3II3A

Structure of orf157 from acidianus filamentous virus 1
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
150
structure length
150
Chain Sequence
SVVEYEVVSKNLTSKMSHELLFSVKKRWFVKPFRHDRQLGKLHYKLLPGNYIKFGLYVLKNQDYARFEIAWVHVDKDGKIEERTVYSIETYWHIFIDIENDLNCPYVLAKFIEMRPEFHKTAWVEESNYSIAEDDIQMVESIKRYLERKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ORF157 from the archaeal virus Acidianus filamentous virus 1 defines a new class of nuclease
pubmed doi rcsb
source organism Acidianus filamentous virus 1
molecule tags Dna binding protein
molecule keywords Putative uncharacterized protein
total genus 39
structure length 150
sequence length 150
ec nomenclature
pdb deposition date 2009-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11646 DUF3258 Protein of unknown function DUF3258
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.2930 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 3ii3A00
3II2A 3ILDA 3II3A 3ILEA 3VB8A
chains in the Genus database with same CATH superfamily
1CU4H 4E36A 3WG7B 5DWPA 2ZSVA 4AKQA 4YHIA 5BRZD 4BINA 2VR6A 2NNXA 3IJHA 1RMFH 1JUFA 2DYPD 2OSWA 4LHUA 4GKNA 3D5OF 4N68A 2PUQT 1NDMA 2XWXA 4J3OC 4GRWB 3MRMA 4LSSL 4M7ZB 1UM4L 1FYTB 4U1NB 1HIML 3DMMA 1N2RA 5J9PB 2W81C 1AYOA 4L4JA 1KB5B 1HZHH 1A3ZA 1KLUB 3ESMA 4KJYA 2IFFL 1UHVA 4XNYH 4Y2LA 2WLZA 5F44A 4ZD3L 4P5KB 4QRQA 2WUBH 4ICXA 2QGCA 5AWNH 3SOBL 5I15H 4JM2C 2KH2B 4RAUA 3ARSA 1NIAA 4PB0L 5DK0B 1E9PA 4EDWL 4C83B 3CVHB 5AB9A 4Y16C 3TFKC 2WYHA 3Q6FA 4IU2B 5IZ7A 3T6WA 3DO3A 4IBLT 1TR7A 2Q8AH 4KTEL 4PTTA 1G0DA 1FFRA 1SM3H 5CJOH 4AK1A 3EYQD 4WKXA 4XNZB 2XWTA 4XPBH 1OWWA 3PV6A 4YDVA 1S7TA 3CFUA 3WEXB 3IDMB 3VMOA 5FWRA 1KIRA 3IPFA 4A7VA 1OTSC 3TX4A 3OV6A 5ESVA 4EI5B 4HLZH 4B41A 3IMTA 2FRGP 3ROOB 4PGDA 1X9LA 4DUXA 3P77B 5EWIH 3ECBB 3QISA 1J8HA 2YFNA 3DK2A 3H4FA 2WNKA 3VRLF 1KN2H 5TGBA 1W15A 1BZ7B 4I3RL 3V6OA 3VVVA 2KMWA 2KLTA 1WISA 3ARBD 3MCLL 5F7UA 3FQRB 1A6TA 4O51A 2P5EE 1XCQB 2DIJA 1EXGA 4MB4A 3VTMA 4KX7A 2E7LA 1RV6X 2PO6C 3MV01 1Q9WA 3NA4A 2QADC 1AGCB 4QHMB 5ADPL 1Y07A 1CYXA 3CZFA 4LMQI 4QJ3B 4X42A 1JDAA 3VTTA 2R0WH 3V0GA 1QRKA 3WNJA 2BNQB 2MPAL 5GZOD 2O5XH 3WNOA 1ZS8B 4J6RL 4I3GA 4D9QE 4XP6L 3O2WL 1OAUH 4JO4H 1AXTH 2JKXA 4NPJA 3FCUB 2ZXGA 1VJSA 4U7MA 2XXCB 5AZ2H 5IF0B 4OD2B 3ISRA 3NN8B 3U9UB 4W9DC 3WXWL 3OAZH 5E7FA 5HTSA 4W93A 3RUGB 3UDWC 3VFNA 4ZMQA 1OWRM 1P5UC 2G60L 2Z0BA 4MQ7A 1TIUA 1HIMH 3QUXD 1HH9B 3PP4H 2DKUA 3IDGA 3KGUA 4M7LH 4NO0A 5C0IB 3OL2A 2VRAA 4LL9A 4FQXB 3BJLA 4Y9BA 3VNYA 1YMMA 2OBGA 4JFEE 5JIKA 4IBVA 3FQXB 1MWOA 4KK9D 2BP8A 4WW2F 2ODIA 3ECVA 2VWEE 1J1XL 3DX2A 3LCYA 5T3XL 2O6CA 3JWNH 4YSSA 1KTKE 2GEEA 4F1SA 4PLKD 1MEXH 4XMUA 2XQ0A 4CJ0A 2P8PA 3SKOA 4F15C 1BVKB 4JDVA 4U0RC 5DK3A 4WU7A 2PLTA 4P46D 4QRQB 5E6SB 4S1QL 1P2CB 5CGMA 1KB9J 1P0SE 1VZHA 1T2QL 4ZPVA 1NGPL 3LDBB 3IGUA 5IJKC 1N64L 4JY5L 5EZLB 3FAXA 5EUOE 2HTKC 2QFPA 2YC1A 1OZUA 1ZSDA 2QVMA 2YKKA 4I3RH 4UNUA 2K70A 3EGSB 2OAAA 4GFXA 2C1PB 2BK8A 4UYQA 3VWJB 2JJTA 4NLAA 4DEPB 3RNKA 1TJHL 1N0LB 4XC3L 4AQ1B 1LK2B 3W3BA 4F7CB 2Y36L 4GSQA 1Z9SB 4XN9A 2E75C 4B9JA 4PY7B 2HA1A 3MNZB 5KUKA 5IB4A 4FEIA 2R0KH 1QLEB 1KGXA 2WBJC 1DEEA 2Y2WA 4PJ6A 4M7KH 2X3CA 4A2EA 3QDGA 4ZPVB 1IIKA 3KAAA 4PSPA 3TBSA 3WV0A 2H9GA 1OAUL 1H15B 1NDTA 3GBEA 4P5MA 4WO4C 3QXDA 3UTPE 2Y5TB 5T3ZH 3U4BL 4YSDA 4XRCA 1ASQA 3KW8A 2MPAH 4HXAH 4GG8B 4M5SA 1PLGL 5ALBL 1HKLH 1MW1A 5KAQG 3C87A 3KBHE 3TA3C 2Z7ZA 2VAAB 3H3KA 5AENA 4XP6H 3GMRA 1AZBA 3BFWA 3SQRA 4WK4B 4CUCA 5ALCH 5KG9B 3BAXA 2VXTL 4OZGB 2BXYA 4R0LC 4ANXA 4QXWA 1MRDL 4XAKE 4ZW6A 4N20A 4AGOA 2NT1A 4Y4HC 1YUHA 3CXFA 5JOFA 4NUJB 2L7QA 3ZQWA 4DJMA 1L5GB 7FABH 3UC0L 3KPOA 4AYEC 1XBRA 2ZICA 4IEFA 4R0LB 4G80B 3LRMA 3NIFB 3NSXA 3TVMB 1BQKA 2X4TA 3VGGA 1GS7A 1HHGA 3QULB 2YD5A 4A7TA 4OQ1A 2F18A 4K9EL 5C0BE 5EOTB 3G6DH 5I1CL 5ABZA 1QLFB 4K7FA 4UQ9A 1ERNA 4NO2B 5CM1A 3B5TA 2WLIA 3IFLH 3O9WB 3U82B 4G1EB 1JZJA 2R8SL 3T0EB 3C2AL 4E68A 3VSTA 2HVBA 3UYRL 3WE6B 5IWLC 1MPAH 2OP4L 3QRFM 2ZKYA 1BZ9B 1R33A 3BESR 2NY3C 2VMJA 3X14A 4XAWL 2OMVA 4M6OL 2OXHB 4XBEL 5DK2B 3LAFA 3ZDZB 4GQ9H 4DPBX 1XH0A 3NZUA 5I19H 3D0LB 4FEMA 3S3SA 4PJBE 1G7QA 2DWEB 3EYFA 4TSAH 4Z7UF 4ZYKB 5F9WB 1BBDH 1IFHH 3L7FB 5CIPA 4ERSL 4LARL 5GS0H 2YPKA 4MX7A 4XPAL 1CUOA 3RPIB 3B9VA 1DLFH 1L3WA 1EO8L 4ZNEA 5I18L 1LLAA 3GBDA 3MRCB 4M6NH 4N3UA 4A7GA 1FNLA 3LNEA 4FNTA 3NPSB 3O2DL 1A6AB 4FXKB 1F0LA 1S9XA 2ZKMX 2RB8A 5LNDA 3L8QA 5C0ND 1S9YA 2X2HA 2ZUYA 3UADA 1IBGL 3SE8H 3BWAA 5TD4A 3TFKD 1OO2A 4PY8J 3SD2A 4NN5B 4OCSH 5HI3C 2X7LA 4PCTA 2YIHA 2ZKXA 4JO2L 3SE3A 4HJTA 1KC5H 1W0VA 3W82A 3SDAB 2XA8L 1FG2B 4DGIH 3UYOD 2W0PA 2WSDA 3KEHA 1NCGA 2V17L 3MLRL 3OG4B 3SKJL 1K2DA 2AABH 2E9BA 3RWGA 1CXIA 3REWA 3SY0A 3C5ZC 4FULA 2V9QA 2QPFA 2IPKB 3NJVA 2JK5B 5DT1H 1AVAA 4MCYA 3VI3A 4APXA 4P9MH 4HS6B 2CLZA 2GFBA 2Q20A 3B6SB 1N7ML 4GMTL 3VA2C 3I9PA 4JDVB 1NC2D 1T1ZB 5I6LA 4I9WD 1JGUL 3V79C 1MIEH 1NBCA 4PRNB 4YH6A 1DVUA 3F7KA 3BFOA 3FBQA 3T6ZA 4IIZA 5IBTL 4HALA 4PG2C 2AJSH 2YLHA 4OBSA 3HCVA 3BKML 1MFDL 4QT5B 1OTUC 1CFTB 2VQUA 4UDTB 4G8IA 4BIKA 4KO9A 4XN2A 3BVDB 4PJ5D 1N8ZA 5A7BA 2YPVL 2IWGA 3A22A 3EO9H 