3IJ6A

Crystal structure of an uncharacterized metal-dependent hydrolase from lactobacillus acidophilus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
303
structure length
303
Chain Sequence
LTKIDAYAHILPAKYYQKMLSVEPNIPNMFPFIKIKTLMDLDERLTKWPDQNTKQVISLANISPEDFTDSKTSAELCQSANEELSNLVDQHPGKFAGAVAILPMNNIESACKVISSIKDDENLVGAQIFTRHLGKSIADKEFRPVLAQAAKLHVPLWMHPVFDARKPDNNLVFSWEYELSQAMLQLVQSDLFQDYPNLKILVHHAGAMVPFFSGRIDHILDEKHAQDFKKFYVDTAILGNTPALQLAIDYYGIDHVLFGTDAPFAVMPSGADQIITQAINDLTISDKDKQKIFHDNYYSLIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCHARACTERIZED METAL-DEPENDENT HYDROLASE
publication title CRYSTAL STRUCTURE OF AN UNCHARACTERIZED METAL-DEPENDENT HYDROLASE FROM Lactobacillus acidopphilus
rcsb
source organism Lactobacillus acidophilus
molecule tags Hydrolase
total genus 103
structure length 303
sequence length 303
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3ij6A00
5CH9A 1ITQA 3WZ0E 3URNA 2DVXA 3GUWA 4UBPC 4C6IA 2PGRA 4C6NA 1FWEC 3S4TA 3T8LA 3OODA 4GK8A 4XAGA 4IFKB 4B3ZA 2D2GA 2PUZA 2VC7A 2VR2A 4ERGA 1QW7A 1FWIC 2ZC1A 3LSCA 3GIQA 2HBVA 3EGJA 1E9ZB 4DZIA 2Z2BA 4Z42C 1PSCA 1A5MC 3IGHX 4KEVA 3TN5A 1A5KC 3RN6A 4GXWA 1RA0A 1PTAA 3OJGA 4IGNA 2Z28A 3N2CA 2OGJA 3OOQA 4B91A 4XD3A 4C6KA 3A3XA 4H9YA 3MDUA 4GX9A 1K6WA 1P6CA 2AQOA 4IFKA 4CQDA 4RE0A 4CNTA 4IQJA 3QGAC 4I6KA 4PE8A 2WJDA 3G77A 3A3WA 4GX8A 1GKQA 1EJVC 1EZ2A 4KETA 2EG6A 3EWDA 4ICMA 1RK6A 1FWAC 1V4YA 4WHBA 1ADDA 4NI8A 4EPBC 3PNZA 4C6MA 3CJPA 1ZZMA 1WXYA 3QY8A 4C6BA 2Z26A 2GWNA 1NDZA 1KRAC 3IPWA 4H9MA 3S2MA 1FWHC 3SFWA 1A5OC 4I6VA 4CEUC 4E3TA 3UR5A 3FEQA 1NDWA 2RAGA 3CAKA 1PO9A 3HPAA 1EJTC 1J79A 4JOMA 3AU6A 4H9VA 4RZBA 1FWJC 1KRBC 3UR2A 1FKXA 3NURA 4C6CA 4GY7A 3PNUA 2AMXA 4RDWA 4M51A 3E0LA 4F0LA 2QPXA 3B40A 1RJRA 2Z00A 2HPMA 1NDVA 4B92A 4J2MA 2P53A 3E74A 4IFRA 3MVIA 3ID7A 4INFA 4XAFA 4C6FA 4KIRA 3S2JA 2FTYA 3MJMA 1RA5A 2PLMA 1WXZA 1R9XA 5FSEC 3K2GA 4DYKA 4DZHA 4C6QA 2E25A 4C65A 2ANUA 1A4LA 2O4MA 3DUGA 2OOFA 4GYFA 3E0FA 5FSDC 1EJWC 3V7PA 3GTHA 3GG7A 4RDVA 2QVNA 2Z25A 3E2VA 4LAOA 1FKWA 3TNBA 2YB1A 4BJHA 4C6DA 1EJRC 1FWDC 2HQAA 3QGKC 2BB0A 4RDZA 2D2HA 4IF2A 3A4JA 3ITCA 4YIWA 1RAKA 1V51A 4GY0A 4LALA 4NP7A 1PB0A 2HBXA 4G2DA 3WYZA 3URQA 2G3FA 5LXXA 4QTGA 2BGNE 3LU2A 1FWCC 3B0XA 2GWGA 4EP8C 4IH3A 4DNMA 2E1WA 4EPEC 1R9YA 3F2DA 3FDKA 1UIPA 4GC3A 4LAKA 4XAZA 4LEFA 4IFOA 2EG7A 1GKRA 2GSEA 4OFCA 4NG3A 3NQBA 4C5YA 3HTWA 4H9ZA 1GKPA 1A5NC 2QT3A 1BF6A 4D8LA 4PBFA 3GRIA 2OB3A 4AQLA 4AC7C 1EYWA 2OODA 4XAYA 1JGMA 1QXLA 1I0BA 3E38A 1POKA 2Y1HA 2YB4A 3R0DA 3T81A 4IG2A 4DLMA 1YBQA 2XIOA 1J6OA 1YMYA 3UF9A 1UIOA 1RJQA 1ONWA 4CEXC 5HMFA 2UZ9A 3OQEA 2CZVA 4HK6A 1R9ZA 3LS9A 2FVKA 4QSFA 3IARA 3QY6A 4H00A 3GU9A 2W9MA 4G7EB 2OQLA 4C60A 3LNPA 1VFLA 3S2NA 3DCPA 4C6LA 1ITUA 3BE7A 1DPMA 3CS2A 3MVTA 1RK5A 3MSRA 2Q09A 3MTWA 4QRNA 2P50A 4R85A 4HK5A 4J5NA 1EJXC 1O5RA 2DVTA 1J6PA 3IJ6A 4LH8A 3RCMA 4DO7A 2HPIA 2DVUA 1FWFC 2R1KA 2WJFA 4EPKA 1K70A 4H9UA 4LCRA 4C6OA 3O0FA 4PCPA 3LGDA 4R88A 3MPGA 4CNUA 3PANA 4EPDC 1J5SA 2Q01A 2R1PA 4G7EA 4PCNA 4HK7A 2AQVA 1A4MA 3OVGA 4GBDA 3AU2A 4KQNA 4L6DA 2A3LA 2O4QA 1ONXA 4DI8A 1YNYA 2FFIA 2KAUC 3OU8A 3RYSA 5HMDA 2I5GA 1NDYA 4H9TA 2VM8A 2R1NA 4C6JA 4DLFA 4GZ7A 1E9YB 4R7WA 5G4HC 4V1XA 4CQCA 1P1MA 4ERAA 4DIAA 3GTXA 1FWBC 3JZEA 4XD5A 2IMRA 1A5LC 3C86A 2GZXA 4L9XA 3ISIX 4GOAA 3B0YA 3S2LA 1NFGA 4B90A 1FWGC 2ADAA 2PAJA 4H01A 1EJUC 1V7AA 3HM7A 3MKVA 2Z27A 3AUOA 2VUNA 4H9XA 4KF1A 3IACA 4GY1A 1HZYA 3D6NA 4LCQA 4XD6A 3KM8A 5A6TC 3URBA 2WJEA 4IG2B 4KEUA 1YBQB 3LGGA 3LA4A 3GU1A 4MUPA 4QS5A 3IV8A 4ERIA 3LY0A 3FDGA 2FTWA 1UMLA 2YZ5A 2ICSA 3UPMA 1M7JA 2PGFA 3K5XA 3F2CA 3F4DA 2Z7GA 2YXOA 3RHGA 1EF2A 3GU2A 3F4CA 4ZSUA 1KRMA 1YRRA 1IE7C 3GTFA 4CNSA 4WVXA 3T1GA 1W1IE 2Z2AA 4TQTA 3SO7A 3UBPC 2Z24A 3URAA 3O7UA 4QROA 3E3HA 1KRCC 4RDYA 1K1DA 1XRFA 3WMLA 2EG8A 4C6EA 1POJA 3TN4A 4P5UA 1YIXA 1O12A 2R1LA 1UBPC 3F2BA 5AKQA 3NEHA 3TN6A 4KESA 4C6PA 4F0RA 3PBMA 1RJPA 4LFYA 4BY3A 2Z29A 1XWYA 1EJSC 1S3TC 2I9UA 4PBEA 3TN3A 1XRTA 1XGEA 3MDWA 4C5ZA 4DI9A 1M65A 4QS6A 3QY7A 2GOKA 5HMEA 4KERA 1P6BA 3IRSA 2D2JA 1V77A 3GTIA 2HNHA 5E5CA 4WGXA 2R1MA 4BKNA 4CQBA 4HA0A 3K4WA 3EWCA 1I0DA 2FVMA 3DC8A 2F6KA 3ICJA 4IGMA 1V79A 4XD4A 3GIPA 3ORWA 4UB9A 3PAOA 2Z4GA 4KEZA 4V1YA 2QS8A 2WM1A 3LSBA 2VC5A 4LANA 4HJWA 4LCSA 2UBPC 1KCXA 4LAMA 4F0SA 4ZSTA 1M68A 2VHLA 4J35A
chains in the Genus database with same CATH superfamily
