3IIAA

Crystal structure of apo (91-244) ria subunit of camp-dependent protein kinase
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
137
structure length
137
Chain Sequence
AASYVRKVIPKDYKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVSFIAGETVIQQGDEGDNFYVIDQGEMDVYVNNEWATSVGEGGSFGELALIYGTPRAATVKAKTNVKLWGIDRDSYRRILMGSTLRKRKMY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords cAMP-dependent protein kinase type I-alpha regulatory subuni
publication title Cyclic AMP analog blocks kinase activation by stabilizing inactive conformation: conformational selection highlights a new concept in allosteric inhibitor design.
pubmed doi rcsb
source organism Bos taurus
molecule tags Transferase
total genus 32
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2009-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00027 cNMP_binding Cyclic nucleotide-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 3iiaA01
1ZZ7A 3HQXA 5E16A 4MGZE 4AXOA 3CL1A 3OTFA 3H8UA 3I59A 3CF6E 1Q5OA 3ES1A 4XEZA 1GQHA 3WW4A 3PVBB 4KL1A 3TNQA 2K0GA 5CADA 3OF1A 2XLAA 2GH2A 1H1MA 3WW3A 4BIFA 3SHRA 3MZHA 4UBHA 2VECA 5I93A 4I0BA 1CAXB 4IEUA 4QXKA 5C8WA 5KHKA 4X6RB 4O9GA 3ZDSA 4MZUA 2B8MA 3ST7A 4I01A 4N9IA 1RGSA 3FE5A 4XETA 1CAUA 1XE8A 3M3IA 4I0AA 1CAVB 1UW8A 1L3JA 4L11A 1O7FA 3U10A 1O3RA 2XLGA 4HN1A 4OFGA 3EHKA 1J59A 3U0ZA 4NVPA 1DZRA 3RZZA 3H1YA 2IXLA 1LRHA 3B02A 4OLLA 2B9UA 4LEJA 4HZFA 4IEQA 4KWJA 2OYZA 2CAUA 3IBMA 5LEJA 2XGXA 3SCGA 2IXIA 4BYYA 4DINB 5FLIA 4LA2A 2Q0AA 1XRUA 1X82A 2C0ZA 4Q29A 4A2UA 3RYKA 1YUDA 3SXWA 2D5HA 4AQ6A 2V09A 3QACA 4Q0VA 5BV6A 3USSA 4J1WA 4IEXA 5JAXA 4MGYE 4XF4A 1YFUA 2UYAA 4IEZA 3H3UA 4HSLA 1O3SA 2BEOA 3DKWA 2XL7A 3LAGA 5C6CA 5FQ0B 2Z2SB 1EP0A 1CAXA 1CAUB 3VHRA 1ZREA 3O14A 3RNSA 4MH0E 1J3PA 3SCHA 4CYDA 3OGJA 3UKVA 5FDBA 4IEPA 3D0SA 2EAAA 3JZVA 2CGPA 3DN7A 1CAVA 1RL3A 3ES4A 1PMIA 2ATFA 3IIAA 5JSRA 4PIXA 2IC1A 4HLTA 2PAEA 1RC6A 3LA7A 1VJ2A 3NJZA 5KBFA 4FBFA 3S7EA 4QMAA 1EYBA 2GZWA 2D5FA 3NL1A 1WGPA 3UKTA 5I0UA 3NSTA 4HVRA 4XFFA 1Q43A 1NE4A 4XFHA 2PHLA 2BNNA 1WA4A 3D0JA 1LKNA 2Y0OA 1YFXA 2EA7A 4FT8A 4Z07A 5JCTA 2FMYA 1ZZ6A 1Q3EA 3DL3A 1Y3TA 3BB6A 1EPZA 1VP6A 3KGZA 1I5ZA 4WVZA 3WW2A 3KMHA 4HN0A 5F1RA 3HT2A 4EV0A 4AQ2A 1U12A 1SEFA 5I8SA 4KWLA 4D7TA 4KU8A 2GC1A 1YHFA 1XE7A 2BYVE 4FAHA 2GC2A 2P17A 2QJVA 2XHKA 5FQ0A 2OA2A 3H50A 4MV2A 5T3NA 2VPVA 3E5UA 4F8AA 1ZZBA 4LULA 4YSFA 5CU1A 2EVXA 4HSJA 5J3UA 1FT9A 5I91A 4WBBA 1J58A 3BPZA 5I0RA 4PJYA 3FHIB 5BY5A 1UIJA 2FQPA 4META 3OCPA 1DGWA 4JV4A 1YLLA 1J3RA 1SFNA 3H1WA 3BALA 1NE6A 4FAGA 5FPXA 2MNGA 4XF1A 1RUNA 2PAKA 4P9GA 3RYPA 5KHIA 1YWKA 1ZRDA 3IDBB 4O9EA 3GYDA 5J48A 2BNMA 1TQ5A 5EFUA 2IXKA 1X8MA 4HVQA 3CLPA 3CO2A 1O5LA 3ROUA 1ZX5A 2XKOA 4Q0PA 1QWRA 4EWAA 2VQAA 1OI6A 1QXRA 1ZZ8A 2QCSB 1ZRRA 3C3VA 3CJXA 1J3QA 1ZRCA 1O5UA 2D40A 2K9ZA 4BHPA 4MUVA 2Q30A 3GBFA 4R52A 2O1QA 1UIKA 4JVAA 4IERA 3NKTA 4ZU5A 1ZNPA 1GQGA 4QGMA 1FI2A 4UXAA 4IEYA 5I0TA 3E97A 4XFCA 4J1XA 1UCXA 2WC2A 2E9QA 4JTNA 2UY9A 3FFQA 3MPBA 1O3TA 4ZU7A 4EWEA 3QOPA 2ETEA 3FZ3A 1NXMA 3H7YA 4Q0QA 4YRDA 3LZZA 2H6CA 3D82A 3HT1A 2PFWA 2GAUA 2KXLA 2N7GA 4AVBA 4AVAA 5JSPA 4IEVA 1YFWA 4PIZA 5K8SA 5LEKA 3ACLA 4XF9A 2OPKA 5D1IA 1SQ4A 1ZRFA 3BCWA 4QGLA 5AVPA 1DGRA 2Q4SA 4I3PA 2XLFA 4LA3A 1DZTA 1OMIA 4LUKA 5E1RA 1RUOA 2Z69A 4PIYA 1UPIA 4E2GA 2PQQA 4XFGA 4Q0SA 4RD7A 5LRRA 4LLOA 2Q1ZB 4HBNA 2IXHA 1UD1A 2IXJA 2PYTA 4XFAA 5JR7B 5FLHA 1I6XA 1IPKA 5FLJA 2PAMA 2GC0A 4X6QB 1NYWA 1VR3A 3E5QA 2HJIA 3RPQA 3CEWA 3LOIA 1CX4A 4H7LA 3E6BA 3UKNA 2GU9A 4AVCA 3FJSA 3RYRA 3U11A 1V70A 3BU7A 4YYOA 4IEWA 4QM9A 2OZJA 4L2NA 4IESA 5KHJA 4KU7A 2PA7A 1ZVFA 1CAWA 4EROA 4BH9A 3L2HA 2H0VA 2DCTA 1NZCA 3PLQA 2UY8A 3MDPA 4QX5A 1PM7A 2H6BA 5BUVA 3LA2A 1RTVA 3ETQA 4XF0A 5I0SA 2B5HA 4MGIE 5I8YA 1J1LA 2ZKLA 1Y9QA 4D7SA 4GULA 4Q0UA 3M70A 1CGPA 2BNOA 3H7JA 3DV8A 4EWDA 3H1MA 3EJKA 4WZCA 1G6NA 4E2SA 1OD5A 2UYBA 3OD0A 2CV6A 1X7NA 5FPZA 3SCFA 3PNAA 5KHGA 3NVCA 4N9HA 4XF3A 1JUHA 3E6CC 2XL9A 3IWZA 5KHHA 2IXCA 4ORFA 4XFIA 1ZZ9A 4I02A 3S7IA 1EY2A 3FX3A 4LTAA 2I45A 1O3QA 4B29A 2MHFA 1LR5A 2F4PA 1CAWB 2OZ6A 2XKPA 2QNKA 4F7ZA 4QGNA 1WLTA 3I59B 3ELNA 4YARA 1YFYA 4ONUA 1X8EA 3R6SA 2PHDA 4ZU4A 4MX3A 2HKXA 4YNIA 3HIFA 4R8HA 4LUMA 2CAVA 3EO6A 3TNPB 2BGCA 1FXZA 4XFBA 4I2OA 5HI0A 5BXXA 5LRSA 5JSOA 3LWCA 4MGKE 2WFPA 2PTMA 4Z82A 2O8QA 4KWKA 2ET1A 4HVOA 3WW1A 3SMHA 3KSCA 4QM8A 4TLFA 5I8TA 3EBRA 3I54A 3IDCB 2MPFA 3E5XA 3E6DA 1QXJA 2GC3A 4IETA 1O4TA 3KGLA 3RDIA 2QVSB 4I09A 1OFNA 2ET7A 4UBGA 5BPXA 1LB2A 2ZCWA 5EZWA 3EQEA 3I7DA 3G7DA 3H9AA 3KCCA 1ZZCA 4K8FA 4HMZA 4IEOA 3S0MA 1IPJA 1HW5A 1QY4A 3LA3A 3H3ZA 3NW4A 4E2QA 3N4MA 2QDRA 5CVRA 4JTOA 3MYXA 5J7MA 3FWEA 2D93A 5FCCA 1H1IA
chains in the Genus database with same CATH superfamily
