3IIEA

1-deoxy-d-xylulose 5-phosphate reductoisomerase from yersinia pestis.
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
398
structure length
389
Chain Sequence
SNAMKQLTILGSTGSIGNSTLSVVRANPELFKVTALVAGRNVREMAQQCLEFSPRYAAMSDEHSAKSLRLLLAEQGSDTEVYSGETAACELAALDDVDQVMAAIVGIAGLPSTLAAIRAGKQVLLANKESLITCGKLFMDEVKRSRAQLLPIDSEHNAIFQSLPERIQRQLGYSSLNENGVSRIILTGSGGPFRETPLSQFSDVTPDQARKISVDSATMMNKGLEYIEARWLFNASAEQIEVVLHPQSVIHSMVRYHDGSILAQMGTPDMRTPIAHAMAYPMRVSSGVAPLDFCKVGALTFTTPDYQRYPCLKLAIDACNAGQAATTALNAANEISVMAFLDSKIRFTDIEVINRTVVEGLLLSEPTSVEEVLVIDRKARDVAAQVIAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title X-ray crystal structure of 1-deoxy-D-xylulose 5-phosphate reductoisomerase from Yersinia pestis.
rcsb
molecule keywords 1-deoxy-D-xylulose 5-phosphate reductoisomerase
molecule tags Oxidoreductase
source organism Yersinia pseudotuberculosis ypiii
total genus 146
structure length 389
sequence length 398
chains with identical sequence B
ec nomenclature ec 1.1.1.267: 1-deoxy-D-xylulose-5-phosphate reductoisomerase.
pdb deposition date 2009-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase
A PF08436 DXP_redisom_C 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain
A PF13288 DXPR_C DXP reductoisomerase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1740.10 Mainly Alpha Orthogonal Bundle Rna Polymerase Sigma Factor; Chain: A Rna Polymerase Sigma Factor; Chain: A 3iieA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3iieA01
2YY7A 1H5QA 4MINA 4BHTA 4M54A 3QRWA 1XQ6A 4KZPA 3WFJA 1AN9A 2CUKA 5LDGA 1GTMA 2BFAA 4YXFA 3NTQA 3DL2A 5HM8A 1EBUA 9LDBA 2Y67A 1SEVA 5EMHA 3GMSA 4BGIA 1QR6A 4FN4A 4BKQA 3PI7A 4YPOA 3Q2IA 5GMOA 3JD0A 3IP3A 1WZIA 1HTBA 4CMHA 1ZEMA 5I9NA 1JKFA 4YRBA 5GZ6A 1YDWA 3DR3A 1TB4A 3O9ZA 4MVJG 2DTDA 3GUCA 4IY1A 3PIDA 1H94A 4U5QA 2IXBA 3L9XA 1NVGA 1UDBA 2IXAA 3PYMA 2C2YA 1JW9B 1EQUA 4YAIA 2WM3A 1PL6A 1P1RA 1KC1A 4J4BA 3I9LA 3WYBA 1XYGA 3HN2A 4UREA 4CQMB 1RM5A 1WWKA 4MVJD 1U8FO 4ILKA 4ZU3A 4MVJA 4JX8A 2R00C 4JQCA 1NVMB 4EZBA 1P1JA 1JLLA 1GEGA 3MWEB 4J9UE 1R4NB 4L9RA 4ND5A 5JE8A 4D43A 8ADHA 2Y0EA 1ENOA 3DC2A 1FDVA 1AGNA 3R0IA 4YQYA 2CDBA 1R0KA 1A9ZA 1I2CA 4TRJA 2H6EA 1O0SA 3LU1A 3FBTA 3DOCA 2OO5A 3U5TA 2P5YA 3KO8A 5A9SB 3I83A 2GD1O 1O9BA 1BDMA 2WSBA 3F4BA 3FCOA 1HEUA 2GZ3A 3MJSA 1Y1PA 1YO6A 2PZLA 3W6UA 5JC1A 1O6ZA 1PQUA 4R41A 1H9BA 1YQDA 2VYVD 3C7CB 3JQ7A 1EDOA 3RJ5A 3UFXA 4DPLA 4E30A 3P7MA 1GD1O 4WCDA 2VYVA 3FNEA 3H8VA 1IPEA 1JN0A 1ZW1A 2JFHA 3DTYA 4TRRA 3WR5A 1MC4A 2NQ8A 3ITKA 1GUYA 1I36A 4WASA 3DBLA 3ONFA 4J1NA 2DBVO 4DLLA 2OZPA 4D3FA 4FJ0A 3WG9A 3ST7A 2TMGA 4DMMA 1LDNA 1ZUD1 1C3VA 3DHNA 1Z73A 2G17A 4OQZA 4XJSA 3AK4A 2ET6A 4R3NA 4UUOA 3ZWBA 2O7SA 2NVWA 5I7EA 4TVBA 1C0KA 2A9FA 1XGKA 3BMOA 3Q0EA 3C1OA 1I3MA 2D5AA 5FWNA 2QYSA 1CEQA 4LMPA 4NU6A 3TPCA 5TIIA 3DBVO 1X7GA 1X7DA 2B5WA 2OL4A 3RVDA 1CRWG 1PQPA 4Q3EA 5I9LA 2PKQO 5A05A 4CLEA 1GQ2A 4JJIA 4BNWA 2VT3A 1DSSG 4MIYA 2BF7A 2HK7A 4L4RA 1DB3A 3IJPA 2BI7A 1MX3A 2EKQA 4R01A 1NPTO 4AJJA 1DBVO 1NWHA 4NIMA 4KMSA 3GFGA 3MWDB 5JPIA 4DL9A 1M75A 2GN8A 4ESOA 3AU8A 3X2EA 1LLQA 1V6AA 3S1LA 3ETEA 1U8XX 4UVIA 5KKCA 4NFHA 2WPGA 1SO8A 4DA9A 3WGGA 3AFNA 3ETGA 1E7QA 4CR8A 1UP4A 3WNQA 3JYOA 4I1IA 4CMJA 1UDAA 4RPHA 5ER9A 4PLWA 3WGTA 3GN2A 4RPKA 1YJQA 2QG4A 4H15A 3VZSA 1ZK4A 3N58A 2OP0A 4YB8A 3HDYA 1JVBA 3RFTA 3EYWA 1CJCA 3HN7A 2BKAA 2DTEA 3BIOA 3EZLA 3IDSA 4ZRNA 3DZHA 1PS8A 3UVEA 3KLPX 1ZK2A 3V2UA 2JCYA 1P1FA 2PKRA 4M87A 3DZKA 3ICCA 4D42A 3BTUA 3QSGA 4PZCA 2O50A 1JQBA 1ZCJA 4CLDA 5KNLA 3LT1A 4Q9NA 1HE3A 4AJ4A 3CZEA 4OAQA 4DUPA 3ZI0A 4MKRA 1GZ4A 1VLLA 3AWDA 4MKZA 5IZCA 4WNCA 2EP5A 5KVCA 4AYSA 3O8QA 1NFQA 1QYWA 2F00A 2OGUA 4N5LA 4R51A 3ETDA 1T2DA 4IQ0A 2LDXA 2Q46A 1MGOA 1VJ1A 4WLEA 2ZJ0A 1XCBA 3E03A 3RASA 5C7IO 3OEYA 5JMWA 4IDBA 2UUPA 4W9NA 1VSUA 3EDMA 1TT7A 3WGIA 2DAPA 4K9DA 4CMKA 5TGDA 2ZQYA 4F46A 2RH8A 2O7GA 3LT2A 4WUVA 1W0CA 4DRYA 3QVTA 1PGPA 2AA3A 2I66A 2O3UA 2O3JA 3L4BA 3VH1A 1D3AA 4YJFA 3TZKA 4QSMA 2CDAA 2Q50A 4EUHA 2C2XA 4BNYA 3FR7A 2YV3A 2D59A 2V6FA 3E6AA 2ZYAA 3BZUA 2TMDA 3ROQA 5IDYA 1OOEA 3AJRA 3L0DA 4YJGB 3VOSA 4JBGA 1KEPA 1M2WA 4BS9A 1U4SA 1HYHA 3ZH2A 4OJNA 2GO1A 2JJYA 4BO9A 3M2PA 4IDCA 1E1KA 4EDFA 4A0SA 2ZB3A 2ZTUA 4ONEA 4YT4A 1PQWA 3LLVA 4E4YA 1YKFA 2GCGA 5JCJD 4MKXA 3GPDG 1A4IA 1N7HA 1NHGA 2CF5A 3OM9A 2ZK7A 3WJ7A 2PZMA 4FFNA 2NLOA 2VZ8A 4B79A 4RZIA 3A28A 3EZYA 4OYRA 4PZEA 4LW8A 1A71A 4YJHA 1H93A 3KVOA 3RUAA 5JSFA 4PVCA 4Y9DA 1ISFA 3LC2O 2ZTLA 1M6WA 1LC0A 4WGGA 1H6CA 3F46A 2IEDA 1X1TA 5L45A 5KVSA 1P3DA 4CR6A 5K6AA 3JQEA 4MVJP 5EQDA 4BV9A 2YYYA 3KETA 2ZTMA 4IGFA 3ZV3A 1GV1A 1PGOA 3JQ8B 3DOOA 4LVCA 3O4RA 4BNZA 1UP6A 3G1UA 4NBTA 4YDRA 4A73A 2UAGA 3NGXA 1V8BA 4CM8A 4P22A 2VNAA 4II3A 2ZB8A 2Q99A 5A5EA 3V1YA 3MTJA 4AJIA 1MW3A 2GR9A 1JWAB 1XU7A 3KEQA 3N74A 5ITVA 2YUTA 3V2GA 2X4GA 3C8MA 5HA5A 5BT9A 1WDMA 2Z1MA 2FR1A 1VSVA 2AEJA 2DKNA 2JFGA 3CIFA 3PEFA 4PVDA 4B3JA 4DPKA 3ZWOA 1DC4A 5DBGA 5U9CA 3H3JA 3QIVA 1PJ3A 4WE3A 5JDIC 3G49A 1I30A 2G1UA 3GOHA 1FK8A 1SB8A 3JYQA 4C4OA 4RGBA 4CJXA 4WLFA 1PZEA 3MTGA 2CFCA 4CMIA 3H6KA 3Q2KA 2VTDA 5G0VA 3ADPA 3DWFA 3M2TA 4EEZA 1E3LA 2NWQA 2GN9A 