 3NIGF 2YEZA 2OLDA 4HX1A 4OLEA 1VFOA 2LFGA 4PWJA 5T1MB 3JTSA 3Q1SL 3MV7D 4NQEE 3DBXB 3M86A 3BD3A 1DBKL 5F3HA 3RVVC 1DQJA 3QYMA 4FKKA 2AVFA 4DZBB 2I9TB 2GJ6E 3FB6B 5L9DL 2VDMB 4PG9A 4F8OA 5I5MA 2UZXA 4M4PA 3GSQB 4Y7MA 1BYPA 3RWDB 3US1A 2R0WL 4BSVB 3RL1B 3ZO9A 4KZCA 5C1MB 3W37A 2D0HA 1AH1A 4NC0B 4DO6A 3GMOA 3D2TA 1QHOA 4UQ2A 3V9EA 4O00A 4JFDD 4WI9A 4YVNA 4WSJA 3WGUB 1CTNA 4JFSA 1KB5H 1OE1A 1I3VA 2CGRL 4GQRA 3KGTA 3BX7C 3VQMA 3FAWA 3EOBA 3FTXA 4TULL 3MC0A 1JZ3A 3MNVB 4OLUL 5K9JL 2WOYA 1A6UH 5B38B 1L9PA 4NAQA 5EZLB 2D03H 3ILQC 3TBWA 1YMMA 1ZY9A 1SYSB 3D05A 4ZQKA 2XBTA 2W0LA 5AVYB 3TEUA 2IOIA 3QWQB 4NLAA 2XJLA 1WBYA 4YHOH 4TVUA 1RURH 2D2OA 4LSQL 3QO0A 2YOAA 1NAMB 1N0LB 3HAEH 5F70A 4PIRF 5F1NB 1HHJB 1F1AA 3P3YA 4O5LL 2DQIH 1ZLWK 3KLLA 1J1OL 1FVEB 3IN2A 1EEZA 1A3LH 4MA8H 3T6QC 1KIRB 2NDGA 4M7JH 5GJTL 4GIPD 3IPEA 1Z1WA 2FJHB 3QCTH 1WIPA 4TNVF 7FABH 4QHUA 1IFHL 4LLYB 3ESNA 4OCSH 5CILL 4Q6KA 5KSBA 4XH2A 2W9EH 1CDYA 4KDVA 1NFDE 1YN6B 4ANUA 1DJZA 4JDEB 4GIOA 3KJ4C 4GG8B 3EBAA 2QADC 4W9DC 1IAIH 5D1XC 5DFVD 3ULSB 3P77A 5IBTL 1YMHA 4DPRA 1K4DA 3HCVA 2DYPD 3GDBA 5TDOB 1E2WA 3NP3A 4TSBL 3MI6A 4J27A 4UNUA 3LV3A 4GRWF 1DQQB 5T8IA 4NGHH 1O9VA 1AIFB 4ICWA 2JTDA 2R15A 4EN3D 2PR4H 1N6QH 4X0NA 4A2LA 5GRUL 4WTZA 3L3JB 1IARB 2BVQB 2R27A 5DJXB 4HDIB 2N3JA 1U8LB 1JGEA 2GCYB 5EBWA 3QXVA 5C70A 3GJFH 3KYMB 3R7QA 1JVLA 3ARGC 2XIBA 5IHBA 3PGFL 3MYZA 5TH2A 4PGZA 2J5LB 3LRSB 4PCTA 5MHSE 3H2QA 4Z7VB 5JZ7C 1MWAA 4I2XE 4WWKC 2P26A 2VQ4A 4DSYA 1EPFA 1YPZE 4PB0L 1BOYA 2A6DA 2EEDA 3KBPA 1T6WA 1AXTL 1MDTA 2ZSVA 3S7GA 4CAGA 3KGUA 3P2DA 3AWFA 5C0AE 3RUGE 3U0PA 2ZX5A 1KJ2L 3NJKA 4WNSA 2K4WA 3K6NA 2KPNA 4F8TA 4CADA 5J1AA 3AS2A 3SD5A 3HZMA 2D7OA 3U6XS 2CK2A 4XP5H 2X4RA 1N6UA 3QIUA 4IHOA 4BXSV 2ALWA 1FPTL 3CMOL 2G4EA 5ESVB 4NWUH 4NXKA 3GS7A 1E6OL 4M6NL 4DN4H 4I48B 4AQ1C 4WY7H 3EH2A 3F7QA 4JFYB 4JZJB 2QR0A 3E0GA 1K5NB 3S5ZA 2Y22A 3QH3A 1QSFB 5EN2B 3AXIA 4ZI8A 3HRZA 1JD9A 3CVCA 3BGFC 3CFMA 1H5BB 4Z1PA 3OKNB 1MJJA 3EDEA 4LBEB 5BXFB 