3IJ6A

Crystal structure of an uncharacterized metal-dependent hydrolase from lactobacillus acidophilus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
303
structure length
303
Chain Sequence
b'LTKIDAYAHILPAKYYQKMLSVEPNIPNMFPFIKIKTLMDLDERLTKWPDQNTKQVISLANISPEDFTDSKTSAELCQSANEELSNLVDQHPGKFAGAVAILPMNNIESACKVISSIKDDENLVGAQIFTRHLGKSIADKEFRPVLAQAAKLHVPLWMHPVFDARKPDNNLVFSWEYELSQAMLQLVQSDLFQDYPNLKILVHHAGAMVPFFSGRIDHILDEKHAQDFKKFYVDTAILGNTPALQLAIDYYGIDHVLFGTDAPFAVMPSGADQIITQAINDLTISDKDKQKIFHDNYYSLIKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCHARACTERIZED METAL-DEPENDENT HYDROLASE
publication title CRYSTAL STRUCTURE OF AN UNCHARACTERIZED METAL-DEPENDENT HYDROLASE FROM Lactobacillus acidopphilus
rcsb
source organism Lactobacillus acidophilus
molecule tags Hydrolase
total genus 103
structure length 303
sequence length 303
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3ij6A00
2R1KA 4DIAA 3ICJA 2E25A 3DCPA 4XD3A 2R1NA 4WVXA 3TN6A 4PE8A 1PSCA 2E1WA 2DVXA 4DI9A 1UIPA 1E9YB 1RJRA 3URBA 4EPKA 3O7UA 1EF2A 4KEUA 3IACA 1BF6A 2VR2A 3T1GA 3FDGA 2G3FA 1POKA 4V1XA 3WMLA 4ERAA 1V51A 2PGFA 4M51A 1RK6A 1P1MA 1FWEC 2BGNE 4MUPA 3PNUA 1KRAC 2HNHA 3B0XA 4AQLA 4V1YA 4KQNA 4INFA 3WYZA 4IFKA 2Z4GA 4F0RA 1RJQA 3QY8A 1FWAC 1V77A 1ZZMA 1YNYA 1EJTC 4QSFA 3MDWA 1K1DA 2CZVA 4WGXA 4QTGA 4QS6A 3RYSA 2Q01A 5FSEC 2GWNA 1A5OC 2FVMA 3A3WA 2Y1HA 4LFYA 2QS8A 2Z27A 3T8LA 3E74A 2R1LA 4KETA 3F2BA 4DZHA 1KRBC 3MSRA 2UZ9A 5E5CA 2DVUA 3LSBA 1RJPA 3NURA 3OU8A 4R88A 2ICSA 4XAZA 4IFKB 3WZ0E 4IQJA 1EJRC 4PCPA 4CNSA 4GY7A 1DPMA 4IFRA 1NDYA 1M7JA 2OOFA 4EPBC 4XD4A 1EJVC 3LA4A 4KESA 3A3XA 4IGNA 4J5NA 1W1IE 3TN4A 2WJDA 1POJA 2OODA 4TQTA 1PTAA 4LEFA 1FWIC 4PCNA 3GTHA 3O0FA 2YZ5A 4GXWA 3UR5A 4GYFA 2HBXA 2D2GA 3ORWA 1P6BA 3GU2A 4H9UA 1P6CA 3HM7A 4DNMA 3MDUA 2Z26A 3G77A 4RDWA 4G2DA 3IARA 1FWFC 4KIRA 4J2MA 3B0YA 3UBPC 4I6VA 4L9XA 4XAFA 3IV8A 3IGHX 1EJSC 3LSCA 4LH8A 1S3TC 3URQA 3CAKA 3FDKA 3MKVA 3F2CA 4DLFA 4LAOA 3E0FA 4L6DA 3E3HA 