3IIDA

Crystal structure of the macro domain of human histone macroh2a1.1 in complex with adp-ribose (form a)
Total Genus 62
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
62
sequence length
185
structure length
185
Chain Sequence
ADGFTVLSTKSLFLGQKLQVVQADIASIDSDAVVHPTNTDFYIGGEVGNTLEKKGGKEFVEAVLELRKKNGPLEVAGAAVSAGHGLPAKFVIHCNSPVWGADKCEELLEKTVKNCLALADDKKLKSIAFPSIGSGRNGFPKQTAAQLILKAISSYFVSTMSSSIKTVYFVLFDSESIGIYVQEMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A macrodomain-containing histone rearranges chromatin upon sensing PARP1 activation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Core histone macro-H2A.1, Isoform 1
total genus 62
structure length 185
sequence length 185
ec nomenclature
pdb deposition date 2009-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01661 Macro Macro domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.220.10 Alpha Beta 3-Layer(aba) Sandwich Leucine Aminopeptidase, subunit E; domain 1 Leucine Aminopeptidase, subunit E, domain 1 3iidA00
3EWRA 4ZY0A 3EWQA 1VHUA 3ETIA 3SIHA 5D8NA 1LAPA 5CBMA 4J5RA 1TY8A 3T8WA 4ETJA 5FSVA 3EWPA 4JGKA 2FXKA 3Q6ZA 2FG1A 1LANA 4ZI6A 5CB3A 5FSZA 2BFQA 4GVVA 1LAMA 5DUSA 3SIGA 1GYTA 2EEEA 4ZYQA 3IIDA 2FAVA 5HOLA 5CB5A 1BPMA 3GPGA 4KSIA 2L8RA 3KR4A 3H8EA 3EJFA 3KQZA 4GUAA 2BFRA 4GVWA 4J5SA 3KZWA 4R76A 2XD7A 1SPVA 1ZR3A 3KQXA 4KYBA 3EKEA 3KR5A 4IQYA 4TU0A 3V2BA 1HJZA 2X47A 4JVVA 3GQEA 5CMSA 2EWBA 3IJ3A 3JZTA 4K3NA 5FSXA 2ACFA 3SIJA 1YD9A 4ABLA 3EJGA 2VRIA 4ZY1A 3IIFA 3PEIA 3V45A 3VFQA 4ZY2A 1LCPA 2AFCA 4ABKA 3GQOA 1NJRA 4R6TA 1TXZA 4ETKA 4ZX9A 1BPNA 3JRUA 1ZR5A 4X2TA 5E3BA 3EWOA 5AILA 3Q71A 3GPQA 4ESSA 3H8GA 4R7MA 4ZX8A 4K0CA 5FSYA 4UMLA 3H8FA 2J9AA 5HIHA 4JCAA 3EW5A 4D86A 4J5QA 2LGRA 3SIIA 2DX6A 4JLLA 4J4ZA 3GPOA 1BLLE 5FSUA
chains in the Genus database with same CATH superfamily
3EWRA 4ZY0A 3EWQA 1VHUA 3ETIA 3SIHA 5D8NA 1LAPA 5CBMA 4J5RA 1TY8A 3T8WA 4ETJA 2JZEA 5FSVA 3EWPA 4JGKA 2FXKA 3Q6ZA 2FG1A 1LANA 4ZI6A 5CB3A 5FSZA 2BFQA 4GVVA 1LAMA 5DUSA 3SIGA 2WCTA 1GYTA 2EEEA 4ZYQA 3IIDA 2FAVA 5HOLA 5CB5A 1BPMA 3GPGA 4KSIA 2L8RA 3KR4A 3H8EA 3EJFA 3KQZA 4GUAA 2BFRA 4GVWA 2W2GA 3KZWA 4J5SA 4R76A 2XD7A 1SPVA 1ZR3A 3KQXA 4KYBA 3EKEA 3KR5A 4IQYA 4TU0A 3V2BA 1HJZA 2X47A 4JVVA 3GQEA 5CMSA 2EWBA 3IJ3A 3JZTA 4K3NA 5FSXA 2ACFA 3SIJA 1YD9A 4ABLA 3EJGA 2VRIA 4ZY1A 3IIFA 3PEIA 3V45A 3VFQA 4ZY2A 1LCPA 2AFCA 4ABKA 3GQOA 1NJRA 4R6TA 1TXZA 4ETKA 4ZX9A 1BPNA 3JRUA 2JZFA 1ZR5A 4X2TA 5E3BA 2RNKA 3EWOA 5AILA 3Q71A 3GPQA 4ESSA 3H8GA 4R7MA 4ZX8A 4K0CA 5FSYA 3H8FA 2J9AA 4UMLA 5HIHA 4JCAA 3EW5A 4D86A 4J5QA 2JZDA 2LGRA 3SIIA 2DX6A 4JLLA 4J4ZA 2KQVA 3GPOA 1BLLE 5FSUA