1OAQH 2VZSA 2WZPD 2YMTA 1A1NB 1NGZB 1T6VN 4POUB 3LY6A 5EOQH 4PRIA 5J1SC 3ML9A 2IWEA 4W9HC 2DKUA 2UXGA 4DKFL 1YA5A 1Z5YD 1ED3A 4TNWK 4XCNA 5D9SB 4OZFH 5KVDL 1T04A 5F3FA 3B2VL 5C09B 3UIZA 3RWIB 4PWIA 4JY5L 3RWCA 2GTWA 2H32H 1F90L 2MQGA 3DRQB 3HG1B 1JWUA 1OANA 1XF3A 5IFAL 4GIAA 4JFEA 4FLQA 1D5RA 1IFRA 3HEIB 1FI8C 1FFPA 3BVDB 1XO8A 2ZSWA 1AHKA 3G08A 2EADA 4JN2A 4CU6A 3B9VA 2QVMA 2XNAA 3MRJB 1KC5L 1VCBC 1TDQA 3BP5B 1GZHC 5IJKA 4PJGE 3FL7A 3S5YA 4PJEB 4FC3E 4RSYA 3C6SA 1QWUA 3FN9A 3QA3B 2D4FA 4PJ7A 4AIZB 1HCZA 2DQEH 3SE4C 1KF9B 2VLRB 3K1KC 3ZDXB 3BKJL 1HYSD 2F68X 1P6AB 1WF5A 3OJMB 1H3PH 4P5SA 4MAYD 4L8BB 5GZNC 3DPDA 1ND0A 1QUNB 1XF5B 2J1YA 4Q0XH 4RETB 2WUCH 4XCEA 4UOJA 4AW7A 4WHYH 2DWEB 5E8PB 3BRGC 1AR2A 1V05A 5F0PB 1G9NL 1NCHA 1O7VA 3L08A 2X42A 1DQIA 4UQ3A 2BMKB 2XETA 3U9PL 4ZYKA 1BG9A 2A83A 1G7HA 4X7TA 1BZ7A 3KPPB 2YRZA 1WE5A 5E95B 2R8SL 4AUYA 2H41A 4M1DH 4XPGL 1PF3A 5I1CL 1ZE3C 3GZPA 1JCVA 3IXTB 4F5CE 3B5HA 2EC9U 4WJ5A 4KVCL 4XVTL 4MJ5B 4WWOA 2X0WA 2UZIH 1FNFA 2MMXA 3U7YL 1JYWA 1JF1A 4WSKA 5DLMH 1KTDA 5T5NF 3T71A 5HI3C 3FTSA 2QSCL 3IAPA 2X12A 2WYIA 2A73B 1AGDA 3GXIA 1OGAD 1CXKA 4TUOB 4I1NB 4AYMC 4NKDB 1Q0YL 3O8XC 1TTFA 2W81C 1QSEA 2CIIA 4MJJA 4IDJL 3FQUB 5J3HC 2QGDA 2AP2A 3CFEA 4YHIA 3BPCA 4B9JA 4HXAH 1I31A 2Z8WC 3BPOB 4RGND 5E6UB 2C9VA 1UACH 1SHXA 2YHGA 3TYGH 5IJBC 1RLWA 2FECI 1BZDA 2KZKA 5C0DA 4QYOB 2EIZA 3AB0B 5FKPA 1BJ1H 4W9LC 5C08A 3PWNA 2E9WA 1Q9WB 4WFGE 3L9EA 3LH9A 1E9PA 3JT2A 4XBPA 2GYSA 1CL7L 4Z95H 1I9EA 1MPAH 1WCBA 1NA8A 2BOCA 4XC3L 1UQSA 2JK5B 1MKFA 3IFPA 5HGBA 3L5XL 4N6RB 2BJMH 1NCUA 4IRSA 5ID0B 4P5KB 1N12A 4FZ8L 5HHPB 3RURA 3ZK0A 3MUY1 2L7UA 4G8FB 4JUTA 3D3VA 1TZOA 2BVTA 3GXPA 4LDOB 1CLVA 1GZQB 4YDVA 1SEBB 4D3CH 1HX0A 3L3IA 3PXLA 4OB5L 1T1ZA 3QNXA 5IF0B 4BJLA 4PJHA 5DK0A 3BFWA 5C0EA 3MNMA 3NJHA 4EKJA 2IQ9H 1JK9B 4OFKA 3GSXA 3ZE0E 4CL7A 5I1LA 3P3SA 3PUUA 3OAZH 2PYEA 3S3PA 4AVJA 5EU5A 1G7JA 3LH8A 2E8ZA 4CU7A 3UTOA 5EV7A 2X4TB 2W07A 3TP4A 1BXVA 3DX4A 3JZ7A 4PFEA 3V0FA 1KMGA 