1V7AA 2D2JA 1I0BA 4LANA 2A3LA 3QGKC 1YIXA 2FTWA 1XWYA 4CQDA 3TN3A 2ADAA 3LY0A 1GKQA 3HTWA 4GY0A 3MVIA 2IMRA 4HK5A 3MTWA 4J35A 4H9MA 4C6EA 1EYWA 3E2VA 4XD6A 2BB0A 4C5ZA 4H9VA 4ICMA 1J6OA 3RN6A 2QVNA 4C6MA 3K2GA 3GU9A 3QGAC 4C60A 4XAGA 1KCXA 4IFOA 4BKNA 2UBPC 1UMLA 4GK8A 3CJPA 2VHLA 3PNZA 4C6CA 4UB9A 5LXXA 4NI8A 2ANUA 2AMXA 3K5XA 2EG7A 4QS5A 4PBEA 1FWCC 1WXYA 3GTFA 2QPXA 4EPEC 3R0DA 4LAMA 4XD5A 1ADDA 3LNPA 2ZC1A 4ZSTA 2FTYA 3ISIX 3F2DA 2VUNA 4C6NA 4C6BA 4C6LA 1GKPA 3GIQA 1NDZA 4R7WA 3GIPA 4F0SA 1A5NC 4RDVA 3URNA 4KERA 4H9ZA 2XIOA 1J79A 5AKQA 3NEHA 2GZXA 4H00A 3HPAA 3S2JA 2YB4A 2Z2BA 2WM1A 2YB1A 3FEQA 3SFWA 1HZYA 3E0LA 4GOAA 4RDZA 4DI8A 3S2NA 3MVTA 3LS9A 2FVKA 4DZIA 1YMYA 2AQVA 3IRSA 1FWJC 3AU2A 5HMEA 5FSDC 3GRIA 3E38A 3ITCA 4KEZA 4DLMA 4ERIA 2HBVA 4HK6A 1O5RA 1RK5A 2Q09A 5HMFA 1A4LA 4CEUC 3UPMA 1EJXC 2Z2AA 4OFCA 3GUWA 1JGMA 1M68A 4RE0A 4LALA 3F4DA 2Z28A 4B3ZA 1XRFA 4GX8A 1A5KC 2OQLA 3LU2A 1KRCC 2WJFA 4C6PA 4B92A 4LCSA 4BJHA 4IF2A 1V79A 1IE7C 1QW7A 4IH3A 1M65A 2RAGA 3IJ6A 3S2MA 3BE7A 2Z25A 3PAOA 3S4TA 3MPGA 3PBMA 4G7EA 2Z7GA 4DO7A 3MJMA 1K70A 1NDVA 2Z29A 3ID7A 2HQAA 4QROA 2VC7A 4H9XA 4B91A 3QY7A 4C6QA 3AU6A 4DYKA 1YRRA 4C6FA 4LCQA 1RA5A 2P50A 4LAKA 3EGJA 3SO7A 2DVTA 4XAYA 4LCRA 2PUZA 1VFLA 3TNBA 4JOMA 1FWBC 3A4JA 4P5UA 4RDYA 4Z42C 4KEVA 4GBDA 4G7EB 3KM8A 1KRMA 3IPWA 4B90A 1ITUA 2GWGA 5HMDA 1XGEA 3RCMA 3S2LA 4UBPC 2I5GA 2PAJA 4C65A 1ONXA 3PANA 2Z00A 1NDWA 2PLMA 5CH9A 2O4QA 3GG7A 4C5YA 2VM8A 1EZ2A 1EJWC 3C86A 4NG3A 3DUGA 1A5MC 4C6IA 1FWHC 1WXZA 3OOQA 2OB3A 4BY3A 4CNTA 4F0LA 2I9UA 4E3TA 3QY6A 3AUOA 1J5SA 1A5LC 2O4MA 4YIWA 1R9ZA 5G4HC 1E9ZB 4QRNA 3JZEA 4NP7A 1RAKA 3TN5A 3OQEA 4C6KA 4IG2A 1J6PA 4HA0A 4C6DA 4WHBA 1UIOA 4C6OA 3URAA 1ONWA 2FFIA 2AQOA 3GTXA 1K6WA 2Z24A 3V7PA 1FWDC 3DC8A 2KAUC 3OODA 4KF1A 2GSEA 2EG6A 2P53A 1FKWA 3LGGA 1QXLA 2HPMA 1PO9A 2OGJA 4EP8C 3NQBA 2QT3A 4ZSUA 1NFGA 1A4MA 2F6KA 4AC7C 4CQBA 3UF9A 4CNUA 1YBQA 2PGRA 2R1PA 4IG2B 4IGMA 4I6KA 2VC5A 1XRTA 3CS2A 1PB0A 4C6JA 1UBPC 