chains in the Genus database with same CATH topology
3EWRA 4ZY0A 3EWQA 1VHUA 3ETIA 3SIHA 5D8NA 1LAPA 5CBMA 4J5RA 1TY8A 3T8WA 4ETJA 5FSVA 3EWPA 4JGKA 2FXKA 3Q6ZA 2FG1A 1LANA 4ZI6A 5CB3A 5FSZA 2BFQA 4GVVA 1LAMA 5DUSA 3SIGA 1GYTA 2EEEA 4ZYQA 3IIDA 2FAVA 5HOLA 5CB5A 1BPMA 3GPGA 4KSIA 2L8RA 3KR4A 3H8EA 3EJFA 3KQZA 4GUAA 2BFRA 4GVWA 4J5SA 3KZWA 4R76A 2XD7A 1SPVA 1ZR3A 3KQXA 4KYBA 3EKEA 3KR5A 4IQYA 4TU0A 3V2BA 1HJZA 2X47A 4JVVA 3GQEA 5CMSA 2EWBA 3IJ3A 3JZTA 4K3NA 5FSXA 2ACFA 3SIJA 1YD9A 4ABLA 3EJGA 2VRIA 4ZY1A 3IIFA 3PEIA 3V45A 3VFQA 4ZY2A 1LCPA 2AFCA 4ABKA 3GQOA 1NJRA 4R6TA 1TXZA 4ETKA 4ZX9A 1BPNA 3JRUA 1ZR5A 4X2TA 5E3BA 3EWOA 5AILA 3Q71A 3GPQA 4ESSA 3H8GA 4R7MA 4ZX8A 4K0CA 5FSYA 4UMLA 3H8FA 2J9AA 5HIHA 4JCAA 3EW5A 4D86A 4J5QA 2LGRA 3SIIA 2DX6A 4JLLA 4J4ZA 3GPOA 1BLLE 5FSUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EWR A;  4ZY0 A;  3EWQ A;  1VHU A;  3ETI A;  3SIH A;  5D8N A;  1LAP A;  5CBM A;  4J5R A;  1TY8 A;  3T8W A;  4ETJ A;  5FSV A;  3EWP A;  4JGK A;  2FXK A;  3Q6Z A;  2FG1 A;  1LAN A;  4ZI6 A;  5CB3 A;  5FSZ A;  2BFQ A;  4GVV A;  1LAM A;  5DUS A;  3SIG A;  1GYT A;  2EEE A;  4ZYQ A;  3IID A;  2FAV A;  5HOL A;  5CB5 A;  1BPM A;  3GPG A;  4KSI A;  2L8R A;  3KR4 A;  3H8E A;  3EJF A;  3KQZ A;  4GUA A;  2BFR A;  4GVW A;  4J5S A;  3KZW A;  4R76 A;  2XD7 A;  1SPV A;  1ZR3 A;  3KQX A;  4KYB A;  3EKE A;  3KR5 A;  4IQY A;  4TU0 A;  3V2B A;  1HJZ A;  2X47 A;  4JVV A;  3GQE A;  5CMS A;  2EWB A;  3IJ3 A;  3JZT A;  4K3N A;  5FSX A;  2ACF A;  3SIJ A;  1YD9 A;  4ABL A;  3EJG A;  2VRI A;  4ZY1 A;  3IIF A;  3PEI A;  3V45 A;  3VFQ A;  4ZY2 A;  1LCP A;  2AFC A;  4ABK A;  3GQO A;  1NJR A;  4R6T A;  1TXZ A;  4ETK A;  4ZX9 A;  1BPN A;  3JRU A;  1ZR5 A;  4X2T A;  5E3B A;  3EWO A;  5AIL A;  3Q71 A;  3GPQ A;  4ESS A;  3H8G A;  4R7M A;  4ZX8 A;  4K0C A;  5FSY A;  4UML A;  3H8F A;  2J9A A;  5HIH A;  4JCA A;  3EW5 A;  4D86 A;  4J5Q A;  2LGR A;  3SII A;  2DX6 A;  4JLL A;  4J4Z A;  3GPO A;  1BLL E;  5FSU A; 
#chains in the Genus database with same CATH topology