1CQ9A 4G3YC 4ZKTB 1YYNA 1POV3 1VE0A 4Q4Y2 4AXOA 5FTTC 4CCMA 1TME3 2XVKA 2ZX2A 3TN92 3ZYJB 2FDGA 1CWPA 3PUIA 4COYA 1ODNA 2FDFA 2W91A 3ES1A 3FLPA 5SV5A 4IE6A 3D5OA 4NAMA 5FYMA 3NQHA 2R042 3OF1A 3TAYA 2VMCA 1V6IA 3ZXDA 4COVA 1H1MA 3ZXFA 1RUG2 3MZHA 4DO0A 5K0UC 3PVNA 3PUAA 4RQPA 4I0BA 4WZFA 4YM0A 2FMDA 1REFA 4IEUA 4QXKA 3TOJA 5IATA 4M00A 3GCXA 1JH5A 1WCUA 3NWKA 2B8MA 4I01A 2VUAA 3PU3A 1VBD3 1IKQA 1W2OA 1S2EA 3WDXA 1GZTA 3HNMA 3UGHA 1UW8A 5BNNC 3K46A 2DCJA 4DS0A 1OA2A 1PNGA 4L11A 1O3RA 3U10A 5JOWA 1UNBA 1AR91 3LDKA 2WAAA 5H9RA 2TBVA 3WQ1A 5FAXA 5GLZA 1HRI2 2XVLA 5IVCA 2VZPA 3SEEA 1D4M2 3USUA 3H1YA 4FPKA 4LITA 2FBEA 1LHUA 2VTXJ 3IT8A 2VH9A 4Y4RA 1LTEA 3DYMA 4HG6B 4CXYA 4PLOA 4ARXA 2E33A 2B9UA 2ZGPA 1H2LA 1W2TA 1HRV1 5L7OA 3C8XA 1YQ6A 2ZGSA 4HZFA 2VD7A 3APBA 1KITA 2F17A 3ZPYA 4AFMA 2W68A 2CAUA 4XQDA 3IBMA 2RE9A 4GJYA 5LEJA 1XE0A 3ZKYA 2RHPA 1ND2B 4DINB 1SHWB 2ZHLA 3OGSA 3GJBA 4RGAA 5FLIA 1W9WA 5AVAA 1QH6A 5FY7A 1CIWA 2P3KA 1Y43B 1OLQA 4AEJA 3RJRA 1YQ8A 3VN4A 1XRUA 1WW6A 3WSOA 1E5RA 4AEMA 3NJYA 1YUDA 1VBA2 5ACA2 3PMSA 1W0PA 1NXD1 4A7KA 4HK9A 2V09A 5FZ0A 1LOGA 1AYM1 3HEIA 5B2GB 5KXDA 2Q8CA 3V56A 4OHWA 2FCTA 5FPAA 1YFUA 3O5SA 4CDUB 4IEZA 4GWMA 2HBTA 3H3UA 3LE0A 4GMP3 2ARAA 4HSLA 4Q4X3 3ZXLA 2BEOA 1DGLA 1TMF1 3I3QA 3LAGA 3PIGA 3ZYGA 4Y20B 5C6CA 2Z2SB 2VW2A 1PZ8A 3AVSA 5ANQA 1EP0A 1RUC3 4IDZA 3ZFEB 3OEAA 4KQ7A 1W6PB 1HRI3 5CISA 4M3CA 5A3WA 4GQ7A 2GP5A 4A44A 2P3YA 2GALA 1ZREA 1BMV2 3J26N 4CYDA 4FOYA 3A22A 4CCOA 2VZQA 1C5IA 2RS11 5ABJB 3ASIA 3T0BA 3HAGA 4IEPA 4YFWA 4XC9A 1ONAA 2EAAA 1S0JA 2WWSA 3JBG1 2CGPA 3I8TA 3A7QA 2HWE1 2ZS6B 4OUMA 1AR61 1V9U3 3JB8A 4AFDA 4LBQB 3AKSA 1W8ZA 1OUXA 1C8NA 3VDAA 5DZGA 1VJ2A 3SQOA 4CPBA 1V0AA 4Q8KA 4Y1VA 2AZ5A 2WR9A 1WW7A 2EIEA 2ES3A 1AVBA 2GZWA 2YB7A 4XJ8A 3UGGA 1D2SA 3M3QA 4Q4W1 2D5FA 3NL1A 3QCWA 5K7PA 1UY3A 2A6WA 1ULGA 3NSTA 4Q1PA 4XFFA 2GP3A 5DN2A 4RFRB 3U75A 4HOOA 1K5MC 3QLQA 3HVDA 1LKNA 2Y6GA 4RGKA 4CUGA 1AHSA 4FQZA 5FPBA 3ZYPA 4FT8A 1Q56A 5FY0A 1VRH1 3PVEA 1Q3EA 3N7LA 3DL3A 3WDTA 5FZOB 4AR2A 2FDJA 3LPGA 3KGZA 1I5ZA 4BXFA 5GZGA 2BWAA 2WDBA 4CCKA 1RUI1 3KS7A 4P9IA 3ITQA 3MUY1 1YEWA 4XBQA 2EIGA 4HN0A 5LBCA 3WW2A 4A6OA 3SKVA 1RINA 2ZGQA 1F9KA 4P08A 3HT2A 2JDYA 4EV0A 3O1TA 3A23A 4ZZ8A 3WF0A 4LBLA 4XJUA 2DURA 3SITA 4YW6A 4XMAA 5FWEA 1GP5A 3ZSJA 3VD9A 4CDUA 4AFCA 2JB4A 3AK0A 4FAHA 4MXVA 2HWF2 1QGLA 2VMEA 1RHI1 4MV2A 2JECA 1HB2A 3GHMA 3E5UA 3LDBA 3SEPA 3ZFEA 4F8AA 5HCFA 3KQ4B 4LULA 5LK7B 1V6JA 2CGNA 2YY1A 2NLRA 1SDDB 2VBDA 1FT9A 1FYUA 1GV9A 5I91A 5KC6A 1J58A 4K8RB 5JMOA 1GP4A 1J83A 2WS93 4META 5A70A 4QT6A 3VD7A 1R091 3WG1A 3WDWA 5IK5A 3URFA 3SH3A 4AHYA 3PTYA 2GH8A 1YLLA 4QXHA 3FC0A 1SFNA 4GB32 2Y60A 5FPXA 2G9ZA 1POV1 5KXCA 2PN5A 5D8AB 2RG4A 3RYPA 1TME1 3AMQA 3GZUC 2CTVA 3MPPG 5LASA 3UESA 3VGIA 1WWYA 4PCRA 4SBVA 1RUJ2 1YWKA 3NNGA 1ZRDA 3MF9A 4O9EA 5GZFA 2P37A 3X29B 2WN3A 3WNOA 1Q8PA 5E89A 1U5IA 4J25A 5EFUA 1LOFC 3W59A 5JOXA 2D7FA 1X8MA 5FXZA 3TWIA 1O5LA 3Q8EA 5L19A 3LFMA 1NCQB 4ZHNA 3OGRA 3KV9A 1PO23 3AYCA 5LA1A 1LHVA 2JEMA 3INAA 4FPCA 4Q0PA 4K40A 2QZ2A 4UWDA 4EWAA 1ENQA 1OI6A 4URAA 1QXRA 2P6HA 1BKZA 4HPKB 1DQ2A 2WL1A 2WN2A 4M01A 1ZRRA 3I4IA 3I2IA 4QB1A 5AFEA 1VBC3 1ZRCA 4WM8C 4GKYA 4ZZ5A 4ASLA 4MYEA 5FY5A 1VBD1 3UNPA 4R52A 1ZBE2 4MO3M 3RWNA 3GF6A 4M4RA 5FZHA 4JVAA 4IERA 1RJ8A 4TN7A 1FI2A 4GA9A 4CEWC 4FPGA 1O8SA 3HNBM 5D21A 5I0TA 1AX1A 4J1XA 2QQJA 4OHXA 5CFDB 4CDQC 2ID4A 4Q1RA 2UY9A 3FFQA 4NWVA 4IE7A 4K1YA 5C7GA 5FO7B 1REEA 1NAEA 2VZVA 1JOPA 4NHKA 4FP3A 3QOPA 4XHXA 3FZ3A 3S57A 4YRDA 2H6CA 5IVVA 1WCSA 2E32A 3S30A 1UOFA 2YHJA 2X5IA 2YPJA 3VZJA 1G8WA 4N43B 4E9KA 1GZCA 3LCPA 3VBHB 4Q8LA 2QQUA 3HQRA 3OBAA 5LATA 4AVBA 4OI0A 3ACIA 3ZO0B 2XJPA 3RRDA 4EN0A 2UURA 4QPWA 3O1VA 1MZ6A 3LKJA 2D6PA 2WQZC 1S0GA 3ACLA 5A1LA 4XF9A 1YIPA 5EJ1B 4K20A 4L0PA 1OKOA 3ZIWA 4QQLA 4OHYA 1DGRA 2XLFA 5L9VA 3NJVA 1X50A 1OMIA 1FAYA 2RR12 2ZHNA 3POBA 4QPIB 5FZ7A 4LUKA 3HPNA 1LU1A 3SLIA 1FMD2 1IHMA 1UPIA 1RUD3 4JHTA 2FZ2A 4XFGA 4Q0SA 4EZ4A 2Y64A 1JU4A 2IXJA 5E8AA 3OUIA 3Q8FA 4XFAA 2LALA 5FLHA 1PGW2 4GMP1 1IPKA 4Q4X1 5JPMB 4LHKA 1F5FA 5C3QA 4CTEA 4OQ8A 1LOAA 1NCQA 2JIJA 3I3MA 1RUC1 5FKCA 3CEWA 3ZN4A 4HANA 1EAH3 5JI7A 1DBNA 1CX4A 1HRI1 2ZHMA 4UFHA 4P9WA 3VBRB 4AVCA 4FFHA 4HPKA 5A3UA 1HDKA 4NJ4A 3BU7A 1DZQA 3T3YA 4A4AA 3KT1A 3QD6A 4L2NA 4R9DA 5IVYA 4UFKA 3MUZ1 4U2AA 3VD4A 5A3TA 1Q8OA 4KU7A 2KD7A 2PA7A 1D7PM 5EHDA 4D94A 5FMOL 1LGNA 1OLME 4Y1ZA 5FPUA 1MS0A 4BH9A 3L2HA 2H0VA 4AZZA 2DCTA 3MV01 3CHXA 2JICA 4BMBA 5JXHA 1V9U1 1W9SA 4PF1A 5JZGA 1QOTA 4M3CE 5KHJA 4DRRA 2XJVA 2RS53 2QFEA 2VOTA 3ZYRA 1WLWA 1CIYA 2LM3A 2UY8A 4MHUA 3RG0A 3HWJA 2SBAA 2X05A 2XPJA 4BA6A 2H6BA 3KB5A 1RTVA 3LA2A 4K1ZA 1ZYBA 2LRPA 5CIRA 3ZYIB 4BISA 5IK8A 2X53S 1UAIA 4V2WA 4QX2A 4MGIE 3VB9A 2K46A 1LOEA 5I8YA 4L92A 2LW8A 5IK4A 4N43A 1Y9QA 4D7SA 3VBHA 1UN1A 3OGGA 2R0FA 4Q0UA 4FPEA 5T55A 2BPA2 3VLBB 3H7JA 1MEC2 2VVDA 3DV8A 4LORA 4N53C 1K3IA 5LA2A 2VUDA 4A6SA 2W95A 1XNKA 1SLLA 1YXWA 5FZDA 1H2NA 3VBSB 4CDWC 1QJEA 2PHFA 2WSUA 3ORJA 3VBFC 1WCQA 2W92A 3SCFA 1A3KA 3ALQA 3PNAA 1GNZA 2HLEA 5DAXA 4AVVA 1JS9A 4V2VA 4N9HA 4XHBA 4RR3C 5FYIA 5J98B 1PGSA 4FPFA 1PM4A 4ORFA 4QX7A 1R1A3 2CDOA 2VZSA 4XJ9A 4UFIA 2JX9A 3FX3A 1LCLA 4ISQA 4LTAA 4XE9A 4XPVA 5DG2A 5DG1A 4BQYA 1W8WA 5FY8A 3ZSMA 1RMU2 2DDUA 3WEZA 3WQ0A 4ASMB 2VXJA 5CKQA 2ZGNA 4MGQA 4COZA 2VMFA 3WZ1A 3ZSKA 1MQTA 2WNVB 5LW9A 2EIBA 2W9XA 4HT1T 3ON7A 4G4FA 1CAWB 4DOUA 2WQ4A 2XKPA 3VBRA 4DMIA 5HPOA 2P5BA 4YGEA 2B39A 4INDA 2HWD2 3K75B 3C7FA 