1JJKA 3WCZA 3WLNA 4BWLC 2Z1KA 4OGZA 3EDDA 5KEZA 2OYLA 2OZ8A 1SQ7A 3V3WA 4Y96A 5JQ9A 1LBLA 4R34A 2VC7A 4DAFA 4D6GA 2ZC1A 3W2MA 4UNLA 1PSCA 4IIBA 1A5MC 1DJIA 2PD9A 2PWGA 2ZX9A 1K7EA 3H23A 3RN6A 5D04C 3T2PA 4HSNA 4JQAA 4WKHA 1ITXA 1CXFA 3PZTA 4CQDA 3TU9A 3ZVHB 2FPTA 4IX2A 1S5WA 1MO0A 1UUMA 1SZRA 2I16A 5H8MA 3BOXA 1PDZA 3DDMA 3TJIA 3UWYA 3IIPA 2VUYA 4KETA 1HJXA 3KL0A 1G4TA 1QJWA 2INEA 1Q6QA 1RVGA 4L64A 5B80A 1DVJA 3FIGA 4NSBA 4AH7A 5KITA 4F40A 3GYCA 3ITGA 4MLJA 1XS2A 3OPSA 1YPFA 1F76A 3E2QA 5E9XA 4CEUC 4GQQA 1YDYA 1TV2A 3KTXA 3THCA 2NQJA 3N17A 3IUDA 1ODUA 1R47A 3RLGA 8CGTA 2FZBA 3ONCA 4GJJA 2ZCGA 1MXSA 4FO4A 3EB4A 3N29A 2DT3A 4XUGA 3AALA 2QPXA 2YFOA 5JVLA 4A3HA 3FVMA 4YHEA 4PTXA 1WKEA 2BASA 3CQJA 2P3ZA 1I8JA 5A6SA 3GXMA 2ZUNA 3G5EA 1DQUA 4OOUA 4IL0A 3NO3A 4I9MA 1XXXA 1RA5A 3PZOA 1FUYA 4DJEC 1EPXA 1WXZA 3AOFA 5L6UA 4IIDA 4DYKA 5HWNA 3TZFA 3QKEA 3MO7A 1AK5A 4EKJA 4S39A 1A4LA 2G41A 2D73A 2VGFA 4IGHA 4HU4A 5FCZA 2OOFA 2REQA 5A5WA 1UMYA 4W88A 1GK8A 2YL5A 1ELSA 3OA5A 2A4AA 3N4EA 5DMMA 3T8QA 4B9YA 3QMRA 4E2BA 3B8WA 2YBTA 3ZVIA 3BG5A 3PY2A 1DQXA 2UY2A 3R89A 2ZTJA 1W9VA 3UGVA 1KB3A 2V3GA 5HAOA 3F03K 1RXOB 1FWCC 1HUVA 2W4XA 3M64A 2DORA 4UQAA 3ARSA 4F79A 5F4WA 3KP1A 1EGVA 4LEFA 3QQ1A 3PUDA 3LTSA 2ON3A 1J12A 1ZSXA 5E09A 1XV8A 4QEEA 1LLZA 2JIEA 2VVNA 3MBDA 1JGMA 3E38A 4X3ZA 2V5BA 3CBWA 4XZNX 3C2VA 1YQ2A 1IV8A 3TTYA 3P74A 1PKNA 3LS9A 3TFCA 3BLFA 5EBAA 4HQVA 3O9NA 2ZYFA 1JNEA 3HO8A 2X7VA 4O1AA 3I4KA 2CBJA 4R85A 2IPJA 5AHNA 3G1DA 1EP1A 2DVUA 4M0XA 4M56A 1XLGA 4PCFA 1HGYA 4JTQA 3LZ3A 4HZ7A 4CNUA 1SMDA 5I3IA 3SRDA 4XG1A 2ZC8A 2CPUA 3UT0A 4QDMA 1A3WA 5HOSA 3MCMA 1ISZA 1NVMA 1ONXA 2Y8VA 5CLTA 4HNCA 4CVWA 4AWUA 2GQ9A 3A9IA 1CTNA 2VFGA 1DJNA 1D3CA 3I10A 5FF0A 2VCAA 2WW5A 2ZRYA 1TRDA 4MFEA 4A2RA 3UNTA 5EMYA 4QE4A 3GC4A 3CIVA 2FPVA 2J62A 3HU7A 4POCA 3BLOA 4XBKA 1KM1A 1OFOA 2J7BA 1GZ1A 5F1VA 4DJDD 3BJTA 2RJHA 3AYSA 5D8ZA 3ZSSA 1A5LC 4GYPC 4H01A 5HR7A 1TIWA 3PZ9A 2JEQA 2ZZ7A 3KM8A 3FJLA 4MZYA 1SW0A 4ZQCA 1IT8A 2YBVA 3PVFA 3W87A 2ALRA 1DTUA 4CQ8A 1W56A 2VWSA 4HN4A 3ITOA 4ATLA 2X1RA 3R8HA 2Z7GA 4ZODA 4F2UA 4UTUA 4KWOA 1BAGA 1KCLA 1ZQ5A 4IISA 4ZSUA 4HCHA 2ASHA 4AD1A 4O54A 2EPHA 4ZO7A 1TWIA 1XLJA 1M04A 2NXHA 3FYOA 2BOEX 1D9EA 2IKIA 3O7UA 2ZIDA 4MY8A 1SR9A 1GJUA 1XG3A 3O15A 4MSSA 3REQB 4WDWA 1XLHA 3HMCA 2AAAA 4ZOBA 3FAXA 4P5UA 4WY0F 2QPUA 3W76A 4CD5A 3GAYA 4UTHA 3D47A 2W62A 3CQ0A 3CL6A 3WQGA 1KLZA 2QXWA 4JTJA 5T9CE 2DSVA 2Z29A 3DFOA 1GORA 4S3KA 3TN3A 2W63A 4ATDA 4QLKA 3T42A 4F0MA 4F0HA 3L66A 2VEIA 3L4XA 5KINA 2IXUA 1Z48A 4U3AA 2CZEA 1U33A 1P6BA 3VGFA 3WH8A 5HNRA 2YDRA 1E0VA 4U33A 4CCDA 1UJPA 4WJEA 3L0NA 3K4WA 4C1NA 3W6MA 4Z2KA 1SO6A 4PFMA 5BXRA 5REQA 1AQHA 1LRQA 1PTGA 4AUBA 5AC8A 1OSEA 4A29A 1FCBA 4D6FA 4WX2A 3IIVA 4NX5A 3VX0A 1DWAM 2V3FA 4FALA 4ZSTA 1XKJA 3RMJA 3LHZA 2A7NA 1S2CA 3SJNA 3BCJA 2DVXA 2D2OA 3W26A 3SB0A 5E93A 3PHAA 4HNNA 2YL8A 3IRDA 1W5PA 4PRTA 5LIWX 1UA7A 4D8AA 3CNYA 1DXIA 2Z2BA 1XIBA 3I68A 3LV5A 3TN5A 4O8RA 1EQCA 3Q2DA 2RHGA 4XKMA 1IIHA 3W1TA 1XYAA 1XIDA 3N2OA 5BNKA 3L4YA 4GQ0A 2V82A 1JD9A 5BZAA 2PZNA 2F6UA 3CT2A 4V33A 4IJRA 1DJYA 2O55A 2WCGA 1BEUA 1ZGDA 1J9YA 1FWRA 4ES4A 4U5KA 3SGGA 3H7VA 3GXDA 4JZ5A 3UVIA 3EZ4A 2RH9A 3NVTA 2R94A 3GXNA 3UR5A 1G1YA 2Y0FA 4YVXA 3NQFA 3OTRA 3HQPA 5DT5A 3AU6A 1E0XA 5GNYA 4KFOA 3CV1A 4UWMA 3W7NA 1J93A 5RUBA 5FEWA 1M01A 4RDWA 5CKSA 1JRCA 2DDXA 1E9LA 1E15A 2OO6A 4WCJA 3W7KA 4LRTA 4H2CA 4AY8A 2CLMA 3U57A 2OMAA 4N6FA 2WV8A 4HD5A 1Z69A 2YDQA 3EMCA 4JNYA 2F2HA 4F9JA 1QOPA 4RX0A 1P5BA 1PL9A 4LX4A 1EJWC 4YMZA 5BWAA 3B0VC 2PC4A 4L9ZA 3VCCA 4Q8TA 3QGKC 1E5JA 3VMOA 3W07A 1KM5A 5IM51 1ZLPA 3PPFA 1HP5A 1WAUA 2YCLA 4JPGA 3WYZA 6XIAA 2Y8UA 4QTGA 4AMCA 3NIYA 5IHSA 4Z2JA 2GWGA 3ITYA 1A3HA 1VFHA 2PPGA 1XHGA 1O94A 1M03A 3S8HA 2WZMA 5HBFA 1S5MA 1QDSA 5BXSA 3ES7A 2XIBA 2GSEA 5AZ0A 4JIEA 3AS1A 1VFUA 5BXTA 2OT0A 3ANYA 3GVVA 1P48A 3L4ZA 4AIOA 3GRIA 2DSZA 2QUUA 2XVNA 3QR1A 4H4IA 4ZOEA 2YB4A 1QNPA 4K8HA 2QJMA 1GPWA 1TPWA 1RJQA 2H9AA 3NWRA 3OQEA 2DZVA 3BLIA 4M6PA 3GR4A 4TVDA 4AHPA 4EANA 3SURA 3IIXA 4DJFA 4E2OA 5KZDA 1YX1A 5BMXA 3CS2A 3GXFA 3N6QA 1DEDA 1XH2A 3SCPA 3AWNA 1EJXC 1RR2A 2A2IA 4AX7A 4LUTA 1RVKA 3VGGA 5LNUA 4RXGA 3RX3A 4L6HA 4EPKA 1K70A 3LGDA 1KCKA 2WPBA 5CLWA 2WMIA 2Q01A 1H7XA 3LTYA 1A4MA 3VDGA 1RP9A 1FDZA 1SFTA 4GG9A 3GNPA 1L6WA 4F2TA 4JCLA 3AIUA 4IX0A 2KAUC 1M1BA 2E28A 1Q4WA 3W0KA 3I7SA 4QCEA 3AI0A 1ZJBA 5HPOA 4PR4A 5AYZA 2QDEA 4GJIA 4GACA 4AFYA 4A3RA 1AL8A 3SEPA 3A47A 4CQCA 1WBJA 4IUGA 3M5VA 3HFYA 1FWBC 1B3OA 2GUYA 5HMSA 3T6CA 1FHVA 2E6DA 5AHMA 1V7AA 3UPBA 4Q3MA 3ZR6A 1WKDA 1OCNA 3N04A 4W86A 2VKZG 5CPMA 1MW0A 3PB2A 1VLWA 3GBDA 4NVTA 3TTEA 2YCIX 1TFVA 1M7JA 5IFPA 3STPA 5JBDA 2PD5A 2E9LA 4HOXA 4E38A 2G50A 4HHLA 1PX8A 2WMJA 4AY1A 3QC0A 5A8MA 4O19A 2VTFA 3PK7A 2VGBA 5I24A 5LIKX 3URAA 2ZRZA 3DESA 3HN3A 3PP7A 1BD0A 1N55A 3MUY1 1AFSA 1ZAHA 1TV5A 1WX0A 3C61A 4I9JA 1DWFM 4JIHA 1MVYA 3BLDA 5DEZA 4Q8OA 4O50A 4FZIA 1MI3A 1CX9A 4BI5A 3N3MA 1SZEA 4WF7A 3WLKX 1SUXA 3QVQA 5CJMA 3B8UA 1R3WA 1EJSC 3O16A 3NOYA 4RK8A 4K37A 1VD6A 2FHBA 2OT1A 4AXKA 3KX6A 1U2YA 1X96A 3C0JA 5CPLA 2FHFA 1DOSA 2PBOA 5E9AA 1IT7A 2A3EA 4GQBA 3AS3A 1DV7A 4QM1A 3W7IA 1L9WA 1RQEA 1I0DA 4GH1A 2OXNA 3UR8A 2H8ZA 2ZZ5A 5H1WA 5LNWA 3LG3A 5I3GA 5LXEA 2GDVA 5C9RA 1BYCA 2JKPA 3F5LA 3V5CA 5B7ZA 3ANVA 1IWBA 5AYIA 3CZKA 2BVWA 3W9ZA 3RM8A 2D2GA 3KUMA 3W70A 1KCZA 1KQZA 3GM8A 4FLSA 3AICA 1R2RA 2VI0A 2HBVA 1TX0A 4PB5A 1IR1A 2PTXA 3L21A 4DM2A 2YW4A 3OVPA 4DZAA 2QVHA 4MWAA 5I06A 3N2CA 3G1YA 1IEXA 2WMKA 4E0CA 1F07A 4B91A 3KTSA 4JFSA 1HP4A 5G4EA 3OBEA 2GJRA 3WUEA 2VZTA 3T44A 3MMWA 5LKYA 4HA3A 2VZUA 4K7VA 4BCEA 2XJ7A 3PS7A 2R6OA 1XYLA 1M7XA 4K1WA 1EJVC 3AIBA 1F6YA 3S2CA 1JNDA 2VEGA 2E4TA 5FJIA 4JTLA 8TIMA 2G3IA 3ARUA 3CPRA 3VOGA 5CC6A 1OD8A 4Q4KA 5CJNA 4N9CA 1A5OC 3R1ZA 3GO2A 3GFXA 3HPAA 