3IIQA

Crystallographic analysis of bacterial signal peptidase in ternary complex with arylomycin a2 and a beta-sultam inhibitor
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
245
structure length
217
Chain Sequence
b'FIYEPFQIPSGSMMPTLLIGDFILVEKFHPKRGDIVVFKYPEDPKLDYIKRAVGLPGDKVTYDPVSKELTIQPGCSACENALPVTYSNVEPSDFVQTFSSGFFEVPKNETKENGIRLSERKETLGDVTHRILTVPIAQDQVGMYYQQPGQQLATWIVPPGQYFMMGDNRDNSADSRYWGFVPEANLVGRATAIWMSFDKQEGEWPTGLRLSRIGGIH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL PEPTIDASE I
molecule tags Hydrolase/antibiotic/inhibitor
source organism Escherichia coli
publication title Crystallographic Analysis of Bacterial Signal Peptidase in Ternary Complex with Arylomycin A2 and a Beta-Sultam Inhibitor.
pubmed doi rcsb
total genus 51
structure length 217
sequence length 245
chains with identical sequence B
ec nomenclature ec 3.4.21.89: Signal peptidase I.
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00717 Peptidase_S24 Peptidase S24-like
A PF10502 Peptidase_S26 Signal peptidase, peptidase S26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.109.10 Mainly Beta Ribbon Umud Fragment, subunit A Umud Fragment, subunit A 3iiqA01
2.170.230.10 Mainly Beta Beta Complex Signal Peptidase I; Chain: A, domain 2 Signal Peptidase I; Chain: A, domain 2 3iiqA02
4N31A 4K8WA 1UMUA 1JHCA 2HO0A 3K2ZA 1B12A 1F39A 2HNFA 1T7DA 2FKDA 1JHHA 3BDNA 1AY9A 1JHFA 1KN9A 2FJRA 1KCAA 3S04A 1JHEA 4ME8A 3JSPA 4NV4A 3JSOA 1I4VA 3IIQA
chains in the Genus database with same CATH superfamily
4N31A 4K8WA 1UMUA 1JHCA 2HO0A 3K2ZA 1B12A 1F39A 2HNFA 1T7DA 2FKDA 1JHHA 3BDNA 1AY9A 1JHFA 1KN9A 2FJRA 1KCAA 3S04A 1JHEA 4ME8A 3JSPA 4NV4A 3JSOA 1I4VA 3IIQA
chains in the Genus database with same CATH topology
4N31A 4K8WA 1UMUA 1JHCA 2HO0A 3K2ZA 1B12A 1F39A 2HNFA 1T7DA 2FKDA 1JHHA 3BDNA 1AY9A 1JHFA 1KN9A 2FJRA 1KCAA 3S04A 1JHEA 4ME8A 3JSPA 4NV4A 3JSOA 1I4VA 3IIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N31 A;  4K8W A;  1UMU A;  1JHC A;  2HO0 A;  3K2Z A;  1B12 A;  1F39 A;  2HNF A;  1T7D A;  2FKD A;  1JHH A;  3BDN A;  1AY9 A;  1JHF A;  1KN9 A;  2FJR A;  1KCA A;  3S04 A;  1JHE A;  4ME8 A;  3JSP A;  4NV4 A;  3JSO A;  1I4V A;  3IIQ A; 
#chains in the Genus database with same CATH topology
 4N31 A;  4K8W A;  1UMU A;  1JHC A;  2HO0 A;  3K2Z A;  1B12 A;  1F39 A;  2HNF A;  1T7D A;  2FKD A;  1JHH A;  3BDN A;  1AY9 A;  1JHF A;  1KN9 A;  2FJR A;  1KCA A;  3S04 A;  1JHE A;  4ME8 A;  3JSP A;  4NV4 A;  3JSO A;  1I4V A;  3IIQ A; 
#chains in the Genus database with same CATH homology
 4N31 A;  4K8W A;  1UMU A;  1JHC A;  2HO0 A;  3K2Z A;  1B12 A;  1F39 A;  2HNF A;  1T7D A;  2FKD A;  1JHH A;  3BDN A;  1AY9 A;  1JHF A;  1KN9 A;  2FJR A;  1KCA A;  3S04 A;  1JHE A;  4ME8 A;  3JSP A;  4NV4 A;  3JSO A;  1I4V A;  3IIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...