3IIDA

Crystal structure of the macro domain of human histone macroh2a1.1 in complex with adp-ribose (form a)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
185
Chain Sequence
ADGFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHPTNTDFYIGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A macrodomain-containing histone rearranges chromatin upon sensing PARP1 activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Core histone macro-H2A.1, Isoform 1
total genus 62
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2009-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3iidA00
1LAPA 4R76A 1BLLE 4K3NA 3VFQA 4K0CA 4KYBA 2BFRA 5FSUA 5E3BA 2EEEA 3EJFA 5HOLA 4GVVA 1SPVA 3GPQA 3Q6ZA 2FG1A 2AFCA 1YD9A 3EWPA 2FAVA 5HIHA 4ABKA 4ZY0A 5CB3A 2BFQA 3EJGA 3GPOA 1NJRA 3GPGA 3V45A 4ESSA 3JRUA 4GUAA 4ABLA 4GVWA 4TU0A 1VHUA 2X47A 3SIGA 4J4ZA 2ACFA 4KSIA 4D86A 3H8EA 1BPMA 4JLLA 3SIJA 3SIHA 4R7MA 3GQEA 3IJ3A 1LAMA 5CMSA 3ETIA 4ETKA 5FSYA 3V2BA 1LCPA 4ZX8A 2LGRA 3Q71A 2XD7A 1TY8A 3EWOA 2FXKA 4ETJA 3H8FA 4UMLA 5D8NA 4JGKA 4ZI6A 5FSXA 3EKEA 3KZWA 4X2TA 3KR4A 4JVVA 1BPNA 1HJZA 1LANA 3JZTA 1ZR3A 4ZY1A 2J9AA 3EWQA 3GQOA 1GYTA 4ZX9A 2L8RA 4ZY2A 3KQZA 3EW5A 5DUSA 3KR5A 1TXZA 2EWBA 4J5QA 3IIFA 2VRIA 5FSVA 4IQYA 3SIIA 3PEIA 3T8WA 3H8GA 2DX6A 4JCAA 4J5RA 4R6TA 3KQXA 5CB5A 1ZR5A 4ZYQA 5CBMA 5AILA 4J5SA 3EWRA 3IIDA 5FSZA
chains in the Genus database with same CATH superfamily
1LAPA 4R76A 1BLLE 4K3NA 3VFQA 4K0CA 4KYBA 2BFRA 5FSUA 5E3BA 2EEEA 3EJFA 5HOLA 4GVVA 1SPVA 3GPQA 3Q6ZA 2FG1A 2AFCA 1YD9A 3EWPA 2JZDA 2FAVA 5HIHA 4ABKA 4ZY0A 5CB3A 2BFQA 3EJGA 3GPOA 1NJRA 3GPGA 3V45A 4ESSA 3JRUA 4GUAA 4ABLA 4GVWA 4TU0A 1VHUA 2X47A 3SIGA 4J4ZA 2ACFA 2WCTA 2W2GA 4KSIA 4D86A 3H8EA 1BPMA 4JLLA 3SIJA 3SIHA 4R7MA 3GQEA 3IJ3A 1LAMA 5CMSA 3ETIA 4ETKA 5FSYA 3V2BA 1LCPA 4ZX8A 2LGRA 3Q71A 2JZEA 2XD7A 1TY8A 3EWOA 2FXKA 4ETJA 3H8FA 4UMLA 5D8NA 4JGKA 2KQVA 4ZI6A 5FSXA 3EKEA 3KZWA 4X2TA 3KR4A 4JVVA 1BPNA 1HJZA 2JZFA 1LANA 3JZTA 1ZR3A 4ZY1A 2J9AA 3EWQA 3GQOA 1GYTA 4ZX9A 2L8RA 4ZY2A 3KQZA 3EW5A 5DUSA 3KR5A 1TXZA 2EWBA 4J5QA 3IIFA 2VRIA 5FSVA 4IQYA 3SIIA 3PEIA 3T8WA 3H8GA 2DX6A 4JCAA 4J5RA 4R6TA 2RNKA 3KQXA 5CB5A 1ZR5A 4ZYQA 5CBMA 5AILA 4J5SA 3EWRA 3IIDA 5FSZA