4MS8C 4Z7QF 5K9JL 1WZLA 4OLVH 4PJDF 3MV8B 4MMZA 5AW1B 2X6MA 3U7WH 1JRHI 2VLKA 2N7SA 3V2AR 2Z34A 4PJFE 5GGRY 4X0KA 1GVIA 2EIMB 4HKBB 1DTUA 3WMQA 2EC8A 1XV8A 5LG1A 3WFCH 2OK0H 2AK1L 2PPAA 3FUMA 2UZXA 3MRBA 3L9YA 5SWSE 4X5WB 4DGVH 1R3KB 1E6OH 3BKJL 5E1HB 3UTZB 1J8RA 3CLFL 1RSFA 1JGVH 4YWGH 4Y5YA 5LGYA 3V8CA 1EXUB 1V3MA 2WZAA 5AKTA 3BN3B 2E8ZA 4PJEE 3BZ4A 2DLTA 5BJTB 4YHYB 4Y5XB 1XZ0A 3D52A 1DYZA 2JTDA 4N22A 5EUOB 5B1AB 3RA7L 4YO0B 1GJIA 1DQJA 1RUAL 4E41B 2MCPL 5EZIH 3GIZH 3EGDA 4IDLA 4OLYL 5GGQL 3V6FA 2VDQH 3MR9B 5E1AA 4PJXB 2NUTA 2B1HL 3QEGL 3QIUB 5T33H 1AGDA 5FA4B 1FRGL 4ZS6C 3CFNA 5C0BB 4H8WC 1O5DT 5BQ7B 3MREA 4V33A 3IGAB 2JB5H 2LHAA 1BIIA 3NJGA 4YHKH 4R4ND 3BUYB 3MBXH 2I9TA 1E4WH 2OL3L 2OCCB 4PIBA 3SCMA 3Q1SH 5CILL 3UJTH 3RE0A 1IGIL 2RACA 1U3HA 3BT2L 3KLAB 4N1EA 2FIKA 3ZHDA 2R2BA 1K8DA 4XI5D 4Q97A 1R47A 4QMEA 4CGTA 3CVHA 4GFTB 1WPCA 3D39B 1HAWA 5F6IB 1KENH 3AWGA 2Y6TE 1AQHA 1QVOB 1FHGA 1AGDB 3DIFA 1J87A 4JFFA 2YUVA 1QSEB 4TL4A 1MLBA 5EO9B 1LP9F 4LLYA 3W9EB 4DGYH 32C2B 2B59B 1J5OH 3ATAA 3L4WA 4CNIB 3IJEA 1UWXH 4Z3GA 2BRRH 2HYMA 1UURA 4DP0X 5AD0A 4YDLB 2WNGA 1IM3A 4N4YB 1NAMH 3V5DA 5DRWA 3QJFA 5CGBA 1NL0H 1S6NA 2V2XA 4KAQL 4WNQA 5AVRB 3ZPDA 4CBZA 4JQIH 5ID0B 4IRJD 3ZUNC 4KK5D 1J0ZA 1X5LA 3IS0X 3U30C 3WLBB 3BLKA 1T0MA 4HP5A 2GITB 4Y4HA 2R4RH 4EVNB 2O26U 2IV8A 2BPBA 3GSNB 1AIZA 1OE2A 2X28A 3V0EA 3ELAT 4LGPB 4G8FA 4HW6A 5A2LH 3D25A 3HG4A 2IH9A 4DN3L 1IFGA 1AZCA 3JYBA 1SLXA 3I02A 3OG6B 2VSDA 2BCMA 1EFXA 1YEIH 5JUEL 2E6QA 4YBLB 4OGYL 5IQNA 3MRQB 4FNQA 5DRXA 5AL0A 3H3PL 5DJAA 4X9GA 2GIXA 4WI4A 4POYA 1KB5L 3CFDB 1HYSD 3HC4H 4G8GE 2UX7A 3EADA 4U2ZA 1HEHC 2XT1B 1BAFL 4MQSB 1NBYA 5D5ME 5J6HA 3ARVA 3ES6A 2YFOA 2ZUWA 3FU9A 4OQTA 1R9FA 1X5AA 1UD8A 3T0ED 4U1JA 3EFDL 2PW2A 1KY7A 1MCWW 2DQDL 2ZCHL 3E0GA 2PYEB 1GGCH 1Z0MA 1TEYA 1DBKH 2HTLD 1DO6A 4FQQA 1YMHA 1TKWA 1H5BB 4LEXL 1OARH 4LKCA 4QLWA 4M7JH 1BA9A 4J8RB 3X1FA 1WO2A 4IKLA 5AOKA 3G7TA 4CVXB 4JHAL 2AGJL 3C6EA 4Z0XB 4H25B 3SPIA 4RFOH 4ATWA 4Y2OB 4TM9A 4TLSA 4QHPA 3AQZA 4DTGL 5DGRA 3OR6B 2H3NA 2YGOA 1BQLL 2J6EL 1R3JA 3TEWA 2FLRT 3I9GL 5AVVB 2CUHA 3ME0A 5HGGS 2YARA 1KJVA 4JPIB 4LP5A 4NSKA 1VF5C 1MFCL 3FH5A 4AMWA 2X1WL 3SOBH 5I15L 4N2OA 1DJWA 1J86A 3S37L 5JQ6L 3CU1A 5FO9B 4P2OA 3KPSA 3VFRA 1NL0L 3HG1A 3O41A 4HOMA 5T5FH 3G04B 5ADOH 1IGJA 4M8QA 3ZSTA 2OI9B 3L3IA 3WLWD 5CMAB 4KI1A 2D31B 3V4VH 4F7EB 4OH2A 4MMXC 1LO3H 4HUUA 3MUJA 4M7LL 4D3CH 2IAAC 4AY0A 1JZDC 2ITCB 3T71A 4ZW3A 1L6ZA 1JRHL 1QWUA 2YWZA 1KMGA 5C0AB 4OM0L 2YPLB 5BZXA 4Z18A 1IEHA 3GKZA 3O8XA 5BO1L 1WYJA 3KHQA 3RGVA 3BMVA 3CN3A 1A4AA 3DX7B 4ADIA 4LSDA 3U36B 3VFMA 3LB6C 3RNQA 1ASOA 2IANA 5AVUB 3DWTA 5IB2B 2X2YA 3VD0A 4OLWH 5I9QC 1WS8A 2OMXA 1RZIB 1SJEA 4BHUA 5C9KA 1II4E 3B2UC 3D87B 3G6JB 4WUUD 3L95B 5HJBA 2IGTA 4FTVE 1E2WA 4BH7A 1GGUA 4EN3A 5I24A 1KLFA 3D2UD 1NSNL 3KJ6H 3CSFA 4Y2NA 1CDGA 3MGOB 5E00A 4QHKJ 4J2QA 3WAJA 1TLMA 3AU1A 3ARPA 2VM9A 3FRUA 3TBVB 3MLTA 4OFQA 4OM0H 5FKAA 3QZNA 4J39A 5H2BA 5KYXA 4O02H 3RVWD 3D3VA 5EF2A 1IAIL 1F3JA 2WIMA 4KXBA 3EJJX 4MGXA 3BFQG 1WCBB 3QIWC 3HE6D 3GJEA 3SYPA 1SYSB 3B7SA 2MHAB 2KQNA 3ZLQC 4HUVA 5JHLA 1QBLL 4X4MA 2BERA 3G5XB 4DGVL 1G6RA 3UTQA 4TVPD 2R83A 3RPIA 5TH2A 4MWFB 4GW1A 1KCUL 3WDJA 2C3WA 4G7YH 3GMRB 5HBBA 2VLRA 3GNML 3SDXA 1G1YA 4Z7OE 1S7TB 1UWFA 3RRQA 2LR4A 2P43B 4DQOH 4GBXD 4FQPA 1JWSA 3OX8B 1Q1JL 2Z7YA 4DP4X 2NYKA 3SO3B 3PWUB 4HLEA 2PCPB 4E41D 4HU8A 4B95C 5HHNA 2N1KA 1X5FA 4X7EC 2BMKA 4WU5B 4R4NC 4ZUUB 3AU1B 2DAVA 2DLEA 4QWWC 3KPMB 4DO4A 2WWMC 4HJJL 2EXWC 2VSKB 2A4ZA 4KZDH 4YEFA 1PQZB 1SXBA 5KSAA 5KSUB 2L8AA 4JJOA 4CN1A 4OZIF 3FKUS 3HNVL 3RDTB 4B9KC 5L2JA 4L3ED 4N2GA 3NA9H 1JZHA 1NMAH 3CVHH 1A7NL 4U49A 1YPZF 4YXLH 3B43A 3WJMA 5DMIL 3HMWH 4ODVL 4E42B 1G4RA 4Z8FL 4U3HA 5DJ8A 5F9AC 2V7NA 3P4NB 3ZTNL 3AG4B 4PRBB 3ZDWA 2V3EA 2DQHL 5FO2A 1PNDA 3E1ZA 1VACB 3BP7B 25C8H 1QSED 1TYJA 4O02B 4DH2A 2EDKA 4KXDA 4RAHA 3R0MA 1L7TH 3E8UH 4FFZA 4IRJC 4AL8H 5EMYA 4KHXL 3S2AA 2B08A 2D3LA 2B39A 3NG5A 4YSPA 1AKJB 3IFOA 1JHLH 4LSPL 4QF1B 4MRBA 4JRWA 3MOAH 4PAZA 2VSMB 3JVGA 2EDBA 4J8QA 4QIRA 3BSZH 4Z0BH 3QDGE 3FT4B 3KJ4C 4JFUA 1I8AA 1YJDL 5DURD 1DJSA 3P3RA 5JDSA 2E9JA 2FUTA 1ZT4A 3GB7B 4IIQB 4N8CL 1H6UA 1VZGA 5CSZB 3OJDB 4XNQB 1ORQA 2EE6A 2WD0A 1C5BL 3B2VH 3GHEL 4XTRD 1LGVA 1BM3L 2CHZA 3X13B 2MOQA 5ACZB 3DI2B 3RUGE 4XNXL 4MD5B 1JXJA 6TAAA 4LLAA 2IQAA 1WBZA 4LLWB 4HOXA 3D7PA 2YO3A 3AY2A 2EC9T 1FORH 2QPDB 1MI5B 3VFWB 1PAMA 1IBHA 2HLFD 1RHHB 3BDXA 3S8FB 3PFUA 3F8UB 4ZRGA 5GIRA 5T1LA 3VXQB 1T7YA 4JM2A 3EYVA 4NJAH 4LSPH 3V4PA 1IARB 3OVUB 4UMSA 5C8JB 5KJ4A 2BCKB 1UZ8B 2CBOA 4DKEL 4IMLA 2B15A 2QVIA 1N5AA 1ROCA 3PPEA 4R8WL 3SKOB 5JMRA 3W56A 2B14A 4EN3C 1OV8A 2ICEB 3F7YB 4N5EC 4MRCA 1KN2L 4ZMXA 1S46A 4RCAA 3VGAC 1ID5I 3E6HB 1AHMA 2GUOA 1IKFH 1HCZA 3TCXA 1KACB 3KPSD 4PN6A 3WHXB 2WKLA 3OJDA 1NBYB 4U6VL 1D5ZA 3DECA 3MODH 4UB0L 3ZZSA 5CCJA 2NLJA 1PKQA 1CDHA 1FL5B 4L1HA 4ODXA 2XTJD 3BIKB 2ZTBA 3MRGB 4BK4A 2BSED 3VXTB 4MQXD 5CN1A 3U46B 3MFGB 4RA0C 1NLDL 4UIKH 1TQSA 1AD0A 1DQLH 4FHBD 1XZWA 3HI5H 4GNKB 5D7HA 5INCA 5GGQH 2Z4QA 3AXIA 5F7FA 4I8DA 3D0AA 3I74A 4N2BA 3ARGB 2ESVE 3GK8L 4EDXB 