2EXKA 4YARA 1MS8A 1VLNA 3T0DA 1FV3A 1UU6A 2ZX1A 3E1F1 5JIUA 2HKXA 4QHZA 2WS91 2VAUA 2Z79A 1AYN3 1SG3A 2GNTA 3AM2A 3VHPA 5JR2A 5FYZA 3POWA 1TVGA 3N3HA 4QHOA 2D6OX 5JSOA 1GBGA 3SNMA 3LWCA 5C3RA 3VBUC 2BZDA 2WFPA 1E57A 2O8QA 1OUSA 2ET1A 2AR6A 2V4AA 3SMHA 5EQUA 2ZGLA 3P3PA 4MVTA 2W1SA 4XOGA 5EYYA 1RUE2 3N7KA 3K48A 2D6NA 4GH4C 4YVSA 3EBRA 1HV0A 3I54A 3IDCB 5A7WB 4MG2A 3GXUA 3CJIB 1OT5A 5EP9A 3OG2A 2GC3A 1PO21 1VAVA 3KGLA 5K9YA 2WLQA 2X29A 3I49A 2A6ZA 3AZVA 4TZDA 3ZFFB 1DU3D 4BQ4A 2ORZA 4JGZB 1L7RA 3QBQA 3VBSA 5BPXA 2ARCA 2W52A 3WF2A 2QQPA 1C4RA 1VBC1 1VMFA 2UWCA 5AFBA 3I7DA 3W58A 3AL6A 2O0OA 2VOKA 1ZZCA 1AXKA 4IEOA 2ZTNA 4HK8A 4DB5A 2A5ZA 2JDMA 5EWSA 4RR3B 1OA3A 3TEWA 2RMU2 3VDDB 1AL22 1UMHA 2ZPXA 1W9YA 1NCRC 4Y22B 1JODA 1S4CA 4QB6A 5CVRA 3WY6A 4DXTA 5KR7A 5FUPA 3J8F2 1V6NA 1SLIA 5FCCA 2WNVA 3QH7A 1MZFA 1UU4A 2OQ7A 3MGUA 4FFFA 5CFCB 2RS33 1JYVA 4MGZE 1ND3A 1LAJA 1LEMA 1FNYA 1QKQA 1XSQA 3WUDA 2C26A 1Q5OA 3VZKA 5FYHA 1I5PA 5TSWA 1QJU3 1GQHA 3N9PA 4KL1A 2JB8A 3TNQA 3THPA 1H8TC 4HL0A 4AI9A 1HB3A 1PGL1 2WQ8A 1JZ6A 2I74A 2V72A 1CPNA 1YQ2A 3OYWB 4YW1A 5F3GA 2CNAA 1BXHA 2VMDA 3SHRA 4L99A 1QMJA 1XBFA 4AGGA 3ZN6B 5I93A 3FBYA 1GOGA 1CAXB 1J84A 5J96B 5C8WA 4PBPA 1ASJ3 5F37A 5BNPA 1RUD1 4S2DA 4LJHA 3NAPB 2AENA 2BU9A 1DQ0A 2LUWA 4MZUA 1GOHA 2BGPA 4N9IA 1ULDA 2F6BA 4XETA 1SACA 1CAUA 1W8NA 1XE8A 4I30A 2CU5A 1I9RA 5BNOA 5FIXA 2QBXA 4I0AA 3CQOA 2YMZA 3DKQA 3CJIA 1JZ2A 1F15A 5C9AA 1WD4A 4BDVB 4A45A 2VU9A 1EAH1 2XLGA 3KCXA 3U1XA 5L7OC 1J59A 2OQ6A 2WNOA 4R4ZA 1C8M3 4JGZA 3NNFA 1OOPA 2HYXA 2J22A 1LRHA 4BLJA 4GIQA 3ZR6A 3PU8A 1DYPA 4PT6A 1SPPB 3EXUA 1MS3A 4DUWA 3POYA 4Y26A 2P3IA 4QPGC 3T09A 4LEJA 1XYNA 4KWJA 1W6OB 1GSLA 4GD4A 3IN9A 1SCRA 4FFIA 1XXNA 4OYUA 4ZPIA 2OYZA 3RI8A 1H2MA 2VJXA 2VCMA 3VDDA 4AEKA 3O1UA 2RS51 1OXCA 3WP4A 4FPHA 4B4RA 1W03A 2VNRA 4Q4V2 4DY3A 4ZS2A 4N7IA 2W3JA 3DXUA 1OPOA 4Q29A 4A2UA 1LJ7A 4IV1A 3HOBA 4YZ3A 5CKMA 2NQYA 1JYWA 4LBJA 4UYBA 3KWVA 2B42B 5DAWA 1Q8VA 5CFCA 1POV0 1GOFA 5J09A 1XOYA 2JD4A 3QH6A 2PQSA 5CB7A 4A41A 4XYXA 4JZRA 5A6QA 4IE4A 1JZ7A 3ACHA 3USSA 5IYYA 1QNYA 3M2MA 4J1WA 5JOYA 1KDKA 4CCCA 5JAXA 1HXS2 5C3PA 4RQPB 4ZY9A 3RMXA 2VCCA 2PLV2 4IQPA 3FL7A 4FCAA 2AGSA 3DKWA 2QZ3A 3AMHA 3OYWA 5FQ0B 3PURA 2QQWA 1BEV2 2DWRA 1RUF2 2V5DA 3R4SA 1PIV3 2JDKA 1UQXA 4XDOA 1XQNA 3CMGA 3ZDVA 3C7EA 1CAXA 4EE2A 4E4HA 3PDQA 4XVHA 1IGOA 2BTVC 2XMLA 3VHRA 2ENRA 4MH0E 3O1PA 4LHLA 3NAPA 4NRQA 1C57A 1JU3A 1A8DA 2MEV2 2PHWA 4JQTA 4LBQD 4W50A 1RB8G 4QAWA 1CONA 2BBVA 4XUPA 1R1A1 4PF5A 4QX8A 5FDBA 3AYEA 5FZMA 3VDCA 2C5DA 3WF3A 1C5HA 4NIIA 3DN7A 4CU9A 5JSRA 3IIAA 2C1FA 4DXSA 1QQP2 3LSEA 4NWWA 4RFT0 1O6UA 2KM2A 3UYJA 1RC6A 3ILRA 3NJZA 4FPYA 5KBFA 2BVBA 5L7OB 4FBFA 3GBWA 3K3OA 4JGYA 4M4PA 4QMAA 5FZAA 3S7EA 2BW8A 2DBNA 2JKXA 2SLIA 5IVJA 4LHSA 1SPPA 1VBB3 5FP8A 3UKTA 5JXJA 4AAXA 1QJX3 1SFPA 1NE4A 1UYYA 4XFHA 5FK7A 1AYN1 1C3HA 1CZVA 2J1TA 5FYVA 3VBOA 2Y0OA 2JG8A 2E51A 2EALA 3DPRB 2VUCA 3J9SA 2YU1A 3MIHA 4CUBA 1A78A 1LESA 2EA7A 1OA4A 2FMYA 1VMJA 4RHV3 5IW0A 4O61A 5LBBA 1MR5A 4E4DX 2K2SA 4JQRA 3VDBA 3S5AA 2Y0IA 4XUNA 1EPZA 4GWNA 5F2SA 5K4LA 4FTEA 1UYPA 5KWRA 4CDUC 3IB3A 4LOSA 1CPMA 5F32A 4YWAA 5F1RA 4AG4A 4D69A 4XCAA 4CRQA 1VIWB 4QKBA 4AQ2A 4KWLA 3M3EA 3POGA 1H4HA 3ZFEC 5F7UA 3H8XA 1QU0A 4QB2A 1YHFA 4GMP0 2R073 5DDJ2 3UK9A 3B00A 3B93A 1H9WA 1AF9A 1Z7S2 4M3CB 3Q8AA 5A1AA 2BYVE 2CYFA 2QJVA 2P17A 2V5YA 2XHKA 5FQ0A 2BDRA 1Y4WA 4H3WA 1QQP3 2Y38A 4XW3A 3S6PA 4DEQA 5ABJC 5T3NA 1LOBA 1XPWA 2R32A 3HD8B 1ZZBA 4YSFA 2ZMLA 5CU1A 2LROA 1KEXA 2OXBA 3ZXGA 3AZZA 2YFZA 2Y6JA 4HSJA 2Q8DA 1W0OA 4JRAA 3K2OA 4AI8A 2X09A 5HXVA 1UMIA 2WT0A 5A7QA 5I0RA 4OI1A 5H9PA 4CU8A 1XC6A 1DQ1A 2AUYA 1XYPA 2PXJA 3FHIB 3B01A 5BY5A 1UIJA 1Z78A 3JD72 2VZTA 2DVBA 1GQPA 3N9OA 4JKMA 1DGWA 1Y9MA 1J3RA 4MXWB 5DABA 2RS31 4Q4Y3 1PO12 4RSUA 5HCHA 2W47A 3I3DA 4QU1A 5HBAA 5FP7A 3TN93 2PAKA 1IZ3A 2RJLA 1YQ5A 1BLZA 1D0GA 2E26A 2VE1A 2WSVA 3ILNA 4JAAA 4A7YA 5KHIA 1QJU1 1V6LA 1SBDA 2R043 2JIGA 4OULA 3FN9A 2BNMA 5DZFA 3NO8A 1LODA 5C70A 4BQ3A 4KGGA 3RWKX 4HVQA 3CO2A 4BB3A 1EV12 3DPRA 1RUG3 1YQCA 1H4GA 3VZMA 3R05A 4PQ9A 2VGDA 3ROUA 5C8CA 3AX4A 5A80A 5FWJA 3ZPOA 4LKDA 3Q8BA 1ASJ1 1GR3A 5IJRA 5IAVA 4OHVA 1PVC2 2LTNA 5KXEA 2Y6LA 1J3QA 1AJKA 2ZMNA 2D40A 1NQDA 1ULPA 2F4LA 3AP4A 2HH9A 4WVVA 1G9AA 4AQSA 3LOBA 3VKOA 1QJZA 1UIKA 1A8MA 1OLMA 4JHZA 1H1AA 3MW2A 5AC92 4ES8A 1GQGA 1ULFA 4AGRA 4UXAA 4AI3A 3I2KA 4YPJA 2VL4A 2Y33A 2VQ0A 1OQ1A 1D4M3 2P3JA 1C8M1 4YW4A 1RJ7A 5JXGA 4AK3A 3ILFA 2DTYA 1W9TA 4HKLA 2XH6A 1R082 2FZ1A 2YGMA 4AGVA 1VAKA 3LZZA 3AP5A 1L7LA 2TNFA 3D82A 2OS2A 5JUVA 5F2WA 2NMOA 4OZOA 4P9JA 2HEWF 3I2GA 1AL0G 2KXLA 5DQ0A 4AVAA 1F31A 5A7OA 4PI2A 2YPDA 4P02B 4IEVA 4D6QA 4Q5OA 1HLCA 4XJWA 5D8AC 5FZKA 3PMEA 4KMQA 5FO9B 2XXZA 4YM2A 4E8CA 1NLSA 4XABA 3CKHA 1EV13 1VBA3 1CESA 4QGLA 4XCBA 4QDSA 5AVPA 5FBJA 1R64A 5ACA3 3NNMA 2P6CA 5LK5A 2KR2A 3LFIA 5FR3A 2J7MA 1H30A 4MXWA 4XQWA 1RUOA 2Y6KA 2R30A 2XQRA 4LK7A 4PIYA 3AVRA 4QKFA 4LNVA 3CDZB 4DEVA 2A3XA 5A3OA 4B7EA 1NCQC 3IAPA 3MIFA 4H14A 2ZEYA 4YW2A 2Q1ZB 3TEXA 4BMEA 3ZKUA 4CUAA 4XJZA 3WNKA 2XONA 4XIOA 4DFSA 5DXDA 2WUHA 3FHQA 4QQPA 5A6XA 2EICA 