2VNSA 2X9NA 2Q3EA 2POQX 1V3UA 4R68A 1E3IA 1LA2A 4ZN6A 1FF9A 5JAQA 4RVUA 4UEJA 1SC6A 4XD2A 3Q11A 4M55A 3JQGB 1E3WB 1XG5A 4E12A 4K28A 4RLHA 3KBOA 1UJMA 2FMUA 3U4IA 2FR8A 1K89A 3TNLA 3EGOA 1Y81A 4FSHA 4KQXA 3VPFA 2JAPA 2OBYA 4CL8A 1R12A 1KEUA 1O94A 1E7YA 1PGQA 4J0EA 3WOHA 4J4TA 4QEDA 2JD0A 2FZEA 3E8XA 5AOVA 4BIIA 4RF3A 2GNAA 2NM0A 1BVUA 1A7AA 2QZ9A 1UXJA 4S1VA 3ZWCA 1JTVA 1N1GA 2DBQA 3K2BA 4EUFA 3UH1A 3O03A 5HTOA 3MJTA 4EUEA 1K6XA 2CNBA 3E18A 3WNVA 3JQBC 4IIVA 4CV0A 1LSJA 3U4HA 1GY8A 1DIRA 2I9PA 3BTOA 4A5OA 3PFWO 2ZIZA 1K6JA 2WDZA 2WEKA 2W4QA 3AI3A 3ZHZA 1J4AA 3FI9A 4E21A 1Y8QA 4IS2A 1IE3A 3IQDB 4TZKA 3VH4A 5GZ3A 5CEFA 1QYCA 1RWBA 4BO6A 3CKYA 3PIIA 4RPGA 3RKUA 6ADHA 1FJHA 2HAEA 2VYND 2FR0A 4N7RA 5BSFA 2HUNA 1H9AA 4PLPA 2VZ0A 2VYNA 4KDFA 3TRIA 3V2HA 4L75A 2PK3A 1GCUA 4GX2A 1UH5A 3F1LA 2R6JA 2SCUA 3GUYA 5DBFA 1RKXA 4FFPA 1PEDA 4BQPA 4CMGA 2W2KB 6LDHA 3ZDFA 5JCXA 5L4NA 3WGHA 3ZHYA 1OFGA 1ZMOA 1Z82A 3H65A 4P38A 3NT5A 4O5OA 3EC7A 1QORA 1A4UA 1H2HA 2F1KA 4U0KA 1DRUA 4BO4A 4PRLA 4PIVA 1GDHA 2ZYGA 2IZZA 3EY4A 5K0ZA 4KUGA 1WAMA 3W1VA 5IN4A 4URFA 3ZHXA 4PG6A 4EJMA 4YT5A 1FMCA 5L53A 1DAPA 1NTOA 3L9WA 3WS7A 2VWGA 2BFMA 1W8DA 3DMTA 4Q39A 4NJMA 4XZ3A 4R5MA 4B7UA 3HE3A 3H9JA 3DFUA 3SEFA 3I9KA 3RUHA 4OXYA 3R1IA 3W8EA 2D2IA 4ALIA 2VHVA 5TLSA 2GLXA 3JQ7B 2VRCA 2QRJA 3H5RA 4OKIA 2X6TA 1EQ2A 2X5OA 4QTZA 3PHGA 1X1EA 3R3SA 2GF2A 2VHZA 3KHUA 1WNTA 4WEQA 2JHGA 4M49A 3GR6A 2OOSA 5DOVA 4CM5A 3DBLB 2NTJA 2Y1GA 1F12A 1NX6A 5DF1A 3ZU4A 1GV0A 1V0JA 1YXMA 4GWKA 3OIDA 4BVAA 3FWZA 3RWBA 4KP7A 1L7EA 1XR3A 2DU8A 4K1LA 2PNFA 1GZ3A 2O4UX 5JFOA 2PKQP 3JQ6A 3BMOB 3ZNOA 2FZWA 3EUWA 3GF4A 2FHSA 2FOIA 2HRBA 4MP8A 2ZCVA 3LK7A 3AUUA 1YBVA 2PV7A 1HDCA 1ONOA 1F17A 4P4GA 4D7AA 2IYOA 1I3KA 5C3MA 1B7GO 1QLHA 1SZJG 4L74A 3I4CA 1BSVA 4UAGA 4ZGWA 1K5HA 1ZSNA 4R1SA 3DZGA 1MC5A 3RUDA 2XAAA 4RPLA 3RIHA 1TVEA 1SAYA 3CMMA 3HADA 4B8WA 4E13A 1VKOA 3I9NA 4AJKA 1DLJA 4O59O 3ASUA 2B36A 3BMNA 4UVHA 4FJ1A 5IFLA 5A06A 4RQTA 3OIFA 1BWSA 3G3EA 3OH8A 3OSUA 4I9UA 4DVJA 3F5SA 2NVUA 3HB5X 5KVQA 1T4BA 1LXCA 2OMEA 1ZS2A 1R16A 1NAIA 3RAJA 1E1NA 1UXIA 2NTVA 2FY8A 4Z9YA 3G17A 2FSSA 3K8ZA 3BYZA 4R4JA 4B4OA 4BNIA 3ONEA 3JQFC 3DB2A 5L9AA 1F8GA 3S2GA 1ONNA 3FRJA 4KWHA 5T8KA 1ZO8A 4YAKA 2BFOA 1WXDA 3ZWMA 1Q0LA 3VDRA 4BNVA 1YOVA 2VQ3A 3ROKA 2AE2A 1P77A 5KOIA 2YFHA 4CMEC 2EF1A 3H2SA 3OJEA 5MDHA 5B37A 1QV6A 2D0IA 4YAEA 3IAHA 5C7LO 2WJPA 4AJHA 2P5UA 4XQGA 3F1KA 4WCFA 3SJ7A 3ADOA 2DPHA 2J8ZA 3JYLA 3JCZA 3RBZA 2O48X 2X9GA 4PFJA 1B14A 4A03A 1CQIA 1LQUA 3NV9A 4Q3BA 2P91A 2BI8A 3SXPA 1QMGA 2X5KO 3STHA 3FTPA 3MOGA 1O5IA 5DULA 3RJ9A 2AW5A 5CDTA 3X2FA 3IKTA 2VRBA 2YQ5A 4MVJM 4EBFA 4A7PA 2FWMX 1DXYA 3BHMA 2PTGA 4IDEA 3HFGA 4R3WA 4BNJA 4DMLA 4NZ9A 4XQCA 2UYYA 5AQ1A 5CDYA 4J0FA 5FFFA 1GU7A 1NFFA 3MJVA 1T24A 4RL6A 3OHSX 3C1AA 3RC1A 4HUJA 1MVYA 1NHWA 3VPHA 4HWKA 2IZ0A 3ABIA 4GBJA 4XQ9A 1PSDA 3ZW8A 5IDQA 3CZGA 4CMAA 3TQHA 3H7AA 2V7PA 5L40A 2IRWA 3H9GA 2GUGA 4YJFB 2D4AA 1IL0A 1JAYA 1LSSA 1P9LA 1R37A 3GFBA 3GEMA 4NHEA 3LZ6A 4OH1A 5KWEA 3COSA 1B8VA 2AHRA 2HJSA 3HG7A 3OJLA 4XYMA 3KRTA 4L4XA 3UCEA 4GH5A 1PU2A 1ULUA 4IDAA 1HDYA 3PDUA 4OM8A 4J16A 4JROA 3GG9A 4ND1A 2VZ9A 4DQVA 4ITUA 4K6FA 3TN7A 3WWYA 1E6UA 4MVJI 1XDWA 4BMVA 4GAEA 3EK2A 5CPBA 1GYPA 2NNLD 3OMLA 1IHXA 3Q9NA 4HADA 4P4NA 3ANMA 4ZQEA 3KLMX 3PJFA 2JL1A 4HNGA 4YJHB 3BTSA 1F14A 4KOAA 5FF9A 1Q7GA 4F3YA 1UR5A 4J49A 2CD9A 2BGMA 1MG0A 1DJNA 1U28A 5CDUA 3T4EA 3GVHA 5EQFA 4TVOA 1WMAA 5DCWA 1FDWA 4TKMA 4BKPA 1EDZA 1HE2A 2BGKA 3AY6A 4DGSA 4NBUA 1HKUA 3HWRA 1YDEA 3FPLA 1KVQA 2ZATA 2QW8A 5ADHA 1W73A 1DPGA 3JV7A 2JCXA 1HSZA 3EVNA 3L4SO 3P2OA 4GX5A 3ROMA 4GI2A 5B12A 4CM8B 1G1AA 3D5QA 1T1RA 1ADBA 3MEQA 4D3SA 1C1XA 3PWZA 1QRRA 1DC5A 2XOXA 4FJ2A 4IJWA 2HMSA 2Q4EA 3BA1A 1NQOA 3UF0A 4FC6A 1LU9A 1EFLA 3JYPA 3DAGA 5DCUA 4DYVA 1ISHA 2A35A 1VPDA 1E3JA 4GLOA 2HCTA 2PH5A 2X23A 3PYXA 1LX6A 4U8GA 4BO2A 4DXHA 3KUXA 3ON5A 4ZQBA 5A03A 3ULKA 3PFFA 3RUIA 4LRSB 2ZKLA 4TQGA 4E5NA 1K6IA 1O95A 3I9JA 2I3GA 4Y8VA 3S55A 3SC4A 2Q2QA 4XIYA 4E2XA 4CMIB 4JJGA 1P0CA 4ZA2A 3AM5A 5TJHA 1VL8A 4BNUA 3CZRA 1QLJA 3OQ6A 1BXKA 4WJZA 1DLIA 4AVYA 2OBNA 2B69A 3ASVA 3AM3A 3DBHA 3B1JA 2OUIA 3PGXA 1E7WA 3DBRA 4FOSA 3GNSA 2NUAA 1U2DA 4YA6A 3IJRA 3EHEA 4FQ8A 1UXKA 3JSAA 3AY7A 3MJEA 4BB5A 4D3DA 4DTIA 4MIEA 4LGVA 1SBYA 2RHRA 4DQXA 4BNHA 2AG8A 2ILTA 2NU7A 5JNLA 1YS4A 5JO9A 5BNIA 2X0RA 3HQ4O 2YHIA 2GPTA 3HFSA 4WLVA 2R00A 1MLDA 2Q4BA 2PA3A 1LDMA 3GEGA 4UVGA 1E6EA 1NYTA 3U4DA 3RFVA 4ZQFA 2IE0A 2VWPA 1NR7A 1IB6A 3FPCA 1MW2A 4I08A 4GVLA 4J1SA 4E2WA 1ZNQO 4J4HA 1PWXA 2EWMA 2WYUA 2Y1OA 1KS9A 3VTFA 3BMQA 1OR7A 3ZWXA 4XEHA 3JD1A 2V6BA 1EK6A 5AXAA 1ENZA 1QKIA 4ZRMA 3SBOA 4L0QA 2FN7A 1R15A 2QRLA 4XCVA 3FBGA 1YBAA 2PGLA 4RF2A 1JG9A 2EW8A 4Z0TA 3KSZO 3Q1LA 1Y8QB 5HWSA 1X14A 1NXQA 3I6QA 3W8DA 5L4SA 1YL6A 1ZZEA 4XDZA 5JYDA 5L51A 2CVZA 2B4RO 3GRPA 2QYTA 4B7XA 3TOXA 2Y1FA 1C1DA 2HRZA 2AEFA 1RP3A 3PHIA 4IMRA 1P1IA 5AVOA 5HBRA 3BMCB 1X0VA 4UVDA 1UXHA 1SMKA 1T2EA 3GVIA 3PZRA 1BXZA 3CE6A 3ZN2A 1B3RA 1EEHA 2OORA 3ICPA 2X7HA 1ORRA 5L4LA 4ROSA 4YT2A 4BNTA 3H9QA 4UUMA 3ZZNA 4RLSA 5A9RA 1ZK0A 3PRJA 3GQVA 3GEDA 1WMBA 1CF2O 3OBBA 7MDHA 3DZIA 1XA0A 1IY8A 3NDRA 1G5AA 3DFZA 