1JG9A 1EJTC 4KRUA 4OKDA 4JOMA 1VRDA 1MWOA 2W67A 3AMLA 2B81A 4MKNA 2DUXA 3CZGA 4B2DD 3RPDA 5BMWA 1D3GA 3CB3A 4FMVA 3MVIA 2REQB 2V8ZA 2VX7A 1KXTA 3I7QA 3UCDA 3ALFA 3WF3A 3VOCA 1I6NA 4JFTA 1OCBA 1JPKA 2DZXA 5FSEC 3WLRA 4NJIA 4W84A 3WBWA 4ZQPA 1ZY9A 3SY8A 5G2IA 3W28A 1H0GA 3EWXA 4N7QA 1AQ0A 4YTSA 4MNLA 4NX0A 4LNCA 1H62A 1TQJA 1BGGA 3R8GA 1UBSA 3BSMA 3SCOA 2QPSA 3A9BA 3PFRA 2WHLA 2QCMA 2ZRVA 3JRKA 4IF2A 3ITCA 2SFPA 2XH0A 2XSAA 4G2DA 4XTIA 1W3LA 5LXXA 8XIMA 1UP2A 4WEVX 4GLEA 1WDWA 5BW6A 2AGTA 4XZHA 2GJXA 3VOHA 1C8YA 3BOLA 1RD5A 2HCVA 1F8MA 3N18A 4IFOA 1LRNA 2PDPA 1GZGA 1EZWA 4QP0A 2WNNA 3EDJA 3EOOA 2D22A 4H7ZA 5HATA 4H9ZA 1J4EA 2CXEA 1R2TA 4H41A 1B31A 3CH9A 1EXPA 2Y1HA 3EB2A 3R0DA 3T81A 1YBQA 4S38A 3KL3A 1MFVA 1IQ8A 1GT8A 2IXVA 3MUIA 2YR1A 1ONWA 3RJXA 1R9ZA 1MXGA 1NWTA 1UASA 3PSVA 1LRTA 5I3KA 2X2GA 2OO0A 1BG4A 1YDVA 2V68A 2DJLA 3T07A 2VO5A 1RK5A 5E1QA 1MNZA 5HNNA 1PE1A 5D2TA 2X1TA 3W25A 4AEEA 4GNKB 4J5NA 3RCMA 1J6PA 1TZ7A 2C0HA 4UMCA 1BG9A 1TJPA 3MPGA 4LBRA 4M7SA 4XO7A 3ZT6A 3S46A 4EPDC 2HVNA 3II1A 1W1ZA 2F9RA 1D3HA 3N4AA 3HG3A 3EBVA 5D32A 4GBDA 4L6DA 2A3LA 4QR6A 4HNVA 1TPVA 3WQVA 1UD3A 1V02E 2VL4A 4ACYA 1IT0A 2HISA 3UGRA 2VFIA 3NQAA 3QV8A 5CAHA 4NZCA 4FXSA 1DIEA 1XM3A 1Q6CA 1Y8BA 4K3ZA 2BXYA 2TSYA 2XFYA 1E9YB 1ME9A 1OIMA 3A22A 3U3HA 2WCAA 1H11A 3AUJA 4DIAA 1VKFA 1TMLA 1E70M 2VJXA 3WDHA 4AISA 3ISIX 2HE8A 3CASA 4O8AA 4WK9A 1TG7A 4PTNA 5D09A 3QMTA 3O6CA 1UUOA 4HZMA 4GQRA 4B9ZA 3E1F1 2XN2A 2AL2A 1CGVA 1IHIA 2X30A 4HSHA 1Z42A 4ZQNA 3AXHA 4RR4A 3UY8A 1UH4A 1JGIA 3W4RA 1K03A 3KFTA 3EMZA 3CU2A 1I2OA 1U5HA 3ARVA 1UH2A 4DUWA 5AZ1A 5I77A 3AMCA 1UZ1A 2YXXA 1M9HA 1EDQA 2XFRA 3BSHA 4D6IA 2GVEA 2O9PA 1XRFA 1VGAA 1DP0A 2KX9A 2ZZ3A 3WSUA 2PRMA 5A6KA 3LHTA 3WO8A 3BARA 3ARXA 3INPA 4FHAA 3C3NA 2JF7A 4RW5A 3WQCA 1W1TA 4H6KA 2YPIA 5LIYX 3PWIA 1GW1A 4B5SA 1R6WA 2HTMA 3V75A 2DW6A 2Y8KA 2GL5A 4A4AA 5AECA 1AJZA 5CSSA 3T55A 5REQB 3AYVA 5B7YA 3B8TA 4IL2A 1PX3A 2VFFA 5D30A 3ZO9A 1XPGA 4N9BA 2DUAA 2H6RA 4RPQA 3L9CA 1QK0A 4YXGA 4WGXA 4HNUA 3N9RA 4GISA 1JZ2A 4CN1A 2JEPA 3DC8A 3ICJA 2I5QA 5C2XA 1A50A 4JN7A 3NQVA 3N2TA 4AVNA 1OEPA 4P7RA 2PLKA 3W1RA 1OWQA 3FSUA 2OTDA 3OGVA 2Y7DA 1HL8A 1VFTA 2VHLA 2CW6A 1VCVA 4H7VA 5HJLA 1FWEC 2VDHA 3OODA 2VZSA 4Q7BA 2G0WA 4GMEA 3V18A 2F84A 1PHQA 2TMDA 3TOPA 2IPWA 4PL1A 1TPH1 3EGJA 4FAMA 4PULA 1R3RA 4KEMA 4Z42C 3TAOA 5IBXC 3WFAA 1QI0A 4YCOA 3ABSA 2GUUA 3PPCA 2OGJA 3R7MA 3AHXA 4PSPA 1A0DA 5HINA 3UPWA 1KGUA 1FXPA 1J0ZA 1ADSA 1UD8A 2VC9A 3OO2A 4JKMA 4HMEA 3CWNA 2WWDA 3BMVA 4GX8A 1GKQA 1R2SA 3XIMA 1HVXA 4TTUA 4IIHA 4F2BA 1RK6A 2I7GA 4X2PA 5FACA 4N2YA 1IGSA 3ENLA 1GYNA 3O8AA 3UXIA 1XFBA 2Z26A 3VIKA 4PRWA 5JU6A 4H9MA 1S2AA 3LRKA 1OVDA 2RAGA 5LHFA 5CPTA 1J79A 1DKWA 1G01A 2V67A 1UD5A 1Q65A 4WJ8A 1OK6A 3MT1A 1V3IA 1PKYA 3LPOA 4OUEA 4BI6A 3FNDA 4WDXA 1CT5A 1QTWA 3B40A 2D20A 5U7SA 4EX4A 1XCXA 2OYKA 4DNHA 3CIWA 4O1FA 2FDSA 3WG6A 3IGUA 1J0HA 1YPIA 4Q4PA 3FAWA 3LTPA 3HGRA 3KTCA 4GXPA 4BR1A 4DZHA 4DJDA 2ANUA 1L8PA 4KCUA 3QXBA 2VEKA 4GKLA 4P8VA 1ZJAA 4RV3A 2YCLB 4O1BA 1W5QA 3XINA 1US2A 2A85A 3ONBA 1T96A 2ZUSA 2V38A 4EE9A 1CXIA 1XP3A 1S1PA 2HQAA 5J8LA 1TR9A 1AZ2A 1KGXA 1JYXA 3A3HA 3AJXA 1DL3A 2YKKA 4DBEA 4HZ8A 2G96A 4M82A 1CIUA 2TODA 2G3FA 3USBA 1C92A 3PTMA 4LQ1A 2Q8LA 1NFPA 2ACSA 3FDKA 3W53A 3KRZA 1E4NA 5C55A 4GC4A 4P7NA 3ZR4A 5F4SA 3W7PA 2FZNA 4W89A 3H21A 1WZLA 4C91A 1AH4A 4DB7A 2J24A 3LRMA 4UTIA 1C9DA 2XWEA 4ACZB 3I6TA 3W2KA 1CECA 3WEMA 5F7UA 4ZXOA 1KKOA 3T7VA 2WMIB 2C1HA 2DW7A 5CG7A 4OE7A 2GGEA 4ZGYA 2YA2A 1TA3A 5EGRA 3BCFA 4FK9A 4WQ6A 4MDPA 4FLRA 3OLGA 4I7UA 2NVCA 1PZ0A 2DH2A 4PCPA 3LCXA 3QHOA 2INFA 1Q4NX 4LB4A 1B2YA 1Z3NA 2O7SA 2Q8ZA 1KBBA 1QBBA 4FX8A 4ENLA 1WDPA 3AU2A 2A3CA 1SGJA 1YNYA 4QEHA 2WOQA 3WNLA 3VK5A 1BVZA 4NNAA 5HMDA 2I5GA 3C3UA 1AH0A 2HK0A 1YHTA 1XINA 3GVGA 4GZ7A 1B5TA 5L9FA 3T2QA 2VCBA 1HJUA 4V1XA 4ERAA 4KH2A 2NT0A 3E2RA 4F8XA 3VE9A 1H1NA 4PMRA 5IDIA 5LZLA 2WSRA 1AQFA 2I5IA 3KBWA 4HCDA 4UTTC 3S2LA 2J7DA 2FPYA 1HJSA 3HV8A 3S9IA 3HIJA 2D0FA 2VUNA 4JKLA 2BWGA 1ZU8A 3HOJA 3IWPA 1K3UA 4JTHA 2W79A 1JCJA 4YWIA 4LGXA 2OEMA 4MUPA 2FTWA 2YZ5A 4Q4OA 1LLWA 1IZCA 1EF2A 3TR9A 5GJNA 1X8FA 3BV7A 3H2EA 4D8ZA 5IDZA 1Y7VA 3WUFA 1IE7C 1HG3A 4E3VA 1TO3A 4GCAA 4XK2A 3K30A 3PFMA 1CXKA 4A2SA 4K38A 1I1WA 3SUSA 1Q45A 1POJA 2VELA 4UIOA 4QG8A 4REQA 2R82A 3U0HA 3DIPA 2GK1A 1UBPC 2NT1A 2PWHA 3QPZA 3NEHA 3N25A 5BXPA 3LV6A 3GNNA 3S3GA 3XISA 1T8XA 1W8SA 1NAL1 3LBOA 4PUMA 1F3EA 2YDSA 3T05A 1E6NA 4FEZA 2G3NA 2D3LA 1LT8A 1FFQA 3W1NA 3S5YA 4A8RA 7CGTA 4Q4SA 4Z1BA 1AH3A 3IGSA 1LG2A 4IQEA 4I8DA 3TYZA 1W31A 1EUAA 3QEZA 1GOMA 2VRQA 1VBJA 1V79A 4K68A 1JD7A 4PRRA 1EWEA 3CWOX 3GW3A 2W3ZA 7ODCA 4LANA 3DOPA 1KFLA 2E09A 3C2FA 5AOUA 2DQWA 4OBTA 4FXJA 4UR7A 4CCZA 2VR5A 4MWAB 3SQSA 4U5IA 2BVYA 1DQWA 5D38A 1G67A 5EPDA 1JCXA 2ZZ4A 2VX4A 4DXKA 3UCQA 2QV5A 4S23A 1C8QA 2W6RA 2ESCA 2VR2A 1NP0A 2PTWA 5A6BD 2DJXA 2J77A 4FNTA 5C5YA 1YNPA 3RX2A 3UG3A 2YW3A 2WXDM 3IGHX 4LNYA 2J9XA 1RA0A 1GQLA 2YYTA 4H3DA 3K8MA 4ZOCA 3AAMA 2GPTA 3G1SA 2B7QA 4F4RA 1K9EA 1TV7A 2YGYA 3GNRA 3G6LA 3L4UA 4ZQMA 3ZWTA 3MSYA 3CIXA 3MY9A 2F7FA 3FEMA 2OZ0A 1XC6A 2Z2UA 