2ROYA 3VYNA 4ZAKA 1XIWB 5CEZE 4BFRA 3WY1A 1WUZA 5EZOL 4G42B 2OMYB 1ZVSB 1MSPA 4DAGL 4JO2L 1MH5B 3SZ6A 2J8UF 4U1JB 4QXUL 2BNQB 2CDGA 2O5ZH 1G4RA 4LLVA 1X5MA 3LMJL 3FCSB 1AS6A 4NQDA 1YEEL 2YPKB 1RZIB 4RISL 5ISZE 3VQ1C 3PWVB 4XPBL 3CCHB 3CZFB 4I0PB 1QR1B 5IGXL 2CPUA 2B5IB 3DVGB 3WNOA 3RVXD 1F6AA 2YD8A 5IQMA 4KKRA 3P54A 3KBFA 4XO4A 2H1PL 4HGKC 4MWFB 1OSEA 2BS71 1GZPB 3DXAB 3OXRB 4IBYA 5E51A 3ZYOA 3HI5H 3EYVA 5B1KA 4LVOC 3VTMA 1F41A 1GYUA 2DLIA 2QSVA 4RRPA 2J1XA 3FSZA 2BW5A 5ALCL 3GMLA 1JXFA 1T2QH 4QUOA 1Z9MA 5EIQA 3ABMB 4ODHH 3U30C 4PJBF 5C0IB 1BHGA 4Q74A 1N19A 3NSCA 3RWJA 4MCZB 4OD1L 4KROB 3ZT6A 2OYKA 1YYMH 5CJ8A 5AKTA 5IT2H 3KLHC 3FT3A 3HN8A 4L8CA 4JHVA 4YGVA 1C1EH 2ZPKH 5EOTA 1A3QA 1KUMA 3ZKXC 5D2NE 3WKML 1EVUA 3JTTA 1V3MA 3PREA 1Q4NX 2VIRA 3UGEA 2BLFA 5BO1H 1ZS2A 4DQOH 3GLEA 2OM5A 2ADGB 2CGZA 3P2BA 4PV9A 1ZT4B 4Z23A 1DCLA 2AEWA 4WNQB 1B4LA 2XVLA 5FK9B 3DX9A 3IRPX 2K3TA 5I8EB 2J3SA 3WXVH 2IGLA 2APXA 2VRAA 2J6EH 3BD4A 1U3NA 2VXUL 4P3DB 5DZJA 3PP4H 2H0PA 2BSSB 3GMMB 1LQSR 1AD0B 2MCPL 3FQNA 5DMGC 5L4JA 5B3JE 1HTYA 2CR3A 3ARFB 1EUTA 4GUQA 4JGUA 1ICTA 1F0LA 1W80A 2V3FA 2G60L 1TZHB 4D7BA 3JQOB 3R8QA 3VXOB 1D5BB 3GUTA 4PJ9C 2E9BA 4WV1B 1MCWW 3MZGB 1UWGH 4PS4H 5CS7A 1QASA 2WLLB 4MGXA 3GSWB 5D8JH 5EWIL 4OKVB 4FD0A 2JLPA 2FGWH 3K4AA 3ARBC 1CFSA 4PJXF 5C86A 4MMXA 3EJZD 4Z5RA 1AQKH 1Q72H 4WGKA 4OW6A 3RZCD 2FJUB 2XDHA 4MSWA 3QI9C 4TNEA 4R0LC 5FO9A 4KV5F 3QPXH 1RUML 4QRTB 3QUYD 4XHJD 4PMEA 2C9QA 3SKOB 2VLKD 4X5LA 5IEKA 4N0CD 4X6FB 2IBZX 3O3AB 4ZFFA 3NFNA 3MJWA 3ILPB 3EHBB 1DFBL 1U8PA 2XG5A 1ZGLP 4F9LC 1BM7A 2PO6C 2VW4A 5H94B 1FFQA 5CJ5A 3H1ZA 3GNML 5CEZH 5AQ0A 2W0FB 2AW2A 5LBGA 4PGDA 3VYOA 1GS6X 5DVLA 1BW8A 4G6MH 1JAEA 3WY2A 3I6GA 3I6LD 4XI5C 4PLKD 8FABA 5IOKA 1U8OB 5MENB 2NY2B 2VR8A 1VPOH 3H7LA 4HIIB 3PRZA 4RBPK 2WWKT 4B53A 4Y4FD 3TBYB 5L88H 1BFTA 2FX7L 1PY4A 4A55A 1SXSA 2UXVA 2Z93A 1TJGH 3NP4A 1FNGB 5DD5H 5FHAH 1E9QA 1QRND 2WIIB 1DEEA 3FO2B 2CXGA 1IEAB 3TA3C 3PP3H 2JCCA 3L54A 3RGBA 1YEIL 3K3QA 2NY0B 