3VH3A 4E5PA 5AXDA 1P0FA 3SJUA 1MB4A 5DT9A 3VVCA 1E77A 1XU9A 1BMDA 4HX5A 2ZQZA 3D3WA 1KOLA 4A2CA 1EVYA 2I99A 4FIZA 1MW1A 4CQLA 2X5JO 1D4FA 1EUZA 4TROA 3LSYA 3W4IA 2VCYA 2AQHA 2H1SA 2J3JA 2Q45A 3M1LA 4OSOA 1E7RA 2HU2A 4FS3A 4G2NA 4LN1A 1BRMA 4WLUA 5C5IA 1WDLA 1ULSA 5IXSA 3JQ9C 3JTMA 3OF2A 1B2LA 1OZAA 5F3RA 5TJ9A 1GZ6A 2B83A 5COQA 4PLVA 4XRRA 1XKQA 1PIWA 1ZXLA 2DT5A 1TEHA 3PK0A 4EYEA 2X0IA 1R4MA 2ZB4A 1I0ZA 1S7CA 1ZFNA 3RROA 2VOEA 4CXFA 5L3ZA 4HV4A 1PJBA 1T1SA 1UUFA 3GMDA 3OJOA 3PP8A 3TWOA 3W4KA 5EN4A 3K5PA 1M6HA 2GZ1A 4YQZA 4CUJA 1KY5A 5ILOA 3F5QA 1HYGA 2AE1A 4ND4A 3QWAA 4I9HA 4ZD6A 2X22A 3ZU2A 4S3MA 3U3XA 3QVSA 2EKLA 3DOJA 1Z75A 1GUZA 1NBOA 5TNXA 1AHHA 1EBFA 5A3VA 5JAMA 3PXXA 3D3EA 5FYDA 5IF3A 3CXRA 4HY3A 3WXBA 3C85A 4YAGA 4CLOA 1KIFA 2ZCUA 4NBVA 4JBIA 5JAIA 4I8XA 5LCXA 5DZSA 2DFDA 5LC1A 4N54A 4NG5A 4OMUA 4XR4A 5C37A 2FPGA 1UZLA 3H5NA 4Y98A 1SPXA 3KSDO 1AXEA 1Z74A 1PJTA 4IQ8A 3BHIA 1QYDA 4PLTA 1LRJA 4BNFA 3NT2A 4HFMA 4R54A 3WGOA 4J91A 1E5QA 4FLSA 1CIVA 2PD4A 1PGJA 4WOKA 2QRKA 4CM4A 1IZ9A 3JQCA 5DP1A 3WGZA 3AOEA 4CLXA 4F6LA 2B4TO 1AE1A 4XYGA 1XSEA 3QWFA 1T2AA 2CMDA 5B4UA 4LISA 1KERA 4IJUA 3DZFA 2NV6A 4L76A 3E5RA 2NVUB 1V35A 3UN1A 3VH2A 3MOIA 4FPXA 3ANLA 1C0LA 5DCYA 1BXGB 3L07A 4IJVA 1PWZA 2X0JA 1ARZA 3F4LA 3K31A 3WTCA 4OHUA 1HRDA 4II2A 3U62A 3B6ZA 3S2IA 1KY4A 4DBZA 1LEHA 3TSCA 2Y68A 3GC6A 4C7JA 3OP4A 1YOVB 4KUEA 3UXYA 3INRA 5EINA 3I1JA 4IDGA 3TZHA 4WECA 3E48A 4YT8A 3GAZA 3C1TA 3F9IA 2BHLA 4MO2A 5EERA 4NJOA 3WSVA 4RVGA 1R4NA 4WCFB 2YDXA 4GX0A 4IDFA 1OI7A 2B37A 4E5YA 4I5GA 2RHCA 1Y7TA 2GZ2A 1GL3A 5I9MA 3F47A 1DRWA 3L77A 4OSPA 1H0KA 3DDNA 2HK8A 1HDOA 4TRNA 3QWBA 3KYCA 1PGNA 1TI7A 2EJWA 4CLRA 3E82A 3ZHBA 3IUPA 3HSKA 4I5DA 1JDJA 2UVDA 1GAEO 1A72A 2EGHA 3WTBA 4RCVA 3N7UA 4ID9A 5AXBA 4KQWA 2P4QA 4DLBA 1U1IA 1Y9AA 2YJZA 1YGYA 2AEMA 3TZ6A 3GDOA 3V1UA 4WLNA 4QQRA 3NKLA 4G5HA 4IZHA 1TLTA 3RUFA 1EE9A 4KTTE 3I9OA 4DC1A 2P68A 2WE8A 4GKBA 4BGEA 1Q0QA 1B8UA 3RQSA 3RI3A 3K2EA 3K73O 4OOEA 4OGWA 3H2ZA 1WP4A 4PG8A 5TF4A 2PFGA 4R9SA 4N18A 3ZV6A 1U5AA 2RCYA 3SVTA 4BKRA 3UCFA 4E2YA 4UEOA 1N7GA 3FNGA 3WB9A 1U3UA 5T5QA 4BV8A 5JC8A 2PH3A 4CUKA 5JDCC 4I5FA 1LJ8A 1TXGA 2IEBA 1SCUA 4AFNA 3VKVA 4YACA 1GQYA 5ENDA 4D0SA 4R16A 3AY3A 1GPJA 1VC2A 2HMUA 4J90A 4WKGA 5TT0A 5IN5A 2XPCA 3KXDA 2O7QA 2DPGA 2OXIA 3T4XA 4B7CA 3NDIA 1IPFA 1LRLA 1TT5A 2DFVA 4CM7A 4AICA 4L73A 5DNAA 2GYYA 1HZZA 5JDIA 1NPYA 3O38A 1U3TA 5B4VA 3UERA 4XGKA 2WTBA 5KTKA 1P1HA 4Q3CA 2Q1WA 4R9RA 5L7WA 4FW8A 4MP6A 4XDYA 5AYVA 3ZW9A 1LC3A 2P9CA 1D8AA 2Z1NA 4IUYA 4B4VA 3AUAA 4BNXA 1EE2A 1ZBQA 4BO1A 4JP2A 3WDSA 3WX0A 2WD7A 4RF4A 4R69A 3Q3CA 5T57A 3FSRA 4Z0PA 4BO5A 3HZZA 5I7VA 4M1QA 2O3TA 4OOFA 1O8CA 2EXXA 2DQ4A 4FLOA 3U09A 1AUPA 2G82A 1V9LA 3A1NA 3I5MA 1VRWA 1HDXA 2YV2A 1J0XO 3VAZA 4AJPA 5I7FA 2ZYDA 1N92A 2H63A 3U49A 4B8ZA 1LDGA 4LK3A 3GHYA 2G0TA 5T6BA 3NT4A 1C1XB 5G0TA 1E5LA 5JAZA 3JQAD 4J7CA 1KVRA 1SB9A 1ZSVA 3K30A 2PLAA 5C7OO 2C07A 1HL3A 3JQAA 3R6DA 4QXMA 3DZJA 4DPMA 4F6CA 3VPSA 2DM6A 3ENKA 3F6YA 3DQPA 4CMCA 2VHXA 3FNHA 4NMHA 4W7HA 4WEOA 5BR7A 5COAA 3GRKA 1NM5A 2XXBA 3CSDA 2VUUA 1ISMA 4IMPA 5IXYA 1R0SA 4BNKA 1CQJA 3L6OO 4I9NA 4CODB 4Z3DA 1IYZA 3RSHA 3OEWA 3W6ZA 2Y0CA 4BNMA 3AI2A 4WNIA 1ZH8A 3JQBA 3A06A 2Q1TA 2J5QA 2DBZA 4F45A 2HK9A 2VRCD 2BLLA 2A4KA 2NACA 5CP8A 7ADHA 2QIOA 3PWSA 5DDIP 2C82A 2RBEA 2H9IA 1B3BA 4M8SA 3LT0A 4D0RA 5JMPA 4IS3A 2X58A 2IODA 1C0IA 3DBHB 2EGGA 2X1HA 3DBRB 4ZQGA 2PZKA 5EPOA 2NU8A 5ITWA 3NTRA 3GH3A 3PDJA 3WLEA 1ONPA 2E6UX 2G5CA 1DFIA 2OHXA 2YQ4A 3LYLA 4IBOA 4Z0HO 4QO8A 1MP0A 4ZJUA 4IIUA 4FDAA 1HE5A 2YHIB 8LDHA 4DIBA 1P44A 4PLGA 4GSKA 1KEWA 4YJGA 3SC6A 1FDUA 1YVEI 1W4ZA 2JFFA 5L7TA 1LSUA 2XXJA 3VC7A 4BO7A 3W8FA 2Q1UA 1BVRA 4EJ0A 2C20A 4FFOA 4Z9XA 3ZWPA 4D41A 4XWYA 3CZLA 4JIGA 1LDYA 1AHIA 1XELA 3BMQB 4MVJF 4J2OA 1RM4A 4PLHA 5GY7A 3C24A 3HDHA 2FP4A 4CV1A 4Q3DA 5JLAA 1YJ8A 1CERA 5CHEA 1JKJA 5K9ZA 2NADA 1LUAA 4FLRA 1HE4A 1DOHA 1H6BA 1PX0A 1U9JA 1SC5A 4ALJA 3E9QA 1GUFA 1KYQA 1VL6A 2B4QA 4CLHA 2BMAA 4EJ6A 1MA0A 3D4NA 3NTOA 3GDFA 4B4WA 1JGIA 1N1EA 2QX7A 4JGBA 3GN1A 3P2YA 1V3TA 4XIJA 5KKAA 2H5LA 5CEEA 3ZNPA 1D7OA 2I65A 4CV2A 5COBA 1EFKA 4CM9D 1Y6JA 3CTMA 2O4CA 3PLRA 2C54A 1EUDA 1C0PA 4CM9A 1K3TA 1LI4A 2HMTA 3IL2A 2ZTVA 3HB4X 2YV1A 3OIGA 3WGYA 3LC7O 4CL3A 4XR9A 3ZNQA 1ML3A 5F1OA 2HQ1A 5ILGA 4CM1A 3C7AA 4GX1A 4DWVA 2AQIA 3GZNA 1E7SA 5F21A 1EZ4A 1ZKMA 3D3WB 4LCJA 4YCAA 4E32A 3PZBA 2A94A 3B70A 4CQLB 1T2CA 1E3EA 4ZQHA 3KTDA 3SLKA 4RDHA 5HRUA 1DIBA 3D5TA 5IAAA 3NGLA 3O8QB 4UULA 3D7LA 1LLDA 2O23A 3K92A 1QXSA 5L95A 3GAFA 1GQQA 4NU5A 3WQRA 1PZGA 4IM7A 1SOVA 2WE7A 3K9QO 2J5RA 1J5PA 2V65A 1ZIDA 4U6QA 2W8ZA 2HJRA 2P9EA 1MFPA 4Z3KA 1RM0A 1R4MB 3AI1A 3CUKA 4BKOA 3WIEA 3A14A 3GK3A 1E3SA 3E5MA 1Z45A 3ROPA 2Q49A 5DBIA 1M76A 4XQEA 3RKRA 2VWHA 2NSDA 3KB6A 3U9LA 4NK4A 2A92A 1LLCA 3JQFA 2MAOA 4GQAA 3KV3O 3RBXA 4MIOA 4E5KA 1VE9A 3DO5A 4BQRA 1I33A 1JAXA 2YZ7A 4W99A 3ZWAA 1E92A 1PS0A 4HNHA 1DIAA 3GG2A 5G0WA 3RFXA 4CMEA 2VTEA 1KETA 4NBRA 3RU9A 3DEYX 2G76A 2BELA 1I5RA 4DYDA 1MW0A 4XYBA 1IOLA 4DIOA 2C59A 5CFZA 3UGKA 4INAA 5BSHA 1XLTA 4EEXA 4B3HA 1SNYA 4NH4A 3WQQA 1NFRA 1ZK3A 5G0SA 4MDHA 2IZ1A 2BGLA 3OETA 4NFYA 2D1YA 3E9MA 