3NSXA 2WSQA 1ZZMA 3TW6A 1FWTA 5C9XA 4FI4A 2CESA 3H54A 4AD4A 2X42A 3QFEA 7A3HA 6A3HA 5E6ZA 3TP4A 2XISA 4I6VA 3E9AA 4X0VA 1BGAA 3S83A 2Q3OA 3CGTA 1VYSX 4ZL1A 2Y61A 5CSRA 1FCVA 2JF6A 2VENA 3E0LA 4LS0A 4D71A 4BF7A 1HJQA 1T0OA 1E0TA 4NILA 3NXLA 1O5KA 1SPQA 4A6GA 1ECEA 1PPIA 3DG3A 2O56A 3H2OA 4XIMA 3LQLA 2X16A 4GIEA 1B54A 3E74A 4P2VA 1BVWA 2NXGA 3ID7A 3TUUA 1P0KA 1C93A 4QX4A 2HMCA 4XAPA 4M1RA 3VYLA 1U22A 1EQPA 1SZFA 4JTTA 3PTKA 2Y70A 4L4MA 2G3JA 3M1ZA 1EF3A 3BICA 4S3AA 1AMKA 4QLJA 1QI4A 3DUGA 4JL2A 3CTTA 3MKKA 3BXWA 2AOSA 1BYBA 4JN8A 3VKCA 4DQWA 3B9NA 4I5UA 3ARTA 2ZZ1A 4RDVA 3T0AA 5LIUX 3OLDA 3FV9A 1FKWA 2NVDA 2EJ1A 1SZGA 1OBAA 3GNXA 3TYEA 4TU1A 5HNTA 2WHMA 3A21A 2GJLA 1TE6A 3PB0A 3G6MA 1NWRA 3EWZA 4PMXA 3WEZA 2YCKX 3SECA 2E1WA 4EPEC 3F2DA 2XIQA 1KA9F 4MNKA 4Q4MA 4PUDA 2J8GA 3KVKA 1ZFJA 2I9EA 5GVJA 4PTMA 1XLFA 3NDZA 4ADUA 5EBUA 4YWSA 4L6OA 3W2LA 3HJZA 3GUGA 5A6JA 2ISFA 3NZPA 4S3FA 2JIWA 1M7OA 5DXYA 4BK9A 1XFCA 1JXJA 4MB4A 3OGSA 1A5CA 5K3VA 3V5FA 4J3WA 3TJLA 3WJSA 1JXKA 5KZEA 3OG3A 4MDOA 3T08A 2QULA 3NM1A 3VDCA 4F9DA 4H04A 1G4SA 3RU8X 2ABAA 3M5ZA 4AG0A 2PWVA 1BSLA 4DPQA 2DSKA 1JDDA 1WPCA 1OFRA 1G6CA 3B9AA 1F7BA 1DPMA 3KRSA 3CUXA 5ABFA 3NG3A 1XUUA 4HCLA 3LXBA 4BF5A 2VR4A 1JCNA 2BP1A 5CCZA 2Q3RA 2WVSA 2RDTA 4DVOA 3IJ6A 1U83A 5CPSA 1CGUA 2A21A 2J7CA 3UJSA 3GS6A 2ZE0A 5FEZA 4MMWA 3QPEA 4GUJA 3WLMA 1QPRA 3J7HA 3O6DA 4W8AA 4B5XA 2PDCA 2D0GA 3MU7A 2NQ5A 4X61A 3R12A 4QBXA 6REQA 4O1EA 1W2VA 3LCFA 2RKXA 2Y7FA 5K9CA 3WH9A 3QKZA 2VEMA 4IXHA 3OU8A 1R86A 3C2YA 2TRSA 2R1NA 5E0FA 3PBUA 4R7WA 3PZVA 3VIHA 4WKFA 2XVKA 3FFSA 1Q6GA 2AL2B 3N9KA 4XD5A 4JTCA 3W74A 4OV4A 6ALDA 1UWIA 2D3NA 4B90A 2GFTA 4HA4A 1R85A 1TZZA 1VRXA 2PP1A 4GXMA 3I4EA 4KCTA 4MHBA 1LQAA 3MCOA 3PZUA 1UMLA 2PGFA 3PN8A 2V3EA 5FJOA 2HZGA 3LNMA 3OBKA 3RK8A 3AC0A 3M44A 5C8BB 1XLMA 3GU2A 3THAA 3VKJA 2ACUA 3M0KA 3GHUA 2A3HA 4MY1A 3RO8A 4B5TA 1QI2A 2PDJA 1TMHA 4UQ9A 4DWSC 1R8LA 1Q7ZA 2PURA 4XX6A 3HJEA 4GIAA 4O1DA 1RLDA 1G69A 4DF1A 2PU0A 3WLSA 3RM9A 2HVOA 3CZ8A 4RZ5A 3ZVHA 1KM0A 3VKBA 2DZPA 2PCEA 5FL1A 4JAWA 1QNSA 2CIPA 4FNSA 4C1KA 3NQ6A 3A6OA 4NZFA 4C6PA 1UR8A 1EC8A 5BOEA 4N42A 5T9BG 4HOWA 2E6YA 1QW8A 5A8OA 5F2MA 1FH9A 1M53A 3QPYA 5AN7A 5K4ZA 4ZENA 1TRIA 3IJ9A 1E1CA 1WNOA 3E5PA 2XGBA 3WQEA 3VD5A 3CQKA 5DLCA 2DPEA 4QDWA 3AMGA 3AQUA 1VAHA 3KVLA 1E73M 1UPMB 3IEBA 1AW2A 2IQDA 2VC5A 1QATA 2NV9A 3RMEA 3WMCA 1CGXA 3AHVA 1M68A 4JFVA 5CC5A 2OLAA 1JZ3A 3ABXA 5GJMA 3GUWA 1GWJA 4H8VA 1D7KA 3N3TA 2XZ7A 1KR0A 4C6NA 1BF2A 3S4TA 3GDRA 5DCEA 3LN3A 2ZUTA 1W1B1 3FKRA 1XBVA 3CUGA 1XIFA 2J88A 2PP0A 6PTDA 3A13A 3SCUA 1XL9A 4DZIA 4IMCA 1U5VA 1ZHAA 3ZYZA 2WKLA 3AXXA 1W9BM 3I65A 4IGNA 3W23A 4TMCA 2YCEA 1CXHA 3U4AA 2OEKA 1M41A 4IQJA 1SJBA 1XIEA 3V4BA 3RRAA 2X7WA 3B9DA 4ZFMA 3G77A 3BSGA 3KBJA 3EX6A 2FZ9A 1EZ2A 3G8RA 5HANA 4E8GA 3OEXA 1Q2SA 3KXQA 4PC8A 5LNVA 4LYRA 4ILSA 1RBAA 4XWUA 3GXTA 3C0LA 2OKOA 1XUZA 4V28A 1LJYA 3MZNA 3SCTA 1K8YA 1FWHC 3QBUA 4OECA 1SVDA 3KEHA 1S5TA 4GVHA 1CENA 3T9PA 1X38A 1RZMA 4JIIX 1HKKA 3PTDA 3WF1A 1VCFA 1WDDA 1XW8A 1V08A 1XH0A 3WF2A 5EYWA 3T4CA 3FN9A 2JBMA 3DGBA 2FGZA 1SFLA 3BMWA 1S5NA 1XX1A 2G4JA 2VFEA 2A6NA 3OVRA 1IXQA 2A5HA 3SY5A 4BI7A 5EA9A 4KIEA 4LXFA 4GGBA 1V0MA 2BGQA 3QM3A 4AF0A 3KCLA 2FTYA 3GHRA 2CBUA 1OINA 3D3FA 1PYMA 1ISWA 3WD0A 2E0PA 4NAFB 4LF2A 3KBNA 5AC6A 1X6LA 5C7HA 2DZUA 4NZ3A 2QJIA 1TTIA 3ZLGA 1W0MA 5EU9A 3EPOA 5D02A 4BQ2A 3MS8A 1RV8A 4GYFA 1KFCA 3F7JA 3KP0A 5DRIA 2WNQA 3ZT5A 2ZDSA 3RR4A 2X0HA 4IT1A 4UTWC 1EC7A 2Y88A 1JQXA 4P61A 3BC9A 3WK2A 3N6HA 2QYGA 1KFJA 3GC5A 3BTNA 2J47A 3HMJG 3AHZA 4NP7A 5BRQA 3RLHA 4BA0A 2ALDA 3AS0A 3TC7A 1XD1A 4LVBA 1UW9A 3IJIA 1J0IA 1RBOB 3Q94A 1DWHM 4KWWA 3PSWA 1FQ0A 4IXXA 3AFBA 2DZWA 5CZ0A 3QLDA 4YYCA 1JUEA 2BTMA 2FLIA 4JTEA 4WKAA 1GVYA 3QLLA 1EYWA 5KZMA 1BKHA 1CLXA 5FF3A 3GAKA 2JFEX 4AC1X 1XPYA 1TA3B 5E6YA 3VCRA 4IIFA 1LL4A 1DE5A 1J6OA 2NV2A 2WC7A 1TUXA 1V6VA 2AKMA 1UA3A 3IARA 1LM1A 1MNSA 4H00A 4O0QA 2DGAA 2W9MA 3EWWA 2V5LA 2BLEA 3PBVA 1C90A 3BE7A 3NR0A 4I9AA 4W7WA 3IV3A 1X97A 3ANUA 4ONVA 2OZTA 1PIIA 1EEXA 4PCTA 9RUBA 4ZXLA 3REQA 1VYRA 3SN4A 1GJPA 2ISDA 1DWJM 1WP6A 1AJ0A 1X98A 4O57A 3PC0A 2AQVA 4PMQA 4DJFD 3VOJA 3K1DA 4KCVA 4EK7A 4Q8PA 5I79A 1UROA 2PDUA 5I2UA 4B5VA 4HYVA 2BDQA 3W7GA 1NWUA 2X2YA 3H2CA 1JEZA 1US0A 2BS9A 3ABZA 4FOJA 1BTMA 3GDBA 4ZB5A 1Z41A 4R33A 3W1QA 4D6HA 3LCIA 5DXXA 4PUJA 3RPTA 3Q67A 3PULA 4RKAA 2ZFAA 2VZOA 2D69A 4I9TA 3S6OA 2IMRA 2PDMA 1E72M 2XIMA 1HO4A 1JCYA 3B0YA 1NFGA 5BROA 1DORA 1RH9A 1GOQA 1SO5A 4E2DA 4PMJA 4FSAA 4O4VA 2E68A 4TVUA 3R6IA 3W82A 2QCCA 3BGGA 3HURA 3F5JA 2V9DA 3GU1A 3TCSA 4ERIA 5FF7A 5A3HA 1I2NA 2J4GA 4N4QA 2NQLA 3ARWA 1LORA 1KO0A 3WJYA 1ZBWA 4QAWA 4REQB 3T1GA 2GK1B 2CLLA 4W8LA 2ACQA 4DEFA 4LJ3A 5F2GA 1Q6FA 3OYXA 4QROA 5CAKA 2IS7A 3CUZA 3W71A 1H7RA 1A5BA 1WAWA 4AB4A 3DBPA 2ISWA 1BYAA 4R3UA 3HV9A 1XSIA 3VXGA 2I17A 5D9PA 1EPVA 5HQLA 3TWAA 2WMFA 4OUIA 4O11A 1T5AA 1LT7A 4N9EA 1MEIA 3W1PA 1GQJA 2UWFA 3SIZA 2E9MA 1H5YA 1EX5A 4FB7A 4NZ1A 3G0SA 4QITA 1A0CA 4HPXA 3MDWA 3FS2A 4DRSA 4PMNA 2MNRA 3NJ3A 3WQ6A 2NZLA 1GOXA 3DYOA 1TJRA 5FF4A 5D2VA 1EKOA 2PU1A 4CCCA 4DUOA 1HVQA 3VE7A 