2CHHA 2PAMA 1W0NA 2Z42A 4CEYA 2PHTA 5G05L 4AEDA 3E5QA 2HJIA 3POEA 4IV3A 1PIV1 4AFAA 1CVNA 2RM22 2WFF2 2WZR2 3ZXAC 2IZWA 3MIDA 3MFCA 3RYRA 4Y1XA 2R7EB 5JVVA 4YYOA 4NR1A 1R083 4IEWA 5EPAA 4IESA 4ZXEA 1K5JA 4Z1VA 4WM7B 3A0NA 2QKDA 3KV6A 4OI2A 4DRVA 2GSYA 4U36A 2FDKA 4UAPA 4CP2A 1T6GC 3I2OA 5CFDC 4JKLA 3IDEA 3WNNA 4EROA 3HN1A 3LEMA 1AR82 3W21A 2QQOA 3I2HA 4NROA 3PLQA 2HWC2 3AL5A 3MDPA 5FOBB 2J1VA 4KNCA 3V0BA 4N43C 1PM7A 2X5IB 2WIIB 3VBHC 3ZFGB 1QHDA 3ETQA 4KH9A 4XF0A 5A7SA 3A4UA 1XU1A 1ULCA 2JJ6A 2QDNA 2ZAAA 4AI1A 2B5HA 3DF0A 4FTBA 1VBB1 1G9DA 2D6LX 4CCJA 1BBT2 2P2KA 3MHZA 2A1XA 3JB4C 1KGYA 1QJX1 2DVFA 3LD8A 3I3EA 1NY72 1J1LA 1TEIA 1COV2 4URTA 3M70A 1CGPA 3NV2A 2Q1FA 5EJ3A 2BNOA 2C24A 3T2TA 4AWDA 3O12A 3TB0A 1OF3A 3EJKA 4QPIC 4RYDA 4RHV1 1ENXA 4H2AA 1G6NA 1JOJA 4LK6A 4E2SA 2UYBA 2O14A 3BYWA 1GMMA 4GAZA 1ALYA 4LIVA 4QQ2A 4FXGB 1K12A 1NX9A 5FZ1A 3VKMA 3ME2A 3POSA 3WG4A 2ZGMA 4Q2FA 1VBE2 2G4IA 2DFCA 4IGQA 3R4DB 2XL9A 4LKSA 5HCBA 2ZABA 3BUCA 3J7NA 1UYXA 1KJRA 1MQTC 2Y8KA 4BOWA 5BNNA 1DHKB 4GWIA 2JE8A 4XFIA 5C71A 3KHCA 3WDUA 2R071 3VBRC 5T54A 2WNEA 4QDRA 2E31A 2ORXA 2HWF3 3C2UA 4RA0A 2I45A 4JDNA 4LKFA 5F5QA 5H9QA 1V6MA 1QQP1 2VZ3A 4Y1YA 2MHFA 1I1EA 3WCSA 4UW3A 2F4PA 2YFUA 2ZGKA 2OZ6A 3MIGA 3PL0A 4F7ZA 5I0DA 4QGNA 5JZGB 2QUOA 5EJZB 3IPVB 3VZLA 4DQAA 3JXSA 4WM7A 2WO3A 4ONUA 4UW6A 4LT5A 3VHOA 3WOGA 3OSDA 1XSRA 3P1IA 1JZ3A 4R8HA 1G9BA 4FPJA 2CAVA 4FI9A 2VMGA 3H8OA 5FYYA 1FXZA 1MS9A 1APNA 4UI9L 4C1WA 4GB33 3VKNA 3F2ZA 2EXIA 4J6GA 4Q4Y1 3ZFGA 3TN91 3ZR5A 3SKJE 4Z82A 4D6SA 1RUJ3 5FJKA 2PHUA 4AYUA 4COUA 2B4KA 5L9RA 1SLTA 2YC2A 3KSCA 1HIXA 3HN3A 2R041 2QQIA 2VTFA 1UZWA 3NV3A 5FYTA 3VBSC 1UPSA 2VY0A 3ZX7A 1OQEA 1RUH2 2MPFA 3PUHA 5DPNA 3WDYA 1RUG1 3ZM8A 3E6DA 1QXJA 1DYOA 3H42B 3D6EA 5GZCA 3IM0A 3RDIA 5E88A 5C4WB 1LNSA 3BOPA 4ATFA 3UJOA 1FPN2 4YZ4A 5A33B 2R6QA 4MHRA 1LB2A 1ZBA2 5LA0A 2CDPA 5EZWA 1HN1A 5SV8A 2W87A 3THTA 4DXRA 4E27A 2VUJA 1W04A 2R062 3EQEA 4A3XA 1ZBE3 3K4DA 1AR72 3WVJA 1AUYA 1NKGA 4K8FA 1S55A 1N3OA 1BCXA 4XURA 3LA3A 1J1TA 5FMOS 2WNVC 3ACFA 5T52A 1MQTB 3H3ZA 1OLRA 3IMMA 4CVUA 4QQHA 2BP6A 2W2IA 1D4M1 4OQ9A 3N4MA 2OKXA 3WP3A 1JYXA 2WRAA 3IKWA 3FWEA 2OUJA 2ZEXA 3SC7X 2VOXA 1ZZ7A 2XDVA 1KFUL 5J1XA 5IUQA 4QQOA 5GZDA 5E16A 5CEHA 1G7YA 1VAMA 4QX1A 2OW4A 3JUUA 3OTFA 1HN0A 3KHBA 1O59A 3IPVA 3LF7A 5L9BA 2JD9A 2ZGUA 1ST8A 1N1SA 2LS6A 2D97A 3J7MA 3AKQA 3PVBB 4XEZA 1OVSA 3AB0A 5A7PA 2ZACA 3WW4A 4BQ1A 5IVEA 5HXMA 4NPRA 1EUUA 4XACA 1EV11 1VBA1 5ACA1 3ZXJA 5JWPA 4M0HA 3UV9A 4BIFA 2W1QA 5F3IA 2ZZQA 2RR13 3IZOA 1VRBA 3GDBA 4Y1UA 1FMD3 1NA1B 5LBEA 1FPN3 4YFZA 4YVSB 2BOJA 3NV4A 3CJIC 1ZBA3 2AREA 3OPZA 5T5OA 5C9AC 5KHKA 4O9GA 5A3NA 2DBIA 4YW3A 1SBEA 3WP5A 1NOVA 3ZFFC 4OUSA 2W0XA 3LEIA 4L9BA 4QKDA 1MVQA 4JGZC 4V1PA 2FD8A 1CAVB 2J1EA 3CZJA 1E5HA 3K4AA 1O7FA 3N9QA 4RGGA 4YG3A 4IE0A 3WXPA 5HCAA 1KS4A 2YZ4A 2NP0A 1X9PA 4OFGA 4P9LA 5C4WA 4AQTA 1D0HA 1NUKA 4NOTA 5D2AA 3RZZA 2IXLA 5A33A 1BMV1 1R081 3WDVA 3VDDC 1OBNA 4OLLA 1RVF2 4YVWB 3T2PA 3ACGA 3ZXEA 4IEQA 4KBZA 1ULEA 4JC1A 4AI2A 1UKRA 5CA6A 1AZDA 1SCSA 2VZ1A 3IAQA 4LO6B 2CL2A 3SCGA 2IXIA 4BM8A 4M0NA 2JDZA 4BYYA 3CNAA 5CFCC 5JDBA 1FATA 1IQDC 4LA2A 4EN8B 1US2A 2Q0AA 1ND3B 2GMEA 3T1LA 4EQVA 3B69A 3K77A 1OURA 1X82A 1S1AA 2B9VA 2OUHA 4KG8A 4KGQA 4LPLA 4WVMA 3RYKA 2X8KA 3ZLIA 3SXWA 1XB9A 4O7XA 1YI9A 1W3VA 3QACA 1QIQA 5BV6A 1WW5A 2VULA 2DVAA 1H6YA 2JDHA 1MEC3 2ZXQA 3T4VA 1ENSA 3SH5A 1CX1A 5CKNA 4XF4A 2UYAA 1NT0A 1O3SA 2W1WA 2VG9A 2ADEA 2XL7A 5BNPB 1R1ZA 3NAPC 2WABA 5M0TA 2JDAA 4B1LA 1AR92 1F4HA 1CAUB 4XMIA 1NA1A 4JDOA 4QPYA 2VQUA 4CP1A 5A6ZA 5BNOB 1Q8SA 4LLFA 4LO7A 1OHFA 3CBNA 3O14A 4XTPA 3RNSA 4FPOB 1J3PA 2VTXA 4FP2A 1HJGA 2ZMKA 3KT4A 5T50A 3SCHA 5C9AB 1CZTA 2BFUS 3D4KA 3J4UH 3LGRA 3RSJA 1RVF3 4WVWA 1WCKA 3KVAA 4JGYC 2XJSA 3RFRA 1ZM1A 2OPWA 3D0SA 1HRV2 3JZVA 2HWF1 1RMU3 1OOPB 2J1RA 3WHUA 1CAVA 2A3YA 4CDQA 1PMIA 3O1SA 1H8VA 4BQ2A 4PIXA 2IC1A 4NO4A 2W08A 3KV4A 4HLTA 2PAEA 4CU6A 3LA7A 4RS5B 4ES9A 4MADA 4BQXA 2BFUL 3FLTA 4CCDA 1CZSA 3KF5A 3M7AA 2HWD3 1SZBA 1LOCA 2ARBA 1MS4A 3ZSLA 4YVWA 2ZGOA 1NY71 1Q43A 2YG0A 5L73A 5LA9A 2W39A 1JYTA 1AYM2 1WA4A 3D0JA 5A32B 1LHWA 4XDQA 1EPWA 2J42A 2DU1A 4IV1B 1IS4A 5DUUA 4AVSA 5FMBA 3OBRA 4GB31 5JCTA 1X36A 1QOOA 4HKWA 5C5UA 5FXWA 4AAPA 1O4YA 2DUQA 1ZZ6A 3WX5A 3BU0A 1TMF2 1Y3TA 1RUJ1 2FHRA 3DYOA 4RN5A 5CG8A 2WNUB 1PK6B 3LIGA 4RQPC 1GLHA 1UOJA 1UOBA 3K51A 4AHWA 4WVZA 1RUE3 1Y7BA 2FDHA 2IUWA 2WYFA 1JUIA 3KMHA 3GM8A 3KT7A 2GNDA 5EXOA 3DUIA 1WBLA 3MFAA 1D2QA 4XZUG 3VV1A 1SEFA 1W2NA 4PLNA 3O1MA 2GC1A 2RS12 2YBPA 1SLBA 1W06A 1WMEA 3BN6A 4D3WA 4M3CF 2KA3A 3JBG2 2C6SA 1PX4A 4Z92B 1C1FA 2HWE2 3H50A 1AR62 5FZFA 2A6VA 3V0AA 2DYCA 4G9SB 3LPFA 4YM3A 1C1LA 1ZBE1 1PVXA 2WYSA 4P14A 4CPBD 1W6QA 2JDNA 5CG9A 4MOAA 1U5XA 2RMU3 3AFGA 5J3UA 1AL23 4Q4W2 4OHZA 4KWUA 3SH4A 4JGYB 5DAQA 5J37A 3B5LB 2FQPA 3J8F3 3M8LA 1H6XA 1PHMA 2Y6FA 1OC1A 2WKKA 5IK7A 2YGLA 1BVP1 4NIDA 1Y9GA 1OKQA 2A73B 2UU8A 4JV4A 4P9XA 3WNLA 1NG0A 2G9FA 4RS5A 1FX5A 4Z2AA 4EN6B 1DGRN 1AX0A 4FAGA 3CZUA 1VRH2 1RUNA 1DCSA 4P9GA 4MGSA 3VBOB 3WG2A 3DPRC 2E7QA 5JXIA 2JG8B 5F5IA 5FUIA 4D7YA 5FOJB 2QQKA 3FMGA 