3MBEB 2EJ1A 5IB3A 3WIAA 3U30B 3DSFH 1QAWA 1YQ2A 3KS0H 3GXUB 5F7MC 3WE1A 3TJPA 3QNYB 1Y6NR 4M6OH 3RWGB 1QFWL 2GITA 5FYKU 4EZLA 1RIUH 3F12A 2YQ3A 2HXAA 1NCCL 1JNLL 3DBXB 1FG2A 2H0PA 2BIPA 2C3GA 1UG9A 4WNQB 1MCWM 4LPCA 1HWGB 4K8RL 4PG9B 4QR7A 4PRAB 1DBAL 2PWGA 4G7QB 4NO2A 2GY7B 4UNIA 4LEOA 4XMKH 3ZL2A 3IEAA 3LB6D 2JTYA 4NXSA 5C0AD 2GPZA 3LZRA 5AEAA 3NTCL 4F7PA 4D9LL 4R6UA 5D4IA 4YZFF 4YE0A 2LTQC 3GRWL 3CFQA 4MJ6A 3DX6A 3QYMA 5IW6A 4IKIA 2BSSA 4CL7A 3CSGA 1FGVH 1M2VA 4NO5B 5F7AA 5FGSA 2WYZA 1YNKH 2JE8A 2DKSA 4DWHA 3FN0L 1WWCA 4J27A 4N0YH 5JIIA 1KXVA 2OR9L 4Q2ZA 4TULL 1GHFL 3DGDA 3I6GB 3CUPA 5C0CE 5M7QA 1CYWA 1N12A 3LKRB 5EG6C 1HK6A 3ETTA 4RMVA 4Z7NB 4L4VA 4Q4EA 3TA4D 3A6BH 1P9MC 1Q1PA 1E5YA 5HHVL 4IOIA 2V7HB 2I9TB 3POCA 4FYQA 4BFJA 4QRPD 5I1GH 3PHOB 3FJTA 4ZPTB 5SWQA 4QRTB 2R1YB 3RWHB 4X5PA 4GRWH 1NOFA 3NJIA 1IKNC 2MTPA 3IAQA 1PLAA 4PJIA 2C7UB 2BW5A 4P46A 1MHPH 4UM8B 5JPMA 3V0DA 1JK8A 2F15A 4XMTA 3HLAA 4S0HA 2VDRH 4J3OH 5EEZA 4C4BA 5E2TL 2ENPA 5HYFA 1N26A 4XVOA 1T83A 3P0GB 3ESNA 5EA0H 1CL7H 3EBGA 3TWCH 3UZEA 5BVJB 2WB7A 4Y19A 1VGEL 1EIBA 2Z8VC 1T5KA 3CK0L 1DQKA 3WGVB 3W9DA 5I76A 3C60C 5D1QD 2CKBH 4HKZA 1D9KB 4P2QE 3AWFA 5FYKE 3S96B 4GBXB 1V54B 1X7QA 3MYJA 4G8AC 1D3CA 4BZ1H 1QLRA 2WWMD 3RY4A 1W0WA 5C0CA 3JTTB 2GVYA 2N01B 2WUCH 5FECA 4FI7A 3WSQL 3ZRSA 3FYIB 4PJBB 2ZXQA 3D3VD 5CBAB 4G8GA 1LL1A 4G9FB 1FO0L 2F54E 2IBGA 1WAAF 1JPTL 2YEQA 2NSXA 1UCBH 4GLRH 4ZX6A 1VADA 5ETUA 5DUPL 2ICWI 1GZPA 2COQA 1LILA 4I5BA 3VRIB 1SHMA 1FVEB 3ARZA 4HUNB 2NW2B 2YN3A 2LAAA 3UJIL 4FABL 5EWIL 2X41A 3AT9A 1M3JA 2VWEC 2ZJSH 3HKFA 3QZBA 5IQ7H 2ZE0A 5HGDB 2BY3A 3T4AB 2DIBA 4F7KA 3C60A 1ZWIA 2OSLB 5D2LB 5CCKH 1JPFA 4QRBA 3CZNA 4KQ3H 5E1GA 1G0YR 1CFQB 1XCTB 4MHHI 4WI5A 1JXKA 1FN4B 1M05B 3VB8A 4E42A 5F1NB 1H3PH 4NHCH 2G3XA 4L05A 1N3NA 4OJYA 1KJVB 5LBGA 5L4IA 1LD9A 1KFAH 4PJCE 1U95A 1KCVH 2QT6A 3E3QE 5MHSD 4S0TD 1FVDA 2R29H 1HHJA 4L3FA 4JN1H 1ZV5A 4NQEE 3OR6A 4ZZFA 4LP8A 2OXGA 4XXDA 1JAEA 3LH2H 4PCKA 2B16A 3HAEB 1U8MB 3N9GL 4X7SH 3CDFA 2ED7A 3OMNB 4UQ2B 4HCIA 4UT9H 5CINL 5DURB 2PCXA 2P24A 3MRNB 2Z6FA 4MA8H 4Z95L 3NIGF 4XVUD 3RVVD 1UJ3A 5KTEH 5J6GA 2ADGA 3MRDB 3AREB 4WJKB 1LP9A 2C9UA 5CEYA 4FNRA 1MAJA 5KVGH 5IFJA 1I9EA 3VFTB 1UT1A 2VSCA 5ITBH 3NCXA 2F53E 5EO1B 5ISZA 4LIQH 5LGKA 3KVDD 4C59B 1MG3C 1SDDA 5F2FA 3HLKA 1AZVA 1QX1A 1V7NH 5FK9B 1FORL 1XB8A 3TT1H 4EUPB 3MU3A 4UM9A 1J1XH 2EE0A 4Z9KB 3V7MA 2HWZH 1JERA 1H19A 3V5KB 4CVUA 3GSVA 2LFGA 1FYTE 1E6JL 2XZQL 1IC4L 4KDVA 4LU5H 2DEXX 2BIQA 4YBQD 2FR4B 1MVFA 1RJYB 2AV7B 3PFQA 1QMUA 2DM2A 2G5UA 4WWOA 1KELL 1DVXA 2C9VA 4PRPA 3P69A 6FABL 1P53A 1JOIA 1WHPA 2PW1B 2YMXL 4U1MA 5F7EL 3UX9B 1IGYB 4XVJL 1SN2A 1E9OA 4NP9A 3JWNE 4CU8A 1VA9A 4TUKL 2BZDA 1H9VA 5DRNA 1TJMA 3ZHFA 3AVEA 1ZS8A 1NCNA 2QJDA 4M3HA 1P1ZB 2A73A 3KE0A 1P4UA 3EBHA 4GJTB 5DHDA 1INDL 4DN4L 1T83C 4ZX3A 2EUWA 2WW8A 1I9IL 1I8IB 3BQUB 4M00A 3QA3A 3NH7L 3LRSB 2FVNA 4JHWH 2HX7A 1YNTB 5JIHA 5K5YA 3HE7D 4MTMA 2AJXL 1J88A 2WQRA 2CHXA 1NC4A 2FJFB 4AVKA 3NCJH 1DVQA 4FFZL 4R97C 5F0LB 3WXVH 3LNIA 4YX2H 2ZONA 1E8WA 2IMMA 4IIQC 1BMWA 2A9ML 3NFPA 2IGFH 2VLJD 4Z23A 5ANME 1I7UB 2XZZA 1ZHNB 2QV2A 4CC4A 4CU7A 4KHTL 2A4EA 4P49A 4K73A 2OZNA 4KK8D 4ZFQA 1NCIA 4HIHB 3EH4B 3NAAL 2LFEA 4I0CC 4EMZA 1NANI 1FP5A 5BZDB 1X5KA 3M17A 4NKDB 2OMBA 2J6EH 3O3DA 4FD0A 5B21A 3REVA 4DT2A 1MWAL 3L5WB 1GGYA 1SLUA 1DEEB 1PG7X 3CSPA 3P4LA 4K3JH 1ZA6A 5HYJB 4X2UA 2QGBA 2Y24A 5DHYA 5I0ZA 2F54A 1WT5A 2P80A 4HX1B 4GQRA 1D5XB 3F7QA 4PS4H 4K5NA 5JXEA 5LG6A 3MRKA 3CQFA 4N0YL 5KYYB 2AXFB 2DRUA 4G1MB 5ITFB 1A0QL 2XIDA 1JNNH 3NEOA 3JTTA 2CKBL 2OMTA 3HZ3A 2AQ2A 4Z7QB 1K6QL 4AEFA 3RBGA 4UAHA 2BXZA 3MYZA 4QRPB 3F6LA 1XSKA 1FJ1A 1I3UA 4RGMB 5E1QA 5TDNB 2DOCA 1C8QA 4M93B 5D2LE 3WAKA 4ANWA 3LKQB 4GI8A 1DSWA 2F9BT 2NNFA 1MHEB 4L5FL 2D2CC 1JZ3A 3LY6A 5CJBA 4UOW1 1OP5K 3GUFA 1BQUA 2B1AL 2EDXA 2R1XA 3MACL 5DMGC 1DUZA 4JN2B 1PZ2A 4LARH 4QY8A 2B0SL 5KBPA 2Y7LA 3ZDYF 3TZVA 1PYWB 2J1WA 2X0VA 1NKRA 1P6AB 4NZUL 3ZO0A 2F19L 2UZIH 3FMGL 4HD9A 5JPMB 3FU7B 1JGDB 5EU4B 4JHWL 3S3CB 2OSYA 5JXEC 1TTRA 1L9MA 1V7ML 2X4RA 5D1QB 4FG2A 3UBXG 4C56A 3H85A 4GB9A 5GGVY 3WI9A 1QNIA 4JKPL 3TBTA 2CLVA 4MMYB 3V0VA 1DBMH 3HHMA 2EIJB 3JV6B 3RI5K 5IROC 4OFYA 2IADB 5C09D 12E8L 4UZGA 1AXSB 1DE4A 5CUSH 1CGWA 3HHRB 4CKQA 3BH8B 1I7RA 4LCCA 4NKOA 3ZTCC 3BP7A 3DKHA 4YSTA 4LCWD 3MODL 4AG4H 3LD8C 2UVEA 3MRRB 1RMFL 4JRXB 4XX1E 5AYUH 1KSRA 1DVZA 1HDMA 5E1IA 2K6ZA 5D4JA 3IPEA 1NC4B 3MLUH 3O0RL 5AUMA 4PVBA 3HC0B 4FFWC 1SOXA 1YEJH 2CLRA 3BVWA 4IRSC 4WV1C 1WH0A 4S10A 4GOSA 1CLCA 3LQAL 2HJKA 4PJ5B 4IBQA 4GP4B 5CEZL 2O5ZH 5F93C 2DTMH 3EYOB 2F53B 1OCWH 1OAQL 2AXHA 4L1SA 1KGIA 3O4OB 2R23A 2I5YL 3ZHLA 2XIIA 2D03L 2EIDA 2EH7L 2QQNL 2X7LB 4MDIA 2NTFB 1AR1B 1RHFA 4HU2A 5IV2B 3BOVA 3B37A 4PJBF 3QFDB 1F45A 4J3XA 3SPGA 5I0WA 4TNVK 4QHNB 5BZWA 3OB0H 4JKMA 2CDFA 3IJYB 3MMEB 1QSVA 4K5MA 4X0NA 3X17A 1BVOA 4IRZL 5TE6H 1DE4B 3SE6A 2W0FB 4PTTB 4XMLL 4JM2D 4GIPD 3FFOA 3AWEA 4MD4A 2B77A 3BP5B 1A6ZA 4K55A 3KVPA 3LIUA 4NQDE 4PJ8C 4V11A 4TN9A 1R3HA 4ZO7A 1DVTA 2VGLM 2Y06H 4KZCA 4ZW8A 4CMHC 2EZ0C 4XP9L 3HN5A 3VQMA 2ENYA 5C0BA 4KRPD 4JFPB 1CIDA 