3F4CA 1O12A 2EG8A 4GY1A 3LGDA 4R85A 4ERGA 3OVGA 4H9TA 4PBFA 1ITQA 2YXOA 4CEXC 2WJEA 3OJGA 1FKXA 2D2HA 4H9YA 1I0DA 3UR2A 3N2CA 2GOKA 1GKRA 3K4WA 4RZBA 2HPIA 4GZ7A 1V4YA 4HK7A 5A6TC 1YBQB 3GU1A 1FWGC 4GX9A 1EJUC 2R1MA 3GTIA 4CQCA 2W9MA 3D6NA 3EWCA 3B40A 3RHGA 1R9YA 4D8LA 3T81A 1R9XA 4GC3A 4EPDC 3EWDA 1RA0A 4HJWA 4H01A
chains in the Genus database with same CATH superfamily
2R1KA 3IJQA 3GLCA 4O1BA 1R85A 3CH0A 4GMEA 2R1NA 5HNNA 4J27A 1TZ7A 3NDYA 4M56A 4W85A 4Z2IA 2DVXA 2NX1A 4GE8A 3FLUA 2PDPA 2DSVA 4WGHA 2EKGA 1WZAA 3DYMA 1G9HA 2G3FA 5DY3A 1V51A 1OCBA 3UWEA 4AHPA 1XRSA 1P1MA 4MUPA 1FP8A 6A3HA 3PK7A 4NKCA 2IW0A 2ACSA 1P0KA 1M53A 2W67A 3UJSA 5LA1A 5FI8A 4F4RA 2QZRA 3LPGA 3UA3A 3O07A 4DNHA 4D6FA 3WD4A 4XZHA 3W88A 1DTUA 4CNPA 3E6EA 1JZ8A 1FCQA 2DY3A 3HGJA 3LEPA 3P93A 2AKMA 1A5OC 1BTCA 3EOEA 1ZCCA 1I2PA 4UTUA 4BS0A 4WDXA 4JAWA 3F2BA 1DJNA 1BHGA 3N19B 1KCZA 4OBSA 3W38A 4H3DA 4DN1A 4NAFA 4CNSA 4LW7A 3VGFA 1KXQA 1E0TA 1E1FA 4FIQA 5LA0A 4F79A 1C8VA 1MRAA 1PTDA 2OODA 2E4TA 2PDLA 4V33A 1PTAA 2REQB 1LF1A 4AHQA 4EX4A 3EX3A 4BFAA 1FXQA 4K8HA 2HDJA 5A6MA 1GVIA 4XUYA 3RFAA 1XH1A 3LXBA 3EA1A 1P6WA 2QJNA 3BCDA 4BQ4A 4GH3A 4W4QA 4OE7A 4QP0A 1F8MA 3BAIA 3LSCA 3A21A 3UYIA 3RM9A 1LOQA 3H4XA 3VZZA 3WJXA 4IGHA 2DZTA 2GJXA 1AH0A 4JHZA 4CD8A 3BXWA 4HT3A 2E68A 2YBTA 3GDTA 3A5VA 1CZ1A 4Q32A 2FTWA 4NAEB 4GY0A 2OLSA 3SCWA 4QG9A 4HK5A 3E2QA 1TV2A 3ZLFA 3TC7A 2DZWA 1UPPA 4U33A 1HVXA 3DKLA 1DTNA 1Y5WA 5FCZA 4KFOA 4D8ZA 4D1IA 1HO1A 5G2WA 1RALA 1YHTA 1I75A 1EKOA 2BZNA 2XH0A 3AUJA 4BF9A 4DF0A 4WY0B 4HNNA 2YL8A 4JQAA 3B9OA 2W62A 1G94A 3VMNA 1GYMA 1A53A 2OR2A 1MEWA 1GHSA 1ZBVA 1IQ8A 4B3LA 4W8LA 3UNTA 2J74A 2OU4A 4BF7A 1ISWA 1S2CA 1W32A 1CDGA 1EA9C 1VC4A 1V8EA 3KLKA 2D69A 1GTHA 1RHCA 2VDGA 2CYGA 1XF0A 3CZEA 2JIEA 2J7EA 1KBBA 2WCSA 5I07A 3UEQA 2GGIA 5I3FA 1Z69A 6ENLA 4UQDA 4DLMA 2FMOA 4ERIA 5AC5A 1ZJIA 2XM2A 1BKHA 2VRKA 5HMFA 1J0YA 5BWFA 4FLOA 4PC8A 4O17A 2YX0A 4MB1A 4HU0A 5HK4A 4LYQA 4MWAD 3S1WA 2ESCA 1OWQA 4JTQA 5FA5A 4LS2A 