4N53A 3IDBB 1FNZA 4N7UA 4QXBA 5C33A 3GYDA 5J48A 2QQLA 1RUI2 2YC4A 3PTRB 1TQ5A 1YIFA 3AMMA 4NIHA 5FZCA 5A32A 3CLPA 4CDWA 2A3WA 2BJSA 3MV11 1TE1B 1V00A 2E7TA 3CIHA 2RR11 1H0BA 4UFJA 4CZSA 3BGAA 4PQQA 1QWRA 1FMD1 2W94A 4BCUA 1ZZ8A 5CBLA 1IOAA 1KDMA 1MZ5A 2QCSB 4CP9A 1POQA 2ARXA 1ZBA1 2HWE3 3KLSA 3DCQA 3U37A 5LCWL 2WNUA 1PK6A 3C3VA 3CJXA 4S2GA 4AW7A 1O5UA 1RHI2 2K9ZA 1PZ7A 4MUVA 1ENRA 2BUKA 3IMNA 2Q30A 1KD7A 4UW4A 4B3NA 1PGW1 3GBFA 1KFXL 3LQCA 2O1QA 4XXAA 4DY5A 4MLOA 2VBBA 1NLQA 2WWUA 3NKTA 4QGMA 1BK0A 1OH3A 3P5BA 3THCA 3P6BA 3ZIXA 4OMDA 4DIQA 1W28A 4P5HA 2ZX0A 4YM1A 4IUGA 4XFCA 1LENA 4I0WB 4YZ5A 1B35A 4AVTA 3AYDA 1RYYA 2E9QA 2VMHA 4UW5A 4JTNA 5CAZA 4R9CA 3PVOA 3Q8CA 3ZMOA 2E7AA 5LY1A 3RZHA 1R092 1LECA 4IL7A 4IGPA 1O3TA 5ISLA 1D4VB 4P9YA 3OPWA 2ETEA 1NXMA 3H7YA 4E8DA 4YG6A 1GP6A 3MO4A 2GMMA 3HT1A 2WLPA 3IIIA 4JX0A 4KG0A 4C1XA 3LEGA 4K21A 2PFWA 2WA3A 1TME2 2GAUA 4ATEA 2WO1A 1US3A 5IWFA 2N7GA 4HXCA 4YW7A 4BU2A 2W1UA 3OJBA 5JSPA 1W6NB 4PIZA 2V73A 4Q4V3 1KJLA 1PMJX 3WINE 2JG9A 3KCYA 5LEKA 1SQ4A 3OOXA 3WNXA 1IG0A 3BCWA 3DYPA 2OVUA 3W20A 2Q4SA 1E5SA 5HV0A 2VNOA 2XB6C 3B3QE 3BIWE 4OUEA 1URXA 4E4SA 5E1RA 1SBFA 3HBKA 5IT6A 2YU2A 4W8JA 1RIRA 2PMWB 4E2GA 4GH4A 4PDWB 1MEC1 4AEDC 5LRRA 1UY1A 1HXS3 1XU2A 5C8CB 1UD1A 2XQXA 1NLRA 2PLV3 1WKYA 5FREA 3U4XA 1VBD2 1I6XA 1O91A 2GC0A 4FSJA 4E4ZA 2VNVA 1BEV3 4X6QB 1RUF3 1NYWA 1VR3A 3RPQA 1TNFA 2A75A 3LOIA 4LXLA 2JE9A 4W4ZA 1FV2A 4H7LA 3WG3A 3PUSA 1IKPA 2GU9A 4N90A 3UKNA 3VD3A 3FJSA 2XOMA 4LIUA 4B7KA 3U11A 4CXWA 5GZEA 4C0BA 1UL9A 1DLCA 2MEV3 4QM9A 3T4HB 2VXRA 3VD5A 2P34A 1JI6A 3I2FA 1RVF1 4QD2A 2XJQA 2XVGA 5LB6A 1ZVFA 3Q9OA 4LO5B 1AXZA 4FOQA 4YZ2A 3AZWA 2HWB2 3DXTA 3UL2A 5GLVA 1NCRA 1RMU1 1N47A 5FZBA 3UJQA 3NRUA 2W46A 2VW1A 1NZCA 4YGCA 3UT0A 3FUOA 2CWMA 4F3JA 5F3CA 4BQ5A 1QF3A 3RVHA 1BJQA 4QX5A 5FZLA 4O65A 2HWD1 1JHJA 5FP4A 4Y3OA 5FUNA 2D98A 2D6KA 2ZEZA 3HMYA 4GALA 1STMA 5T5LA 4CU7A 3AKRA 3NNJA 2V4VA 2DCZA 3RMYA 3UETA 5CZKA 1H8TA 2ZKLA 2XUMA 5JLVA 4GULA 4H7MA 4C90A 5A3LA 2OX0A 5FZ3A 3AMNA 1HQLA 4EWDA 4LQRA 1ZA4A 1X9TA 4NRPA 1MS1A 1W6NA 4EJRA 1ODMA 5IHRA 1A34A 4XUOA 2ZOEB 1GFF2 3WD5A 4Q4X2 5A7NA 1HKDA 2AC1A 3ZYFA 4BPZA 5DAPA 1CJDA 2DV9A 1AXYA 5FPZA 4B1MA 1QOSA 4CDXA 3MLKA 1RUC2 1EUTA 2Y26A 1RUE1 3GHNA 5APAA 5KHGA 1W6MA 4S2HA 4LR4A 3WT3A 1JUHA 4PDWA 3E6CC 4CEYB 1S0FA 2HBUA 3IWZA 4GKXA 5HV4A 4UFLA 4AEDB 4IV3B 2IXCA 4EYUA 1BZWA 4PBOA 5DDJ3 1V6OA 1Z7S3 2YV8A 3N7JA 4TSVA 1H9PA 2HWB3 4I02A 4K3UA 1HQNA 1EY2A 2TEPA 4SLIA 4AL9A 2QQNA 3T30A 4C91A 2P4EA 1O3QA 1OFSA 2WINB 1LHNA 1V9U2 4LBNA 4OI4A 4WM7C 3BPSA 5F5CA 5FZGA 1LR5A 5FO8B 2XJRA 2XBO2 4NHMA 4TTGA 2G1MA 1WMXA 4QPGA 2WZPP 4XDPA 3L2YA 3N36A 4OCTA 2NN8A 1WLTA 3AP9A 3I59B 1QDCA 2RMU1 4B4QA 1AL21 1UZYA 1YFYA 2BERA 3ELNA 2OIIA 4W65A 1UOGA 4CUCA 5A3MA 4CCEA 3R6SA 2PHDA 4ZU4A 5FP9A 4BXSV 2X5IC 3V0BB 3D3AA 4YNIA 3ZFGC 2G9GA 3J8F1 3JD73 3FFZA 4D0QA 3RZLA 2VCAA 3RS6A 5FFOC 1JZ5A 4XFBA 1PZ9A 4I2OA 5HI0A 5BXXA 1UO9A 1JHNA 1PO13 2VM9A 4A3ZA 1PMHX 4C0HA 2VR4A 2B46X 2PTMA 2BOIA 2QTWB 2ZX4A 4I3GA 4KWKA 1LGBA 4HVOA 3WW1A 4JCKA 4DUVA 2DF7A 1YJLA 3K3NA 5K0UB 4Y4YA 2AACA 4QM8A 1W2AX 4TLFA 3U78A 3VZOA 5I8TA 1TZOA 2R0HA 2YUEA 1HB4A 1NQJA 1S0CA 3ZMNA 1DF0A 4FOVA 3JCIA 1OSGA 1GU3A 4HKOA 2C4XA 4IETA 5DAVA 2CGOA 1C28A 3N9NA 4I09A 1WMDA 4LKEA 1PVC3 5GLWA 4COWA 2VMIA 2VCBA 4ASKA 5BNNB 1IPSA 2ZCWA 4BWOA 1GKBA 4HETA 5IVFA 3MW3A 2XBO3 3LEKA 3L9JT 3OY8B 2RJKA 4GZ9A 3G7DA 3H9AA 1JN2P 1DFQA 2YC0A 3ZYBA 4L8QA 4EZHA 4B8EA 5AC93 2ZHKA 1IPJA 1HW5A 5F39A 1RXFA 2X10A 1HB1A 3SISA 1CN1A 3ZN5A 2AEYA 4XAAA 1KQRA 4A7ZA 4CSWA 5ANNA 4YGBA 5JZGC 3BKZA 2WS92 2VBPA 1N1YA 4JTOA 4BK5A 3MYXA 3AZXA 2IWGB 4LBOA 1YI7A 1JBCA 2YROA 2VO5A 4XZPA 4ZS3A 1H1IA 1V6KA 4JRLA 1ND2A 3GNEA 3HQXA 5FY1A 5FZ9A 4YG0A 2Y6HA 3M3CA 3GJAA 3CL1A 3H8UA 3I59A 3O0XA 3TBDA 1S2BA 4CA9A 3CF6E 4DNYA 4NE9A 4R9BA 2JWPA 4Y5SA 1WUVA 5E6HA 2E6VA 2A6YA 2K0GA 4Q4V1 5CADA 5J36A 4XQ4A 3POJA 2NZ9A 2XLAA 3LIHA 3T08A 3JQXA 2GH2A 4UT5A 1IS5A 3OGVA 4LBKA 4Q27A 2BVVA 3WW3A 5BYNA 5FPLA 4UBHA 2VECA 2VNGA 1PO22 5FP3A 1GICA 4AI0A 5CYYA 1CJPA 4ISRA 3PJQA 5F3EA 5T5JA 4UF0B 2Q1MA 4MSVA 3HNYM 3BVCA 1SMVA 4Y20A 3I2JA 1UU5A 4X6RB 1CD3G 3F95A 2ZGTA 3ZDSA 1HXS1 3ZXKA 3ST7A 2J1SA 3WP6A 2XJTA 1VBC2 5DUWA 5C4WC 1RGSA 2PLV1 1W6PA 3FE5A 5K0UA 1W8TA 3AKTA 3M3IA 2GN7A 3JQWA 1JMUB 3ABZA 5IFPA 2NPIA 5GJ6A 1L3JA 1BEV1 4TYSA 1RUF1 1G86A 4F83A 5FZEA 2RM23 1W39A 4KBBA 2WFF3 5GM0A 2WZR3 1I3HA 4HN1A 5T5PA 3EHKA 1L7QA 5ABJA 3U0ZA 4NVPA 5IAXA 2DTWA 1DZRA 1OH4A 1SLAA 1YCIA 2RV9A 3OBZA 4JDMA 5F5AA 3RJ2X 3ZYHA 4BE3A 1XNTA 2MEV1 3B02A 4LBQA 2XG3A 3ECQA 3NJXA 2QQVA 3OY8A 1OD3A 2HEYF 3C7HA 1U5YA 1AR83 1QEXA 2JXAA 4LE3A 4QWNA 2AH2A 2XGXA 4AF9A 2DVDA 1OQDA 3H3LA 2HWC3 4FVVA 4EN9B 3BI3A 2YXSA 2ADDA 1O4ZA 3OUJA 1N3PA 3NKGA 1ZRIA 1K5MB 1PGL2 3HJRA 2C0ZA 4NPLA 4X8NA 2R16A 5FXXA 1BBT3 2D5HA 1ACCA 4K9SA 4AQ6A 4P00B 1YO8A 2WO2A 4Q0VA 1COV3 5FKBA 4NHLA 3AXDA 2WBKA 3MICA 1UY4A 1XNBA 4W6YA 5FZOA 1RUD2 5H9SA 2Q8OA 5BNQA 4QHBA 4IEXA 1LGCA 2VZUA 4MGYE 3N9MA 1JZ4A 3W9AA 1NA1C 1JOBA 4YVSC 1QDOA 3WQBA 2BGOA 1UZ0A 1S0BA 1SDWA 2I07B 5FYUA 2JKBA 4Y33A 1EAH2 1GYKA 1VBE3 