4FFRA 2Y1DA 3KEOA 1Y8RA 3PWKA 4GMGA 5TT1A 2QZZA 1KC3A 1HYEA 1FDSA 3DMYA 2YFQA 3PJEA 4CM4B 4AJ1A 4P4LA 5CG2A 1LNQA 4DIFA 1ADGA 4BKUA 3H5AA 1UP7A 1VL0A 3TF5A 3P19A 4RVDA 5A5FA 3QQPA 4JN6B 2C0CA 3LVFO 4FOOA 4JBHA 4BNGA 3I9MA 3UAGA 3R3JA 3PPIA 3RD5A 4IQGA 1PJSA 1KVUA 4LUPA 3QW2A 1EMDA 1YWGO 5JY1A 2AG5A 5T64A 2B5VA 4NDNE 2GRAA 1VI2A 4BOYA 1MFZA 4YJDA 4FGWA 1Q7CA 1R66A 4NNJA 1H6DA 3LLSA 2W2KA 5CDSA 3UEQA 3GPIA 3VPXA 3WWZA 4QECA 4E33A 1VM6A 5KJFA 1B26A 5B4TA 4GGOA 3TJRA 1E7MA 4ALKA 2PGJA 3GVPA 3QLJA 2GDZA 1CWUA 3D0OA 1NQ5A 5IJZA 2O2YA 3C3XA 2PWZA 1MG5A 4GLLA 4NFSA 3OA2A 3PHJA 2EV9A 2PD6A 4WOJA 4DREA 1O89A 1XHLA 4D44A 3PHHA 5BNTA 4ND3A 5KVVA 3KYCB 3VZPA 3ENNA 4YRDA 3PGJA 4CLRB 2DC1A 4FFMA 4YEDA 1TA4A 5KJ6A 3GGOA 4PLCA 4TWRA 1VKNA 3D1LA 2J3IA 1EVJA 4RF5A 3TL2A 2AQ8A 2AXQA 2E4AA 3D4PA 4K26A 4BGVA 1E1MA 3TZCA 2BD0A 4FR5A 2Q2WA 3KYBA 1M66A 1AXGA 4Y6SA 2VWQA 2WYWA 1JA9A 2GGSA 4Z9FA 4BO0A 2Q1SA 4E31A 2GSDA 2YDYA 1B0AA 3CH6A 3WFIA 2W2LD 3ITDA 1NVTA 1LDBA 1YB4A 1YRLA 1NPDA 2W2LA 1T2FA 3DTTA 3GY0A 2VOJA 4ND2A 1DC6A 4XGIA 5BSEA 1PJQA 4O0LA 4IXTA 2I6TA 3CEAA 3E9NA 4QO7A 3AUTA 4W4TA 4UUNA 3HUDA 2O3SA 1I3LA 1RYEA 1BHSA 1YBMA 2FPIA 5LDHA 3JYNA 4CUZA 5TX7A 1H3LA 1YH3A 1NP3A 1J6UA 3PQEA 4ZICA 4E6PA 1TT5B 2O3RA 5A04A 2UUOA 3CMCO 1P31A 3JD3A 3DXFA 1YB5A 5CDGA 2Q2VA 3VHRA 4CR7A 5IZCC 1N9GA 3M1AA 4A26A 2Y0DA 4QUKA 1YQGA 1UZMA 4O6VA 2Y66A 3QVOA 4LCEA 5TSDA 4GSLA 3UICA 2DVMA 4IJKA 1BGVA 1GFSA 3PTZA 4J1TA 4JP3A 4TZTA 1JWBB 4DQUA 2DBRA 2X9VA 4D45A 3WBFA 4A27A 3HDQA 1UAGA 3GVXA 1N2SA 9LDTA 1YL7A 2HSDA 4W9NC 4Y6PA 3WYCA 2Z5LA 1WLYA 4AJNA 2WD7B 1G6KA 4XKJA 1YB1A 2DLDA 2IYPA 4D46A 3B1FA 4PG4A 1PJCA 1DIHA 1UDCA 3KM0A 4EW6A 1NASA 3BTVA 3L4BC 4RQUA 4AJLA 2VN8A 1DAOA 3VDQA 1JVSA 3DHYA 4PN3A 4E3ZA 3WMXA 1DFGA 2PGDA 2EG9A 1ZMTA 3KZVA 3AOGA 2VT2A 3F3SA 3RCBA 2YHUA 4OKNA 3I23A 2ZB7A 3AUSA 2Z95A 1BDBA 2FPPA 5G4LA 4BNLA 2NTNA 2NVBA 2IDZA 3JQAB 3U0BA 5JS6A 1DRVA 4H7PA 4PLYA 4J6FA 4P8RA 2UV8A 3M6IA 1UZNA 4JNKA 5EL0A 4HFNA 4Y6RA 3G79A 5THQA 3TOZA 4CM6A 2EIHA 4HP8A 2PY6A 5EJ2A 5THKA 1I32A 2CY0A 1DFHA 5DP2A 1WW8A 4AJ2A 4NJMB 3I3OA 1MXFA 3B20A 3KYDA 3OQ1A 3ZCXA 4Z6KA 1BG6A 1OMOA 1RM3A 1YONA 1QG6A 3BHJA 4IGEA 1KEVA 1CYDA 1X7HA 3E1KA 2EEZA 2CVOA 3D4OA 4MPDA 1HETA 1H2BA 2EW2A 2J3KA 4W7IA 4EI2A 1RPNA 4GKVA 4PLFA 4H3VA 5JBIA 1HF3A 5K6AC 3AOEC 5FI3A 3AW9A 1QV7A 4RO0A 1B15A 4K6CA 4ALNA 1MV8A 2AMFA 2UDPA 2WD8A 3FTNA 1ENYA 2JKVA 4X54A 4XB1A 3INGA 2WWRA 4UVEA 4CM3A 3G1TA 3PQFA 3EVTA 3ZV5A 3MZ0A 5KCZA 4D79A 1Z6ZA 2NU6A 2PD3A 2D8AA 3IIEA 3ZV4A 2W98A 5H81A 3ZGYA 1U3WA 3QHAA 2LDBA 5G4KA 1PR9A 3FHLA 3WLFA 1U5CA 1BW9A 3AM4A 5TS3A 4TSKA 2NQTA 2P2SA 3BAZA 2Y99A 2JD1A 1ZJYA 4BMNA 1GPDG 1Q7BA 3L6EA 3U4CA 3FF4A 4O1MA 5U1PA 5JO0A 1GEEA 2JCVA 5ICMA 1Y9EA 4J7XA 1B16A 2B35A 4BO8A 3QJ5A 1HDGO 4QFCA 1DHTA 1G0NA 1QYVA 3IMFA 3TFQA 4MVJE 3WQSB 1L7DA 1VJ0A 3GVCA 3BMNB 3VKUA 3PQDA 3PJDA 5JCJA 4DC0A 3VVBA 5BSGA 1GR0A 5BNFA 3JQ9A 1ZXBA 4RZHA 1U4OA 4RJTA 2E37A 5IG2A 1WPQA 3VZRA 4BMSA 2Y1CA 4J3FA 4OO3A 5ER6A 1GYRA 4ZHSA 3DAFA 3WBBA 1D1SA 3FR8A 1NQTA 3WIDA 1I3NA 4CQMD 3GHHA 5G2OA 4CQMA 3OJ0A 1OC4A 3I52A 4HXYA 2D3TA 3UUWA 1R0LA 1E6WA 5TQVA 5CG1A 3EAGA 1PJ4A 4FGSA 1E1LA 1ISIA 4NR0A 2O3QA 3SX2A 4N5MA 1JU9A 1LLUA 3T7CA 3GNTA 4RVFA 2V6MA 1WDKA 4IPTA 4BO3A 3LC1O 1KVSA 4GMFA 4PG7A 1Q1NA 5A1TA 2V6GA 5KJ1A 3NYWA 5JXWA 3UCXA 4OQYA 4YWJA 1HT0A 2VHYA 3UW3A 3GZNB 5A9SA 3C7DB 5TC4A 3IC5A 4JK3A 3NRCA 2CF6A 2HKIA 1ISJA 1I10A 5JW6A 3QWHA 4XA8A 4J1QA 3H4VA 1I2BA 3QV1A 1EVIA 3B1KA 2HMVA 3IUSA 1NNUA 1P33A 3GGPA 5TRTA 5J23A 3PLNA 2DTXA 4UEKA 4CMBA 1PL7A 2W90A 3GLQA 4NQWA 3MJCA 2J5KA 5JY6A 2FSVA 5MGBA 2PZJA 3DAPA 4FD3A 4XX0A 1W6UA 1XEAA 1X0XA 4U0JA 5IDXA 2E82A 3FWNA 4C7KA 1JKIA 3IKVA 2OP1A 4GWGA 1WZEA 4RORA 1U7HA 2CDCA 4NPCA 1HDZA 1B8PA 4BNNA 3GDGA 1UAYA 1I8TA 3FNFA 4FCCA 4O63O 3ONDA 4WK6A 1QSGA 3A9WA 1PR3A 1PJ2A 5U4QA 1HSOA 2GN6A 3EW7A 4YBZA 4YRAA 1VJTA 4J9VA 3NUGA 1H6AA 1RYDA 4QX6A 1LQTA 3IS3A 3QVWA 2GASA 5I7SA 4KUHA 4B3IA 5B1YA 5HS4A 3RUCA 3JD4A 2P4HX 4OIMA 4RV9A 1ISGA 4GL4A 2DUUA 4MJLA 5I8ZA 3AFMA 1DO8A 4IINA 2C5AA 1U3VA 3UOGA 1Y5MA 4U6SA 4E2ZA 2RIRA 2O2SA 4BL5A 2EP7A 3EMKA 4NI5A 4KTVE 3PHLA 1ENPA 4AL4A 3NX4A 4A10A 1A9YA 1EK5A 3DMTC 2D5CA 2X86A 3LF2A 1IULA 1A7KA 1C14A 3RC9A 2EKPA 1Y8RB 2BH9A 2BRUA 3QP9A 3T7EA 3UKOA 4BB6A 4NK5A 3LDHA 1P45A 3ZU5A 4H16A 3ZU3A 1DHRA 2CSUA 1I24A 1N8KA 2C7GA 4EGFA 3G0OA 4L8VA 2X8LA 1XQ1A 1Q0HA 3V8BA 1QYXA 4R5HA 2GN4A 1HLPA 4RDIA 1HLDA 4OXNA 3I4FA 3QWIA 3BMCA 3NJ8A 1DDOA 1PL8A 3GGGA 4WLOA 3CZKA 3A4VA 3ZWVA 4E5MA 3KSUA 3P5SA 4CV3A 2VHWA 4RVHA 1LRKA 5JDCA 3TDKA 4YVFA 1I01A 1OBFO 3FD8A 4FFLA 2GERA 1PS9A 3RUEA 2WYVA 3D64A 4GVXA 4Y67A 3VTZA 3IOYA 1A27A 1ZEJA 1SOWA 3OA0A 5G0UA 4HBGA 3TL3A 2FRDA 5A3JA 3ORFA 2VUSA 1F06A 4AJOA 1PJLA 2P9GA 3NDJA 1Y5RA 2J6IA 4LVUA 4NBWA 2NU9A 3S2FA 4XYEA 2E49A 1MUUA 2C7VA 2RH4A 1LSOA 3GNQA 4HFRA 3W4JA 1I2ZA 3LF1A 4FC7A 3WICA 3ZWYA 2I76A 3OQBA 3CINA 4J2HA 4TRMA 3JD2A 1S6YA 3FN4A 3IP1A 4FB5A 5I8WA 5IZ4A 5AXCA 2HLPA 2EJVA 2VUTA 2EHDA 3UCQA 4JJFA 1GADO 2WMDA 2OFPA 1NR1A 5F1KA 3OFSA 1ZJZA 4J43A 2ZJ1A 1S46A 1F8FA 1CDOA 2BFPA 4PLZA 4QT0A 4YR9A 1EVZA 1MXHA 2JD2A 1YE3A 3LQFA 3DHEA 2E48A 4RPJA 4JLWA 