3L3IB 3AAZA 1KTLB 3ZE0F 1J10A 3VH8A 2EINB 3ARED 3KBPA 2Z31D 5HGAB 3FSZA 1HJCA 4I4WB 3QIUD 5I8OL 2WZ6A 4W81A 2GJ6B 1WEJL 3EBIA 3AFLA 3ARBA 1FV1A 2DWDA 1OOWA 4UTAA 4IU3B 3EDJA 3PNWB 4NN7C 3AREA 4IMLB 4LMQE 2N56A 1PNCA 1JHTB 4PJGE 1JSYA 2H6PA 5BV7B 5AALA 3TL5A 4NZRH 1RZJH 3SPCA 1TQVA 2J8UA 3JWDH 4BQBA 3B8SA 4ZAKC 1KTBA 7CGTA 3CFMA 3O0RH 3UO8B 4YNYA 1CFMA 2UZXB 2WBKA 4JY6B 4JEGB 5HJ3B 1MFBH 4NRZA 4CDGC 4A66A 2CHWA 2XFXA 5IW1B 1KCRH 4RX4D 5HHOB 3PWNB 3JV6A 3VXPB 3WXWH 3H9SE 4KVNH 5CD5D 2AK1H 3BZFB 5GZOC 4OCNC 5I23A 2GI7A 2NOYA 2WAHA 4Z7WA 1YRKA 2A6KB 2O30A 3DX1A 4KHTH 4ONOA 4GY4A 1MREL 1PJ9A 2X2JA 4PRPE 5EC1B 3ZKSD 4U3XA 1WFNA 3CGTA 4ODXB 4BFOA 5LGJA 3Q5TA 4G8EA 1AHKA 3QXVA 3BWZA 3GSOB 4UQIM 1RZFH 4W9IC 3SB3A 3KYAA 4NZDA 1IGCL 1JGVL 1KBKA 4YWGL 1IE5A 4JM2F 5JOPD 3QUXC 4JUSA 4YLQT 2DEWX 1SXNA 1J5IA 5FV2A 3JUZA 4QF1A 1TUPA 3VFSA 4HC1A 4S1QH 4ZAKA 5DI8B 4A2DA 5IESL 1QTYT 2V0AA 3GMLB 3BVVA 4JFFE 1A6PA 4IYKA 3I6LE 5FCSH 2ERJC 3HNTL 4PLKC 4PY7A 3S35H 2BSCA 4HHAA 5AW3B 3QUML 4AC2A 4JO2H 4Y7MA 2CO1A 1E4XI 1JHKL 4KJPD 4Y2DB 3MJ8A 5L7XH 5KSAB 3O6MH 4LLWA 5DJXA 4UNVA 3FSWA 2IALB 4E9QA 1FFNB 3IGFA 2HRHA 3W9DB 1NZRA 2Q8BH 3DRTB 4F5CA 3CZSA 3RTLA 1AS6A 1U8OB 2ARJA 4AITA 1BAGA 3MA7A 4LSUL 3A3YB 3JWOC 4O2FA 5EO0A 3TV3H 1AMYA 2QQNH 3WIHA 3NSCA 3BEVA 2NNCA 4KJWD 1MCIA 4P9ML 4FJZA 2ZSWB 3DTXA 4XPHL 4MA1B 1BDYA 1TCRA 1V3KA 1WTGT 2EVJA 3NPSC 1AR2A 1E65A 3N55A 4NIYE 4WY7L 5A2FA 1ET5A 1T1YA 5AB0A 3GMOB 5L4JA 4QYAA 4QOKE 1DQIA 2FECL 4R4FL 5I0YA 4PJEA 5I1HH 2AQQA 5JTWA 1TZGH 5SWQB 2EEDA 4KPHH 3ZL1A 5KTEL 1GXEA 1GOGA 5EU3B 4M62H 1YEFL 5I17B 1CD1B 4WVRA 4YMPA 3GQFA 1KULA 4ETQB 4I0PB 1XF4B 3MA9H 1JV2A 3OKMB 1SUJA 2AQ1A 1TJHH 3P54A 1PIFA 1JF1A 4L8CA 4KY1L 1IGFL 2WHVA 3BQUC 2HKAA 1P6FA 3QFGA 4J1UB 1QEXA 5GGVL 2QPEB 3PWNA 2K4AA 1EFXB 3DOHA 4PJAA 4XPGH 3S88L 2BHUA 3K1KC 3WMPA 4U31A 3B1UA 5GS0C 3VB9A 3T0EA 1F02I 2YOCA 3WUWB 2WVVA 1XR8A 3MSPA 4G8FB 3BEWB 4EQ3A 1ZKAA 2DS4A 3DPDA 4PI0A 1GC1H 2GBTA 2MMXA 1WFTA 1RUQH 2BRQA 2FL5B 2RTTA 3T0EE 3TBYA 1BAFH 3CFEA 3DETD 1QO3A 3T8MA 2EH8H 3AB0B 1DFBL 4PJIF 3ZE0B 2X40A 2FBRA 1A3RL 2AZAA 4DOHB 2VR5A 4DF9A 1FC1A 1EO5A 5C09B 5AWNL 2EKJA 2BVEA 2GK2A 1GH7A 3MRHB 4QRSA 4CMMB 3F85A 3W9EA 1A14H 1MDAA 4JMXA 1MUJA 1MDTA 1UH2A 1RJYA 3K2KA 4QRFA 5E99L 4MCNA 3DSNB 1MHHB 1QFUL 5BOJA 4LRNL 5D7LB 1FN4A 5KG9A 5C3IA 1CICD 3ETBF 4OZIB 2FDBP 2E27L 3QS3A 4LLUB 3WKML 1AP2A 1Y18A 4IBZA 4N0FA 4WGVB 3RTQA 4EAEA 2P47B 4XODA 1T1XB 1MFNA 2OTWA 1TJGH 3PABB 2XKUA 2UXFA 1E6JH 1IAMA 5I5MA 3LN4A 5MP6L 4EOWL 3DV6B 5IJBC 2BVPB 3DJRA 4W9HC 1IAKB 2L7UA 3IS1X 4HIJA 4XC3H 3HC3L 4GRWE 3H2WA 1FL5A 4LOVA 2HT4C 4B6ZA 3CFBB 2FBOJ 4GKSB 3IAGC 4D8OA 3GTVA 2FHFA 5K39A 1GW6A 2LLNA 1SQ2N 2F5BH 2ROYA 5AW0B 5HDQH 4RGNE 4RRPM 1GS6X 2P1YA 3OKNA 4NB7A 4Y8DC 3ILPB 4QTIL 1FFNA 4F7CA 1A66A 3K2UL 1RVFH 4MCYB 3QQ4A 4GS7B 3TBWB 3X2QB 2DJMA 5KVFL 4MCMA 4K3DL 3X1NA 2X1PA 4BQ6A 3KPLB 1BFVL 4PGBB 5FHBL 1S5HB 3MUGA 3A4AA 1X7QB 2J8HA 1IU1A 1THCA 1ND0B 2NYYC 2OQJB 1XL6A 4GINA 2AK4A 4YHIB 3BUPA 3HI1A 4HS8H 2DQFA 4MNGB 3UTTD 5CKGA 2LU4A 3EJCA 4GW4A 3WFHA 3ZDYB 1I75A 4G72B 1TKWB 3SN6N 2VXSH 5K39B 4ECNA 5I6MA 4E0RB 1WAPA 4WEMB 3FFCA 1GC1L 3QWRA 5BUAA 4G7SB 3CHRA 2G4GA 3VGHA 4HV8B 3FUFA 3TIEA 5JA9A 1CGUA 3RB7A 4WFFE 5DD1L 3AT0A 5ETUB 1MCDA 3FFCE 4OLZL 1OB1B 2A77H 3PHAA 3VI4F 5I73C 4HKJA 4I0KA 1BFVH 3CSYB 4HUXB 1JYVA 1X5MA 1AANA 5CD5C 3EJSA 2F74B 5JQHC 5F7LB 4EF3A 1GCFA 1G7HA 3GSQB 3UAAA 5FECB 1P5UB 4HK0A 1PZ3A 1S7RA 2B4CH 3BVTA 1MI5E 1WBXB 2DH3A 3CFDA 3HB3D 3NYKA 4M1CC 5HHOD 1S7UB 3KD4A 5K9KA 1FDLL 4YK4C 5LNEA 2ZG3A 2VE6A 4G6JL 3UXFA 5KJ7E 2E74C 5KW9H 1VEPA 5DZOA 3ETSA 1QNZH 2J1ZA 1MAMH 1A3LH 1ADWA 2EIBA 3QBTB 2NY3B 5JPNC 2JK5A 1HEZA 1SJHA 2FHBA 4NOBA 5DGQA 1FFOB 3CXHK 3ARRA 4FQCL 4PUBH 3IMSA 2C9PA 3BXNB 3N5AA 4FNLH 3GIVA 2WTRA 4LGRB 3QC5X 4LAQH 2HG0A 3TT1L 1ES0A 5F9JB 2VN5A 3P9LB 5GPRA 1UWXK 4L29A 3ZE2F 1EZUA 2CALA 2CPUA 4X6CB 2PW2B 1Q0YH 3ARDB 3NMEA 4IMKA 3GT6A 1HHHA 3DIFB 1A7OL 1C08A 2DLIA 4ZXBC 5CWSA 4GKSA 2CR0A 1PX3A 5JW3H 3D2UA 3D69A 4H1LH 4M5YH 1HNGA 1JS4A 2YJQA 1JN6B 3TYFA 4UOZA 3PJLA 4I18A 3SQOH 4OVVA 2AXGA 4XP4H 3KWUA 4XCFH 2A5UA 3PXHA 5CEZE 4BSWB 3FBKA 1PSKH 4P57B 3PWPD 4KMTL 4YSRA 5BRPA 4WEEA 5JIDA 4ZBJA 2MCMA 3QT2A 4ZK8A 3DGGB 2GJJA 4J3TA 4QXGH 1I31A 3GGWA 3JSSA 1I1FA 5BRZE 3ZJAA 5I1AA 3HMWL 4ODVH 4XHJC 1BAWA 1S7XB 3KYNB 1WICA 1HHHB 3LZFL 3N1MC 4K7PX 3BSHA 4ZQTA 5HDQL 3JXAA 3BIKA 2EDHA 4Y1SA 4ZTOL 1SJXA 3R06B 1H3GA 4PJXA 1T0MB 4EVNA 1CF8H 5A2CA 1NCAH 3WUZA 1NIDA 3NEEA 3QDMB 3VD4A 1IBGH 3OTTA 5E7BA 4XWOD 4JDTL 1G94A 1YECL 1G6RH 2FATH 4Z3HA 1HNYA 1ZTXL 4NQDD 3GEFA 4HIXH 5GGUA 3WHE0 3V6FB 1MRCL 5ENWA 1R1CA 4PJFF 1IL1A 3ZMRA 3QO1B 4JPKL 5EDSA 2AI0L 1EEYA 3QW9A 1UT9A 4QRPE 4YDJB 1GMIA 1PX8A 5I30L 4B5ZA 2Z9TA 1XR8B 2Z0UA 3FB8B 3GRWA 4PJEF 3BX7C 1KFGA 2HG5A 3NABH 3MRFB 2VZUA 1UWYA 2LT9A 4MYPA 1BJ1H 3GFUA 4NQQA 2NY5L 3VG0H 4HKBA 1P2CA 1R5IA 3T2NL 2BWQA 2OW6A 2FWSA 2D7NA 3EYSL 4ENED 4WW2C 1UQSA 4XN4A 4NCC1 1Z2KA 5D5MA 1I3GL 4HJEA 1UA3A 5DS8B 2EUVA 2B2XH 4G7RB 4N2IA 5EU3A 1RZ8A 5JORA 3CH8A 4POZD 3FO0H 3KDPB 2X1XR 1L7IH 4YLBA 3ULUF 4AM0A 1JWMB 4AUYA 