chains in the Genus database with same CATH topology
1LAPA 4R76A 1BLLE 4K3NA 3VFQA 4K0CA 4KYBA 2BFRA 5FSUA 5E3BA 2EEEA 3EJFA 5HOLA 4GVVA 1SPVA 3GPQA 3Q6ZA 2FG1A 2AFCA 1YD9A 3EWPA 2FAVA 5HIHA 4ABKA 4ZY0A 5CB3A 2BFQA 3EJGA 3GPOA 1NJRA 3GPGA 3V45A 4ESSA 3JRUA 4GUAA 4ABLA 4GVWA 4TU0A 1VHUA 2X47A 3SIGA 4J4ZA 2ACFA 4KSIA 4D86A 3H8EA 1BPMA 4JLLA 3SIJA 3SIHA 4R7MA 3GQEA 3IJ3A 1LAMA 5CMSA 3ETIA 4ETKA 5FSYA 3V2BA 1LCPA 4ZX8A 2LGRA 3Q71A 2XD7A 1TY8A 3EWOA 2FXKA 4ETJA 3H8FA 4UMLA 5D8NA 4JGKA 4ZI6A 5FSXA 3EKEA 3KZWA 4X2TA 3KR4A 4JVVA 1BPNA 1HJZA 1LANA 3JZTA 1ZR3A 4ZY1A 2J9AA 3EWQA 3GQOA 1GYTA 4ZX9A 2L8RA 4ZY2A 3KQZA 3EW5A 5DUSA 3KR5A 1TXZA 2EWBA 4J5QA 3IIFA 2VRIA 5FSVA 4IQYA 3SIIA 3PEIA 3T8WA 3H8GA 2DX6A 4JCAA 4J5RA 4R6TA 3KQXA 5CB5A 1ZR5A 4ZYQA 5CBMA 5AILA 4J5SA 3EWRA 3IIDA 5FSZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAP A;  4R76 A;  1BLL E;  4K3N A;  3VFQ A;  4K0C A;  4KYB A;  2BFR A;  5FSU A;  5E3B A;  2EEE A;  3EJF A;  5HOL A;  4GVV A;  1SPV A;  3GPQ A;  3Q6Z A;  2FG1 A;  2AFC A;  1YD9 A;  3EWP A;  2FAV A;  5HIH A;  4ABK A;  4ZY0 A;  5CB3 A;  2BFQ A;  3EJG A;  3GPO A;  1NJR A;  3GPG A;  3V45 A;  4ESS A;  3JRU A;  4GUA A;  4ABL A;  4GVW A;  4TU0 A;  1VHU A;  2X47 A;  3SIG A;  4J4Z A;  2ACF A;  4KSI A;  4D86 A;  3H8E A;  1BPM A;  4JLL A;  3SIJ A;  3SIH A;  4R7M A;  3GQE A;  3IJ3 A;  1LAM A;  5CMS A;  3ETI A;  4ETK A;  5FSY A;  3V2B A;  1LCP A;  4ZX8 A;  2LGR A;  3Q71 A;  2XD7 A;  1TY8 A;  3EWO A;  2FXK A;  4ETJ A;  3H8F A;  4UML A;  5D8N A;  4JGK A;  4ZI6 A;  5FSX A;  3EKE A;  3KZW A;  4X2T A;  3KR4 A;  4JVV A;  1BPN A;  1HJZ A;  1LAN A;  3JZT A;  1ZR3 A;  4ZY1 A;  2J9A A;  3EWQ A;  3GQO A;  1GYT A;  4ZX9 A;  2L8R A;  4ZY2 A;  3KQZ A;  3EW5 A;  5DUS A;  3KR5 A;  1TXZ A;  2EWB A;  4J5Q A;  3IIF A;  2VRI A;  5FSV A;  4IQY A;  3SII A;  3PEI A;  3T8W A;  3H8G A;  2DX6 A;  4JCA A;  4J5R A;  4R6T A;  3KQX A;  5CB5 A;  1ZR5 A;  4ZYQ A;  5CBM A;  5AIL A;  4J5S A;  3EWR A;  3IID A;  5FSZ A; 
#chains in the Genus database with same CATH topology