3ZLHA 3U4FA 4CUCA 2ZA1A 3LCHA 2ZRXA 3OLEA 2VRKA 3ORWA 2J9ZA 3GQYA 3LSBA 4TX6A 3EXSA 4X22A 4AZHA 4LCSA 1TPFA 2R9RA 5ABGA 4F0SA 4S3GA 3MHFA 4AD0A 3RPMA 1V3LA 3URNA 4Y6GA 4GD0A 2PGRA 4GK8A 1FDJA 1HIZA 2J75A 4NJJA 2B31A 2AL1A 4DBDA 4UCFA 2J8TA 2Y62A 2DT1A 3GIQA 3EDKA 2DH3A 3P60A 4PH6A 2BY2A 4HGXA 1NFBA 1VQTA 4WR3A 3OJGA 1UQZA 4IQDA 2E8ZA 5A2BA 1WXJA 5FJJA 1V7YA 3LHUA 3F1QA 1B30A 4D72A 1R7AA 1YXCA 1ESWA 1J10A 4YYFA 1YPXA 2TAAA 4YTRA 1E4LA 3CLWA 5LNSA 3OQ8A 2GJNA 3EEGA 2EG6A 3NDOA 4WHBA 4Z1CA 2VGIA 1PIGA 3WLLA 4MWAD 1G0CA 4R27A 4OU1A 4Y7EA 1JCTA 1WXYA 1QCWA 4H83A 1OYBA 1OZMA 4OZOA 4J40A 3L2MA 1Q66A 3ERPA 4Z1AA 3WFZA 4OV9A 2C0AA 2V69A 2X05A 1MRAA 1W5OA 2P1FA 4QCFA 1CEOA 3QV6A 4GY7A 1PDYA 3OBAA 2CLPA 1C9WA 4MNJA 3I3EA 2WSYA 1H49A 5CGMA 2Y5EA 3I3DA 2CERA 5C71A 3THDA 2QAFA 4QQ3A 5D9MA 3BAIA 3MCNA 3L68A 4DYJA 1BWLA 4O17A 4MM1A 2G95A 5AC5A 3W72A 4XZBA 2BVDA 3GR8A 2FGBA 1XGZA 3WFLA 4QDPA 1UR4A 1XLKA 5LA0A 1DJHA 5TD4A 3WQ4A 1MSSA 4K2SA 3DC0A 1WKFA 1CXEA 4HYRA 2QVNA 1NY1A 1ITCA 1S5VA 2ZQ0A 3WH6A 2QIIA 5FOOA 2Z7KA 5FIPA 1JPMA 1LUCB 1KC7A 4JDYA 1RAKA 2GQAA 3AISA 3BURA 1LQ2A 3GH4A 3LMZA 4GE8A 3U8GA 3VIGA 4ZO9A 2DSWA 3W27A 3B0XA 1XICA 1OY0A 1AODA 1R9YA 1JVNA 3SM0A 1UIPA 3OYZA 4GGHA 3WUBA 1R3VA 4NASA 3WLHA 1PHWA 4R7OA 3PWGA 1GKRA 3NAVA 4WSHA 3RUBL 3JU2A 4QJ4B 3N73A 1RPXA 1Z32X 3VD7A 2EPOA 5K9DA 5ABFB 4DLMA 4GRSA 3THUA 1SFSA 3WN6A 3TDFA 1GHSA 4CEXC 5T8GA 5HMFA 2X09A 1V3MA 4KWSA 3QTGA 4XVDA 3LXCA 3NYDA 1HL2A 4MB3A 2P5NA 6REQB 3H22A 1XYFA 2VRJA 4CQ9A 4JQ4A 3PBGA 3OLIA 3C52A 3P3BA 1PYFA 2HPIA 3A4AA 3W7HA 2WZIA 3GDLA 1E0WA 4RLIA 1LBFA 4AHOA 3QJAA 4B4FA 5GQBA 4R88A 2C6QA 4N02A 3S9YA 1XCFA 4JIQA 4Q8VA 4AAJA 1PUDA 3PZNA 1YADA 1VH7A 1VHCA 2O4QA 3H4WA 3AJ7A 1XQLA 3SI9A 2PTDA 2QHAA 1KV5A 4GZIA 2DZBA 5LGZA 4TUFA 3WNNA 1Y65A 2X0SA 4DLFA 2Y5JA 3VI2A 1VF8A 1IWAA 1OHLA 1OFBA 1DWGM 1OX6A 4JFUA 1TWDA 1RCXB 4S3BA 3MI3A 4I7WA 3L2LA 1VBHA 4R53A 3PBYA 3WD4A 1YYAA 1YW1A 1CGWA 4H9XA 4I5XA 5D9NA 3P61A 3SCQA 3VC5A 3M9YA 2PDBA 3ECQA 4PTWA 5A6TC 3H2AA 3URBA 2V0TA 3GZAA 3KDOA 3TVAA 3KOYA 1J5TA 4A21A 3W7JA 1MZRA 4LT9A 4O53A 1W2PA 2NLYA 1ONRA 3IIOA 3DG6A 1J2BA 4FLQA 3F4CA 1UZHA 2O9OA 4U3CA 1DHKA 3NUKA 1YE4A 5CZJA 2Z2AA 3QHNA 1S2WA 2HS6A 4Q6XA 3SSJA 3VKDA 1DJGA 1OZQA 1DJXA 3B8IA 1JF5A 1A0EA 4UFIA 1WB0A 3UXDA 4UFMA 3KS5A 3NL2A 1V0NA 3E0WA 5LA1A 2BOFX 1GOIA 1O5XA 3SQMA 1X1ZA 1E1CB 4R7JA 3SSZA 1PCKA 3PZIA 5D9OA 3IVTA 3TN6A 3PBMA 5JH2A 3SJ3A 3OGRA 4TVCA 2VWTA 1RP8A 1XYZA 3GC2A 2I9UA 3EOUA 3BH4A 2XINA 1XYBA 1CCWB 3EDEA 4DXVA 3QC3A 3E6EA 4IMDA 4JIPA 4IPLA 5BOOA 4W7UA 2PLJA 4KERA 4OIFA 2X1IA 1JCLA 3SGZA 1V77A 3GTIA 1XLAA 2PGEA 1H50A 4PUEA 1KFEA 2AKZA 1AW1A 2E67A 2PDKA 5DBUA 4AD3A 1WDRA 3TC3A 3LXAA 4XD4A 3GIPA 2QGYA 3GHTA 4W87A 2Z1XA 3U2CA 4AZCB 1N8IA 1H41A 1QI5A 5I6SA 1VC4A 3WUGA 1JULA 1E9IA 4LB3A 3GD6A 1EEPA 3STFA 1C91A 4EWND 2PTYA 4IMAA 1NOUA 3A24A 5G1MA 1P43A 5H8PA 3PJTA 3JVAA 3UXAA 2VEFA 2ZX6A 1Y5WA 4ERGA 1FWIC 4EXAA 4WY0A 1E9ZB 1NU5A 2WVVB 1VJSA 2HRWA 2J6VA 1JZ5A 2E5CA 4GZJA 4LBUA 2VX6A 4XD3A 3U7VA 3H53A 3MJYA 1Q6OA 1EBHA 1JIBA 4MF4A 5DX7A 2IQ0A 4DYEA 2DP3A 1EHAA 3NPWA 4X9YA 2X1UA 3A3WA 3LMYA 3OIXA 3WBXA 1I75A 2GOUA 3FGCB 2ZBTA 1KXHA 4L7ZA 4YVVA 3CEPA 3TYCA 4FR1A 3TH6A 1UJQA 3HGSA 1ISVA 4R9OA 1TPC1 4C6BA 4HVXA 2OVLA 1U5JA 2CHNA 1KRAC 2CHRA 3LI0A 5LGXA 3FEQA 3CT7A 3M0IA 3DFPA 1AW5A 4IUOA 4Z2HA 4RNJA 4NF7A 4AF0B 3UU0A 1AD1A 2ZA2A 4K1GA 1FKXA 3NURA 5FJRA 2J8FA 3D5HA 3KWXA 2GQ3A 1R87A 3M6DA 3PNUA 1NP2A 3P67A 1UPPA 4QG9A 2W66A 4W85A 5BWFA 4FOUA 1A53A 1WBHA 1NM9A 1YTEA 3BAYA 4J2MA 3VDHA 1GOWA 1YDNA 3S2JA 1OK4A 2V5JA 5HULA 3M07A 1KBLA 3MJMA 3Q37A 4ZA0A 1J8VA 2H3DA 1HL9A 1Z8AA 3P5ZA 4ZO8A 1GG1A 5F2IA 2GSHA 1X1OA 4MGGA 3K2GA 5TIMA 4C6QA 4C65A 4H6EA 4LYQA 2PWUA 3H4XA 2I1OA 3B03A 1MZHA 4YCPA 2PE4A 4JQ2A 3CWHA 3V7PA 2WQDA 1GYLA 3S5NA 1K4GA 4XSLA 4I8YA 1N2VA 1JUBA 1UCWA 3FW6A 2YB1A 2O9RA 2C19A 2BB0A 3DFQA 3RRXA 1JL8A 1H7OA 2A0NA 4LALA 3KL5A 1GZJA 4JTIA 1IEIA 1T41A 1XR2A 2PZ0A 3A12A 1GW9A 2PDFA 3EXRA 3DG7A 3LU2A 2OX4A 4O28A 2XH4A 4LS2A 1B3XA 4EP8C 1TTQA 3TKFA 1IXNA 2XM1A 1F3TA 2XN1A 3NO5A 3VD9A 4JL1A 3MYPA 1FRBA 4GC3A 4LAKA 4GUIA 4ADSA 1JI1A 1ZL1A 4ZE5A 1PVNA 4JICA 2EG7A 4IPPA 5TF0A 1US3A 3CEUA 5CBBA 3LM3A 4QQUA 3GSMA 3TNOA 2PDNA 2OB3A 3OP2A 4AVFA 1QXLA 1I0BA 3BAKA 3F4VA 4NZ4A 4UFHA 3W02A 4M7TA 4HJFA 5M1TA 2Q8XA 1KTCA 2I14A 1QBAA 1Q5MA 4BF9A 5G4WA 3TOYA 4XKYB 3GDMA 3TR2A 3GU9A 2WMGA 3BG3A 1XLIA 2JE8A 1E55A 1TV4A 2JK2A 1ITUA 1ODZA 4LWWA 3EXTA 1L6YA 2DVTA 5FJPA 3BANA 2PWEA 3ITXA 3LGEA 3P8JA 5D8WA 1ISXA 2CWNA 5FL0A 1QHPA 1OFEA 2JALA 1OB0A 1TWWA 4DUVA 3TFXA 3TYDA 4PCNA 2WANA 2POTA 3PG9A 3UJEA 4DO6A 1GYMA 1OIFA 2YXGA 3DH7A 1OG0A 3UJRA 3TAKA 4QGCA 4NUWA 2FFIA 3ITVA 3VIFA 3IK4A 4O0ZA 3DHDA 4JTFA 1NQ6A 1W8GA 3S6TA 4DJFC 3VGEA 5LHEA 2MANA 3A64A 2QF8A 4FOKA 4PSRA 4M29A 4PUKA 1P0DA 4IMEA 4UC5A 3FCPA 2IW0A 1FDYA 4GABA 1P1MA 2GGGA 3CPUA 3GTXA 1YEYA 2QJNA 1ZBCA 1HO1A 1X7FA 3LBMA 3GFYA 1FWGC 3R0KA 1QASA 3M0ZA 5C7VA 3K1GA 4LVAA 3G1HA 4AY7A 2WC3A 4KF1A 2FZMA 4MAVA 4XB3A 3AYTA 3W01A 1UKSA 3VM7A 4KEUA 1HKIA 4QS5A 3MBFA 3VNIA 2WNWA 5FJUA 1VFOA 3FDGA 1RLCL 