5EO1A 2JJSA 1NKGA 1DN0B 2CK0L 2J7LA 2NUPB 3PQYD 5GSVA 4Q14A 5CEYA 3RFRA 1UYWL 1A1OB 1HH6B 4JFQA 4JKMA 4XXDB 3HZKB 3SCMA 2HUEA 4FNSA 4QTIH 4DW2L 1SY6A 2NZ9D 3L48A 1WS8A 3M1CA 5A1AA 2O5YH 2CAKA 4NNXA 4JCWA 1CTOA 4V1DD 3GMRA 1BVKA 3C6LB 1QI5A 1S78C 4EI5D 5IFHH 3X13B 2FATL 4L2LA 3RGVA 4EF3A 2QADB 4MD4B 4P06A 4S1RH 2IAND 2H9GB 1Z3GH 5JW4R 4YOKA 3ZZLA 2ZUXA 3C08H 3S34H 4DKDC 1QYGH 4F58H 2A9AA 3ECBB 2HRPH 1IM3B 4K2UH 4NQSA 4HIXL 3GBLA 1AZRA 2DTML 3BMVA 5HD8D 3GI8H 2R0KL 2LE9A 2W65A 2CGYA 4PJFB 5T1KA 3Q06A 5CHNB 1ZA6B 4JMXA 4PWKA 3CUPA 1P7KB 1X7SA 3L4TA 5GGSY 3TJEL 2XQBL 1P4LA 3O4LE 3QJHA 5HJ3A 3TN0A 4QY8B 4P46B 1OW0A 1L9RA 4G59C 2AJ3B 2X4OA 4KNQA 4GMSL 1N59A 1ZJAA 4XBEH 3AM8C 2P42B 1SLXA 1CGUA 2H26A 4NBYB 4OUUB 3BH9B 2QKIA 3TFKD 3WN5C 1BZQK 2HKAA 1J0YA 3TJHD 3IXAB 1U93B 3C5ZC 4MYWB 4PJ6A 1SHSA 2B39A 1JMZA 3MBEC 3CDGB 3P3RA 2AANA 1BF5A 3DROA 3MCYA 4GAGH 5FA3B 5I1GL 2GITA 5D5MF 2IV8A 5AW7B 4UDTA 1BVNT 2H4EA 5C8JB 3CTTA 3ZTDC 4OAWB 1BQLL 1ZHKB 1LE9A 3X1EA 2COVD 3QXTA 4FQPA 1ZAGA 3UO1L 3UTTD 3WS6A 3TESA 3B56A 2X4QB 1WZ1H 2Y0SA 1PZ5B 4N9GB 1FNHA 1I7RA 5ADPL 2GIYA 2PKDA 2K1MA 3FB5B 4ZUSA 1DJGA 3O11A 3P0YH 4JO1H 2ZXQA 4XB8A 2VM9A 4CKVX 4UMSA 2V4LA 2XQYK 4WW2A 4DWHA 4XBMA 5TPWH 2XVGA 4UIMB 2O6CA 2Y7OA 5ANHA 4DQOL 4WAFA 4CBPA 2A6KA 4JG9A 5HGGS 3F6JA 3IWVA 3GHBH 1SJEA 3ISYA 3UC0L 2CJSA 1XB6A 2J4WH 3WXVL 2BO0A 2K6WA 3M7OA 2VKXA 3C9NA 1WC7B 4K9EC 4MNQA 5SX4H 4MMYA 4Y7OC 2DQMA 2NY5L 3HN5A 3TC9A 5CIPA 3G5VA 4KRPD 4BUHA 4Z7UF 3P4OA 4HKZB 1A4AA 4CN1A 2FRGP 4CW1A 4GXUM 5CLYA 2AV1A 5DRZA 4AY0A 4B9KC 4GXVH 5I71C 2E9JA 2VDNB 3ZGIA 2X2HA 3GSNL 3S8WA 1U3ZA 4JLRA 2IJ0C 4QWWD 1E40A 1YEGH 2HG5A 5F89B 2YARA 1Y6NR 3CAFA 4OCYH 1M9WA 5F9WC 4D8PA 1BF2A 1MNUH 3B5TA 4OF5A 2A4EA 3KCPA 1OWWA 1Q72L 4PP2A 1JDCA 3UG3A 4RX4A 1MW0A 2EDOA 1TXKA 3ET9F 4OZHB 2EAEA 5HVGB 5IMOB 1JWSA 4NC1E 3RPBA 4X9HA 5IR1B 2R7EA 4K71B 1W0VB 4XCFH 3M8OL 4ZFZA 2FT7A 5HGAB 4FMKA 3QIUD 3NIFF 3UXFA 2KHAA 2QQLH 5BZWB 3WNPA 4QHKI 4X5PA 3W11C 4OGAC 2YRBA