4IIGA 4DUVA 1B54A 1AL7A 3L4WA 2HCVA 3KWXA 1MW3A 4AY8A 3N73A 5FESA 1Z7AA 1G01A 1XLFA 3AIVA 4M7TA 1LRTA 3PBMA 1NDVA 3K8LA 1K03A 2R14A 3B0PA 1KTCA 3WF4A 4NZ3A 3FNDA 3WD1A 4LCQA 2PC4A 3EOLA 2G50A 2E6AA 2Y7DA 5MKGA 1WAUA 4H8UA 4AVFA 1BLIA 3BSMA 3FJ6A 3E49A 3IIVA 1MI3A 3CAWA 3TMLA 4K36A 3W84A 5F7UA 1OCJA 3VKJA 2NVDA 3VDGA 4P7RA 4AX7A 3S2LA 2I5GA 2BV9A 4IICA 5DT7A 3T44A 1MEIA 3LHTA 4FZIA 1KO0A 5DMMA 3W74A 3NCOA 2PSNA 5CEWA 1U30A 4KWUA 3QC0A 1M01A 5M17A 1GUVA 1C8QA 1EJWC 3VI2A 3VC6A 1QI2A 4PYSA 4ZQNA 3ABRA 4LC6A 2P5NA 4BY3A 1JIBA 2AKZA 2I9UA 3S1GA 2OZ0A 4YIWA 4IMCA 1UUQA 4ROPA 1RAKA 3LLFA 2QHAA 1P4CA 2B7PA 3WLLA 1OVDA 1AK5A 1H7PA 1W9VA 2AQOA 4AYGA 3GW0A 3P14A 3Q65A 3GVQA 4NHVA 2PWGA 5DXYA 5DN1A 3PBVA 2WMIA 3QJAA 5IHSA 4QEHA 4UWMA 1Q6OA 2ISDA 2ZX9A 1ODUA 4OV9A 3WUFA 2OEJA 1KA9F 4XO6A 1UR2A 2VC5A 3E9AA 4UFLA 4GKLA 3WL1A 1XLKA 4JBRA 4PGLA 4NI3A 4F9JA 4LNCA 4IMAA 1EA0A 3R43A 4BEUA 1JCMP 2WYSA 4PRWA 3UP8A 4HHHA 5G5IA 4UOZA 1XLLA 5LHEA 2R1MA 1F61A 3C52A 2D3NA 3G0SA 2RGMA 2B0MA 5CAHA 4CVUA 1X1ZA 1HT6A 3EWDA 4PMOA 5HOSA 3N34A 3BDKA 3SUUA 1J0IA 2C8NA 4D9PA 2XGIA 5EMMA 1J0KA 3BW2A 4LY4A 3CMFA 1N82A 3SQLA 2E6DA 5ABFB 4IUOA 3L5LA 2PDNA 3NG3A 1MO0A 4W88A 4V1XA 2C16A 2GSJA 3TP4A 4YN5A 1NIUA 2E9LA 1TPH1 3TJ4A 3O16A 1CLVA 2QXWA 3B8WA 3KCOA 3R12A 3EMQA 1S2VA 3VDBA 4NL1A 3WYZA 4UIOA 1GG1A 3PN8A 4GUIA 1IGWA 4AIOA 4MKNA 1XBYA 4PUKA 1QHZA 1R3SA 3MUZ1 4J3VA 1V6TA 4QFUA 1TPB1 1YPFA 2WANA 3LHYA 1OFQA 3ARPA 3ARUA 3OG2A 2NQ9A 2Y1HA 3CO8A 2XUCA 1P0NA 5CZSA 1OZQA 3TQ0A 3FJLA 4A3UA 4AZHA 3VOHA 4R5EA 3WQGA 2I16A 5I02A 3QVQA 2QMKA 3RITA 1FDZA 2XPKA 3H2OA 5HULA 3GH7A 3CLMA 3W85A 2QCHA 1DE6A 1E56A 5DF0A 4RKAA 2GQ3A 1WO2A 1B0IA 3S0CA 2Z26A 1V3IA 3VOCA 3SCUA 2C1GA 4V27A 4L9XA 4L1GA 3WENA 4NXKA 1V02E 2NVCA 1QCWA 3RCNA 1J2BA 5C7VA 3N15A 1BXBA 5A6LA 3M0ZA 1ZPTA 2BDQA 5JBEA 7A3HA 4DPQA 3FS2A 3QQ1A 1JCTA 1RVKA 4Q8QA 3GO2A 1QASA 3NO1A 3DHDA 2X8RA 3LCFA 3QGKC 1VPXA 1SSDA 5K9XA 5I6SA 2AMGA 2VOTA 4LUYA 3T0BA 1XC6A 4ZCWA 3CUXA 4A4AA 