3V5KA 3VRJA 1BHGA 1X5YA 1OIOA 4P8QA 5I1JH 4JZOB 2ARWA 4OFIA 4XPTL 1SVCP 3ULUD 3KG5A 1EGJH 1TZOA 3WYRA 3BN9C 1DBML 4A37A 1JP5A 2ZOKB 4U1LB 1T1WA 3N42F 5ANHA 2Z93A 3LH8A 2ZZUT 3AS3A 3VDAA 1NGYA 3FFCB 2QLVB 2BCKA 3RWDB 4FMKA 4M3JA 1ECYA 4O02A 1PEWA 2DBLH 2JB6B 1KPRB 3CTTA 4M5ZL 2GTQA 4FXKC 1P4LA 1ET7A 3P0YL 1FNHA 3QUMA 1EBPA 4Y1AE 3OF6A 1TVDA 3LZNA 2W94A 3LV3B 1B4JH 1ACXA 1DVSA 3H9SD 4UIMA 2H3NB 1INEH 2VDOL 3QG7H 3WKPA 2YSTA 4XBGA 3VG9B 3H6AA 5KYNA 4R2GD 1HZLA 1ANUA 3MBWA 1GTFA 1EANA 1HAUA 1OCWL 3K6SB 5DMJB 3NCMA 1OZTG 1QABA 4HHAB 2OM5A 3VO0A 3ARWA 1EQWA 3QG6A 1ACYH 3QJZA 1X9RA 5KYYA 5L9DH 1KV7A 1PQZA 2RQ8A 2AHIA 1CXHA 2XACC 2P4AB 4BSVB 4N0UE 3O4LE 4EIGB 4BZYA 1KJ2H 1AAJA 5IJCC 3CFBA 4FG4A 3CZEA 3L6FB 5C0EA 2ZYIA 2JKJA 3C6SB 5AYUL 3WDIA 4DFHA 3GHBL 2R39A 4K8RH 2FEEI 3EHBD 3ARGC 5KSBF 1YMMB 3IM1A 1Q9LB 5IEHA 3DIDA 1YG9A 3MRPA 4RMQA 3HZVA 1XD1A 3QAZB 4Z7AA 3QDJA 5F7DB 1I3RA 2ZX9A 3P4NA 5E4EB 4A2HA 1EX0A 1TTUA 4I9WE 3NN8A 4GPVA 4KRNA 1D5BA 2LOEA 3KWWA 2IAND 1CYGA 3REWB 3UROR 4F80A 1MPAL 1U3YA 5IHBA 2AQPA 1KENL 2AJUL 2HH0L 4DKAA 1YN6B 1UUSA 4GSDL 3VSUA 2DI8A 4YNYB 1BZ8A 4FE9A 4GT7A 2IWEA 4G5ZL 4FKEA 4QNPF 1UKSA 1YEEL 4OAWB 1VCAA 3NGBC 4YBLC 3KVQA 1DJXA 4XB8A 5DS2A 2EYRA 4N8VA 4BFFA 1PDKA 1UH4A 2R9HD 3RA7H 3VI4A 2CPCA 1ZEAH 3HFFA 5A2KH 4RGOL 1URZA 5C2UB 1OALA 1XAUA 1JRHH 4LCUB 5E8OB 2G75B 1S7VA 5FWQA 3U4EB 1X9QA 3HLAB 4TXVB 3D85A 3P30L 5E4AA 2AKRB 4W9KC 2VDQB 1AE6L 3KM2A 2JSFA 3R06A 4PRHA 4AZUA 5K1VA 4J3OD 4Z7NF 2AV7A 4JKLA 3MRIA 3U83A 5JHDE 5IVXE 1ZVSB 2QL1A 5B8CC 2GTZB 3F65A 2MNJB 3BAKA 5I1AB 4GAJH 4MWFA 5D7EA 2XVGA 1WBYA 5CEXA 2LLGA 2ZJSL 1SXSA 1S9KC 4HT1H 2A83A 1I1YB 4DVRL 2WXNA 5LVEA 3GMOA 4PGCA 5HVHB 3T0XA 5ID1A 5HVFB 5EN3A 1DQDL 2QSQA 3SEPA 4UOQA 4UINL 2ITCA 4K07A 2VMCA 1C7SA 2BW4A 1HL8A 2J2ZB 2UY6A 3ILDA 4OLVL 1F1GA 3T2QA 3GBML 3NPZB 4LF3A 1LO0H 3BZDA 3EZJB 3MLTB 3HMXL 1JFHA 2IJ0C 4QXUH 5D93B 2WP3T 4NLHA 2N4IA 1KTRL 3L3JB 2AAVA 2MOVA 2VDKH 4LVNB 1BFSA 3U0WH 5IG7A 3PU7A 2H9GB 1QLFA 3MV8E 4K7FB 1NFDF 3O41B 4K15A 1HHKB 1Y6KR 2X5PA 3I3BA 2OFQA 5HYSA 2W8CA 1BBDL 1IFHL 4ELMB 4YDIL 1XEUA 3RUGF 4DAGH 1DQJB 4E41A 9CGTA 1OARL 2CK0L 4JFXB 2DQJH 1QUNB 3KPRE 2CCWA 4I1NB 3U9WA 3FUNA 1BP3B 3BKMH 4TUJA 4FQ1H 1F4XH 2QZQA 2YBRA 4A6YL 2WBWB 1HDMB 3CD4A 3MLPA 4W9CC 5LXVA 3DXAE 1SLWA 3MAWA 4PJDE 4WO4D 5FF6A 3B3IA 4CRPA 4LBEB 4K4KA 5G4OA 1F4WL 4MMXA 2WP3O 1KYOJ 2I27N 3L3GA 1ZVYA 5DWUH 2HVJA 4FXGA 1FZMA 4HWZB 5K93A 2OMYB 5C07E 3MJ6A 1M9WA 4Y8AA 4PJAF 4RMTA 3WD5L 5IK3A 5K9JH 4RRPG 5LBVA 2ZOTA 3HKZA 1JZ7A 2Z35A 2QTVA 5ID1B 4HKJB 2W60A 4BZ2L 5I8KL 4OF0A 4ZO8A 5H4ZA 3D3VE 5GS3A 3OPZL 4FJYA 3I50H 4UQAA 1KGJA 4KDTC 3D9AH 5GRXG 2WOYA 3PAZA 3RWCB 5JPNB 3FCTA 1A1NB 4QRRE 3B1TA 3DBSA 1B0IA 1C5CH 1CFNA 1Y6MR 1YY8A 2JKSA 3NFPB 1IAOB 2NZ1A 4NUGH 4UV4H 1Q9KA 2GY5A 4MD0A 2VUYA 1AG0A 1B2YA 1FVCA 4PV9A 1RZKL 3IGLA 3L5XL 1QLRB 3ZMEA 3LYRA 4JFDA 5AW7B 3BO8B 4POZC 1YVLA 4CMMA 2X1QA 1E7UA 3MVSA 2EXYD 3ARQA 2W38A 2IPTH 1Q94A 3MLVH 1KJ2A 1N6VA 1V7NL 2AJ3B 4YHLH 4P3DB 1QYGH 4H88H 2VB5A 3N41F 2WOBA 2FWLB 4YDNA 2XRAH 2ZP9A 2EEAA 3V4PB 5C07B 3E8VA 1O7VA 1BOGB 2YEVB 3CFEB 3EJRA 3QIWB 4B9FA 1ZLUK 3ZKMC 3GHPA 3IRZA 2NZIA 3CCHB 3GXNA 1C16A 2P26A 5L9DL 4QO1B 1J48A 4FA8A 5I6XC 3E2HC 2NNRA 1KXHA 5INDB 2CIIA 2ZD0A 2CDEB 2PP8A 5TTRA 1HI6B 1T6VN 5BS0A 1IGYA 1CDBA 2Q9OA 5EU7E 4XBEH 4JB9L 1XD0A 3AACA 1OGTA 2FNBA 3MGTB 2OL3H 4XWGH 2Y4SA 4GSRA 3NJLA 3KPRB 5IREA 3ZIYA 4KC3B 5F1SA 5JDSB 5AOJA 2OX5B 1LTXA 4BA8A 2X4PB 2AJYH 2IH1B 4XBPB 5HDRA 4XO3A 5FB8B 3WTWA 2BLFA 4NZTH 2VLKE 4WGKA 1XO8A 5E2WH 1OSZA 4BM7A 1BQSA 5GS1C 1ORSA 1EO8H 2GAZA 2YWYA 4OLUH 3V6OC 3Q9QA 1PS3A 5BCAA 1A7QL 3I85A 4R2GB 1G7MA 2K45A 2MSPA 2XTJC 2FIKB 3L4TA 1LHZA 2HSIA 5DSCA 3GINA 3ESOA 4YHNB 5IW6B 1LO2L 2XZCH 2WYTA 2PP7A 1T7XA 4IU2A 3G6JE 2JKWA 3D4CA 3SHSA 5LN8A 1NDGA 1RK0B 4TTDD 4XNUH 3VUAA 3I6KA 3GLEA 4B0MM 2QDVA 3PYCA 1E4XH 2ZX5A 1TFHA 1IBBA 2XG5A 1KB5A 3D48R 3L54A 1SZNA 1KIQA 2C9RA 5CZXC 4HWUA 4P9HC 1DBAH 2R4RL 4K9EC 3QUGA 3UFIA 1F4HA 3MJ8B 1M1XB 2HFFB 2V9TA 5C6TL 3UCQA 3DPBB 4JZNA 4E9VA 2WTRB 5T3XE 3EO0B 4IK7A 5DVKA 2VDMB 1AC0A 4D9LH 2VERA 3ZZQA 2VC2L 2YOAA 3SY6A 3WNIA 4FZEL 4BWWA 5F3BA 1CF8L 1NBQA 1CLYL 3NP3A 2FQDA 1BD2A 5CJXA 2BY2A 1U3HB 5JQIB 4IHOB 5I8EB 4HIXL 4M61B 3LKNB 1E28B 1U92A 4PG2A 5BO0D 1N64H 3H9HA 1E4XL 1JWSB 4NQTA 4R90L 4FA7B 2F8VA 3FT2B 4X0KB 3BUYA 1XTLA 3MRGA 5GRYA 1PFCA 5AZEL 3GZOA 3S5LA 5IJVA 2WMPB 4HUXA 1KZYA 3GXFA 3MV9D 1VKXB 1ZT1B 2QSTA 2TAAA 3TZVB 3HUJA 3VXSE 2GJ6E 4XP9H 3WHE1 5ABDE 1KYFA 5C09E 1KXQA 1H3XA 4AC4A 2DH2A 1DDHB 1ZE3H 1AY1H 3GMMA 5CU5A 1BYPA 4PJBA 3VG9C 2R69A 4JE4B 3TNMA 4BBWA 2FNWA 4WIQA 1LO4H 4PJXE 4WTWA 2HVJB 4FXGB 2FIRT 1EAPA 5DHVA 3AT8A 3FYEB 5GGTL 3B9KD 3EOAB 5IB4B 2O4EA 1JCVA 1Y1DA 3CDGA 3L4YA 2ICEC 4B96A 2C4FT 3NZSA 5C0NC 1BIHA 2Z7WA 5EU6A 5E8EA 1ZLEA 3SE9H 5IFHL 2FX8L 3MUGB 5E8NB 4AK2A 4DNLA 2C34A 3KLHD 5L4MA 1A1OA 3RFZA 4MMZC 3VU2A 4EE2A 3SY0B 4ELME 4ZX4A 4KITB 2YD0A 1FLTX 1W2KT 3FN9A 5B7MA 2Z31B 3DX7A 2V3DA 4PJ7A 3O6FA 3QXAA 3C9NB 4YC2B 3VWKD 4UM8A 1D7FA 1M57B 2EC9U 3OBAA 2EIKB 3RDTC 3R1GL 4PV1C 2VR3A 3BH9A 3GMPB 1KBBA 1ZGLP 