2Z5WA 4UF0A 2R1BA 4ARYA 2GNMA 5B4NA 2VVEA 2WZEA 1JYIA 2ZJCA 3AYAA 3DEMA 3KD4A 3RZKA 2XWBB 3EMRA 1HQWA 3OGJA 3UKVA 3OPTA 3N7MA 5DDJ1 3AKPA 2EAKA 3GBGA 3J7HA 1GUIA 1Z7S1 1U5ZA 1WA6X 1WCDJ 2HWB1 2E53A 1S2KA 1BVVA 5EIYB 1RL3A 3ES4A 2ATFA 2O8OA 3OB8A 4ITCA 4Q26A 1K42A 2WJSA 3WUCA 5LZ6A 3B9CA 3O7OA 4YVWC 2DCKA 1FOD2 2RS52 4PLMA 2XWJB 4DUXA 2QQMA 1DDLA 2WAOA 1XYOA 1EYBA 5FBZA 2Y34A 3A0KA 5A3PA 1M4WA 3T1MA 2DFBA 2WT2A 1WGPA 5I0UA 3W5NA 1ND3C 4HVRA 3ZVXA 1G9CA 2PHLA 3ETPA 3JD71 5D8AA 2BNNA 3TEZA 2XUEA 2A70A 3P3NA 4K6BA 4WVMB 4RL7A 5DZEA 5F6LB 4QX0A 1WBFA 1YFXA 1OF4A 4Z07A 5GKAC 1PO11 5IVBA 1PNFA 4XJAA 2VQTA 4HFSA 3KVBA 1IG3A 1K5MA 1IS6A 3BB6A 2QE3A 1VP6A 2DUPA 3UGFA 2RDRA 4S2FA 4QX3A 5LWBA 4XTMA 3B9IA 4W6WA 2G19A 2ZGRA 5BNPC 1RUH3 4D8MA 2Z4FA 1IS3A 2ZX3A 4FXKB 2RDQA 3PHMA 4P5YA 1YRZA 1U12A 2JDPA 5I8SA 1DQ5A 1GNYA 4D7TA 2UWAA 4K7JA 1WLDA 1SFYA 4KU8A 4WM8B 4LBMA 4TLGA 1UX6A 1UXZA 4XUTA 4ZXKA 2C9KA 1R1A2 5BNOC 1JTZX 1XE7A 2NYYA 4KI5M 2PHRA 1T2XA 1PVC1 2D3SA 2GC2A 2VZOA 2CWSA 2ERFA 3OD4A 4BQWA 3R0RA 4XAEA 3HQUA 2OA2A 1GANA 2NMNA 1FOD3 2R063 2VPVA 2XBO1 3VL9A 1QJY2 3AMPA 1AR73 4B4PA 4CEWB 4CE8A 1UY0A 5DMYA 3NNLA 1OOPC 2EVXA 2J1UA 5CFDA 3AXEA 3A21A 2VW0A 3KF3A 5G04L 3T2OA 4CDQB 5AC91 5FYSA 2EXJA 3AJZA 3G6JB 1S0DA 3MLLA 4WBBA 1QXPA 2ZBJA 2WZ8A 3BPZA 1WZXA 3D8CA 3POFA 4RS5C 4PJYA 4TXWA 3GGLA 1LU2A 3FBMA 5FXVA 1JZ8A 3GCWA 1HX6A 1UXXX 4NRMA 5LY2A 3OCPA 1Z0HA 1AYN2 4NIAA 5FMDA 1NZIA 4NN0A 3VKLA 2YYOA 3H1WA 3MIBA 4LE4A 4NIGA 3BALA 1NE6A 5GALA 2MNGA 4XF1A 2C9AA 1TNRA 4IV1C 1GWLA 3MEPA 2DCYA 4D6RA 4UFMA 1WMFA 5LBFA 5FZ8A 2CSGA 3MW4A 2B45X 3M4FA 2EIDA 4HONA 1WLCA 5JOZA 4QPIA 4LOTA 3TYJA 4CCNA 2IXKA 2GMPA 2UWBA 2XR4A 3DGTA 3ZSEA 2EXHA 1DQ6A 1PK6C 2WNUC 1W2UA 2CY6A 4N8MA 4IXLA 1JYCA 3MLJA 1T6BX 1ZX5A 1OVPA 2XKOA 4Y5Z0 3V64A 1PX3A 5FK8A 2D44A 2VQAA 1SLCA 3I2DA 1UWWA 2WWJA 1LOFA 3AP6A 3GZTB 1DLLA 3I97A 4NPMA 2YBSA 2XHNA 1VMHA 2DVGA 1W90A 4BHPA 1N1VA 1QJY3 2ZA9A 2ZAHA 1GZ9A 1B35C 3AJYA 1N1TA 3WHTA 4Y24A 3W5MA 3VKFC 4ZU5A 4AFBA 1ZNPA 1DG6A 4BZ4A 1GZWB 1W9FA 2RM21 5FYCA 1KXGA 1UZVA 4IEYA 2WFF1 5FYBA 1B09A 2WZR1 4WM8A 1G9FA 3V0AB 3E97A 5JIAA 2DUOA 1UCXA 3VHNA 1DP0A 1W8FA 2WC2A 5EYXA 3WF1A 1W6QB 3MPBA 4NUBA 1UF2C 3C7GA 2D3PA 4EWEA 1F2NA 4ZU7A 1VALA 4CEWA 1UX7A 4Q0QA 2A71A 3AFKA 4ET7A 1XNCA 2JG9C 4WV8A 1YJKA 5IFTA 2RS32 2EF6A 4NAOA 3THDA 1F8VA 1AR81 3OEBA 3U07A 4DXZA 1GNHA 5C3OA 1M06G 2BWCA 2HWC1 4DZGA 1QJU2 1YFWA 4AE2A 4FPLA 5K8SA 1BK1A 2NM1A 4CCLA 3VBOC 1BHGA 1YC61 3O1RA 2JG8C 2OPKA 2P1BA 4R4XA 2IFRA 2R1DA 4TWTA 5D1IA 3WR0A 1ZRFA 5ERLA 4I3PA 1BBT1 4N53B 2D6MA 4LA3A 1DZTA 3S5QA 3EYPA 2D43A 3C7OA 2IVIB 4Z8BA 5EV7A 3IDAA 2FCVA 1COV1 2Z69A 1ASJ2 2PQQA 4FO9A 2RVAA 1OPMA 1E5IA 4CDWB 4RD7A 4OMCA 4FFGA 4LLOA 4YLZA 3VBFB 3WQ7A 4HBNA 2IXHA 5FMCA 3TEYA 4LO8A 2PYTA 2VOWA 3HBZA 5JR7B 1S0IA 3RGBA 3RZMA 1JW6A 1MPXA 5FLJA 3M1HA 2A6XA 2OT7A 4A42A 4CP9B 3T0AA 1DIWA 3TRSB 5F8PA 3N35A 5JI9A 2AYHA 4GXLA 4JKKA 3JU9A 1AR93 2E63A 1VBE1 4LO4B 3E6BA 3VL8A 1VPHA 3B94A 5FY9A 1C8M2 2WA4A 1V70A 4UOJA 3FUQA 2OZJA 1BQPA 3RZGA 4YW5A 4BIOA 1CAWA 1UY2A 1HRV3 1B35B 1JYNA 3MF6A 1W3XA 4XIKA 1U0AA 5FPVA 3O0WA 4AHZA 1MACA 1GZWA 1N3QA 2YDEA 2Q8EA 3VZNA 2IFWA 4YGDA 3R4UA 1F4AA 2GNBA 1VB2A 3BIEA 3N9LA 3K4ZA 5A1FA 3B7MA 5BUVA 1P8JA 5I0SA 4H55A 1UYZA 4R9AA 1XJAA 1KRIA 3VUOA 4PHZA 2ZZJA 3NMBA 3O0VA 1GWMA 1IQAA 2PHXA 2DU0A 3H0OA 4FTSA 4XBLA 2ZEWA 3BODA 2JG9B 1QNWA 3BTXA 1AYM3 3VBUB 3I3BA 3WLUA 1JXNA 4NHXA 4XBNA 1W8OA 2BQPA 1F35A 4CDXC 3H8RA 3H1MA 4WZCA 3GALA 5C5TA 3WCRA 5KC5A 3WV6A 3KM5A 4NHYA 3RQ0A 1QJFA 1OD5A 1TG7A 4LHNA 1QH7A 5FJHA 1F5JA 1TMF3 2RJ2A 4PDWC 4GH4B 3MBWA 3OD0A 1DYKA 3GZEA 5A7WA 2CV6A 1X7NA 5JMCA 5C8CC 2HEVF 5CNAA 1Q8QA 4C8DA 4QKNA 1PIV2 5L36A 3ZFFA 3NVCA 2JENA 3FHAA 1W8HA 3M3OA 3PIJA 2GN3A 4GWJA 4OVEA 5A6YA 1RUH1 4XF3A 3CU7A 3POIA 2RDSA 1XNDA 5KHHA 2H0BA 1LHOA 3WF4A 2JDUA 3VBFA 3KV5A 2RS13 1ZZ9A 2ILMA 3BTZA 3ENRA 3S7IA 4BJ0A 1FPN1 2W5FA 3JBG3 4LMFA 1LULA 4NMIA 4B29A 4FQ4A 4MGTA 3LB9A 1AR63 4RR3A 1S0EA 1FOD1 2R061 3AC0A 1AX2A 5DUVA 1AR71 2AEZA 4GJZA 1MS5A 4ZONA 3U4SA 5GLTA 2BRTA 2ZKNA 1NCRB 4XUQA 2QNKA 1HJFA 2FCUA 4Y22A 5B4XA 4AHXA 2XJUA 1REDA 4AOCA 2IVJA 1W8UA 3ATGA 2TUNA 4Q4W3 4IW3A 4Z2WA 3WNPA 1VBB2 1X8EA 5FZIA 4CXXA 2GDFA 4MX3A 1QJX2 3HIFA 2FDIA 4LUMA 1DQ4A 2HYKA 1W05A 3EO6A 1BYHA 1RITA 1VB4A 2BGCA 2PELA 2VVFA 3OUHA 3PUQA 5FY4A 3TNPB 1LEDA 3LSDA 5F9TA 5KXBA 2VOVA 4FOWA 4IGOA 2YBKA 3LDRA 2VZRA 3ZOIA 4YZ1A 5LRSA 3RZJA 3RI9A 4MGKE 3WNMA 3NV1A 1VRH3 1H8TB 2A7AA 2D3RA 4RHV2 2J1AA 5FV3A 3J7LA 4L97A 5FZ4A 3DECA 5GLUA 4CP0A 1WW4A 4BLIA 3T2QA 3V65A 4QU2A 3EB7A 2Q5TA 1KS5A 2R49A 3ZN6A 1GWKA 1RUI3 4BK4A 4XXPA 5F6KA 1MVEA 4XILA 3FLRA 3VBUA 4DPNA 3U14A 3AZYA 5FRAA 1H2KA 1DGWX 1WD3A 2L9LA 1YNAA 1UZZA 3E5XA 3HR9A 4IE5A 4CDXB 3O1OA 1O4TA 5C3SA 2QVSB 4OZXA 1MZEA 1W6MB 2R072 1CR7A 3OBTA 1OFNA 3AP7A 3KZ4C 1K45A 1O8PA 4Y5TA 2ET7A 4UBGA 3USUB 4PI0A 2RDNA 3MIEA 5FZ6A 4CEYC 1UMZA 2BV4A 4IV3C 1RHI3 1ZA7A 3PJYA 3MI8A 1QJY1 4QDQA 3BTAA 3BTYA 3KCCA 2B7YA 2WO7A 4HMZA 3KQRA 4X8PA 3S0MA 1XNAA 1QY4A 3BOWA 1X33A 1HV1A 1ND2C 1W99A 1AJOA 1ULOA 2JE7A 3GZAA 2VC9A 4EN7B 2I2SA 3NW4A 4E2QA 4QPGB 4QXCA 1A6CA 5JPNB 2QDRA 1W6OA 1RXGA 5DUXA 1R093 5J7MA 2D93A 2BBAA 4W6XA 2WT1A 1UKGA