3UR8A 1CXEA 4HGXA 3OQ8A 1PHQA 1LQ0A 2Q6ZA 3QGAC 4P8XA 3UCDA 1LL4A 1PWLA 2R24A 1OX5A 2V3EA 4DHGA 3K13A 3RM8A 4R9OA 1NQKA 2XIJA 3WQ5A 5D8WA 2F6XA 5I3JA 3HPSA 2VEKA 4MWAB 1ADDA 5FL0A 4MZYA 1UQZA 4MNKA 1W8SA 1XYMA 3ITTA 3TTQA 2VL4A 1L6WA 3GIPA 5CBIA 4KERA 3TFXA 3MSDA 4ADUA 3M64A 2ZUTA 3LHWA 4Q4MA 1Y65A 1UKPA 1HZYA 3E0LA 3VM7A 3G1XA 1IR2A 5AC7A 5BNKA 3CZJA 1O1HA 3TA9A 3AU2A 3NUKA 3ZFHA 1YNQA 2NQZA 2HBVA 3M16A 1WV2A 4EWND 4OUEA 5A6JA 4CU8A 3EPMA 3AIBA 4N42A 3A4WA 1K7XA 3QYSA 4DBUA 1QHOA 3W86A 3LM3A 3C2RA 5AFDA 3CTTA 3G1YA 3W7JA 1ZTVA 5LYRA 3MPGA 3BJSA 1W9DM 3SIZA 2O7QA 3K4AA 4Z08A 4XZIA 1F9CA 4PFMA 1G4PA 4WEVX 4A21A 1F4HA 1UKOA 3VNKA 4HNVA 4Z1AA 1JNEA 4LAKA 1B30A 4LCRA 1CT5A 2F6UA 5ABFA 3KBSA 4B5WA 1XIJA 2HZGA 3U2ZA 2CLPA 4XSLA 3B4UA 3LLXA 2WSYA 4ZB0A 1E72M 4JDBA 3UD6A 3IIPA 3R8HA 4Q3MA 1EDQA 1MW1A 1RBLA 3CIXA 2O0TA 3FVDA 3SJNA 3T7VA 2PAJA 3ITGA 1WP6A 1XBZA 3BAXA 2ZRXA 1M41A 1MXGA 4AW7A 1HUVA 4XUGA 2R82A 1UJPA 4ACZB 1GK8A 3DFHA 4IMGA 1UH4A 1MFUA 2PFHA 2XN0A 4JX4A 1SQ7A 2J9XA 3S2CA 1FDYA 4F0LA 1V0LA 4AD2A 2NXIA 2QGYA 2J27A 3CC1A 3LK6A 3SCOA 1LL6A 2FVLA 1L6SA 4DX3A 4IG2A 1N8FA 4QIUA 4ZOAA 1H63A 3TKFA 2FGLA 1V6YA 3URAA 2X40A 7ODCA 4U3AA 5D38A 1JQVA 1EP2A 1LYXA 3GVGA 2D0HA 4DXXA 2A3AA 1TWSA 2ZE3A 1OZMA 1H7WA 5XIMA 3MKKA 3KTSA 4IXXA 3LDVA 3NQBA 3BPWA 5H6HA 1PPIA 3ARSA 4W7WA 3RLVA 4QNWA 2BVDA 5DXXA 4XQ6A 2VJXA 6ALDA 2J13A 4H04A 5FJJA 1IR1A 4LUTB 5HQLA 4CU7A 3B05A 4ZZ9A 1JDDA 1HXJA 3BV7A 3VINA 1AUSL 1T40A 4CEXC 3WQDA 4H7VA 3CEUA 1GONA 1W2VA 1XD1A 4LV4A 4R27A 4GZ7A 1UASA 1E40A 1W6TA 1MNSA 4HNUA 2DORA 3H26A 4PEEA 3QMSA 1B9BA 2G3MA 4MJZA 3GTIA 1EC8A 1XGZA 3ABSA 1QI0A 4LQ1A 4D8LA 4N4QA 4HSHA 3STCA 3ICJA 4YS1A 4UFHA 3AHYA 1KBKA 4Q22A 3RK8A 4AZ7A 4LU0A 1W1VA 2D0FA 3VGBA 2CLLA 1WKYA 2VCBA 4DB7A 1GQJA 1KM5A 2C79A 2V5BA 3N6JA 2PZNA 4ENLA 1FX6A 3ZT6A 1YTKA 2NT1A 1RK6A 4JX5A 3PNUA 1K7FA 2FZ9A 5HNRA 1F05A 1QJWA 3KBNA 1FH8A 1H61A 5A8QA 5F4SA 2WMKA 4KFPA 3AS1A 2EJAA 4POCA 3TQPA 5JBFA 4CU6A 1SPQA 2Q01A 4WUIA 4ATLA 