5BQFA 1ADCA 4AJEA 5IDWA 5EIOA 4DBVO 4J7UA 5DN9A 1ZVMA 4ZVVA 5T8KC 4PG5A 1PZHA 5CAEA 3QY9A 3WYEA 4RVSA 3ZWWA 4MP3A 3GT0A 3GA0A 4LSMA 3INTA 4U7WA 1NQAO 4HFJA 5EESA 1FXSA 3L6DA 5ES3A 1Z7EA 1HWYA 1HXHA 4JXKA 1K2WA 4WCFC 1ID1A 2AQKA 2CVQA 1PZFA 1DEHA 1WVGA 2J3HA 4YYZA 4G65A 1SEPA 2JHFA 4B4UA 4I5EA 2B0JA 4L4SA 1LTHR 2QQ5A 3JQDA 3QVXA 3ZNNA 1DC3A 3HDJA 1DIGA 3BXXA 4DLAA 1L1FA 3H9UA 1U2GA 4IZIA 1FDTA 4N5NA 1BTOA 1DJQA 5L7YA 3CZMA 3S8MA 3DONA 3NEPX 1N9GB 3QE3A 4IXWA 4XYLA 3RC2A 1M67A 1OAAA 5H82A 4CPDA 3WSWA 3LT4A 2RAFA 2I67A 4W6ZA 2HDHA 4AG3A 2EERA 1QP8A 2YW9A 1P1KA 4OXKA 4YAJA 3QA9A 4NQZA 4PCVA 3V5NA 1NWCA 4OL9A 1C1DB 5H83A 4QFDA 1IZ0A 3OECA 3JQ8A 4ALMA 4G81A 1T4DA 4M89A 1V3VA 4PRKA 2X0NA 3SLGA 3KOUA 4LMRA 5GZ1A 2HO5A 1IUKA 1IHYA 1BXGA 4GGPA 4E0BA 1NAHA 3VZQA 5DOZA 4PGFA 3MJ4A 4BUCA 1OC2A 3HHPA 2I5PO 4XJTA 3PYLA 3TFOA 1R6DA 3K96A 5F1PA 1GYQA 5HS6A 1J49A 3HNPA 5A4DA 4W82A 1K0UA 3CPSA 4UUPA 3O26A 1X15A 2HMWA 3H9EO 1LBEA 3MCVA 4R1UA 3TZQA 4LSWA 4YTEA 4MOWA 2CZCA 1X13A 1UXGA 1HZJA 3ANNA 2MAPA 2Y05A 2DUWA 5ENVA 1Q2XA 2C5EA 4ALLA 3PJGA 1XWFA 4GPD1 1YQXA 3WJAA 2C29D 1N5DA 3NAQA 4HKTA 5CPFA 4LRTB 4KDEA 1GCOA 1T25A 1ADFA 2JAHA 1ZSYA 3KYDB 1LDEA 1KBZA 1XIVA 1T26A 2Y93A 1Z7BA 3DZBA 5FEUA 5A02A 3T0YA 3NJ4A 5FI5A 4Q3NA 3V1TC 1YL5A 1ZK1A 3Q9UA 4R1NA 3H3FA 4PZDA 4M86A 5ICSA 4JCOA 5JYEA 1U7TA 1RJWA 5KJEA 3RBVA 3GZ4A 1P74A 3JQGA 5A9TA 1HDRA 1G0OA 4MVJH 1D1TA 1E3WA 3VPGA 5T67A 3S2EA 1PTJA 3HJAA 5CEJA 4KWIA 2QHXA 3RC7A 4BGUA 4WPGA 5KJCA 4XB2A 4FBGA 1CETA 3UHAA 1KVTA 4IDDA 5G4KB 4CLOB 1BW9B 4TKLA 2Y1EA 2I3AA 4EITA 1EUCA 1A5ZA 3WMWA 3K6JA 2PR2A 3RU7A 3I6IA 3OJFA 2R2GA 4R1TA 2XF8A 3OICA 1E0DA 5F5NA 4XRGA 4TMFA 3PVZA 3Q6IA 1F0YA 5F5LA 4Q3AA 4XGNA 3WGQA 3ZWNA 3AU9A 5KIAA 4FLQA
chains in the Genus database with same CATH superfamily
4DZTA 5EJ7A 3IULA 4KVGA 3CRNA 1HGXA 2A3NA 2F2TA 4GYWA 3QOYA 3M5CA 4M54A 2Q8PA 3SIXA 1NR5A 4JASB 3SIRA 1H0SA 3EC2A 1T15A 2BFAA 4QJ5A 3PRHA 4Y2SA 5D6OA 5HM8A 4C7MA 2Y67A 4JVMA 2WJJA 1SEVA 4KH1A 2XNCA 5EMHA 3GMSA 3RYHA 5JYBA 2Z98A 1JT9A 3PC2A 4FN4A 1FUKA 2IEIA 4EA7A 2AOUB 1YA6A 3AUFA 3Q2IA 3CLRC 2J67A 2OFOA 4ZO7A 5AVKA 3D2LA 3DR3A 4YV1A 4HGRA 4INOA 2D1RA 1GPBA 2IXBA 3GQBB 1FP7A 1UDBA 3ZE9A 1I94B 5A4IS 4MR9B 2GJAA 5CK5A 1X3WA 5FO1A 1KC1A 3W79A 3Q87B 2JLXA 1FXWF 3OESA 2IV2X 2G1KA 1XYGA 2AWNA 3M5DA 1LV7A 4CDGA 2F64A 2H4FA 1WWKA 4DA4A 2QPLA 2RK6A 3NBMA 2F6RA 1MCZA 1TAGA 1SA0B 3FUEA 5C0OE 4DLVA 3L0CA 3FLAA 2ISSD 4K1XA 3GFPA 4QODA 3ADDA 5H02A 4BQQA 2J59A 4QUGA 3CE9A 4PHCA 4J9UE 1R4NB 1V39A 4L9RA 1IIRA 2P9BA 1IG0A 2XQIA 1J39A 3DC2A 1NVAA 2B3TA 5EE1A 2I6XA 1FDVA 3KSAC 4R71A 1QBGA 4YQYA 1CS0B 1A9ZA 1LKZA 2X6RA 1W48A 3L02A 1Z2DA 4RW0A 2RIPA 5DYWA 5DSXA 1TVKB 3EZGA 1VG8A 2FEMA 2J09A 4L9AA 1JTFA 4Q4HB 2XB8A 1FC0A 1GTSA 1T0BA 3OU6A 3I83A 4ZW8A 2IYYA 2JF0A 2ZRCA 5CYPA 1CEXA 5SYMA 3TNYA 3UQYS 1BDMA 1YS6A 1PFVA 5DV9A 3FCOA 4G8BA 4EF6A 1R0CA 5CGZA 1AUOA 5CFMA 4JBWA 4YJ3B 1OPRA 1TYEB 2Z5GA 3W6UA 1NNLA 1M33A 4R41A 5AW4A 2CKMA 4LZZA 1YQDA 2VYVD 2XIJA 3JQ7A 2X3UA 1N2EA 4ITVA 4QOJA 4BB9A 1YJBA 3P7MA 4HDNA 2J30A 4WCDA 1ORVA 2VYVA 3H8VA 4YRCA 5DLEA 5JQGB 4LF9B 4ZCSA 3FULA 1MC4A 2C31A 2NQ8A 1FJXA 1FUYB 2FW1A 3I04A 1Y1TA 4PFKA 4JYCA 1GUYA 1WKCA 3VNVA 1J8QA 4J1NA 5CDFA 2XMQA 3VR2D 2DBVO 4C5BA 5DGXA 4DLLA 3MGCA 2QENA 2EYQA 5K7SA 4OJYA 3EVGA 3VR2A 1EFCA 1VJGA 4DMMA 2FZ4A 3B36A 3DHNA 2G17A 4Z99A 3M9XA 3UBMA 5IUNC 2IBTA 3EVBA 1ZJ5A 1XZCA 2NO7A 4N47A 1XTBA 3CRZA 4C6RA 1G8FA 2JZCA 4TVBA 5K1ZA 2B7LA 4B43A 3HH8A 3HR8A 4EENA 2P2ZA 4CWAA 2OGZA 5FWNA 4MYUA 1QF9A 5TVGA 1K08A 4DSUA 4DDUA 2YJ3A 3ETCA 5I4IA 3A3PA 1X7GA 4H6VA 3TQIA 3TR6A 5LQKA 3AKZA 1C9EA 3WI7A 3KV1A 2ZIEA 4Q3EA 5I9LA 2JEOA 2ZUDA 1VPVA 4CLEA 4EVIA 3EEYA 4KR7A 3EH1A 5KBYA 1B0ZA 2XQFA 2VT3A 4HAXA 4MUXA 4UCFA 4MIYA 2BI7A 1MX3A 2EKQA 3NNSA 3UJ9A 4C20A 1P1CA 4CU5A 5E1DA 1NPTO 4KFSA 3U17A 1MT0A 2XB4A 3GFGA 2ZW9A 4EATA 2EKZA 4PIPA 4OHVA 4B84A 3VPBA 3AU8A 1AQLA 3L0BA 1LLQA 2OUKA 2RKOA 3IMCA 4UCXA 3RSLA 3KT6A 3ZHVA 1NC3A 1Z0AA 2FZGA 2A86A 2I91A 1N5IA 1SULA 3KVNA 2Y27A 2QSZA 1JYEA 3NWJA 3WGGA 2JFWA 2Z0MA 2BY4A 3AFNA 3TKLA 5JZ9A 2QBYA 1E7QA 4V24A 1UP4A 1XOIA 1D0SA 1JDUA 2C57A 2ODQA 4KN5A 4ZALA 1OFUA 1YCFA 2JK0A 1Y3DE 2PPVA 2FGJA 1QQAA 1QB7A 5T4HA 2R68A 1SG0A 1QGZA 3GN2A 4HGQA 3OZDA 4PZZA 4Y0AA 4HRYA 1RQ7A 3DYVA 1ZK4A 2JARA 3HLYA 4E4TA 1JBEA 2H1FA 3AHJA 2V97A 2KYRA 4NCIA 4QOEA 2WM9B 5C32A 4XVHA 2YWBA 2QUBA 3NORA 4D4LA 1W2WB 4CKWB 5KSOA 4XUEA 3UZUA 2YOFA 3CHRA 1MO4A 2DTEA 3SNHA 4D80A 3DZHA 3V4LA 1RP7A 2PZBA 4XN9A 2Q2NA 3KLPX 3IFSA 2PIDA 1KMIY 2C7RA 2PKRA 1XEWY 3G89A 4DA8A 1Z13A 4FLMA 2X3YA 1K8XB 3QSGA 3VZDA 2VXBA 4PY2A 3BJEA 3KOWA 3S7ZA 2QEQA 3B6EA 4I19A 2W6ZA 3QYJA 4HDOB 1JQBA 3L7NA 4DAEA 1N2XA 4FZVA 4EHNA 4AJ4A 3KWFA 4DUPA 3V1LA 2QAIA 4MKRA 2VCHA 2FVXA 4QIHA 2P6PA 3AWDA 5FUXA 5AM3A 1DUVG 3TW8A 4Y9TA 3NUZA 3M6AA 1NFQA 1QYWA 4V3CA 3HCNA 4N5LA 5CLHA 4R51A 4H35A 1T2DA 4IQ0A 2Q46A 1RI1A 2DOKA 2CXSA 3SZUA 1W1UA 1VMIA 3E03A 3JVDA 4LOJA 2NZ8A 2UUPA 1FP4B 2GEJA 1CHDA 3TD9A 3TINA 1IHPA 1I9GA 2DAPA 1F7VA 4LQLA 3W2GA 2VJAA 1CSEE 2QRUA 5KYXA 1U2ZA 2INGX 1V8OA 1PGPA 3JPWA 1OH7A 3L4BA 3IPCA 1D3AA 4MV4A 1LJLA 2P5TB 2VUHB 3VH1A 3AJDA 4ROTA 1Y6GA 