chains in the Genus database with same CATH topology
1CQ9A 4G3YC 4ZKTB 1YYNA 1POV3 4Q4Y2 4AXOA 5FTTC 1TME3 2XVKA 2ZX2A 3TN92 3ZYJB 4COYA 3FLPA 3ES1A 5SV5A 3D5OA 2R042 3OF1A 3TAYA 4COVA 1V6IA 3ZXDA 1H1MA 3ZXFA 1RUG2 3MZHA 5K0UC 3PVNA 4RQPA 4I0BA 4WZFA 4YM0A 2FMDA 1REFA 4IEUA 4QXKA 3TOJA 4M00A 1JH5A 3NWKA 2B8MA 4I01A 2VUAA 1VBD3 1IKQA 3WDXA 1UW8A 5BNNC 2DCJA 4DS0A 1OA2A 1PNGA 4L11A 1O3RA 3U10A 5JOWA 1AR91 5H9RA 2TBVA 3WQ1A 5FAXA 5GLZA 1HRI2 2XVLA 1D4M2 3USUA 3H1YA 4FPKA 2FBEA 1LHUA 3IT8A 2VH9A 1LTEA 4PLOA 2B9UA 2ZGPA 1H2LA 1HRV1 5L7OA 2ZGSA 4HZFA 3APBA 1KITA 3ZPYA 4AFMA 2W68A 2CAUA 4XQDA 3IBMA 2RE9A 5LEJA 2RHPA 1ND2B 4DINB 2ZHLA 4RGAA 5FLIA 5AVAA 1QH6A 1CIWA 2P3KA 1Y43B 1OLQA 4AEJA 3RJRA 3VN4A 1XRUA 1WW6A 4AEMA 1YUDA 1VBA2 5ACA2 3PMSA 1W0PA 1NXD1 4A7KA 4HK9A 2V09A 1LOGA 1AYM1 5B2GB 5KXDA 3V56A 4OHWA 1YFUA 3O5SA 4CDUB 4IEZA 4GWMA 3H3UA 4GMP3 4HSLA 4Q4X3 3ZXLA 2BEOA 1DGLA 1TMF1 3LAGA 3ZYGA 5C6CA 4Y20B 2Z2SB 2VW2A 1PZ8A 1EP0A 1RUC3 3ZFEB 4KQ7A 1W6PB 1HRI3 4M3CA 4GQ7A 2GALA 1ZREA 1BMV2 3J26N 4CYDA 4FOYA 1C5IA 2RS11 5ABJB 3ASIA 3HAGA 4IEPA 4YFWA 1ONAA 2EAAA 1S0JA 2WWSA 3JBG1 2CGPA 3I8TA 2HWE1 2ZS6B 4OUMA 1AR61 1V9U3 3JB8A 4AFDA 4LBQB 3AKSA 1C8NA 5DZGA 1VJ2A 4Q8KA 4Y1VA 2AZ5A 1WW7A 2ES3A 1AVBA 2GZWA 4XJ8A 1D2SA 3M3QA 4Q4W1 2D5FA 3NL1A 3QCWA 5K7PA 2A6WA 1ULGA 3NSTA 4Q1PA 4XFFA 1K5MC 3QLQA 1LKNA 1AHSA 4FQZA 3ZYPA 4FT8A 1Q56A 1VRH1 3PVEA 1Q3EA 3N7LA 3DL3A 3WDTA 3KGZA 1I5ZA 5GZGA 2BWAA 1RUI1 3KS7A 4P9IA 4XBQA 3WW2A 2EIGA 4HN0A 1RINA 2ZGQA 1F9KA 3HT2A 4EV0A 4LBLA 4XJUA 2DURA 3SITA 3ZSJA 4XMAA 4CDUA 4AFCA 3AK0A 4FAHA 4MXVA 2HWF2 1QGLA 1RHI1 4MV2A 2JECA 3GHMA 3E5UA 3ZFEA 4F8AA 5HCFA 4LULA 5LK7B 1V6JA 2CGNA 2YY1A 2NLRA 1FT9A 1FYUA 1GV9A 5I91A 5KC6A 1J58A 2WS93 4META 4QT6A 1R091 3WG1A 3WDWA 5IK5A 3URFA 3SH3A 4AHYA 3PTYA 2GH8A 1YLLA 3FC0A 1SFNA 4GB32 5FPXA 5KXCA 1POV1 2PN5A 5D8AB 3RYPA 1TME1 3AMQA 3GZUC 2CTVA 3MPPG 3VGIA 4SBVA 4PCRA 1RUJ2 1YWKA 1ZRDA 3MF9A 4O9EA 5GZFA 2P37A 3X29B 1Q8PA 5E89A 1U5IA 5EFUA 1LOFC 3W59A 5JOXA 2D7FA 1X8MA 3TWIA 1O5LA 5L19A 1NCQB 1PO23 3AYCA 1LHVA 2JEMA 3INAA 4FPCA 4Q0PA 4K40A 2QZ2A 4EWAA 1ENQA 1OI6A 1QXRA 4HPKB 1BKZA 4M01A 1DQ2A 2WL1A 1ZRRA 3I4IA 5AFEA 1VBC3 1ZRCA 4WM8C 4GKYA 4ASLA 4MYEA 1VBD1 4R52A 1ZBE2 3RWNA 3GF6A 4JVAA 4IERA 1RJ8A 1FI2A 4GA9A 4CEWC 4FPGA 5I0TA 1AX1A 4J1XA 4OHXA 5CFDB 4CDQC 4Q1RA 2UY9A 3FFQA 4NWVA 4K1YA 5FO7B 1REEA 4NHKA 4FP3A 3QOPA 4XHXA 3FZ3A 4YRDA 2H6CA 1WCSA 3S30A 2YHJA 2X5IA 2YPJA 3VZJA 1G8WA 4N43B 4E9KA 1GZCA 3LCPA 3VBHB 4Q8LA 4AVBA 4OI0A 3ZO0B 2XJPA 3RRDA 4EN0A 2UURA 1MZ6A 3LKJA 2D6PA 2WQZC 1S0GA 3ACLA 4XF9A 1YIPA 4K20A 3ZIWA 4OHYA 4QQLA 1DGRA 2XLFA 1X50A 1OMIA 1FAYA 2RR12 2ZHNA 4QPIB 4LUKA 1LU1A 3SLIA 1FMD2 1IHMA 1UPIA 1RUD3 2FZ2A 4XFGA 4Q0SA 2IXJA 5E8AA 4XFAA 2LALA 5FLHA 1PGW2 4GMP1 1IPKA 4Q4X1 5JPMB 4LHKA 1F5FA 4CTEA 1LOAA 1NCQA 1RUC1 3CEWA 3ZN4A 4HANA 1EAH3 5JI7A 1DBNA 1CX4A 1HRI1 2ZHMA 4P9WA 3VBRB 4AVCA 4HPKA 1HDKA 3BU7A 1DZQA 3KT1A 3QD6A 4L2NA 4R9DA 4U2AA 1Q8OA 4KU7A 2PA7A 4D94A 5KHJA 5FMOL 1LGNA 4Y1ZA 1MS0A 4BH9A 3L2HA 2H0VA 2DCTA 5JZGA 2JICA 4BMBA 1V9U1 1QOTA 4M3CE 4DRRA 2XJVA 2RS53 2QFEA 3ZYRA 1WLWA 2LM3A 2UY8A 3RG0A 3HWJA 2SBAA 2XPJA 4BA6A 2H6BA 3KB5A 1RTVA 3LA2A 4K1ZA 1ZYBA 5CIRA 3ZYIB 5IK8A 2X53S 1UAIA 4MGIE 1LOEA 5I8YA 4L92A 5IK4A 4N43A 1Y9QA 4D7SA 3VBHA 1UN1A 3OGGA 2R0FA 4Q0UA 4FPEA 5T55A 2BPA2 3VLBB 3H7JA 1MEC2 2VVDA 3DV8A 4N53C 1XNKA 1SLLA 1YXWA 1H2NA 3VBSB 4CDWC 2WSUA 2PHFA 3VBFC 3SCFA 1A3KA 3ALQA 3PNAA 1GNZA 4AVVA 4N9HA 4XHBA 4RR3C 5J98B 1PGSA 4FPFA 4ORFA 1R1A3 4XJ9A 2JX9A 3FX3A 1LCLA 4ISQA 4LTAA 4XE9A 4XPVA 5DG2A 5DG1A 3ZSMA 1RMU2 3WQ0A 4ASMB 2ZGNA 4COZA 3ZSKA 3WZ1A 1MQTA 2WNVB 4DOUA 4HT1T 4G4FA 1CAWB 2WQ4A 2XKPA 3VBRA 4DMIA 4YGEA 2B39A 4INDA 2HWD2 4YARA 2EXKA 1MS8A 1VLNA 1FV3A 1UU6A 2ZX1A 5JIUA 2HKXA 2WS91 2Z79A 1AYN3 2GNTA 3AM2A 3VHPA 3POWA 3N3HA 2D6OX 5JSOA 1GBGA 3SNMA 3LWCA 3VBUC 2WFPA 1E57A 2O8QA 2ET1A 2AR6A 3SMHA 2ZGLA 3P3PA 4MVTA 4XOGA 5EYYA 1RUE2 3N7KA 3K48A 2D6NA 4GH4C 4YVSA 3EBRA 1HV0A 3I54A 3IDCB 3CJIB 2GC3A 1PO21 1VAVA 3KGLA 5K9YA 2WLQA 2X29A 2A6ZA 3AZVA 4TZDA 3ZFFB 1DU3D 4JGZB 3QBQA 3VBSA 5BPXA 2W52A 2QQPA 1C4RA 1VBC1 2UWCA 5AFBA 3I7DA 3W58A 2O0OA 2VOKA 1ZZCA 1AXKA 4IEOA 2ZTNA 4HK8A 4DB5A 2A5ZA 5EWSA 4RR3B 1OA3A 2RMU2 3VDDB 1AL22 2ZPXA 1NCRC 4Y22B 3WY6A 5CVRA 3J8F2 1V6NA 1SLIA 5FCCA 2WNVA 3QH7A 1MZFA 1UU4A 3MGUA 5CFCB 2RS33 4MGZE 1ND3A 1LEMA 1FNYA 1QKQA 3WUDA 1Q5OA 3VZKA 5TSWA 1QJU3 1GQHA 4KL1A 3TNQA 3THPA 1H8TC 4HL0A 1PGL1 2I74A 1CPNA 4YW1A 3OYWB 2CNAA 1BXHA 3SHRA 4L99A 1QMJA 4AGGA 3ZN6B 5I93A 3FBYA 1CAXB 5J96B 5C8WA 4PBPA 1ASJ3 5BNPA 1RUD1 4S2DA 3NAPB 2AENA 4MZUA 1DQ0A 2LUWA 4N9IA 1ULDA 2F6BA 4XETA 1SACA 1CAUA 1XE8A 4I30A 1I9RA 5BNOA 4I0AA 2YMZA 3CJIA 5C9AA 1WD4A 2VU9A 1EAH1 2XLGA 3KCXA 5L7OC 1J59A 4R4ZA 1C8M3 4JGZA 1OOPA 1LRHA 4BLJA 4GIQA 1DYPA 3EXUA 1MS3A 3POYA 4Y26A 2P3IA 4QPGC 4LEJA 1XYNA 4KWJA 1W6OB 1GSLA 3IN9A 1SCRA 2OYZA 1XXNA 3RI8A 1H2MA 4AEKA 3VDDA 2RS51 3WP4A 4FPHA 4B4RA 2VNRA 4Q4V2 4DY3A 4N7IA 1OPOA 4Q29A 