3WJSA 4O12A 3WJYA 2NQHA 1WAWA 4JTUA 1EGMA 2PE4A 1D8CA 3CIVA 1SFSA 2YDRA 2ICSA 4IQJA 2VEIA 3TR9A 4JIPA 1GVYA 2WJDA 4LF1A 2VDHA 1TYGA 3K1GA 3WK1A 4B5TA 3EKZA 1GJUA 1FWIC 4MAVA 2ISVA 1ZSXA 4DAFA 1K6AA 1CWYA 3NWRA 3U0HA 3KL5A 2J88A 4Q8PA 3AIEA 1VJZA 2GK1A 2VGGA 2Y61A 1E1CA 3OVQA 4LBUA 1EPVA 4A8RA 4TOQA 1KBIA 3KCLA 3T9PA 4OBTA 3FDKA 4LAOA 3PWGA 1EDTA 2YLAA 3NSMA 2O9TA 1X7IA 1TO3A 3QMRA 1IIGA 3AIWA 3WLIA 2OZ3A 2WZMA 5AECA 3N3MA 3ZJ6A 5AHFA 3P80A 1GKQA 1DJQA 4BQ2A 5D9OA 4ACZA 2Y7EA 4UTFA 4GQQA 1M7XA 4JL1A 2QUTA 4ICMA 4BQ3A 2ZBTA 3WDPP 1Y8BA 4MADA 3CGTA 1E15A 5LSMA 4NJGA 4ZXLA 3CJPA 2PP1A 3R5EA 4FIRA 3WDJA 3RRXA 5DRCA 3SJ3A 3W37A 1NTHA 2QCGA 2CLFA 2B7NA 5I3DA 1WXYA 5CZJA 3WX7A 4XD5A 2GVLA 2L5HA 1ZS2A 1H1ZA 1O95A 4A22A 3A9IA 1JPHA 4MZ8A 3VVGA 3VDCA 4C1NB 2E28A 2VVSA 6REQB 4RL3A 3WDIA 3I68A 3VKBA 4KCWA 1D7KA 5DMYA 1FCUA 2YB4A 5FF3A 1I8JA 3AWOA 3DFYA 5A8PA 1SMAA 3XINA 1OD0A 1GCYA 1YMYA 1DWFM 4DJFD 1MDLA 2ZRWA 4NJIA 2CKSA 1YX1A 1O5RA 3N17A 2Y5EA 3TFCA 5FF0A 2VT0A 2P8CA 1TPDA 1L6YA 1SZNA 1N7KA 5K4XA 3F4DA 4B3ZA 1S5TA 4IIDA 3GH4A 1NFPA 4W9TA 3CASA 3S42A 3BLOA 2TYSA 2JFEX 1FWNA 4HD5A 3WD2A 2Y89A 1Q2RA 3RNDA 3KVJA 1BVWA 2RAGA 3FV9A 1QATA 4LWWA 3CPGA 4FF5A 3L0NA 4AH7A 2YGYA 4C6QA 4B9ZA 3UGRA 2G3IA 3LLDA 2VYOA 3FKRA 1RA5A 4IIEA 3UWVA 2PWUA 5C6MA 3MV01 1VPYA 4A05A 1AQMA 1LLWA 3UCQA 3P0WA 5I0DA 3MP4A 1KFKA 2NW0A 3LCLA 3C3NA 2QAPA 1GJWA 4RZ4A 1JF5A 2CWXA 4GKTA 4P7LA 4O0KA 2FTPA 1ZBKA 1GVEA 3WLTA 3MS8A 3D0CA 2JALA 4JTDA 1OY0A 3IRDA 3V4BA 2ONEA 1BD0A 4PMNA 4GIEA 2ZA2A 3MW7A 4C90A 5LIUX 2AGTA 2VFFA 3VIKA 3GKAA 3SY8A 1J12A 3RUBL 5A69A 5BZAA 1Q6RA 4PMYA 5DMNA 1GW9A 2F84A 3V5CA 5AY7A 5D2TA 3W1AA 1LOSA 3MWCA 4FA3A 4BQ5A 4H8VA 5ECVA 4JPGA 4MNMA 5GJPA 1RPKA 2HXTA 2PWFA 2NUXA 1DHKA 4UNIA 2UY2A 3AMGA 2WCGA 3SN1A 4LVFA 4MZ1A 3H2NA 4R9XA 3C8NA 4FAMA 4PSRA 1S5VA 4W89A 3DC8A 3I6TA 2KAUC 4PZVA 3UJRA 5C2GA 3MMWA 3OP2A 2I56A 2HRWA 3QTPA 2DGAA 1W3HA 1N8IA 1CGUA 1XDMA 1PUDA 3SEPA 5EMJA 4US6A 3B9AA 2R1PA 5FIPA 1VYPX 4HPGA 