4TYYA 4QSMA 3N8IA 3QVVA 4BNYA 3EOAI 1P9NA 3LA8A 5FX2A 1CEYA 4G2TA 2GUWA 1K8RA 1T1JA 1OBCA 1ZD3A 1ACLA 2VNKA 3RVOA 4V1CB 1ZR2A 1XP8A 2RHMA 1Z18A 1O08A 5J5VA 2QS9A 4MV9A 3ZE2B 1MW8X 4Q9AA 4YMLA 3GCZA 1A8IA 1T5LA 3DE6X 1R9JA 2GO1A 4CFYA 4E88A 2HNKA 3I09A 3PGKA 2ZTUA 4G26A 3OPMA 5DM60 5REQA 3LLVA 4Z49A 4R2HA 1OGJA 1YKFA 5EWJB 4DT1B 1A4IA 1N7HA 2CF5A 2A0UA 2ZK7A 2ZRAA 2BTEA 1UFKA 4PZUA 4QTXA 2A5YB 2ZR0A 3OURA 1DJPA 1ICEA 4RZIA 5LA6A 3ROZA 3TE7A 821PA 3C3PA 4OI0A 4YJHA 2NAFA 1U8AA 1BMTA 1H93A 3U48A 1RSZA 3CW9A 3MJRA 5LQNA 4Y9DA 4QQKA 1D2CA 1QCYA 3GDWA 1R0RE 1W46A 1TUBA 1Z4KA 3HS3A 3NTUA 4E22A 1TCVA 5KOYA 1Q1BA 2BOVA 1H6CA 1E2NA 3FPKA 3OFKA 3SC2B 1X1TA 5L45A 1QK3A 5FOTA 1TTPB 3NQ41 5KVSA 4CR6A 3R6GA 4BVJA 2BDUA 2WNIA 4TS4A 2RHTA 2WC1A 3PFNA 2YYYA 4GP9A 4AURA 5JNUA 2ZTMA 4MEAA 3A3OA 4C05A 1G20A 2P1DA 1WSWA 3PVSA 2GPJA 2YC2C 1ZWKA 4LDJA 3G1UA 3QFFA 3QX8A 1GZ7A 3FOBA 4YRJA 3M3DA 2O5EA 1JG2A 1YFZA 3GI1A 3QMMA 3KLBA 4AXXA 5AM2A 5JTUA 1X94A 2Q99A 4DHEA 5BPFA 5F98A 2OD2A 3V1YA 3MTJA 2XZPA 1Z0JA 1I0LA 1MW3A 2GR9A 2AWOA 1FFBA 3HCDA 3P0HA 1XU7A 3N74A 1SBIA 1LS1A 1MTZA 4AWAA 1DAHA 4DJDC 3KAKA 1G7SA 1JB9A 2OCLA 1KOFA 1MOQA 4QRHA 2PJDA 3OT1A 4JLKA 3CM0A 1UWVA 4RD0A 3OJXA 2AG6A 4GR9A 2FPXA 2Z1MA 1Z2EA 5DWQA 4XM2A 2QIPA 3QLVC 2XRMA 3LL7A 3Q43A 2SKDA 4W5HA 4DPKA 1WF3A 1N0IA 1EFVB 4DJJA 5I8PA 4JKYA 3ZWOA 5U9CA 2WM8A 3EWIA 1NKTA 3QIVA 2FQXA 3DMHA 4OLBA 4WE3A 3L0SA 1HZZC 5JDIC 4DW8A 3ANSA 7ABPA 3RFCA 2IIVA 1DCKA 1FK8A 1OXBB 3AEUB 2OMKA 2VPPA 3BJIC 3FB4A 3EDRA 2QUZA 2G8NA 2VJQA 3PPYA 4RZ3A 5IC6A 1TYBE 1PZEA 4UTRA 1U2EA 2NSJA 3DF9A 1Z4QA 3H6KA 1C80A 2O5CA 2GK7A 3E2MA 1LPOA 5G0VA 2GN0A 3DWFA 4V0KA 2TMYA 2QUJA 4EEZA 5F3DA 3OPYA 2C5FA 1E3LA 1RE0A 2VNSA 1UANA 5I51A 4IR7A 2YMLA 3TECE 4JUFA 1VB5A 5A7FA 4DXDA 4WA7A 2HT1A 4IHAA 1NXSA 4NF2A 2JGFA 3T1HB 5BSWA 1WHSA 1QHHB 2IZ7A 1TZBA 6REQB 1LA2A 1SHKA 1P3JA 3RFUA 2OO3A 3BWMA 4JOSA 4P0PB 4RVUA 1Z4IA 2CZGA 1WB9A 3Q11A 4M55A 3SQWA 5ADVA 4HT3B 1HFJA 1TFRA 4L8FA 3VNBA 4CCYA 2YVKA 5L3VA 2X2OA 2O2EA 1XG5A 5IBCA 4BRUA 1U1FA 4U2GA 2R9VA 4RLHA 5HCNA 3OM8A 3TNLA 2J0UA 3KSBC 1R12A 1KEUA 3JVVA 3OMWA 4RDCA 1E7YA 4J0EA 1JLMA 2VPTA 3F74A 3Q7EA 2WPDD 4BIIA 5GONF 3FHOA 3F5FA 2VJBA 2ZM5A 4Y2JA 3CT6A 1EUCB 4RTSA 3RIGA 8ABPA 1P4HA 2WPDA 1BVUA 4GPAA 3T9BA 3T7IA 4CKCA 5LD2B 4JJ6A 3FU5A 5EY5B 5HYVA 4Q37A 2ONCA 1R2QA 1LW6E 1DO0A 1JTVA 1NRJB 2FRDC 5HTOA 5E9QA 3UH1A 4EUFA 1JG6A 4Q82A 1J22A 4BTEA 3FCYA 5AUQA 1E89A 3E18A 3P0EA 4AB1A 1HKHA 2IS4A 1BDJA 4GHWA 2HXYA 2EFEB 3HABA 4JQZA 4MQEB 3EOZA 2ZIZA 2AW3A 1K6JA 1AS0A 2WDZA 2W4QA 2WEKA 3EZFA 3FI9A 3IT1A 4JVOA 4BWGA 4ZDKA 1XQ9A 3KJXA 4FNGA 2GAOA 4X7MA 5KOJB 1EUYA 4UU7A 1Y8QA 3HDTA 4IS2A 3VUFA 1UK9A 1P4SA 1Y6ZA 3BB3A 3I0MA 1CY0A 5CEFA 3WKCA 4DILA 1QYCA 2CB9A 3O7WA 3D6MA 3VU0A 1ZGJA 2E5LB 3R9XB 5CHYA 1QDUA 2CW5A 1MKYA 2OILA 4KO4S 1QZ3A 4MXDA 4UE6A 2H52A 3DF7A 2HAEA 1NT2A 1CUZA 1V7ZA 3AVPA 3L7LA 3C3CA 2WJVA 4ARFA 4JWKA 4REQB 4EA6A 1H9AA 1RD4A 3EZ6A 3K4PA 3TRIA 5J2UB 3FUJA 2FETA 2ECFA 2PK3A 2XGGA 3EIQA 1F8XA 2X15A 3H97A 4FMCF 5E38A 1UH5A 1OLSA 2YV4A 1V37A 1G2OA 4J0KA 2EKBA 2R6GA 4FONA 5LP6A 5DBFA 3KQWA 4UTXA 4HDCA 3I9V6 5ERYA 3W06A 3JU3A 5L4NA 4N3GA 3THSA 3D7RA 2CLCX 1BN6A 3IX7A 1USVA 5JOQA 4LS3A 3NOVA 4Q9JA 5C34B 1N3IA 5CFQA 4OREX 1EP3B 4AX4A 3G2KA 3QUCA 1DRUA 3NO4A 1EDEA 2JI6A 5FO0A 1UJ6A 3HJUA 1EXVA 3K94A 2RHLA 4V1CI 5UKDA 3WLQA 2IZZA 3N5CA 3EY4A 3N28A 5CR9A 3CLUC 3W9BA 1WAMA 3OM1A 3PR1A 4KQIA 1FBTA 3PF8A 4PYKA 4TYMA 4RULA 3ZHXA 2GFIA 4G5OA 4IH1A 4DDKA 1VE6A 3IGFA 1NTOA 2HU8A 3B1YA 2A0XA 1KAQA 3M3PA 2BFMA 5ALWA 2YZGA 3NBXX 3FYDA 1T1EA 2ZRKA 1JFVA 2JGRA 2ACWA 3FYUC 4NJMA 4OUKX 4R5MA 1BOFA 4XPIB 2DUMA 3A4LA 4KLAA 5EKUA 4EARA 4OXYA 4LHEA 4ZODA 5EHGA 4US2R 3GGCA 3R1IA 2O2JA 1QO0D 2JVJA 3LPNA 4D26A 3NHRA 2WY2D 3C3DA 2D2IA 5AVVA 3Q9LA 1QO0A 2NZXA 3SHFA 3KEDA 4HH0A 3U1TA 4M36A 3QPCA 1RLMA 3AXSA 4OKIA 1EQ2A 2XECA 4C4XA 4AS1A 3WKDA 1C41A 3EGIA 1U0LA 1UPTA 3HR4A 4CTKA 1T3GA 2VAVA 4CM5A 2BM0A 2Y1GA 1F12A 1NX6A 2NTJA 3V4VB 3DLCA 5DF1A 4EG5A 2ATEA 1GV0A 2RHOA 3DE2X 3N05A 4GWKA 3RYIA 3ZU4A 4WV3A 3RHSA 5JAUA 5K8TA 5A2QA 4P32A 3IEPA 3LVRE 1NI3A 2P11A 5IVDA 1G20E 1JPJA 2H1RA 4B74A 3RHZA 1JFFB 3GD7A 2PKQP 3V4OA 2R25B 1RRVA 4F8JA 3BMOB 3O1JC 2XITA 3QKUA 2WZBA 1MO2A 4B0PA 3LY5A 1KZ7B 1YBVA 4MCJA 4A4DA 3ZVLA 2JBWA 1WUYA 4D7AA 3HEAA 4NSNA 1QLHA 5CT8A 3A7EA 1BSVA 3LUFA 1EWQA 3RIMA 4AG6A 4NV1A 3DZGA 2YWJA 4LBYA 3RUDA 4O0MA 2BR3A 1QIMA 1SAYA 1K2VN 3PD7A 3PT5A 3SDZA 4RKFA 5T7BA 3KKQA 3SS7X 4MUKA 2K6GA 2UZ1B 4AJKA 3WIUA 2VF8A 4M8IA 3BMNA 2YWHA 5AFSA 5CFOA 2QUAA 1WJGA 4YK7A 1YA4A 4RQTA 4OM7A 3BFXA 1KQNA 3G3EA 3K0CC 4I9UA 3TIXB 1VA4A 1UKEA 5F2EA 5KVQA 4DVJA 1GFWA 3GRCA 3V4RA 4C87A 1ZS2A 4K9SA 3ZCSA 1XCLA 1HTTA 5C1PA 3H2HA 3PUHA 2NTVA 3ZKWA 1UODA 2FY8A 2XHZA 4QPPA 3NDPA 2O8DA 6ABPA 4N3CA 3CWCA 2R60A 1X7XA 3K8ZA 4PPFA 4IWXA 4CN9A 2IX3A 3WHKA 1G2PA 4AMBA 4B4OA 3ONEA 1TAUA 4JR1A 4ENVA 1KFBB 2BE7A 3COPA 3DB2A 5L9AA 3HEBA 2R97A 3S2GA 3WQBA 4BCBA 4KWHA 4OLHA 4I6GA 2HPZA 2R65A 1A1SA 4B5KA 3DMRA 2BFOA 1WXDA 3KT8A 4RQBA 4YAKA 3UM9A 2V0CA 1ADYA 1PJAA 1JEAA 2B94A 2XMZA 1PNOA 3PB3A 1YR8A 3KZKA 4N0PA 3ROKA 4MPJA 2YFHA 5TVKA 3OJEA 3H2SA 4XDHA 3G0GA 