 3EWR A;  4ZY0 A;  3EWQ A;  1VHU A;  3ETI A;  3SIH A;  5D8N A;  1LAP A;  5CBM A;  4J5R A;  1TY8 A;  3T8W A;  4ETJ A;  2JZE A;  5FSV A;  3EWP A;  4JGK A;  2FXK A;  3Q6Z A;  2FG1 A;  1LAN A;  4ZI6 A;  5CB3 A;  5FSZ A;  2BFQ A;  4GVV A;  1LAM A;  5DUS A;  3SIG A;  2WCT A;  1GYT A;  2EEE A;  4ZYQ A;  3IID A;  2FAV A;  5HOL A;  5CB5 A;  1BPM A;  3GPG A;  4KSI A;  2L8R A;  3KR4 A;  3H8E A;  3EJF A;  3KQZ A;  4GUA A;  2BFR A;  4GVW A;  2W2G A;  3KZW A;  4J5S A;  4R76 A;  2XD7 A;  1SPV A;  1ZR3 A;  3KQX A;  4KYB A;  3EKE A;  3KR5 A;  4IQY A;  4TU0 A;  3V2B A;  1HJZ A;  2X47 A;  4JVV A;  3GQE A;  5CMS A;  2EWB A;  3IJ3 A;  3JZT A;  4K3N A;  5FSX A;  2ACF A;  3SIJ A;  1YD9 A;  4ABL A;  3EJG A;  2VRI A;  4ZY1 A;  3IIF A;  3PEI A;  3V45 A;  3VFQ A;  4ZY2 A;  1LCP A;  2AFC A;  4ABK A;  3GQO A;  1NJR A;  4R6T A;  1TXZ A;  4ETK A;  4ZX9 A;  1BPN A;  3JRU A;  2JZF A;  1ZR5 A;  4X2T A;  5E3B A;  2RNK A;  3EWO A;  5AIL A;  3Q71 A;  3GPQ A;  4ESS A;  3H8G A;  4R7M A;  4ZX8 A;  4K0C A;  5FSY A;  3H8F A;  2J9A A;  4UML A;  5HIH A;  4JCA A;  3EW5 A;  4D86 A;  4J5Q A;  2JZD A;  2LGR A;  3SII A;  2DX6 A;  4JLL A;  4J4Z A;  2KQV A;  3GPO A;  1BLL E;  5FSU A; 
#chains in the Genus database with same CATH homology
 3EWR A;  4ZY0 A;  3EWQ A;  1VHU A;  3ETI A;  3SIH A;  5D8N A;  1LAP A;  5CBM A;  4J5R A;  1TY8 A;  3T8W A;  4ETJ A;  5FSV A;  3EWP A;  4JGK A;  2FXK A;  3Q6Z A;  2FG1 A;  1LAN A;  4ZI6 A;  5CB3 A;  5FSZ A;  2BFQ A;  4GVV A;  1LAM A;  5DUS A;  3SIG A;  1GYT A;  2EEE A;  4ZYQ A;  3IID A;  2FAV A;  5HOL A;  5CB5 A;  1BPM A;  3GPG A;  4KSI A;  2L8R A;  3KR4 A;  3H8E A;  3EJF A;  3KQZ A;  4GUA A;  2BFR A;  4GVW A;  4J5S A;  3KZW A;  4R76 A;  2XD7 A;  1SPV A;  1ZR3 A;  3KQX A;  4KYB A;  3EKE A;  3KR5 A;  4IQY A;  4TU0 A;  3V2B A;  1HJZ A;  2X47 A;  4JVV A;  3GQE A;  5CMS A;  2EWB A;  3IJ3 A;  3JZT A;  4K3N A;  5FSX A;  2ACF A;  3SIJ A;  1YD9 A;  4ABL A;  3EJG A;  2VRI A;  4ZY1 A;  3IIF A;  3PEI A;  3V45 A;  3VFQ A;  4ZY2 A;  1LCP A;  2AFC A;  4ABK A;  3GQO A;  1NJR A;  4R6T A;  1TXZ A;  4ETK A;  4ZX9 A;  1BPN A;  3JRU A;  1ZR5 A;  4X2T A;  5E3B A;  3EWO A;  5AIL A;  3Q71 A;  3GPQ A;  4ESS A;  3H8G A;  4R7M A;  4ZX8 A;  4K0C A;  5FSY A;  4UML A;  3H8F A;  2J9A A;  5HIH A;  4JCA A;  3EW5 A;  4D86 A;  4J5Q A;  2LGR A;  3SII A;  2DX6 A;  4JLL A;  4J4Z A;  3GPO A;  1BLL E;  5FSU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...