3K5XA 3FOKA 4YTTA 1NELA 1LWJA 1KV8A 4WLCA 8RUCA 9XIMA 2VNCA 1P7TB 3UYIA 5A8QA 2PA6A 1R46A 1K77A 4D2JA 3E3HA 4RDYA 3GXIA 1BQGA 1K1DA 1GTEA 5TAOA 5AY7A 3CHDA 1BHGA 2BV9A 3CMJA 1I2PA 4I3GA 1TCMA 5C70A 1O12A 1VEPA 5M03A 2BOGX 3L2IA 1TVNA 1AZ1A 4FX6M 3ZFHA 3MHGA 4FX7A 1RJPA 4LSBA 1XWYA 3NPVA 3E49A 1GQKA 5HUPA 5DMLA 1PCWA 1RCQA 1KR1A 2GVYA 4B16A 1WDQA 2NXIA 3QY7A 4GPNA 4WRHA 5CPOA 3V0TA 3VCNA 2GOKA 5JUVA 2WWCA 1E1EA 1TIMA 1GNXA 3P84A 3TA9A 4KGLA 4GHRA 5HDRA 3RX4A 3EOSA 3HF3A 3LRLA 3VUPA 3RNDA 3VKAA 5A95A 2ZWZA 5C9ZA 4JX5A 4CNOA 4AZIA 4UB9A 1XF0A 4L1GA 3HG5A 4G1NA 2WM1A 5JMUA 4HJWA 3VNLA 2QUVA 3WD3A 2J66A 1UWUA 4NU7A 3W7CA 5KMYA 1LP6A 1W1VA 3H6OA 4DWSA 4US5A 4JHOA 3IVSA 4XAGA 3TMLA 3WD2A 4UMBA 3ZJ8A 3HQNA 4WXZA 5CGTA 2PWDA 4UTFA 2Z1VA 2OG9A 3LK6A 3MMDA 4ZB2A 3KS6A 4J3ZA 3GNOA 1HKWA 4GUGA 3A3XA 1SU5A 4C90A 3GVRA 2BXVA 4V27A 3GY1A 3R13A 4I6KA 1M5WA 3P93A 1PWLA 2I57A 2VMFA 4J3SA 1RHCA 2YA1A 2D24A 4K39A 3WKZA 2CHOA 1W17A 3WNPA 5AHFA 2BXZA 1RUSA 1V3HA 2PCQA 3SFWA 3BAWA 2X0YA 4MWAC 3DFHA 4Q32A 1V03A 4NJGA 1E3XA 4O15A 1HJVA 4H9VA 4ZQOA 4A8NA 1MRQA 5I78A 3STGA 3CHFA 5AHIA 3PZGA 1V6XA 5DCBA 4D6DA 1LZOA 3BGJA 4MG4A 2Z00A 4NAEB 4FR6A 5DCDA 2NX9A 4LEQA 4BFAA 4B92A 4ACZA 3FX4A 2EGZA 2J13A 4Y9OA 3TTQA 3EAUA 1EO7A 1SSGA 2QCGA 1F4HA 3QTPA 2PLMA 1UH3A 4Z08A 3VIPA 3EDFA 4ML9A 5LIXX 3W7DA 2O4MA 3W38A 1UC4A 3CL8A 5JH1A 2C7FA 3OHMB 3S1GA 3KCOA 3MV01 2QNEA 2CLOA 2Z0IA 3SAZA 2Z25A 1ENUA 3NA8A 4AEOA 1B90A 3E2VA 2XH2A 3L4WA 1FWDC 2PTZA 3V0UA 2DZAA 3BW3A 2CNCA 4S3DA 1PIFA 1PB0A 2HBXA 3KHJA 5I5RA 3VOIA 3GNDA 4DX3A 3W1LA 3S5ZA 5HQMA 2P0OA 1R0MA 1I2RA 5ABTA 1IEVA 3TTOA 3APYA 3LPPA 2P88A 1X7IA 3GDTA 4IH3A 1BSIA 4I5RA 2PF8A 3FYPA 4YN5A 2FH8A 1UWTA 4H8UA 3CK5A 2P3EA 1OYCA 1QR7A 5HA7A 3VKKA 3KOXA 2VQTA 1KWKA 2CLIA 1H7NA 3CV6A 3G1AA 4AQLA 2VZVA 1ZAIA 1R3TA 5A94A 3NVDA 3FA4A 1SYTA 1T6MA 1V8EA 4TO8A 3UCCA 3P80A 2QCLA 1W5NA 5DMYA 1B57A 3S2NA 3L5AA 3DCPA 3EKLA 3UWUA 3TV8A 3PUEA 1PXGA 3H24A 4X60A 3GXPA 4ATWA 1Z44A 1FCQA 5I3HA 4W5UA 4EOUA 3M0MA 4IP5A 3OB8A 1C8XA 3PANA 3VUSA 5KTLA 2C71A 3BK0A 1LL7A 4Q7NA 5JXQA 1CLVA 2XIIA 4QJ3B 3KE0A 2XG9A 2YFNA 1WDSA 4NYYA 4DBUA 2DQXA 2Z1SA 6CGTA 2WK2A 1LDCA 2FJKA 4KKXA 3DERA 3S5SA 1FBAA 3AMDA 4KPLA 4TV5A 3VMPA 1Q8JA 4S3JA 1V02A 1RPKA 1GVOA 4RUBA 4OHQA 3WDJA 4KT2A 3O07A 3M46A 1KGWA 1A80A 4KCWA 3GIYA 5JIWA 1F9CA 1R5YA 4M6QA 1JYVA 9CGTA 3U6WA 4F0KA 3TX9A 3CUFA 1H5VA 2PDGA 3HPZA 3G3MA 4XD6A 3KOZA 5J5DA 5GJPA 2WJEA 4IG2B 3VA8A 3K4AA 3LY0A 3B8DA 2ZICA 3UWEA 2EHHA 3VD4A 3N12A 4Q7IA 3VIIA 1PZ1A 4AZ6A 3E02A 4UMAA 4WIWA 3W1AA 4ICCX 1XSKA 5IOBA 2NSXA 5HUOA 1IXPA 4A05A 2Y6ZA 1TPUA 4DXXA 3TIMA 2VQUA 3VU2A 3LEPA 4YPJA 3VFCA 3NSNA 3U5YA 3WMLA 1VS1A 1NF0A 3I7RA 2NW0A 3QN3A 2Y2WA 2QGHA 4W7VA 4MKSA 3NM3A 3QMSA 3TLQA 2YSWA 2VX5A 2PBGA 2C79A 5AKQA 4MJ2A 1KD0A 1T99A 1W37A 4JDBA 1JZ4A 3F5KA 3WELA 1RY0A 3L23A 1LF1A 2WB5A 4HTYA 1I1XA 4US6A 2VGGA 3MSDA 4P7OA 3D3AA 4MNMA 1JI2A 5FAGA 5DFAA 4QHRA 2XYLA 3W24A 4U4MA 3RIKA 4B5UA 1A5UA 4YNGA 2IPGA 5M5DA 1EO5A 2V2CA 4A8IA 1GG0A 4HPHA 4UUIA 2TPSA 1XQKA 4V1YA 3N19B 2QS8A 4WY0B 1X39A 2J25A 5AYBA 3EYPA 1UD6A 3S6DA 4MY9A 1QRQA 4J35A 3TC6A 4HNOA 3M5XA 2VFDA 4C6IA 1G5AA 4DO4A 4WUIA 3SFKA 2QJHA 1LWHA 3P62A 1K8ZA 3L5MA 1TCDA 3KOFA 3MUZ1 3CAQA 4KEVA 1WA3A 1FH7A 4N4PA 4Z17A 1K7XA 2P0IA 2YZRA 4Z0SA 3B05A 4C6KA 1L6FA 4H9YA 1KFKA 4GX9A 1TWZA 1QNOA 4IFKA 4EAYA 1UR0A 4RE0A 3WQ8A 3GE7A 1LCOA 1MXDA 1NOWA 4CD4A 2FJUB 1KQYA 2FYMA 2QIWA 2V3DA 3BG9A 3LHWA 3PBWA 4HKPA 1S46A 3ARPA 1ADDA 1AQMA 3CZLA 4NI8A 3LZ5A 1MW2A 3H70A 9XIAA 4E2VA 3R10A 3U9IA 5E0CA 2C13A 1KM6A 1FX6A 1PEZA 3L67A 3VDBA 4KS0A 2J9YA 1EL3A 1JF6A 4QXIA 3SW6A 4XZ9A 1XJBA 2DIKA 1U30A 3EX4A 2QEZA 1B3WA 5XIMA 4JXCA 4MLRA 5DRCA 5I7GA 4Q4QA 4AYSA 2J7EA 3L12A 3B3DA 4UOQA 4J28A 1DE6A 4JTSA 2RDXA 2ZADA 1BYDA 3FLUA 3FSTA 1ICSA 1NDVA 3WQFA 1W6TA 2P53A 3LPGA 1VB9A 3BV4A 1U1UA 2EQDA 3NQ2A 1KTNA 2A3BA 3VABA 1W1PA 1G4EA 3LD5A 1WV2A 3DFNA 1BXBA 1XBYA 2CCRA 1C7TA 1EA9C 5HJYA 1H60A 4Z1YA 3RG6A 1OF8A 1HKVA 2QJGA 3N4FA 2H3BA 3C2EA 4PMDA 2ZZ2A 2QJJA 3MP3A 3GX9A 3U5UA 4Z2LA 3UWWA 2IKJA 3PTQA 3B0PA 4RZ4A 3W7EA 4Q8QA 4S3CA 1VEOA 3TNBA 4DZ5A 1YXDA 1GHRA 1QMLA 4HA1A 2Q71A 4OTKA 1V51A 3TXZA 3NSMA 3NTYA 1UR9A 3NQGA 5IFTA 1OT1A 2RDWA 4ECLA 2XTKA 1OFDA 2BGNE 4DJDC 3M0LA 1WO2A 2PDQA 2CLKA 4PUWA 1K9FA 3SN0A 4D1JA 1MW1A 1Y0EA 3TONA 4H6QA 3PPHA 4KRZA 1H3GA 4LUSA 3W2JA 3NL3A 3PM6A 4U2ZA 2FVLA 5DO8A 4GCXA 2QW5A 3HTWA 3UP8A 1LLOA 3W75A 4D8LA 3B4YA 3VD3A 1JFXA 4AC7C 1F3XA 3N11A 2W61A 3T4WA 4NNCA 5I00A 3M41A 1IYXA 4WOZA 4M19A 4Q6JA 1EXBA 4IQLA 2VDIA 3SBFA 3QY6A 4IGSA 1TUFA 3DFSA 1WCGA 3LNPA 3CPGA 3L4VA 2VP8A 4C6LA 3WQOA 3ZMRA 2J74A 3GH7A 2HROA 4NXKA 1T40A 3VIOA 4KMQA 2R1KA 2PLCA 4LBSA 4UQBA 1VIWA 1F61A 4PODA 4GIYA 5A8GA 2CETA 4W8BA 1QT1A 4AWTA 2VT0A 1W3KA 2GQ8A 4IZGA 3T78A 3K13A 1FP8A 2Z6IA 3BZJA 1XLLA 4LUJA 3UXLA 3O06A 4L80A 3WL1A 4H9TA 4C6JA 1E5NA 2FMNA 3OZPA 4CN6A 4AZ7A 3BAJA 1E51A 2HDJA 2WO5A 3WF4A 1H61A 5IRPA 2HSAA 1JPDX 3NQMA 4HHMA 4E4UA 1YKWA 3WMBA 2OR2A 4MJMA 4XBJA 3TROA 1PBGA 2GZXA 1GOKA 1UD4A 4K8GA 3UZJA 4JS3A 3SDOA 1GEHA 1JAEA 1H7WA 3GDKA 2OX1A 4EAMA 4PB4A 