1FYHB 3O6FD 3TTSA 1MAML 3GSUB 3S8WA 4XNBA 2NW2A 1ZS2A 3X3FL 3QDAA 4FLHA 4JRXE 4AVIA 4GO9A 5FHAL 3O3BA 2IANE 3IFLL 4QHNA 5DYFA 2R8SH 1E5CA 1I8KA 2G9HB 5CR8A 4LLQB 1QI5A 1MCHA 3FQ1A 1NLDH 4L8DB 1G0XA 3WO4C 2NMSA 2J5LB 2VC2B 4BFGA 5EU5B 2IXQA 3LN5B 3MRJA 3BZEB 5IQOA 2GBAA 4DIXA 3LHAA 2IC2A 3MYJB 1KFAL 4WI0B 2WLLA 4JFOA 3V0JA 3RJQB 5DTFB 5IFAL 1XBDA 1IC7L 2OMVB 3ZZ1A 4F33A 1NPUA 2NNAB 1LO4L 3QFJD 1B88A 5E9NA 4NQVB 5L0QC 1KDJA 3D39E 4G6AC 2YUXA 2WXQA 3PWVB 2XY2A 3ARFD 3D08A 1MIMH 3QR1A 1RIVL 3HS0A 1HSAB 3AW5A 2LE9A 4FFYA 2Z7UA 4C4UA 3DHJA 5E6IB 4LPXA 4P23B 5HHXL 2IAMC 4NKOB 3Q8FA 1BZDA 3T2NH 1K5WA 4HC1H 3BD3A 1AXSA 2YSSB 3M1CA 4OCSL 5EIQA 3EJTA 2E59A 2A0LC 3T6VA 5DJCA 4OIIH 3FQNB 1AQDA 1XGRB 2RIKA 5INCB 1HQ4A 2FT7A 1JF1B 3SGDH 1WBYB 2BSBA 2OV0A 5ESVB 5T1KD 1I7TA 5JW4R 2VQTA 2AERT 3FW6A 1QA9B 2XWJA 3OR7B 5HYSG 1TXKA 5L88L 4UZSA 3IETB 1QQDB 3AQXA 3CX5K 4V1DE 2Z4TA 2RAMA 2IBZY 4N8CH 5LGHL 2EYTB 4ZMTA 3ARTA 1AJ7L 3I02B 1Z32X 5JHDD 5IV2A 4JFFD 1JK9A 2HVKA 4GBXC 2HRLA 4OJDH 3VDCA 2EYRB 4N8VB 1WWWX 3VFTA 4YDZA 4NWUH 2BOBA 5DZLA 5H37H 3I3EA 4MVBC 2IOMA 2OCJA 3KPRD 2H32H 3DLQR 4X9BA 4JHAH 4FNSA 2F5AL 4KX8A 1LO5A 1SNRA 3NDZE 1UJ3B 4BZ2A 1JMXA 3L16A 1LQBC 4HSAC 3RY6A 4PJHB 3HRZC 3CHQA 4K3EL 4U7KA 3US0A 1RJLA 2IOOA 4PGBA 1SDAB 5DUBB 4G59C 4W9GC 2DQHH 4NQCB 1WF5A 1YJDC 4NHUB 5D72L 4N1HB 4F5CE 6PCYA 1ZEAL 1A3RH 4OIBA 2H3XC 3H56A 1FBIH 3L1GA 2JKRM 3VXRA 4F58H 2XZAH 4FXLA 3AGWA 5D2LA 4EI6B 3N0AA 4H0LC 1KV3A 5IBUG 3U6RA 4QRUB 2DV6A 1V27A 5KYUA 1BQHG 5CLTA 1CI3M 3T2LA 1OSPH 4TOYL 4UTAH 5EOCL 5FXCH 5ILTL 3LXBA 4CC4C 2BWIA 4KPHL 2DBJA 4L37B 4OCWH 4MA3A 4DKFL 3ULUH 2WGNB 2ATPA 4B9GA 4ADGA 3GI8H 5CBEB 4FCAA 5D4QA 2GG1A 1QEWB 3QS2A 5DJDA 5BQ7A 3VFOA 3FOMB 5EH1A 5B4MC 1D5ZB 4JRYD 3D0VB 3QZWA 1KN4L 1QOKA 2VDLL 2YRZA 2F58L 4P5TC 3ZUCA 2O5XL 3F84A 3EOBA 4ABQA 1ED3A 1W72L 3EO1B 1B6UA 3RPBA 3VA6A 3EYUL 4QY8B 2P8LB 2X38A 2ZOLB 2H6UA 4L4TD 1UQSB 4ZS7L 4PJAE 4Y4KC 3IXTB 3ZO9A 5GQBA 3T3ME 3VFNB 2J21A 3VWJA 3QAQA 1CICB 1EAQA 2HKFL 4WY7H 2VLKD 3WS6C 1TVBB 3KZ8A 3KLQA 4HOWA 4ZXBA 2AEQH 3BP6B 4WWKD 3L4VA 4X7DC 3HN8A 3MV7A 4JVWA 1PLCA 2DQJL 3QRGL 3QZOA 1KPUA 5C0DA 3RFRA 3UBFA 1TENA 4AYDC 4EUPH 2BVQB 4NENA 1YQVH 2BNQA 5HDWA 1HL9A 2IDCA 1R24B 5ICUA 4N9GA 1LK3H 2QKSA 4G7VH 4MA1C 3SDCA 3QQ3B 4NRXB 5LBSA 1S7QA 3CZUB 1KTDA 4HHGA 7PAZA 3HUJF 5GGUB 2PYEA 4Q9QL 5KSVB 4ZTOH 4KZ0A 3IMWA 4PY8I 4XXWA 4K3GA 2NSQA 2YKLH 4J6IA 3V0WH 2XJKA 1ZT1A 5HYJA 3W5NA 1T20A 1F97A 2DLGA 2GJ6A 3H3BC 2EDRA 3UC2A 2XV6B 5C9JB 3KLHC 3M17B 2CJUH 4N8PA 4NKDA 2OYPA 5T5NG 4WZ9A 5LDSA 1XGQA 1RZ7L 2FX9L 4NJAL 3CMOH 5FGBA 1T66C 2FWOB 2LLLA 2ORBH 3RUGA 1A5FL 4HCFA 4HWNA 4JFHE 1QG3A 4C4KO 2EDTA 4W9LC 4K5LA 4NFCA 2X09A 1HU8A 5EIIB 1HC1A 4PW9A 1TQBC 3U6XA 4DZBA 3N41B 3LQAC 5L8JB 3TJHD 1N5YL 2C9QA 1RUKH 1MG2C 3K81A 1SJMA 1EV2E 3S48A 4HSQA 3DURA 1WC7A 4M6AA 3UDWA 4ES9A 5MEOA 1DJHA 4MZRA 4WAFA 2ZKHH 3M45A 4GT0A 1GZHA 2FSDA 2G2RB 3FB7B 4OCLC 1QSFA 3DX0A 1AQKL 3N1FC 4HGWA 4LNRB 3ZK0A 1HOCA 4WI3A 1F6AB 4HXAL 1TJGL 2NY0D 3FONA 4GKZB 4GXFA 4JMNA 4NYLB 4TS6A 3UAJD 4GAJL 5HYQB 1B0RA 4UBDD 3ZW3A 5CHNA 1LNUA 4OV5A 2WKOF 1ITCA 2XN9D 3FU3A 2XA3A 1DQDH 1HEZB 3CLEL 5AG8A 1UB5B 2XQBH 3RGVB 1BZEA 4G3YL 3B7TA 3DGGA 4PRIA 5BVPH 2AK4D 2NXZD 3HAEG 3Q0HA 5J3HC 3PV6B 3KBEA 4YDVB 4HWBL 4Q6YA 1N6QL 4LLDB 5DSCB 5HGDA 1WZMA 3DYPA 3PAUA 1YQVL 1F3DH 5E2TH 1UEYA 4G42A 3PL6C 3VYPA 4G6ML 2CXGA 1OT1A 4LSRL 3OKOB 3FB5B 3GS7A 5I1KL 1CG9A 3NIDB 2IAMD 4X83A 1PU0A 4AXWA 2X4RB 5D1QA 1VGEH 1AQDB 1XGRA 1WIPA 1WZ1H 3B4NA 3C6LB 4H20L 4X5LA 2H3KA 3VFVA 1X5JA 2CA3A 4NAJA 4JFYB 1NWPA 2GJZA 5IR1B 1IZKA 4KMQA 3ZKXB 1A5FH 2HRGA 2X3AA 4PGJA 4JANA 3CV5A 5JHDA 2A9NL 1GOHA 5H2BB 1JGEA 2GUOB 35C8H 3C6LC 3BKCH 4NM4L 4AUJA 1O6VA 3LJ3A 1RZ7H 2FX9H 4HMEA 1B3JA 1R0AL 1FAIL 4PWJA 5EIVA 3AREC 4RQQB 3MRNA 4KNQA 3NIFF 5L2KB 1YEDB 2W1NA 4HS3A 1AQMA 2EIZB 1A7RL 2VISB 3K6NA 2EUZA 1JF6A 1YEGL 3QUZC 4TLKA 3DOSA 5IY5B 4OIAA 4LVHB 4NBZB 1U21A 3DC0A 1ND0A 3AQDA 4S1DC 5TK4A 1AFVH 1P69B 1WGVA 2ZWYA 5JIPA 3KDMB 1G9NC 1RZIA 2DQCH 1DQQA 4CAGA 3P02A 2ZG1A 4LPVA 1LD9B 5GIRB 3VYNA 1WZ1L 4H20H 3FO2A 1JPGB 3MFFA 1RUML 2YK1H 1T04A 1UZ6F 2VRQA 3GSXB 4OF5A 1X5HA 2IQAB 4PP2B 4S2SA 1IX2A 1FA4A 5FDWB 5GS1A 1E27B 1ZJBA 4EI5C 3GMQA 2LV4A 3K91A 4G9FE 3QUKA 1QNZL 4GRMB 4NZTL 1MJ8L 5D9SA 1G7PB 2J5LC 3O3DB 5IJKA 4CU6A 2CMRL 4ODBD 3FB5A 2CJSA 4HAKA 2BP5M 3ARFA 1IUZA 1ETB1 2V7HA 3PPSA 4LQFH 3MJ9L 3CVBA 3DMMD 3QORA 3QEUA 1PIGA 5D70H 4JFSA 3IDJA 3VJ6B 3NSYA 2W91A 3OJMB 1IGMH 3TURA 4PHXA 4U6TA 4WFFD 2JELH 3IWUA 1YC7A 1KYUA 1U8QB 3MJWA 4CSTA 1M2VB 3V0FA 5FW7A 2XSKA 3KWTA 4DPCX 1PEZA 4DOHE 5E24E 1MELA 4JN1L 4X9IA 5AVTB 3CAFA 2AJZB 3O4OC 1IC1A 4P59H 3VNZA 2WWOA 5IQLA 1T7VA 4XE0A 3SYQA 1HN1A 1TITA 1EO7A 4MJIA 4N2AA 3PF2A 4BQCA 4ZI8A 2EKSB 4DK3A 3X1GA 5TF0A 3QJHB 2NT0A 5I28A 2NR6C 2VW4A 1WE5A 3FQUA 3LQMA 4OFVA 4AT6A 1I53A 3LSOB 1KIUA 2JJSA 3A4EA 3OZ9L 3Q3GA 5B38B 4QUOA 1AGEB 4AIZA 4PR5A 3UIYA 4FYRA 4QAMB 1NH6A 2NZ9D 4O58H 4JLRB 5IKCA 1JXFA 1BYOA 1YMHB 4K2UH 4DZBB 4RX4A 1CXLA 4BE5A 1YN7B 4L4TB 3O6LL 2WCSA 3OX8A 4ZJ9A 4RISL 1TVHA 3E80A 3GLZA 2VMEA 3EF4A 1KY6A 3DGCR 