3UXDA 1EXBA 3CS2A 3N2OA 1AQ0A 1V5XA 4DJED 3LGEA 3ZR4A 1I9CB 2Y70A 4MNLA 4ERGA 1VD6A 2RDTA 4YWIA 1I0DA 1XSKA 3N2CA 2EEXA 3GR7A 3K4WA 3VX0A 1V4YA 2W91A 1EEXA 2ZCGA 2WVSA 3RO8A 3AHTA 1YBQB 7REQB 4XVEA 2BOEX 3LMZA 1EL3A 3W4RA 5CPSA 1RUSA 1WXJA 3NEVA 1KGUA 1RA0A 3ARVA 3SCTA 4ZVJA 1UJQA 3T6CA 1IZKA 1GOOA 1W9XA 1W1PA 3DCPA 3S5ZA 4AYSA 1KNWA 3LG3A 4DBEA 2VX4A 4DM2A 2WHMA 1UD8A 4JFUA 3B8DA 4E38A 1BF6A 2PGEA 2VNCA 3LI1A 1RY8A 5BYWA 5BXTA 4X63A 3SURA 4GGBA 1ZENA 4J40A 2BXVA 1RQBA 1TZ9A 3GNPA 4C1NA 4AZCB 1E9LA 4AQLA 5J5DA 6REQA 4DBDA 3I10A 1VZWA 1MXDA 1DV7A 1TR9A 5G4EA 1DP0A 4WGXA 1ZQ5A 1W17A 3RR4A 5D05A 4CD4A 3C61A 3B8VA 1OGBA 1HGWA 1WZKA 1KRBC 5CLTA 3S5SA 3WELA 1PS9A 4Q8UA 3EAUA 1Z42A 1IEIA 3WLOA 3W53A 1DJGA 4PCPA 3C56A 3PZQA 3C5QA 4MJMA 1QK0A 1RY0A 4JQ1A 3FXGA 1W1IE 4KMQA 4MMWA 5E0CA 2FGBA 4NJKA 4Q7BA 1AZ1A 4LEFA 4U5IA 2ZICA 1S46A 4PCNA 1Y7VA 1YYAA 1WDWA 3WK3A 3PZGA 3NL3A 4QQUA 3UXIA 3KZPA 1P6CA 1HKKA 4J3ZA 4PMQA 4XIAA 2GDVA 3W70A 4XAFA 3TAKA 2XVKA 5K4ZA 4IX0A 4PMXA 2GDQA 1X6UA 1FOBA 3WQEA 5TBOA 2WAGA 4ATWA 2H8XA 3URQA 2XN1A 5FEZA 4Z0SA 3WLKX 5A8MA 3HG2A 4KRZA 2V69A 1JR1A 4WDWA 2CZFA 2G5WA 3HGOA 3I3BA 1WBJA 4PTMA 1ZCOA 2A3LA 3L23A 1QNOA 4B5NA 1DXIA 3KRUA 3T55A 2NLYA 1O1ZA 1EYWA 1TPWA 2QW5A 2XZ7A 2VFHA 4H6EA 4AWUA 2V63A 5D03A 1MQRA 2CETA 4XAGA 1F3TA 2ISFA 1YDNA 3EOSA 5BXPA 4J28A 5D2YA 1OADA 2ZZ4A 4XBJA 2HS6A 1DIKA 3I7RA 1OX6A 1E3ZA 1XIDA 2E8ZA 5B7YA 4PFHA 3UA4A 4U2ZA 3K5XA 3FJNA 2V6AA 3U7VA 2J4GA 3CHDA 2DFAA 1R86A 1UD4A 2BX7A 1JNDA 3QRHA 4C6BA 3IIOA 3UZYA 3UVAA 4I8DA 3MUY1 3ARXA 3GIQA 2QDDA 2Y6ZA 3R6IA 4FPSA 3Q58A 4HIBA 4S1FA 3HPAA 4CUCA 1DVJA 4W87A 2YB1A 3W7NA 3I7QA 2GUBA 3D47A 4Z1CA 1Z3NA 3S2NA 4F0KA 4C7GA 3FOKA 4F2BA 5LXEA 3GDBA 5AZ1A 4LYKA 3G8RA 3WQVA 4PB5A 5CPNA 3MYPA 2Z2AA 3P61A 1JYWA 1IZCA 3BICA 2A6LA 1TUFA 2OCZA 2Z28A 3DI1A 3FA3A 1XIBA 2XU2A 4KWVA 7REQA 1ECEA 1LRNA 4QHRA 4HYRA 1V3JA 1DWIM 5IDIA 1KRCC 3CWHA 3GC4A 4HPXA 2PDQA 4V2XA 5BMXA 5CBBA 1KLYA 2WLZA 3H23A 5GNYA 3W00A 3MI6A 3PZVA 