4NI3A 3L65A 2NVAA 4GINA 1G94A 3S1WA 2FH6A 3LGGA 1QAPA 3AWOA 1EDTA 2CBIA 1XH1A 1PX4A 2V5KA 1QNRA 2YBUA 4GI9A 4JQ1A 1OFPA 2CLFA 3MI6A 4PUNA 3EWUA 3NEVA 7REQB 1UKQA 3S1XA 1W1IE 4DF2A 4FS9A 2E3ZA 1OYAA 2UY3A 5DF0A 1GCYA 1UWAA 4IWWA 1KRCC 4QE1A 2XVLA 3GYEA 2EJAA 1N7KA 4CGTA 3M0HA 3UYCA 1UHVA 3WNKA 1NARA 1KBIA 2QLYA 2ISVA 2Y4SA 2HJPA 3M43A 3CMFA 1XRSA 4HMCA 3ZOAA 5M3WA 4UTJA 2RFGA 4PBEA 1U1JA 4XQ6A 4DI9A 1JDFA 4BWLA 1M65A 1OCQA 2CZFA 1YTDA 4Q8NA 4J27A 4HN8A 2CFFA 3CV2A 2Y5SA 4MZ1A 4Y9MA 3M16A 5C9WA 4UFLA 4DWSB 3M7WA 4ZMGA 4PEEA 1S2TA 1TPDA 1HNYA 3C6CA 3V0SA 4AIEA 3FXYA 4W5ZA 3OA3A 4MOZA 2YDAA 5DY2A 2OOGA 1P0BA 4OBRA 1EDGA 4JCMA 1G7UA 2QCDB 4B4HA 1TE1A 1PJ9A 3EKGA 4U2YA 4A8LA 3U2EA 1GVRA 1W1A1 3KOWA 3WBAA 4DBSA 5G5IA 4UTLA 4NAFA 5A2AA 4UOJA 3E2SA 4QISA 1P0NA 3P7YA 5C54A 4JTUA 3SRFA 3LERA 3SCWA 2XFWA 1ISYA 2C14A 3WD1A 1A5KC 1EGZA 2ZWYA 4GO9A 3LCLA 1S39A 1Y5VA 2NQHA 5G1YA 1P6CA 1Q2RA 2INZA 1UR1A 3W2NA 2C18A 4JKKA 4JN6A 3IVUA 1ALDA 2WJDA 1K8XA 3H4GA 2E5DA 4DO5A 3W22A 3EX3A 4M6UA 3KCJA 2DZTA 3W83A 1V5XA 3IJ7A 4UZUA 3OG2A 5DELA 2OCZA 4IOTA 4JNZA 4ZZ9A 2GWNA 1NDZA 1GQIA 2PF0A 3TA6A 3RU6A 1KM4A 3TK7A 4IPJA 4Q33A 2BY1A 3SGUA 4F66A 4UCGA 1UOKA 1QWKA 4DJEA 3VMNA 2ZVRA 4S3EA 4Q8UA 2NWRA 3G0UA 4RZBA 4PL2A 4RL3A 2AMXA 3HA1A 4F0LA 4LPCA 1AD4A 3LI1A 1PAMA 1UOZA 2V5DA 7TAAA 1MEWA 1ZPTA 4H19A 1Q13A 4IPNB 2O0TA 4INFA 4YHGA 3VNJA 3QSRA 4M5PA 2WPGA 3SUUA 1Q7QA 1FWWA 2CZ5A 1EFZA 3KLKA 4QE5A 2E6FA 4PZVA 1TQXA 3TQ0A 4NY2A 4UR8A 3RCNA 4Y8EA 4CN4A 1UP3A 4NKCA 1LOLA 2UV8G 3NO1A 3V5OA 1OM0A 1AG1O 2QMKA 2ABBA 1WE5A 2R14A 4RJEA 1HN1A 3GG7A 2OEJA 2CLEA 1BWKA 5CPNA 4MB5A 3S0CA 4BJHA 4C6DA 3L4TA 1QOQA 1TV8A 2ZKMX 3RITA 1PWMA 5DT7A 4HMNA 1NJJA 1SJAA 1BPLB 3KVMA 3NPUA 8A3HA 5C2CA 2HE5A 3PUGA 1EBGA 1QW9A 4QFUA 2FZ8A 4DNMA 3UZXA 3U2OA 1MDRA 1QU4A 4RCXA 3ITTA 4RPPA 4YJ5A 6TAAA 4X0NA 2HEJA 5CSYA 2ATMA 3GK0A 5D33A 2YCJA 2XH7A 4TR9A 1CPUA 1WUEA 3HB9A 2QT3A 2BGSA 1BF6A 4KRTA 4B5NA 2EF9A 3AZSA 2V5CA 4DPPA 3EOLA 4J3VA 4UQDA 3GG1A 4NRSA 3MSGA 3UETA 2XIOA 3PZMA 1ONEA 2OQHA 1W9UA 1UIOA 4JTKA 4CD7A 3EX2A 2CZVA 2P10A 3RAOA 2WKJA 3MUCA 5J5RA 3ARYA 4QSFA 4OWGA 1ZBKA 1HQTA 3W7RA 4C7DA 3BUVA 4DHGA 4E4FA 2QV4A 1WOAA 3KWSA 1XLBA 5F2LA 1UD2A 1MEHA 4Y8FA 3T2OA 2VVSA 5FJTA 4Z0JA 3LB0A 3DU0A 3MVTA 3I6RA 2EO7A 3JUGA 2JGYA 4JYDA 5A2CA 1CWYA 3TXVA 8XIAA 4UOZA 1YXYA 4QSHA 4GYPA 7TIMA 2WBGA 1W32A 1B3ZA 2WSKA 3QYQA 3W6LA 4GVGA 4IICA 3SCRA 1NEYA 2NQZA 3WLOA 2ONEA 3ZWSA 1QFEA 3VC6A 2RDUA 5TQLA 6XIMA 3FVDA 2Y89A 1HT6A 2QAPA 1IWPA 1GONA 1IZKA 5D2YA 3TTSA 1JZ7A 3O05A 4HZ6A 1OX4A 1GQNA 1UYQA 1AJ2A 1XBZA 1YLVA 1UB3A 1QPOA 2PAJA 1EJUC 3ZJKA 1TB3A 2A7PA 2Z27A 4QNWA 3FJNA 1ZS2A 1HZYA 3WDPP 3ZLFA 4QIUA 5BRPA 2BG5A 1R38A 5HPCA 5CPQA 3BWWA 3C56A 3IV8A 3GTNA 2JKAA 2ICSA 3G24A 4BEQA 5CBJA 3WQ5A 1F73A 1GVQA 2DIEA 2NUXA 1LOSA 3RHGA 4ML4A 2XN0A 3GB6A 1KRMA 1SZNA 3HBLA 3GTFA 4WVXA 4F48A 4AZGA 1RCOB 3P2VA 1ZNNA 2QDGA 3V35A 1RQBA 2Z24A 1S2VA 1E3ZA 3GHSA 4JYEA 4UR9A 3JR2A 2VURA 3BZGA 2W0UA 3LCGA 4IP7A 2E6AA 1QPNA 4JR5A 5MHBA 4QG6A 1OABA 4FF5A 3VOFA 4NRRA 1CI1A 2BFGA 4AWSA 3AXKA 1CGTA 2YJQA 4IMFA 3U7BA 1MUMA 1QK2A 2QUMA 3TCEA 3HGJA 2R8WA 1NH6A 1RQHA 4NJKA 4HPGA 3P8IA 3WLTA 3VIJA 4LVFA 3DYPA 2P8BA 4L4PA 2D2JA 2QF7A 2HNHA 3O6YX 1O6IA 1ZENA 3EWBX 1QUMA 1B4EA 4GH3A 3B0UX 2FVMA 3DAQA 2F6KA 2NSOA 4ASTA 2BSLA 4LRSA 3RCYA 3ZS4A 1QO2A 3MA8A 3P5YA 2OGYA 4KWUA 3GKFA 4LOCA 2QUTA 2WQPA 5DBTA 5F1UA 1E6ZA 3CHCA 3BCDA 4HPNA 4JTRA 1OG6A 1XDLA 1CB2A 3T8LA 4IFKB 2WVUA 4E6MA 1CDGA 3LSCA 1Q6LA 3IUHA 1J11A 2VD8A 4XTDA 4L9YA 3ITLA 3L0GA 3NL6A 2FIQA 2Z6JA 2OJPA 1MYRA 4GXWA 3CLMA 1XLDA 5K4XA 1O5QA 3DFTA 4XBSA 2NLIA 4H7CA 3HZ3A 3U48A 5G1TA 3TSBA 1V6YA 2AQOA 4LV4A 1XRVA 3VZZA 4KWVA 3QGAC 1OFAA 4ZE4A 1LUCA 3QZAA 3P0XA 3RDKA 4UQCA 1MFUA 4OOZA 1EIXA 4LUYA 1S2UA 1ME7A 1EGMA 4LF1A 1K8CA 4PUUA 3VGDA 3S42A 3B9EA 2F38A 4AIUA 4IIGA 3S2MA 4E3TA 5MKGB 3UESA 3AMKA 1XSJA 1DXFA 2YLLA 3T09A 4KFNA 3ES8A 1FWJC 3UR2A 4C6CA 1KTBA 1L2UA 3R43A 3VM5A 2OPJA 1I4NA 2WM0A 3FJ4A 3UW6A 1SO4A 4NZJA 3UA3A 4IHCA 3H2FA 1KXVA 4ZVJA 1XGDA 1CB7B 3R2GA 4O10A 3LENA 3IJ8A 3EA1A 3PAJA 1KBKA 2E5BA 2WC4A 1VBGA 2HWGA 1R9XA 5K7JA 3DX5A 4KW2A 4OJYA 1HKMA 3GG0A 3UA4A 1JRBA 2FFCA 3WX7A 4CLMA 3KZSA 1JPIA 1XD0A 4UXDA 1GJWA 3GTHA 2XUCA 3MMUA 1DJWA 1UQYA 4BQ5A 1WOBA 3G2GA 2GUBA 4XIAA 1ADOA 4LAOA 3G1VA 1TJ1A 3AS2A 4HB7A 1KM3A 3A4JA 4Y2WA 4YIWA 4GY0A 3COTA 4I90A 3PG8A 4LUSB 3MUXA 2E1DA 4G6CA 5MF5A 2EPKX 1L2QA 2X41A 1LYXA 3AIVA 1GVIA 5EY5A 3V1PA 2WCSA 1KM2A 1VPQA 4GQGA 3F4WA 2BY3A 1V93A 4DELA 4XO6A 2DSUA 1CW2A 3B06A 1K9DA 4HNLA 4LYPA 1GKPA 3W7LA 1A3XA 3W81A 1ZBVA 4M3PA 4LVDA 2B4GA 3UZZA 1PKMA 3VX1A 1UR3M 3VTRA 1FH8A 2F2KA 3IGXA 5LA2A 2B7PA 3UG5A 3UF9A 3SADA 5EMUA 3UXKA 5EMMA 1HJWA 3UZ5A 4KGJA 4UZSA 2EPMX 3ATZA 3USZA 4GUHA 1V6WA 3T0DA 1TTPA 4JY8A 1E6PA 3AHTA 4XSMA 3C8FA 1Z89A 1OGSA 4RE2A 5AHLA 3WJZA 2PB1A 3LLXA 3TE9A 1FWFC 5D37A 2CU0A 5J04A 4FXRA 4C6OA 4LCRA 3O0FA 1VFMA 1VPXA 7ENLA 4BQ4A 3ZIZA 3BVJA 2XVGA 2CC0A 2PDXA 1MUWA 1UWRA 1DTNA 3QGVA 3G22A 5A1AA 5DN1A 4V2XA 3R58A 2B0MA 1X6NA 1NDYA 4BEUA 1E4MM 3IAQA 5KZ6A 1GUVA 1QPKA 5I09A 3TQKA 3NXFA 