1VKXA 1HZKA 4KBPA 4KU1A 3IK2A 4CILA 1IBFA 4J1UA 4ZFOL 2RQEA 3W57A 5T5FL 3OJVC 3A6OA 5B3JF 4HJSA 4JZJB 3ZGHA 3NCYS 1OQXA 2A74A 4ALAL 4U1SB 5IVXF 3BPNB 5DC2A 5AVQB 2NX5B 2Q0ZX 5FUZH 3SDCC 3JTSB 1MFMA 1KJ3L 3UTSD 4JW3A 2SEBB 3ZE1E 2VITA 2Z65C 4JO3L 3IBEA 1HQ4B 2CU9A 2EDLA 5I19L 5J1SC 1RP9A 2WIIA 3BPNC 1OM3L 4TPRH 4MDJB 4CW1A 4L18A 5ITBL 2EDDA 3WEMA 3QPXL 3IN0A 5A2IH 1T6BX 1PDKB 2X4OB 3OXSA 1RZQA 1CDJA 2CKNA 5E2UL 2O6PA 1U8HA 3KPQA 1JTTA 4XP5H 1L7TL 3E8UL 1MHEA 1JD7A 4LSTL 3FPYA 3KPNA 3TBVA 4FYTA 2NY4C 3M86A 1TTFA 3K72B 2WVUA 3KYMA 4QRPA 3KL3A 1YMMD 4Y1AD 5B3NA 1SDYA 1DSFL 5GRUL 1U8MA 5TF1H 2VZOA 1WD8A 3IE9A 3CLWA 2OP4H 3NCWA 3LRLA 4HZ1A 3VFWA 1EGJA 1M9SA 1CTNA 4XVTH 3OKKB 5IMOB 3FU8A 3WFBH 1OAKL 1JV2B 2NR6A 1NQBA 1E4HA 2XN9A 3NRFA 4XVJH 3EGXB 4AYFB 2A7BA 4HCRH 5JOEA 1NEZB 4NAMA 2IANB 1QR1B 2D7TH 4QXTB 2QVTA 3BPCA 4P5TB 4QHUA 5CSZA 2NTSP 1OSEA 4XPFL 4AE0A 1JPTH 3FOMA 5A6IA 3KR3H 4HQQH 1Z5LA 2N7BA 3ILQD 4HPYH 2PCYA 3CIAA 4JRLA 1UD5A 4UOJA 4MA7H 3WNKA 1KTJA 1E4KA 1EJFA 3GLAA 1OT4A 3AXLA 3F04A 4JRFA 1NAML 4CC1A 1XWVA 1H15A 5LXGL 4ABWA 2HFGL 1EK3A 1B90A 2GW5A 1PKQB 5ELIA 4PJFB 1ZHBA 5D7JA 1GRWA 3OB8A 1DBJL 4NQDA 2O5YH 5CLXA 3P4MB 1RK1A 2JI2A 2XN2A 1CB4A 4NRYA 1MHCB 4GYBA 2Y6SD 4KVCH 4D0CB 2CLZB 2GFBB 3B2DC 4F2MA 2AK4B 2NXZB 4FQXC 3BPCB 1XSJA 5HI5C 2CDGB 3OKKA 5DQDH 5SV4A 2COVD 4U6HA 3WJMB 1OCCB 3QZLA 3P4OA 3M7FB 4GLRI 3KPLA 3T6QC 3RWJB 2XG4B 3HG3A 4HEME 4G83A 1K2DB 4JPSA 1M1SA 1S9WB 3MJ7B 3Q1SL 3QEQD 4LHUB 4FFYL 2ZUTA 3WEBA 3ATDA 3F62A 4GG6F 2PYEE 1W0VB 5IOKA 4YJZL 4XO4A 5F0PB 4MA8L 4Z95H 5C08E 5FPIA 4Y19B 1TMQA 4AYMC 5DEFA 3CZGA 4KNUA 5EB9A 2ZUXA 1YNLH 5D55A 4Y19E 3MLSH 2OZ4L 2MCPH 1MFAL 3N0PB 2XBZA 4X4ME 2AZUA 3QDMA 1CFNB 1RFDL 1AHWA 1USQA 4HFUH 4WJG3 4YBQC 2H0JA 1TQBB 3D05A 3ZDXE 5BMFH 4GRLC 2O5NA 4XNDA 1HHIA 1CJYA 1JD9A 3QAZC 3QEHA 5GHWH 3SDXB 2EVGA 4H0GA 4RDQF 4AYBA 1U8KA 1YYCA 2BSRA 3MNWB 4KO7A 1YHPA 4HPYL 1OHQA 2Q8AL 2EXSA 3PLYA 5C7XL 1N0XH 4UU9B 4PVNA 2P48B 1YSOA 5IHZA 3EH5B 2JI1A 2ZQKA 2CBTA 3QI9C 4FC3E 5D5MB 5LO7A 4NZJA 5I1DA 4TVPE 5KAQF 5JW4M 3D85B 5LAXA 4GAYB 3GZKA 1CTMA 1FGVL 2PR4L 3QFDA 1F8TL 3EJPA 2X6CA 1UA6H 4G6FD 2XCMC 3QI9B 3LXCA 1TJXA 3B7UX 4R90H 4XCCH 2DQ6A 1RFDH 1IEAA 3BIAX 2JKTM 2R1WB 2R0ZH 2FQFA 4OAWA 4KKBC 3VM5A 4JBSA 1WUZA 4AM0Q 3BSZA 2DDQH 3DUUB 3P9LA 3WEOA 4R96B 1BF8A 3TVMA 2E7BA 1QRND 3BDBA 4DCQB 3FUDA 4FFWD 3OHMB 4MJIB 4Q7DA 1B3IA 3UERA 4D0DA 3EF7A 4JFZH 4RMUA 3ROOA 4Z77A 4PJDA 3RAJL 1SBSL 5FGBC 4YX2L 4N85A 2BMKB 4MXQD 4WU5A 1V10A 3C75A 3JTSA 3A24A 5EO9A 3ROLA 4GSXA 3CX2A 5F88A 2ZWLT 2DPKA 1MAKA 3P11H 1S9XB 1CL7L 3PREA 2AEOA 3D39A 4ZXBD 3IFNH 4O5LH 4PTUA 3MMEA 4GKOA 4P46C 5C07D 3V95A 5AYTA 5I8CB 4RAVA 2CO6B 5E2WL 5FOBA 1Z5YD 4FI8A 5DFVD 4WHCA 2GJRA 3D50A 5F7WC 2F1BA 4YS4A 1UM6H 3CBRA 1U8JB 5CLWA 1G7QB 3AABA 2XV0A 3ESVF 1VIWA 3HTLX 3T3PB 3DVNA 3RL2A 3EKCA 3BAEH 4OZGE 4O58L 2QR0A 2R4SH 1EH9A 4R3SB 1U9KA 4LCUA 5E8OA 3VI3F 4PU2A 3LSOA 1C08B 5F6HI 3FXIC 4JQVC 4BUHA 1FZKA 4FHJA 2V17H 3MLRH 3QJHA 3DRTA 5D8JL 3Q2CA 4FL4C 4BK5A 4NIKB 3FU5A 2HRPL 4L48A 2R1XB 1MCSA 5DD0L 1SHSA 4P4KC 1SJHB 4FHKA 4PBXA 4HWEL 1K6QH 5JO5A 3T8VA 4EN3B 1J8KA 4OIFA 3PUUA 2WWNA 1NOLA 2CM6A 4GAGH 4NN6C 4NNYA 3UO1L 4X5WA 3VYOA 3SZ6A 1MCEA 4WI6A 3WFBL 4UQDA 4MKTA 5D96C 4HPHA 4P4KB 4RQQA 5D2NC 1U58B 1OCRB 1UM6L 4HF5L 5FYJE 1DO5A 1F8TH 1OLZA 3ZE2E 2Y7QB 4M43L 5DI8A 2FTAA 2EXTA 3HMXA 3KPOB 3UAFA 4YDLC 4PRHD 2P5EB 1FH2A 1GZHC 3CZKA 3UAJA 1U0QA 2D7PA 2J3SA 2JV6A 2R56H 2UYLB 5B1JA 2FQGA 1SEQH 4XP5L 1KLGB 1K5NB 3P4MA 5KOMC 5TE4L 1NTDA 3PWLB 4AM0B 5LXGH 1O6SA 1IBZA 1J05B 3BGFB 3UYPB 5T3ZD 1OF2B 1A65A 1LO2H 1REIA 2XZCL 3CFKB 3C6LA 2J44A 1XB3A 1R6VA 1P4IH 3FFDA 3ERXA 3TT3L 2FE0A 4MA3B 4I1RA 5I8EA 5D7KD 2VAJA 5FUOH 3S37X 5FYJL 1C1EH 1AIFB 1ZHLB 2G5BB 2Z3FA 3LNGA 5ANMA 1W9XA 1TJIL 2MEJB 3O0LA 4DGUA 1LM8V 1UB5A 3VM7A 4KK8C 3UOAB 3HMXH 3KNBA 3HBZA 3VSQA 5JZ7D 4LKXA 4MNQB 4HG4J 4HAFA 2NXYD 5EEXA 4PV8A 1WV7T 5HPMA 4LHQB 1KCBA 3VFUB 2I07B 2VISA 2GABA 3ESUF 1CBVL 1BV8A 1SQMA 2PPEA 5ITFA 3AJ7A 3RKDC 1IGCH 3GS4A 4QJ5B 4DUWA 1TQUA 1DJYA 1EZVY 2CD0A 4L4VD 4IRZA 4WJ5A 2F54B 1GAFH 2HUHA 2JVUA 2Q76B 3DX8B 2AQRA 3PP4L 2YD9A 4HZLB 3TZVD 5HYQA 1G84A 4N0UA 1DJZA 4JO1H 1ASPA 2MKWA 1SXAA 1I1CA 4HIQA 1MCOL 4L3EE 4M7ZC 1WEJH 5HGAA 5KANI 1NDGB 1N68A 2VH5H 2YMXH 4EEEA 5KVMC 1PCXA 4PRIE 2Y7NA 3HBPA 4WFGD 4AKOA 1ZHBB 5J12C 1KJ2L 1CFVL 3VXOB 3SKMB 2VNCA 4OLZH 4Z7VF 3TCLB 4U1MB 5DHVH 1ZCRA 2OMWA 3JWDL 2VL5A 1H5BC 1PG7H 2GAZB 2LQRA 4X6CE 2VXQA 4ZMAT 1SOKA 5DEGA 1J0YA 1QBMH 3QEQB 4LHUD 3ZTJH 4N6QA 4FQIL 3DDGA 2WN2A 3P2DA 4FERA 4GS7C 4LVNC 5LN4A 1BQHB 3GZQA 4E9LA 2L0DA 4M5TA 1PZUB 2PR9A 1G9HA 5F96L 4ZG1A 3POHA 5C09A 4GG6A 2FGZA 4UM9B 3O6LH 1W6WA 4JFDD 4V1DD 2BHYA 1HI6A 4NPKA 2ZYSA 3WKNA 1F4AA 3GSRA 4PRDA 4HULB 5I73B 2ZCKH 3QJQB 5FYJH 3STZB 1VB9A 1D9KC 4X4XA 1FGNL 5F3FA 4FLOA 1EERB 1ES0B 1SOSA 2IGFL 3T9WA 2Q7YB 3TWYA 3IKKA 5E6IA 1NWOA 3H0TB 3L4UA 4KHXH 2WM0A 3U1SH 4YHLL 1QSFB 1JV5A 3NQIA 4MBOA 4CSSA 4HVBA 2H4EA 1NUDA 1UCTA 3OD3A 5F6IC 2WNWA 4XPBL 2IH3A 4F8LA 3VGDA 1SM3L 3QI9A 1O9VA 4UQ3A 4XB3A 4ZMLA 1P7QB 4EZJA 2CWRA 3RB5A 1A6TB 2O6EA 