3UWMA 5C7LO 3PQ8A 4AJHA 3V6LA 2WUGA 5FPQA 1UBCA 4FTWA 3BIFA 3ADOA 4LHVA 2DPHA 2RGUA 2VPIA 3JCZA 3KQPA 3FPEA 3RBZA 2X9GA 4URWR 1B14A 4Y2RA 4A03A 4LDQA 2WFZA 4Q3BA 1UM9B 5FPKA 2BI8A 3SXPA 1HNZB 2BKEA 3PFCA 4R05A 4ADSG 4BU0A 3M81A 2YXEA 2V5AA 1T0IA 2I6UA 3UHPA 4TS1A 2XZOA 4QHPA 1QH1A 4K9LA 3EEIA 1P2BA 1T5OA 1U5BA 3QE2A 3IVRA 3FTEA 3ESZA 1VYVA 2YQ5A 3O1HB 3P2EA 1YRAA 4QEZA 4V0SA 1OTHA 3F98A 3IHKA 1USGA 4O4JF 5K0NA 5TY0A 1EAYA 3URMA 4EBFA 1KEEA 2QD5A 1U7DA 2XNHA 4LZJA 2AXNA 5H4GA 3E8MA 2F8MA 4HWSA 4BNJA 3CW2A 3MB5A 1AU9A 2HN9A 1JAZA 3EF0A 1UCFA 3CX4A 2Q0QA 2B6NA 3C8DA 3KPJA 3N86A 4EUNA 3A4NA 2OO7A 3C1AA 3UATA 4HQ0A 4HWKA 1KR2A 3OAAD 1S8NA 1V71A 4RSHA 2M6RA 2JGJA 1PSDA 1J8DA 2NU6B 3I6YA 4MJ7A 3AFHA 2GESA 2HWUA 3OAAA 2VO1A 3CEPB 3H7AA 3KQYA 3LIPA 4FWIB 4UPVA 3TQHA 2R72A 4ZMRA 4YAUA 3X1MA 5ES4B 4JUIA 2XVYA 1UWLA 1SBQA 3H9GA 5K3AA 1K7YA 2GCOA 2D4HA 3V33A 3FZQA 3PL1A 4AMUA 5K8JB 3K4QA 3OPXA 4RD2A 2ZREA 1P9LA 3GFBA 3K05A 4OH1A 5DLYA 4DLWA 4UE2A 1Z68A 4BFWA 3COSA 2DG2A 5F77A 1B8VA 3HMKA 2ZSHA 5DNUA 2BKVA 2O8CA 4J0DA 1GDDA 1XQYA 4CKEB 3UCEA 3HY4A 1AKNA 2CHQA 4A6XA 4YDSA 2AD1A 3PDUA 5J5AA 4KIWA 4JROA 1EHIA 4XUDA 5IXJA 2MJLA 3T7KA 4KFTA 4K6FA 3TN7A 1MEEA 3WWYA 2VK1A 2Z30A 1E6UA 3M34A 4F4UA 4ZV4A 1BMFD 4H7JA 2VA9A 4PN7A 2RHJA 2ZOSA 3HU1A 3UAVA 1RXWA 1TYDE 1BMFA 1NY6A 3EK2A 5WRFA 2RJIA 1DINA 2NNLD 2R47A 3H2KA 3RO7A 1BROA 4C5AA 2H4XA 1QZXA 1NJ6A 5IEJA 3C16C 3SDBA 2QNBA 1G5TA 2HA7A 3MT8A 3BTSA 4UFPA 2VLIA 1G5QA 3PQ6A 4KOAA 2QAGB 4NYMQ 1J1UA 3PA6A 4OXRA 4J49A 3B2PA 1JLKA 1MG0A 1DJNA 2CD9A 2R7LA 4B73A 4ES6A 5EQFA 3GLFA 1KQGA 1M34B 4GLJA 2AFHA 2BUAA 4RK7A 4NV3A 4TL9A 5DM70 4R2WA 3GMTA 5DVZA 1SCJA 1GGVA 1DAFA 2WHQA 3I45A 3R41A 4RYLA 4R81A 4LE1A 1HE2A 3MF4A 1ST3A 2EG5A 4G1UC 3V3TA 3RVMA 2ZVJA 3INNA 2XEXA 1IQRA 1Y3FE 1Y7PA 5CXXA 3ZLBA 4ZTBA 5B58T 1KVQA 4C2AA 2JVIA 4RIEA 4MQBA 1DKUA 3O94A 1HORA 1LNZA 3UIEA 3L4SO 1FU7A 4GX5A 2ZBVA 3O75A 4CM8B 3GP8A 1G1AA 4JT4A 3P52A 3D5QA 1JDBC 4NMMA 4MYRA 1T1RA 3VR5D 1M2HA 1XN1A 1ADBA 3MEQA 3FPAA 3OLYA 1V11A 1DC5A 3Q3GE 3VR5A 2D5LA 1EVEA 4L5AA 2YJ4A 1X7YA 5AHWA 4UXHA 1BE0A 1H2ZA 1M7GA 3UJCA 1E3MA 4QXPA 1BNCA 4OHZA 1EFLA 3RG2A 3JYPA 5FJJA 4Q18A 3HK2A 3DAGA 2HA2A 4B3SB 1UPUA 4DYVA 3I6ZA 1NN5A 3ACBA 1P0MA 3E7DA 2HZ7A 4H1TA 1FUEA 1HFEL 5IKMA 1UMCB 2X23A 3HXKA 2YS6A 2BHRA 1JYFA 5CVEA 3VPDA 4LTNA 3GFTA 3AF6A 3ND7A 2QWXA 4ZOAA 2ZI6A 3REGA 5J3JA 3J81k 3FROA 2OV8A 2R1VA 1QIGA 2ZKLA 3P9RA 4Z7JA 3FMFA 4ZFNA 4YT5A 5MN6A 3OVMA 2I3GA 2GO7A 2RGYA 3VR1A 4W9MC 3KZMA 4NH0A 4YRZA 4MARA 1ZU4A 4Z7OB 2I7CA 3AM5A 3H2GA 1KAOA 3P9CA 2CV1A 1R27A 4P2GA 1JMVA 2LW7A 2IYRA 4ISBA 3V42A 5EZYF 3QJXA 1BXKA 4UJ3A 1PBTA 1I14A 1J7JA 1EFDN 1T35A 2ZEJA 1KA9H 2C77A 3NP9A 5EE3A 4EO7A 1NT4A 2VYQA 3ASVA 4RY8A 3EEOA 1YZGA 4ZREA 2CJWA 1E7WA 3DBRA 3GNSA 4ESVA 1YDMA 4YA6A 4MUJA 3ZGNA 5IP5A 4D3DA 4DMUB 2O8BB 3M0EA 1WD7A 3EVAA 4DQXA 1YQEA 4IIJA 2ILTA 5JNLA 1YBFA 3K70B 4DDVA 5BT8A 4UU1A 3W0LB 4M7OA 2GPTA 1JHZA 2Z58A 3MMXA 1RR6A 2PA3A 2RI1A 5ERGB 4JUDX 4INPA 2O07A 4K0KB 4ZQFA 1PK9A 2B1RA 2FFLA 3QVMA 4U7GA 2VWPA 5I7WA 4DCTA 1WV0A 1OH5A 4UOQA 1Z35A 3AILA 2FEWB 4J1SA 4E2WA 1I7QB 2PGNA 1T3SA 4NENA 5AKXA 4YIHA 1FTGA 3WA7A 4PX5A 2EGUA 2GYUA 1VFNA 2NYVA 2R79A 3PQ4A 3CCBA 2QPTA 2ZBDA 4UAUA 3U7RA 4XEHA 1ZGCA 1EK6A 1Q1EA 5HNHA 1Z0FA 2GARA 2ZYTX 3GUUA 3OM0A 4ZRMA 4L0QA 5D3QA 1XA4A 3DYBA 4EH1A 3GLIA 2QN7A 1RXYA 1ZCAA 4YJ2A 3AIMA 1JG9A 2EW8A 1BJTA 1M2OB 3N0VA 2ZRPA 3LRXA 3O4IA 4FMDB 1Z5PA 4QYTA 5L4SA 5TB5A 3SK0A 2C4NA 1ZZEA 4XDZA 1ATIA 2JRCA 3QF4B 4HYQA 3RJMA 1LB1B 4O2AA 2BGWA 2Y4NA 4RKQA 2AZDA 4B7XA 4TKUA 5CBKA 4G9GA 1R8XA 2Y1FA 2A9KA 3K2IA 4RESA 1NATA 3DPIA 4FFVA 6AT1A 5HBRA 4UVDA 1R9NA 3OZEA 1UXHA 2GF9A 2OT3B 3GVIA 4L02A 4BTLA 4MULA 2QAJA 3DZDA 2OORA 4FYKA 5IVHA 1YQWA 3CEJA 2ZRBA 2X7HA 4DLRA 3A37A 5EJAA 3YASA 3FUVA 4ZW6A 1G291 5DXFA 1N0VC 5BNZA 1M5UA 4CEHB 1ZK0A 2ZLBA 4EA8A 3C43A 3TTWA 1EGHA 2H08A 2HV9A 3R0QA 4EPWA 1CF2O 2FGKA 5KWVA 3OBBA 3TIFA 3DZIA 3NDRA 7MDHA 1KDVA 3NHYA 2ARKA 5LMNB 3ECSA 1MB4A 3K1AB 4UM7A 5DT9A 1E77A 4BMXA 4IWNA 2B25A 3SDSA 3O8CA 2V7QD 1V16A 3PU6A 3CYFA 4CQLA 5JFGA 3ESYA 4LYFA 4RKYA 1A69A 1D4FA 2V7QA 5IF3A 5K45A 3U7FB 4KPYA 2PLFA 3PKJA 1D2HA 5ECGC 2H9AA 4HRXA 3PFBA 2VCYA 2AQHA 3LUDA 2YINC 3NHPA 1UBFA 3OFND 4OSOA 4R0VA 5BUQA 1X8KA 4HH3C 4D9EA 3WGVA 3KOXA 3OFNA 1IY9A 4WLUA 4WXMA 3BC1A 1FOEB 4WZBE 3OTOB 4ZVUA 1G55A 1WDLA 3EPRA 2NSYA 3ZUPA 5C5IA 3OF2A 3JVEA 5F3RA 4OU5A 5KTTA 2H5JA 1VKRA 4TWJA 1XVUA 2EFYA 4N3NA 1TCUA 4PLVA 1XKQA 4M0UA 2XOEA 4QD3A 3FH8A 4O2BA 3PK0A 4WDQA 1NYQA 2BPOA 3IIMA 3TIGA 4CNBA 3L92A 1A1VA 4Y2XA 4RFVA 1PTKA 2OCXA 5HE9A 3GMDA 3AVTA 4V38A 5CAEB 3L3BA 2V3VA 4WBNB 4DLPA 1M6HA 4CUJA 4MK4A 1EHYA 2IHYA 3TGWA 3GLFE 2QXYA 4C08A 2AFHE 1U8YA 4NL4H 2AE1A 3L93A 4ND4A 3QWAA 4NBLA 3OZ7A 4XEUA 4ZD6A 3AKYA 3ZU2A 4S3MA 2ENUA 4ARCA 3DC7A 1E1CA 2EKLA 3IV7A 3IPLA 1DGQA 6PFKA 1Z75A 3L7MA 1DBSA 3H75A 1SWVA 1GG2A 2OGSA 5EE0A 1EBFA 3IPXA 3VJKA 1NNSA 3BRSA 1EXNA 3D3EA 2FCRA 3QUBA 3CXRA 4GQBA 4KO3S 3FSGD 3C85A 1LPPA 4YAGA 3MINB 4NBVA 3VSBA 2AX3A 4JBIA 4O8CA 1OLOA 1M7HA 2DWPA 2WW8A 3FSGA 3G5LA 2C8KA 5DW0A 4BLWA 5I9SA 5AI6A 4NG5A 3JZAA 3KDPA 4OMUA 3HV2A 3ZR4B 2IU0A 2NOAA 3ONNA 