 1LAP A;  4R76 A;  1BLL E;  4K3N A;  3VFQ A;  4K0C A;  4KYB A;  2BFR A;  5FSU A;  5E3B A;  2EEE A;  3EJF A;  5HOL A;  4GVV A;  1SPV A;  3GPQ A;  3Q6Z A;  2FG1 A;  2AFC A;  1YD9 A;  3EWP A;  2JZD A;  2FAV A;  5HIH A;  4ABK A;  4ZY0 A;  5CB3 A;  2BFQ A;  3EJG A;  3GPO A;  1NJR A;  3GPG A;  3V45 A;  4ESS A;  3JRU A;  4GUA A;  4ABL A;  4GVW A;  4TU0 A;  1VHU A;  2X47 A;  3SIG A;  4J4Z A;  2ACF A;  2WCT A;  2W2G A;  4KSI A;  4D86 A;  3H8E A;  1BPM A;  4JLL A;  3SIJ A;  3SIH A;  4R7M A;  3GQE A;  3IJ3 A;  1LAM A;  5CMS A;  3ETI A;  4ETK A;  5FSY A;  3V2B A;  1LCP A;  4ZX8 A;  2LGR A;  3Q71 A;  2JZE A;  2XD7 A;  1TY8 A;  3EWO A;  2FXK A;  4ETJ A;  3H8F A;  4UML A;  5D8N A;  4JGK A;  2KQV A;  4ZI6 A;  5FSX A;  3EKE A;  3KZW A;  4X2T A;  3KR4 A;  4JVV A;  1BPN A;  1HJZ A;  2JZF A;  1LAN A;  3JZT A;  1ZR3 A;  4ZY1 A;  2J9A A;  3EWQ A;  3GQO A;  1GYT A;  4ZX9 A;  2L8R A;  4ZY2 A;  3KQZ A;  3EW5 A;  5DUS A;  3KR5 A;  1TXZ A;  2EWB A;  4J5Q A;  3IIF A;  2VRI A;  5FSV A;  4IQY A;  3SII A;  3PEI A;  3T8W A;  3H8G A;  2DX6 A;  4JCA A;  4J5R A;  4R6T A;  2RNK A;  3KQX A;  5CB5 A;  1ZR5 A;  4ZYQ A;  5CBM A;  5AIL A;  4J5S A;  3EWR A;  3IID A;  5FSZ A; 
#chains in the Genus database with same CATH homology
 1LAP A;  4R76 A;  1BLL E;  4K3N A;  3VFQ A;  4K0C A;  4KYB A;  2BFR A;  5FSU A;  5E3B A;  2EEE A;  3EJF A;  5HOL A;  4GVV A;  1SPV A;  3GPQ A;  3Q6Z A;  2FG1 A;  2AFC A;  1YD9 A;  3EWP A;  2FAV A;  5HIH A;  4ABK A;  4ZY0 A;  5CB3 A;  2BFQ A;  3EJG A;  3GPO A;  1NJR A;  3GPG A;  3V45 A;  4ESS A;  3JRU A;  4GUA A;  4ABL A;  4GVW A;  4TU0 A;  1VHU A;  2X47 A;  3SIG A;  4J4Z A;  2ACF A;  4KSI A;  4D86 A;  3H8E A;  1BPM A;  4JLL A;  3SIJ A;  3SIH A;  4R7M A;  3GQE A;  3IJ3 A;  1LAM A;  5CMS A;  3ETI A;  4ETK A;  5FSY A;  3V2B A;  1LCP A;  4ZX8 A;  2LGR A;  3Q71 A;  2XD7 A;  1TY8 A;  3EWO A;  2FXK A;  4ETJ A;  3H8F A;  4UML A;  5D8N A;  4JGK A;  4ZI6 A;  5FSX A;  3EKE A;  3KZW A;  4X2T A;  3KR4 A;  4JVV A;  1BPN A;  1HJZ A;  1LAN A;  3JZT A;  1ZR3 A;  4ZY1 A;  2J9A A;  3EWQ A;  3GQO A;  1GYT A;  4ZX9 A;  2L8R A;  4ZY2 A;  3KQZ A;  3EW5 A;  5DUS A;  3KR5 A;  1TXZ A;  2EWB A;  4J5Q A;  3IIF A;  2VRI A;  5FSV A;  4IQY A;  3SII A;  3PEI A;  3T8W A;  3H8G A;  2DX6 A;  4JCA A;  4J5R A;  4R6T A;  3KQX A;  5CB5 A;  1ZR5 A;  4ZYQ A;  5CBM A;  5AIL A;  4J5S A;  3EWR A;  3IID A;  5FSZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...