1MFEH 1SHWA 3GEWB 1T7WA 3B83A 3DETC 4NUJA 3RIFF 3VXMB 5C0CD 3D85D 1AD9B 1J8HB 4K7PL 2MNUA 4J7RA 2NDGA 4IEFB 2PYFA 3HC4L 4K71B 5E0FA 1L0XA 2FBJH 4R7XA 5D7IF 2VITB 1CE6B 2NQCA 3D30A 5TDPB 2X05A 4MZ3A 4D0BA 4AH2B 3PP3H 1KNOB 1WIUA 3HZVB 1R0AH 2UZPA 2QHLA 3OAWA 2Q2LA 3BKCL 3GNMH 3QEQA 1VFOA 1E42A 3GRBA 3UPRA 3ARDC 4JZJA 4D3CL 2YS4A 5B38G 3WTTA 1FYTD 1Q0EA 3A47A 5DJDB 3IJ9A 4HV8A 4D9RD 1MXGA 2HFEA 3QNXB 3WGUB 1QRNB 4XC1L 5AW2B 5LNGA 1CPUA 2G3MA 4XPHH 4FXTA 3IMVA 5EOQL 1OOAA 4JNXA 1ECZA 1WZAA 1NBZB 1VACA 4HGMA 1NUFA 4UAOB 1Y7VA 1T22A 1YECH 4G9FA 3VGEA 4B9CA 3WFEH 3RY6C 4EI0A 3AS1A 4AT6B 4XCEB 3V0IA 5AAWC 3FQWA 2EO9A 4FQLL 4EI6A 3LN9A 2XG4A 4ZXBB 1I9JH 1QUNA 4OZGF 4F27A 4P07A 1W6LA 4Q52A 4Y4FC 2KI6A 1RIHH 1C9SA 1E2ZA 5CGYD 2Z31C 3QRBA 5AKVA 3M6DA 4OM1L 1SVZA 4UTBA 3P0YH 1CMOA 3MX0A 3D18B 3TN0D 3NUKA 1D5XA 2PABA 1U91A 4ELKA 4HS3B 3SKUD 1ZANH 3B5GA 1T5XA 4UI2A 1CDYA 2VMDA 5K1NA 3UGUA 5IJDC 5D70L 1SHXA 4Q6IB 3CE1A 3SGEI 2OS7A 4M4RB 5EOQH 4X9FA 3GSWB 2JJVA 5C0AE 2P42B 3UZQB 1LJMA 2KS0A 1A22B 2SODB 3ARBB 1Z9PA 2Q5BA 1P84J 1R19A 2BVPA 3EUDA 4U7SA 3VACA 4A2MA 2GTWB 3H9YA 2NY1C 2AANA 4EUPG 4DHLA 4ISVA 3B7YA 4NQCD 3FHQA 3DHUA 2KYIA 3ZRCC 3UJJH 3NCYP 2AC0A 1KLGA 5I74C 3O2DA 3F6IA 3TO4C 1B0GA 4IGBA 3T3MB 4PREA 2O61B 2JJSC 4FADA 3S0PA 1TEGA 1IBYA 4KK5C 3Q7JA 5I1IH 2HJLA 3PRZA 4YSUA 3Q9PA 4HIPA 3N3EA 4HEPG 1RLWA 4WEBH 3GJFA 1E30A 3TJEH 3L1OL 2Q2EB 5DVOA 1J5OL 2OQJA 2V5MA 2HJFA 4YBHA 3MRFA 2VM3A 2BNRA 5GISH 2VW6A 5TQ2L 8FABB 2EXYC 4XHQA 3PWVA 2EIZA 4GUOA 1YYLL 4ADJA 2HPOA 1EHAA 1HKLL 1ACCA 1VFBA 3H9ZA 2DWDB 1NIBA 1L9PA 3I75B 5DLML 4C56D 2AEWA 3IF1B 4JPVL 3SDYL 3VFGL 5JZ7C 2OL3B 5JNYB 1EHKB 3U0TB 3FB7A 3CH1A 1HL4A 4XMPL 3RHWF 2NXYC 4UT7H 2CA4A 3P0VL 2JWYA 4K7PH 4PRID 4GXVH 4LGSB 3K8MA 4N2HA 4NKIL 2C9SA 2E9GA 3VFMB 4AIOA 3ESPA 3RKDD 4YHYC 4DKFH 4JREC 4QTHB 1YY9D 5D1XB 4HA1A 2GSGA 3QNYA 3C09B 1IAKA 2J1YA 3W0WE 3HPLA 3GJFH 1OM3H 4GH7B 3AAZB 4WTXA 1A7PH 1WJ3A 3VXRD 2DL9A 3L5IA 2CBPA 4M9PA 2WXIA 1TU2A 2HTLC 4H8WL 5D1ZB 4EI5A 2KZBA 4DSYA 4U1HA 3U9PH 1PLBA 2IADA 2Y7SA 5FOBB 1IC4H 2ZX8A 5MEPB 2R29A 2D7MA 4Q89A 3T1WA 4UDUB 4OZIA 1NANH 2KPWA 3QP3A 2ARJQ 3JWNC 4IOFD 3PJSA 5TQ0H 4KTGA 3HG0A 4UTCA 4MHHG 1O9ZA 5FGCE 4YSQA 4UINH 2WAQA 5HHMB 2C3HA 1LDSA 2IWFA 4MCZB 4N87A 2VH5L 3QXAB 2OXHA 1WFIA 3FTXA 1PYWA 5GGSA 2BO0A 3T77A 1LNUB 1TQCC 2EYSA 1UENA 2KC0A 2X6UA 2MWCA 3K2UH 4ZFFA 3EYOA 1NBVL 4L29B 5GGTA 4NOFA 3ABMB 3HI6L 1F4YL 2LGNA 3FB6A 3PAYA 4X5QA 1BJ1J 5FYKH 5I75C 1VFBB 1AGFB 3W1ZA 4X98B 5E4EC 1TQCB 5G5DB 3GIVB 2ZNXA 4MA7L 1XGYL 5T8IA 4I3SH 1EFQA 2WTOA 1EHXA 3NTCH 2JB6A 4LASL 4EBQH 1SN0A 5I26A 2KLSA 1BLNB 1FIEA 4G6JH 2ZAGA 4L8DA 4ZDHB 4TTGA 3VI4E 4UM9D 4KKAC 3SJVB 1I7RB 4YAQB 2CRIA 2ENQA 2BSDA 2APFA 3Q8CA 1GGIH 4B9YA 2FLBT 1JMZA 2UZYA 3EFOA 2QMKA 4HMCA 2F1EA 2NY6C 4XMPH 5B1KA 4HX1A 1CD1A 2VLME 2VZSA 1CVRA 2GB2A 4Y4HD 4MD0B 5EEUA 1NFDA 4CGUB 3KXFE 1IGIH 3VE0A 1QPKA 4L4VE 2VCOA 3L5WA 1GIGH 2A77L 3CXHJ 4XB7A 4UTBH 5I2IA 1DVFB 1JG9A 5IW3A 3RWIA 1NPJA 1ITBB 3D06A 1OB0A 3HUJB 2QQQA 4GXVL 2BVTA 1PMYA 3B9AA 3TH3T 5JIQA 3FQ4A 3NACL 3C5ZA 3WJJA 1HEJC 3HI5L 3LD8B 4JDZB 4P5MB 4J5VA 3HEIB 3MO1A 2LAGB 3VXSA 1GTNA 3G9AB 1T4WA 5B3SB 5M94B 5JW4N 2ZCLH 3K7UA 2A6JB 43CAB 1AS8A 2DMHA 1XIWB 1UVQB 4B0MB 1ICTA 1LE9A 4A2LA 5C8JA 5L8KB 1MNNA 3QHFL 5KYUB 3W37A 2VN6A 4YXHH 5FW6A 5GISL 3AGVA 1Z9SA 4APXB 3FUEA 1YNLL 4H2CA 1XIWC 2A6DA 5B39G 1AGFA 1J8HE 1KGUA 2E6JA 3SE9L 4D7PA 3CZFB 1S9WA 3HVNA 2UXGA 3MJ7A 5MENA 3H8NA 1Q9OA 1T3FB 1CE1L 2ZCZA 5LCVH 3LRGA 4AMXA 5KVEH 5IVOA 3DHPA 4O2CA 3DPBA 4JZNB 4DGIL 5BOPA 4OZFG 3D12B 4BKLB 1UATA 4G9DA 4K0OA 5F7YC 5IIEB 1N0XL 4QGTA 1DCEA 3CDZA 5JA8B 4I4WA 3WL9A 1GYAA 4F2MB 3WIHL 4OGAC 5F7BA 3BPOC 3EO1A 1DN0B 3ILEA 2J88L 3GTTA 4N9OB 1BD2E 3ZR5A 1PZBA 4K3JL 4L0ZA 3ULUE 5CGYC 3ZQ9A 2ZPKL 3RLSA 3LRHA 2NYYD 3LS4H 4HUWA 4TSBH 5F7NC 4WTZA 4LIQL 3C12A 1SFDA 1WGOA 3LEVL 1NFKA 5DMKA 5DEGB 1GGBH 4PW3A 1RIHL 2EDEA 1HESA 4ODUB 1PKQE 1MF2H 2ZNWA 4J12A 1LE5A 4XXCC 4L3AA 1ZGLA 1TO4A 5J57B 2IH1A 2DF3A 4XBPA 1ZHNA 4HIEB 3SKMA 3TT3H 3MREB 4PRBA 4NUMA 3G6AB 2E9WA 1T2XA 5IOPB 1P1VA 1J9QA 1OSZB 4GEJA 4IS6A 3L7FA 5CIPB 5F3BB 4APQA 3UTQB 5K1JA 1B9KA 4M7JL 3KH3A 5HGBA 3VX1A 5D5MF 3QIUA 1A3QA 3S36H 4G3YH 4UB0H 4LEOB 1P9MA 3UMNA 4QDGA 3PJNA 4P23A 4QO1A 1UUNA 1YYLH 2C1OB 3DVIA 1HCFX 1OP5H 3LNHA 3V4PL 1LP9B 3PV7A 4PJ9B 4D2NA 3MBEC 1AO7E 1P5VA 1WK0A 3OSVA 3NDYE 2Y0SA 2RALA 4N28A 1BX2B 2Q7YA 3BAYA 3UABA 3V6ZB 1OSYA 1YNKL 2WVVB 4YXLL 3PWUA 5LAXB 2VTFA 4JPWH 5HI4D 2VZVA 1JK9B 5I1IL 5JW5B 1S7UA 2NUPA 5GRWA 7FABL 5KYWA 3ZKNC 4JHZA 3WFDH 3EZ8A 3MLXH 4IRSA 4WV1A 43CAA 2FR4A 5HD8C 1FSKC 3EDKA 4KK9C 3DOIA 5BS0E 3KYOB 3ZDXF 1FPTL 1IC5H 4EQ2A 1SYVB 1NKOA 3OJ2C 1B2WL 5KVEL 4LLQA 1E4JA 1E3ZA 1FNFA 3O3EB 1FVCB 2DW5A 2E3VA 4AEEA 1J05A 4AV4A 3V9CA 1H3WM 2ZXAA 4X6DF 5ICXB 1NGWA 3ZY7A 3NACH 5LKNA 2OMYA 4UUJB 5D1ZI 3OB0K 4JL2A 2R0LL 1MCQA 4M62L 3DROA 1XGTB 4WHYH 5IVZB 4AW7A 2GEQA 2BIHA 1IKFL 5J1AA 3ULVE 2CGRH 4NFBA 2G2PA 4WO0A 3SCMC 2XPGB 1NOAA 4FCHA 2V6HA 1MW2A 4HWZA 5D1XD 2I26N 3SGKA 3KM1A 4KJQC 3NSJA 1WTLA 1Z9OA 2WXHA 1G7LA 5AAMC 1HVXA 4N0UB 1E7VA 3FUJA 4X7T