3R5JA 2P8SA 3H5NA 1K0FA 1H0HA 1QVVA 1SPXA 3PNLA 4C7XA 5I47A 2Z6AA 4F04A 1PJTA 4Y30A 3U7IA 1MR3F 1QYDA 1Y48E 3I2KA 5ERXA 4PLTA 3ER8A 4NECA 2QLMA 4PGGA 1F4PA 4R54A 5EMNA 4ZEWA 3MWKA 3RJZA 3WGOA 4J91A 3MCTA 4RNDB 4ZHQF 1E6LA 2WFLB 1RRKA 1PGJA 3GEIA 4OHFA 2QRKA 3O5AA 4RMIA 1XP5A 3B7RL 5C31A 1O77A 1IZ9A 1NBWB 2CJYA 5ALRA 2UYCA 5CDHA 1XSEA 4MI3A 4W5TA 4O4HF 1RYZA 1KERA 4TWIA 5C1BA 3CH5A 2NV6A 3DZFA 1RLJA 4WZAA 3W05A 4IMJB 3HACA 5IAEA 3R7BA 1XJWA 1Q57A 1C0LA 2XQKA 3FJYA 4TT3D 4XLLA 5DCYA 3NIWA 4ER3A 4FDLA 2Q7XA 1ZHFA 3ANXA 3DVRX 1ZYUA 1T6BY 4TT3A 3GAAA 4IJVA 1I1QB 1UIRA 4LYEA 1EEXB 1P2GA 3BJMA 2JV7A 3F4LA 4JYMA 4OHUA 3MHPA 2JFVA 4BP1A 1YZHA 2PUDA 5AESA 2PR7A 3OWXA 2HHLA 2V1XA 4MUNA 4CTNA 5G1OA 2RGAA 3EF1A 1KTVA 2HHAA 4WESA 4AKGA 1R50A 2RGBA 1YOVB 1SKQA 4FI3F 4KUEA 3UXYA 1KFJB 3ZHCA 3INRA 3I1JA 1Z2NX 4J0CA 4JFRA 1JHQA 3F9IA 4IQFA 3GB9A 1O94C 1K86A 2IYTA 3DE5X 2QRHA 4NJOA 5HF6A 3ND8A 4KQ1A 3T5GA 1KJ9A 3A6LA 2YDXA 4IDFA 1X7WA 1OXMA 1LV8A 2R59A 3FVTA 1Y7TA 2DPLA 1CQIB 4DSNA 1M8PA 3FZEA 2VDKB 1XTVA 3F47A 1DRWA 5FPPA 3VX4A 1H0KA 1WXGA 3DDNA 2V4UA 4DR5B 1HDOA 2B99A 2ZAGA 2VBFA 4H0FA 3ROTA 4EWLA 4OQQA 2OAP1 1PGNA 1TI7A 2L69A 5B1HA 3VM6A 2Z5VA 3IUPA 3ZHBA 1OZ0A 1JDJA 4GBED 4Z5XA 5B36A 3HO6A 4RCVA 4KGXA 5CD9A 5IMSA 3N7UA 4RIIA 5DRYA 5AXBA 4QOIA 3C6QA 4Z2YA 3GDOA 2ACEA 1D9XA 4G86A 3UK1A 4QQRA 3NKLA 1SUWA 3C6KA 2GXQA 1GPMA 4NYJQ 3RUFA 1O0BA 1EE9A 1KFCB 2QVWA 1QFJA 2VYFA 2YYAA 2XMPA 4DC1A 2QXTA 4RTKA 1S8OA 4GKBA 5G40A 5JSQA 1FQKA 1G5HA 4CDMA 2VCEA 2GBLC 3GLIE 2Q28A 2BSXA 3BPSA 3RI3A 4I3FA 1R4AA 2H5EA 2H8GA 4OGWA 3IJEB 3D8TA 1OLUA 4Q00A 3VSAA 2PUCA 1U5AA 1NI4B 1NONA 1B6SA 1ZCZA 4UEOA 1N7GA 3QEOA 1DBPA 1U3UA 3I6MA 3LDGA 1ID8A 1J2TA 1GIAA 3N3AC 3CH4B 2AXPA 5D2CA 4G0NA 5B7NA 3KXKA 2IEBA 1J97A 5E9JA 1DJOA 1E64A 5BWMA 2ETVA 3ZXUB 3TVTA 1NKSA 1UT5A 1BE1A 2QP9X 4UZSA 1KI4A 3OO1A 1NMXA 3QKRA 2BF4A 2HMUA 3KXDA 2NO0A 4GMHA 2ES4A 4Q66C 1M1XB 1Z28A 2ZJ6A 4RX1A 4IRMA 4EEKA 1LRLA 4ZYUA 2DFVA 3B3AA 1Y4SA 2Q9AA 1ESNA 4LMAA 2AOXA 2GYYA 4LJ7A 4WK4B 2D7DA 1NPYA 1S7GA 4MR8A 1V7PC 1S2GA 1T34A 2EDAA 3H16A 2P9FA 4MJXA 3P9XA 1P1HA 4XGKA 5BNWA 3K15A 7REQA 3AG5A 3IMGA 3LCRA 4R9RA 1E58A 2C42A 4FW8A 4MP6A 2FN8A 2H2FA 4ND8A 5EJ6A 2Z1NA 3BGOS 2FSFA 5T3YA 4LF5B 1ZJJA 4BGDA 4QOFA 4HWOA 5GOTA 3DFIA 2ERXA 3BWVA 5JWHA 4R69A 3WX0A 4BO1A 2EAUA 1M7BA 1QVZA 2VP5A 4ENSA 2OD9A 5HCIA 1W36D 3NU1A 1YRHA 4M1QA 4QA9A 5DBEX 4XN4A 3O2JA 1P61B 1O8CA 1QIFA 2DCUA 2ZB2A 2F1IA 1V5WA 1XWIA 1NN1A 3U09A 3FCAA 1OKKA 4NY1A 1N7IA 3A1NA 3BWBA 1L5VA 3PQ5A 2PAAA 4L50A 1G9SA 3ZDAA 1VRWA 2PL9A 2QN8A 1BQEA 3FFAA 1HDXA 4A0GA 1J0XO 2UVPB 2XNJA 3X43A 1Q44A 2H2GA 2Q8NA 4XVQA 2VDRB 5I7FA 4KPEC 1B0PA 1OLXA 3FDXA 1SU8A 2Q4OA 2HX1A 2AMLA 1LDGA 2X0EA 2HYIC 3C45A 2YQZA 4V0LA 4W8GA 3EXG1 4MLPA 4MA5A 5G0TA 1KVRA 1SB9A 1W5EA 1YJCA 2QW0X 3MUOA 4CEIA 1FPQA 3KOMA 2PM8A 3FDZB 3KS9A 3DZJA 3R6DA 4LV5B 4A0FA 5L3SB 5AVJA 2RAPA 3NHJA 5D3ZA 3F6YA 3P9YA 3PA8A 4QEKA 4CMCA 5KEIA 4P0QB 4M6WB 5BR7A 5A0TA 1XFDA 3F3MA 2B2XA 5EE5B 1I6KA 2BFDB 1NM5A 2NZVG 2XXBA 3I5UA 3O6VA 4BC0A 3FUMA 3QXJA 1U2GC 4LOLA 1WCIA 5HKAA 3BEDA 3CKKA 1CQJA 3L6OO 4I9NA 3FYHA 4BYGA 4Z3DA 4DNFA 1IYZA 4MPTA 3PNOA 5IT4A 5T4BA 1N3YA 4GZ5A 4K46A 1NJGA 4IX1A 2WHEA 1GNQA 3ZS8A 2W6MA 3BKXA 2HHCA 3MTAA 2GEUA 3DMGA 3SQNA 4F45A 1L4UA 1L7MA 2ZSBA 3KQMA 2BLLA 2A4KA 2NACA 2ZR9A 3C8UA 5FH9A 1H19A 3NGMA 3RE1A 1TO1E 4IFIA 2IX9A 4RCZA 5DDIP 3F9RA 2H4ZA 3NHBA 3QTBA 2GHRA 3ZLTA 3D2AA 3IPRA 4UEQA 4WHMA 2G5TA 2HDNB 3PDIB 2GSWA 4M8SA 5K20A 1KJYA 4WMLA 1KARA 1HX7A 3MVEA 2XAUA 4PYIA 4IIGA 3TI7A 2IODA 4LHWA 4X1IB 1NKVA 3INYA 4C4ZA 3DOEA 2X1HA 4ZQGA 3BCSA 2XVAA 5HR5A 2EDCA 1CHNA 1Z4NA 2NU8A 5IBPA 1CYEA 2FF7A 2P0YA 2R751 1VBMA 4C9BA 4C14A 3LBYA 1ONPA 3RIEA 2E6UX 4D9CA 3ORYA 1F4LA 2OHXA 4IBOA 4Z0HO 4OD0A 4KNYA 1U0BB 2BCJQ 1MP0A 2NU7B 2ZE5A 3WADA 4ZJUA 1EJ0A 4A92A 5CTJA 5BY2A 3OQMA 5B2EA 2WBLC 3K0KA 3QU5A 2Q5OA 4X20A 4I81A 4PXAA 3BIWA 3PFGA 5LBUA 1P44A 1HOTA 1OAOC 2K2WA 3DE4X 3KL2A 3I6BA 1RWOA 3LWNA 2H2HA 4IGAA 1M0WA 1W4ZA 4DR6B 1KEKA 1JI0A 4HTFA 3MBIA 4OFZA 1LSUA 1TYCA 3LVBA 1U3FA 4IHQA 1MMFB 3UHOA 2JA1A 3ZDDA 4BU1A 3BFVA 3W8FA 2Q1UA 2BONA 2P77A 2QG9A 2C20A 4Z9XA 2ODTX 3PTAA 1A9SA 1E94E 3PITA 4QXQA 4D41A 4TTPA 1Z06A 4QJ3A 4CEJA 4JIGA 1LDYA 1AHIA 1SURA 4C76A 1RM4A 4XGRA 3R8XA 4UNIA 1MJFA 3OE7D 1SHUX 3UMSA 4FFWA 2I29A 4EB8A 3S1AB 3OE7A 5D86A 3T4UA 2OV2A 2ZXEA 3OUUA 4UHCA 5DI3A 3IJ5A 3TX2A 1TU3A 2I8LA 1JKJA 3M89A 2NADA 2KS6A 1LUAA 1H6BA 2A5GA 1EINA 1HE1C 5AJTA 3BERA 3K7EA 5ICFA 4CBVA 2GXSA 3NTLA 3EG9A 1UMDB 3D4BA 3ZCVA 3P96A 5HUHA 2BLNA 3LYHA 3NTOA 4I9GA 3GDFA 4JC5A 4URYR 2WA1A 4DR7B 2RH9B 3NEJA 2QX7A 4FHFA 3AHHA 4C2BA 1G38A 5JT1A 3D8NA 1RXIA 4UM8B 4MHOA 3NP7A 4OJKA 4CI9A 3THXB 2O54A 4XIJA 4Y2QA 2OR3A 1UOPA 4H4EA 2I2FA 1JEQB 2MU1A 2J4CA 2W93A 2Y6VA 3FUKA 4PR3A 2RGXA 2GI4A 2O4CA 4YCNA 4POAA 5EKTA 1C0PA 2JW5A 2EZTA 2RGNC 1K3TA 1LI4A 3C3JA 4G3XA 3A9UA 3HB4X 4RCYA 1BU5A 1KMNA 3IL2A 4JU9A 1OROA 5HF5A 2I6FA 1D9ZA 5DM0A 4C0XA 2PGXA 3U4QB 1L8XA 4QASA 1TIBA 5F7XA 1G98A 4HXFB 4OAPA 4MI6A 2NYUA 4GW3A 4W1QA 1RJGA 2JLWA 1ZN9A 2AQIA 3I0ZA 2JCSA 3R76A 5LZ2A 5IAOA 1U7UA 2K87A 2ZCJA 1FFXA 1CZOA 4YCAA 2VQEB 4S0XA 5IMBA 3PZBA