4A2UA 1LJ7A 4IV1A 4YZ3A 2NQYA 4LBJA 2B42B 1Q8VA 5CFCA 1POV0 2JD4A 3QH6A 5CB7A 4XYXA 3USSA 1QNYA 3M2MA 4J1WA 5JOYA 1KDKA 5JAXA 1HXS2 4RQPB 3RMXA 2PLV2 4IQPA 4FCAA 2AGSA 3DKWA 2QZ3A 3AMHA 3OYWA 5FQ0B 1BEV2 2DWRA 1RUF2 3R4SA 1PIV3 1XQNA 1CAXA 1IGOA 2BTVC 3VHRA 2ENRA 4MH0E 4LHLA 3NAPA 1C57A 2MEV2 1A8DA 2PHWA 4LBQD 1RB8G 1CONA 2BBVA 1R1A1 4PF5A 5FDBA 3AYEA 2C5DA 1C5HA 3DN7A 5JSRA 3IIAA 2C1FA 1QQP2 3LSEA 4NWWA 4RFT0 2KM2A 1RC6A 3ILRA 3NJZA 4FPYA 5KBFA 2BVBA 5L7OB 4FBFA 3GBWA 4JGYA 3S7EA 4QMAA 2BW8A 2SLIA 1VBB3 3UKTA 1QJX3 1NE4A 4XFHA 1AYN1 1C3HA 3VBOA 2Y0OA 2JG8A 2E51A 2EALA 3DPRB 3J9SA 3MIHA 1A78A 1LESA 2EA7A 1OA4A 2FMYA 4RHV3 1MR5A 4E4DX 2K2SA 4JQRA 2Y0IA 1EPZA 4GWNA 4FTEA 5KWRA 4CDUC 1CPMA 5F1RA 4AG4A 4D69A 4CRQA 1VIWB 4AQ2A 4KWLA 3M3EA 1H4HA 3ZFEC 1QU0A 1YHFA 4GMP0 2R073 5DDJ2 3UK9A 3B00A 3B93A 1H9WA 1AF9A 1Z7S2 4M3CB 2BYVE 2CYFA 2QJVA 2P17A 2V5YA 2XHKA 5FQ0A 4H3WA 1QQP3 2Y38A 4XW3A 3S6PA 5ABJC 5T3NA 1LOBA 2R32A 3HD8B 1ZZBA 4YSFA 2ZMLA 5CU1A 3ZXGA 3AZZA 4HSJA 1W0OA 4JRAA 4AI8A 5HXVA 2WT0A 5I0RA 4OI1A 5H9PA 1DQ1A 2AUYA 1XYPA 3FHIB 3B01A 5BY5A 1UIJA 1Z78A 3JD72 2DVBA 1DGWA 1J3RA 4MXWB 2RS31 4Q4Y3 1PO12 4RSUA 5HBAA 3TN93 2PAKA 1IZ3A 2RJLA 1D0GA 2WSVA 3ILNA 4JAAA 4A7YA 5KHIA 1QJU1 1V6LA 1SBDA 2R043 4OULA 2BNMA 5DZFA 3NO8A 1LODA 4KGGA 4HVQA 3CO2A 1EV12 3DPRA 1RUG3 1H4GA 3VZMA 3R05A 4PQ9A 2VGDA 3ROUA 5C8CA 3AX4A 1ASJ1 1GR3A 4OHVA 1PVC2 2LTNA 5KXEA 1J3QA 1AJKA 2ZMNA 2D40A 1NQDA 3AP4A 4WVVA 1G9AA 4AQSA 3LOBA 3VKOA 1QJZA 1UIKA 1A8MA 1H1AA 3MW2A 5AC92 4ES8A 1GQGA 1ULFA 4AGRA 4UXAA 4AI3A 2VQ0A 1OQ1A 1D4M3 2P3JA 1C8M1 4YW4A 1RJ7A 4AK3A 3ILFA 2DTYA 4HKLA 2XH6A 1R082 2FZ1A 2YGMA 4AGVA 1VAKA 3LZZA 3AP5A 2TNFA 3D82A 2NMOA 4P9JA 2HEWF 1AL0G 2KXLA 4AVAA 1F31A 4IEVA 4XJWA 1HLCA 5D8AC 3PMEA 5FO9B 4YM2A 1NLSA 1EV13 1VBA3 1CESA 4QGLA 5AVPA 5ACA3 5LK5A 1H30A 4MXWA 4XQWA 1RUOA 2R30A 4PIYA 4LNVA 2A3XA 4B7EA 1NCQC 4H14A 3MIFA 4YW2A 2Q1ZB 4BMEA 4XJZA 4XIOA 4DFSA 5DXDA 4QQPA 2PAMA 2Z42A 4CEYA 2PHTA 4AEDA 3E5QA 2HJIA 4AFAA 4IV3A 1PIV1 1CVNA 2RM22 2WFF2 2WZR2 3ZXAC 2IZWA 3MIDA 3MFCA 3RYRA 4Y1XA 5JVVA 4YYOA 4NR1A 1R083 4IEWA 4IESA 4Z1VA 4WM7B 3A0NA 2QKDA 4OI2A 4DRVA 2GSYA 4U36A 4CP2A 1T6GC 5CFDC 3IDEA 4EROA 3HN1A 1AR82 3PLQA 2HWC2 5FOBB 3MDPA 4KNCA 3V0BA 4N43C 1PM7A 2X5IB 2WIIB 3VBHC 3ZFGB 1QHDA 3ETQA 4KH9A 4XF0A 4AI1A 3A4UA 1XU1A 1ULCA 2JJ6A 2QDNA 2ZAAA 2B5HA 3DF0A 4FTBA 1VBB1 1G9DA 2D6LX 1BBT2 2P2KA 3JB4C 1QJX1 2DVFA 1NY72 1J1LA 1TEIA 1COV2 4URTA 3M70A 1CGPA 3NV2A 5EJ3A 2BNOA 4AWDA 3T2TA 3O12A 3TB0A 3EJKA 4QPIC 4RHV1 1ENXA 1G6NA 1JOJA 4E2SA 2UYBA 1ALYA 4QQ2A 4FXGB 3VKMA 3ME2A 3POSA 3WG4A 2ZGMA 4Q2FA 1VBE2 2G4IA 2DFCA 3R4DB 2XL9A 5HCBA 2ZABA 5BNNA 1KJRA 1MQTC 4BOWA 1DHKB 4XFIA 3WDUA 2R071 3VBRC 5T54A 2WNEA 4RA0A 2HWF3 3C2UA 5H9QA 2I45A 4JDNA 5F5QA 1V6MA 1QQP1 4Y1YA 2MHFA 1I1EA 3WCSA 4UW3A 2F4PA 3MIGA 2ZGKA 2OZ6A 4F7ZA 4QGNA 5JZGB 2QUOA 4DQAA 3IPVB 3VZLA 4WM7A 4ONUA 4UW6A 4LT5A 3VHOA 3WOGA 4R8HA 1G9BA 4FPJA 2CAVA 2VMGA 1FXZA 1MS9A 1APNA 4C1WA 4GB33 3VKNA 2EXIA 4J6GA 4Q4Y1 3ZFGA 3TN91 4Z82A 1RUJ3 2PHUA 4AYUA 4COUA 1SLTA 3KSCA 1HIXA 2R041 3NV3A 3VBSC 1UPSA 2VY0A 3ZX7A 1OQEA 1RUH2 2MPFA 3WDYA 1RUG1 3E6DA 1QXJA 3D6EA 5GZCA 3IM0A 3RDIA 5E88A 5C4WB 3BOPA 4ATFA 3UJOA 1FPN2 4YZ4A 5A33B 2R6QA 1LB2A 1ZBA2 5EZWA 5SV8A 3THTA 4E27A 2VUJA 2R062 3EQEA 4A3XA 1ZBE3 1AR72 3WVJA 1AUYA 4K8FA 1S55A 1N3OA 1BCXA 3LA3A 1J1TA 5FMOS 2WNVC 5T52A 1MQTB 3H3ZA 1OLRA 4QQHA 1D4M1 3N4MA 3WP3A 3IKWA 3FWEA 2OUJA 2VOXA 1ZZ7A 1KFUL 5IUQA 4QQOA 5GZDA 5E16A 1G7YA 1VAMA 2OW4A 3JUUA 3OTFA 3IPVA 2ZGUA 1N1SA 4XEZA 2D97A 3WW4A 3AKQA 3PVBB 4BQ1A 3AB0A 2ZACA 4NPRA 1EV11 1VBA1 5ACA1 3ZXJA 5JWPA 4M0HA 3UV9A 4BIFA 2ZZQA 2RR13 4YFZA 4Y1UA 1FMD3 1NA1B 1FPN3 4YVSB 3NV4A 3CJIC 1ZBA3 2AREA 3OPZA 5T5OA 5C9AC 5KHKA 4O9GA 4YW3A 1SBEA 3WP5A 1NOVA 3ZFFC 4OUSA 2W0XA 4L9BA 4V1PA 1MVQA 4JGZC 1CAVB 1O7FA 4RGGA 4YG3A 3WXPA 5HCAA 1KS4A 2YZ4A 2NP0A 4OFGA 4P9LA 5C4WA 4AQTA 1D0HA 4NOTA 3RZZA 2IXLA 5A33A 1BMV1 1R081 3WDVA 3VDDC 4OLLA 1RVF2 4YVWB 3ZXEA 4IEQA 1ULEA 4JC1A 4AI2A 1UKRA 5CA6A 1AZDA 1SCSA 4BM8A 4LO6B 2CL2A 3SCGA 2IXIA 4BYYA 4M0NA 2JDZA 5CFCC 3CNAA 5JDBA 1FATA 4LA2A 4EN8B 2Q0AA 1ND3B 2GMEA 3T1LA 3B69A 1X82A 1S1AA 2OUHA 4KG8A 4WVMA 4KGQA 3RYKA 2X8KA 3SXWA 1YI9A 3QACA 5BV6A 1WW5A 2VULA 2DVAA 1MEC3 1ENSA 3SH5A 4XF4A 2UYAA 1O3SA 2VG9A 2XL7A 5BNPB 1R1ZA 3NAPC 1AR92 1CAUB 4XMIA 1NA1A 4JDOA 4QPYA 4CP1A 5BNOB 1Q8SA 4LLFA 4LO7A 1OHFA 3O14A 4XTPA 3RNSA 4FPOB 1J3PA 4FP2A 3SCHA 2ZMKA 3KT4A 5T50A 5C9AB 2BFUS 3D4KA 3J4UH 3LGRA 3RSJA 1RVF3 4WVWA 1WCKA 4JGYC 2XJSA 1ZM1A 3D0SA 1HRV2 3JZVA 2HWF1 1RMU3 1OOPB 3WHUA 1CAVA 2A3YA 4CDQA 1PMIA 1H8VA 4PIXA 2IC1A 4NO4A 2W08A 4HLTA 2PAEA 4ES9A 3LA7A 4RS5B 2BFUL 3FLTA 3M7AA 2HWD3 1LOCA 2ARBA 1MS4A 3ZSLA 4YVWA 2ZGOA 1NY71 1Q43A 5L73A 2W39A 1AYM2 1WA4A 3D0JA 5A32B 1LHWA 4XDQA 1EPWA 4IV1B 2DU1A 1IS4A 5DUUA 4AVSA 3OBRA 4GB31 5JCTA 1X36A 1QOOA 4HKWA 1O4YA 2DUQA 1ZZ6A 3WX5A 1TMF2 1Y3TA 1RUJ1 2FHRA 5CG8A 2WNUB 1PK6B 4RQPC 1GLHA 3K51A 4AHWA 4WVZA 1RUE3 1Y7BA 3KMHA 1JUIA 3KT7A 2GNDA 5EXOA 3DUIA 1WBLA 3MFAA 1D2QA 3VV1A 1SEFA 4PLNA 2GC1A 2RS12 1SLBA 1WMEA 4D3WA 4M3CF