1K6AA 2OWXA 1BTCA 2QQ6A 3FYYA 1UKTA 3DHUA 4PN2A 1TVPA 3DKLA 4D9PA 2J7GA 3AO0A 5A6LA 1TPB1 1P6WA 1SO3A 2VXNA 3ALGA 4DF0A 4AZCA 2CLHA 3OZYA 2IQTA 1IXOA 4NNBA 3M0VA 4Y9NA 1CLKA 1XCWA 2WKGA 3BJFA 4URIA 2A6LA 2OQYA 3MWAA 4PA8A 4HT3A 5EMJA 3RXZA 3TZNA 4PMUA 4TV6A 2ZVIA 5AFDA 1REQA 3UBPC 2WVVA 1DIDA 1O68A 1VHNA 4PGLA 4FNUA 3N1AA 1WUFA 4MUZA 5AC7A 3UZYA 3CQIA 3QF0A 2HNEA 4IM4A 4C6EA 3ZJ7A 2OSWA 3BDKA 1VFSA 3CUIA 1BKSA 5A8PA 3H7UA 4QJ1A 4ALDA 3DI1A 1Q6DA 1JZ6A 4PMYA 3TSDA 1W5MA 2W91A 4KESA 2Y85A 4L61A 3FGCA 3IUIA 2J7FA 5CZSA 2AQWA 5CZKA 3L0KA 1SSDA 1XRTA 5ECUA 1O1HA 4LUIA 2PRLA 2UY5A 5HMEA 3UJFA 3E0VA 1CGYA 2GSJA 1O4UA 2JQXA 3P81A 3R8RA 4PFHA 4XZMX 3N13A 2EXOA 4MPQA 2G8ZA 4OQVA 4MPKA 3PAOA 5A6MA 4TX9A 1UP0A 3DN5A 3WQPA 4WZHA 4JX6A 3ZQ9A 5CH9A 3WZ0E 4UBPC 1IEQA 3BOFA 1GVFA 4MWAE 5H8UA 2Y24A 5CC7A 3LM7A 3RILA 4M1BA 4JTAA 2PDHA 3M0JA 2C15A 4GUFA 1N8WA 4K7YA 4DWSD 3CUJA 3OOQA 1OF6A 1LWIA 4IMGA 4US5D 2C3ZA 2YLAA 4UFJA 1XKYA 4FNQA 2V2HA 4E5TA 2GGIA 2Y7GA 1SW3A 1JZ8A 1Q63A 3WLQA 3G1RA 1V4YA 3ZXWA 3QOMA 3SZ8A 3W3OA 5M2FX 5A69A 4EPBC 3PNZA 4EVZA 3WH7A 1JUKA 5IXEA 2L5HA 5GPRA 2WBKA 2D0HA 5M17A 4DWDA 1NDWA 1EB3A 3MO4A 4C1NB 5GNXA 4RW3A 2C91A 4MFDA 3CAWA 1K02A 3W37A 2NV1A 1VZWA 4GNVA 3BLLA 5FI8A 1OQFA 1RJRA 3ME3A 1E6RA 3UVAA 4G8TA 2OYMA 4LTSA 4IFRA 3FKKA 1H1ZA 1GGOA 2DZSA 2WLZA 4C6FA 1QI3A 1HW6A 1VPYA 4XKYA 1XDMA 3EA3A 1Z9AA 1C8VA 3DFYA 1PV8A 1QO5A 5CEWA 1TJ0A 3HG4A 3DXIA 1LROA 3NZQA 2WYSA 1VYPX 3E0FA 2GVJA 3RF9A 1HGWA 4ICNA 2E9BA 1MDLA 3PPGA 1NSJA 4GZEA 3E0IA 1JPHA 4YS1A 1QHZA 2H8XA 4E8CA 3AIQA 3TSMA 2FZDA 3W86A 4RDZA 1TYGA 3NGFA 4ZR8A 5ABEA 1JAKA 2PRHA 4L5ZA 1H1YA 2BX7A 3RO6A 1EH9A 2BNJA 3MYOA 4O4WA 3PJUA 1JDEA 3Q65A 3PWAA 2QDDA 1W9DM 3CZJA 3V16A 4ZBCA 5EMKA 1BXCA 1H63A 1E6QM 1B9BA 3MWCA 2V30A 3H2MA 5DANA 2HK1A 1FHUA 2HS8A 2CZDA 1GVEA 3WNOA 3RLVA 1FHDA 2GDQA 4H2HA 2CBVA 4CVUA 3EOEA 3MHUA 1VJIA 5HWJA 2YIHA 2XGIA 3QQ0A 2WLYA 3C5QA 4A22A 3HPSA 3QW4B 4LW7A 1YTKA 1XC4A 5HR6A 4PTDA 5DMNA 1EA0A 5CJ5A 4WSJA 4WDTA 2PSNA 1F05A 4PEKA 1P7TA 4TX8A 4HSOA 4NT0A 3M5YA 5T26A 1O95A 1BWVA 3CHVA 1LG1A 1VR6A 4HU8A 3KZPA 4HK5A 4GWEA 4JIRA 2Z1BA 1B4KA 3ARZA 3KW3A 3R11A 2PC8A 1B0IA 3NPXA 5EFDA 2QCHA 1VP5A 3TLLA 3OIHA 5AB3A 3N9SA 3O0KA 4JBRA 3ELFA 4YLWA 2C16A 4HK7A 5H2ZA 5HNUA 3WBEA 4QAIA 4KQNA 4O0KA 1ZCCA 1OX4B 1FY6A 4G1KA 5AYYA 4NZ5A 3G3DA 2PDWA 4C7FA 3AIWA 1K4HA 3DHPA 3WLJA 2J6XA 4NL1A 1EP2A 2V2DA 4O12A 3VNYA 1ME8A 3SY1A 2VM8A 3O63A 2CEQA 1NWSA 4P8WA 2XVPA 3C0QA 5SWUA 4BHYA 3B97A 4EXQA 4JYFA 3IANA 1J18A 4FLOA 2J7HA 3VPLA 5ECVA 4PBGA 5F4XA 5E70A 3VVGA 3GW0A 3AUOA 1RY8A 3C2OA 3NQDA 4RE3A 3H2NA 1XLCA 2ZOXA 3NL5A 3P14A 4U31A 4NQ1A 2VYOA 3N2BA 2H9AB 2ZUUA 5FEXA 1WZMA 1DXEA 4DBWA 2QCFA 4JFWA 4Z1DA 5HK4A 3B4UA 3MKCA 3TJ4A 4N0RA 5AC4A 5T91A 4JEQA 4I7VA 3VGBA 3BW2A 2V63A 1WZKA 4HOZA 1A5AA 3GG8A 4LUTB 5EFFA 3K8KA 1A49A 1P0EA 4Y9AA 4JHMA 2ZXAA 3SIMA 2H90A 4GYJA 1GEQA 3M7SA 1NQKA 1ZALA 4WJXA 4M81A 1N82A 3DHFA 1MQQA 1R30A 2R1LA 3BQ5A 2GDUA 4O18A 3A5VA 3WDRA 2ZX5A 4IIEA 3AIEA 4BY3A 3SUTA 5I3FA 1XI3A 1S3TC 4GFSA 4B5WA 3MUAA 2HXTA 1LTDA 2ZUMA 3B8SA 3E96A 1VBRA 2DIJA 5E5CA 4XVEA 5TBOA 1Q7MA 1M7PA 1J2WA 5ENLA 2QR6A 5IBXA 2WNZA 3WL0A 4AMAA 3E12A 4V15A 3NFUA 3MB9A 1JYWA 5FKYA 2HVMA 1L0PA 4NAEA 2ATSA 4ZTXA 2UBPC 1VLIA 2VOTA 4DN1A 1UC5A 3KAOA 6ENLA 2XSBA 1ITQA 1RD6A 4S2CA 4LYKA 2RUSA 3EMQA 1TTJA 3ZM8A 4PMZA 2C8NA 1LBMA 2EPLX 2PUZA 3NDYA 4R5EA 4P8XA 3DECA 3BAXA 1PTAA 4TIMA 1D2KA 5EKYA 2NWSA 1CZ1A 3QH2A 4J3XA 1K6WA 1DIKA 3WK1A 1GVSA 1R3YA 4CNTA 2CYGA 1JR1A 3O2LA 4RZ6A 2BODX 4S2BA 3SR7A 4FIRA 1Z7AA 3BPWA 2ISSA 3EWDA 3YPIA 4ICMA 5FD0A 1FWAC 3OVQA 5JBFA 2FMOA 4O1CA 5KSWA 2FB3A 4FNRA 4M80A 4X2RA 3TQPA 4TXEA 1E4IA 4IPIA 1H4PA 3CAKA 3A4WA 3SRKA 2DV0A 3TW7A 4A3QA 3IIZA 1SM9A 4CD6A 3A4XA 7PTDA 4M51A 3WDIA 3C0SA 4R9XA 3NCOA 3O1NA 1ZUAX 3WY1A 1MQRA 2Q6ZA 5H6HA 2ODOA 3LLDA 5HJXA 4K8EA 3POHA 2XIJA 3VZXA 4UNKA 4KIRA 1E56A 1B9ZA 1SJCA 3IAPA 4GFIA 4JEJA 5G2HA 1QNQA 4ZO6A 4G7FA 3H7RA 3W88A 2E25A 1F6KA 1NOFA 3CC1A 3W7QA 3MC5A 1ZP3A 1HTIA 4OT7A 4CU6A 3W00A 4D6EA 4JGDA 1J0JA 3NQEA 3JS3A 4D6JA 3QYSA 1P4CA 4JD4A 4ZOAA 2D2HA 4TTGA 3PF3A 4L4LA 1L8NA 3M0YA 1H09A 3UJ2A 4DY1A 3S1VA 2RJGA 1A5SA 4H8HA 2ZX7A 4W4QA 1CYGA 1PS9A 3QV7A 1KLYA 1J0KA 2OLHA 2YL6A 4WOQA 1VCGA 3UWZA 3N15A 3W1UA 2G4FA 3MANA 1TSIA 4NG3A 4NXSA 1TWSA 4HIBA 1TJ2A 2E77A 3CUHA 3BMXA 3LX9A 3T40A 3W2UA 3BLKA 2BY0A 1A5NC 4B3LA 4FF7A 3VILA 1VJZA 3PZQA 1JQVA 4UTKA 2HXUA 4XAYA 4S1FA 5BU6A 1OT2A 5GNZA 4IG2A 2CITA 3MQTA 2XPKA 2O7QA 3W84A 2F61A 1YMYA 1E6XM 3FHQA 3AYRA 4L65A 2OQLA 2NX1A 3T0TA 1MUCA 1NTHA 3N2XA 1X1NA 2X8RA 5D2WA 1O1ZA 1P1XA 1R3SA 2GYIA 2EBNA 3GFZA 4LH8A 4MZ8A 4AW7A 3KBSA 2PS2A 4CU8A 1G7VA 1H0IA 2BHUA 1OGGA 4H9UA 3ZZ1A 1TREA 3WJXA 4LY8A 1FHLA 2QKFA 1QWGA 2NQ9A 3AZRA 4X63A 4UTTA 4G7EA 3Q45A 2W27A 1DIOA 3OVGA 3G0XA 1NIUA 4FPSA 2DY3A 3UG4A 4DI8A 3U2ZA 1DJQA 3OW1A 1SR0A 2J27A 2WHKA 7XIMA 1BRLA 4MJ4A 1V6TA 3GVWA 2ZXDA 3EPMA 4ZB0A 3RYSA 1ZAJA 1FWSA 1AMYA 5D4YA 2AAMA 3EA2A 3UG8A 3EEZA 1FVPA 3AXIA 3UNDA 4U28A 1GPFA 3W6YA 2Z1WA 1F4AA 2GJXB 2J78A 3CYJA 3PR2A 1HX0A 2ZUWA 4KFPA 4DM1A 6TIMA 3A23A 1RBLA 1XIIA