2JBMA 1KXVA 2EPNA 1XLCA 4G7EA 3T4WA 1K70A 3LOTA 3EA2A 1C9WA 1HL8A 3IJ9A 3AU6A 1Q6CA 1OYBA 2FJKA 3IJIA 3IK4A 4ZTYA 3WQPA 2YCLB 2C13A 5EYWA 3TXZA 3VK5A 4XAYA 3DZ1A 2J9YA 1BKSA 4P5UA 1Z9AA 3V0SA 1VR6A 1S5WA 1KV8A 2INEA 2ZWYA 1AD4A 2V82A 3RCMA 2YA0A 1YTEA 4M6UA 4DBWA 1BG9A 1N2VA 3KBVA 3RXZA 4JYFA 3NSNA 1BG4A 3W2JA 4EACA 1TQJA 3W87A 3ANVA 4L9ZA 2Z6IA 2RJGA 3L66A 4MLJA 1K4HA 1VBGA 2IUZA 3W6YA 3VAVA 3ZS4A 2G8ZA 2V5DA 1IYXA 2E5BA 5G4HC 2D3LA 1JVNA 1GEHA 1MXSA 3ANYA 3EDDA 5DFAA 1NEYA 4HCHA 4C1KA 2NUWA 4PBGA 3W1PA 4UMBA 4M0XA 4HP5A 2DSZA 2P3ZA 5LIKX 4I9JA 1KFBA 3KOFA 3NDOA 1XGDA 2GSEA 3LCGA 3DC0A 4W5ZA 1QNRA 3LD5A 4RV8A 1VFTA 4YVVA 1RZMA 2J77A 3VMOA 4JTRA 3UPBA 5F2GA 3U2EA 3EWYA 3ZZ1A 4GC4A 4EP8C 1L2UA 4PMVA 5CC3A 5BU6A 4WCJA 4IIBA 5IXEA 4A3RA 4CQBA 1DJYA 1WKEA 4S3JA 2PP3A 4GNJA 3KRSA 3BLEA 3JU2A 3W7IA 1ZU8A 1DQUA 4QBXA 3UZ5A 1UBPC 2NWRA 3G1RA 3TEVA 3S6TA 1LG2A 4DF1A 1BYDA 3M9YA 1X7FA 4PTXA 4RZBA 4H7CA 3WLSA 2WK2A 2WWCA 1PV8A 1EJUC 3H70A 1C8XA 1B3XA 5LNWA 3GSMA 2NT0A 3ANUA 3L5AA 4IJBA 1XIFA 3EB2A 4CQ9A 3N2BA 3EWXA 2XVNA 4XAPA 4J3XA 5I24A 5JXQA 4RNIA 3WLMA 3R0KA 1TPFA 3PJTA 4IM4A 1P43A 4ECLA 4IQEA 3DI0A 4O4VA 3GFXA 2VR2A 1XIHA 2D22A 3M5YA 1DXEA 2NXHA 4Y8EA 1E5JA 5D2VA 1B3WA 4RW3A 4F0RA 3PPGA 3MY9A 5JUVA 3BZJA 2JGYA 5AHMA 1RCOB 4PMJA 3BG9A 4QSFA 1ZJHA 3EOUA 3T07A 3MB9A 1OG0A 2F38A 3PTDA 1ME8A 3HMJG 5IRPA 3A3WA 2ISWA 3PPHA 3PZTA 5H8UA 2TMDA 2TRSA 3S9YA 3G3MA 1ZRQA 2GQ8A 4QX4A 3U8GA 4YHEA 3O15A 2TPSA 2DW7A 4TIMA 5U7SA 1F73A 4UTKA 2PB1A 4IFRA 3FYYA 1JDCA 3M4HA 4Y9PA 2P8BA 1VFHA 2BG5A 1O5QA 4MKVA 4MB3A 4PTVA 1KM4A 3SDOA 3SCNA 2VEPA 1ZALA 1I6NA 4GO8A 3W81A 4AXKA 2D73A 3TMQA 1H5VA 3HGSA 4G2DA 1FWFC 3VIOA 4E4PA 4FXRA 1AODA 3WLPA 4UQBA 4L56A 3PFRA 1MUCA 3ABQA 6TIMA 3MKVA 1LLOA 2GVJA 2CXGA 3WLHA 1UD3A 4JIQA 1W5PA 1V7AA 3TA6A 3TIMA 1EO5A 1UA3A 4D6IA 4GZIA 4N9DA 3RR1A 3SRFA 5CZKA 1VCGA 4YPJA 1WDDA 5AHEA 4E2VA 3GY1A 3HTWA 1PX4A 4N6FA 1D2KA 5A6SA 2QAFA 2YCJA 1T5AA 1M7PA 2F7FA 1H09A 2BB0A 4FB7A 4PMRA 4GYPC 4C6MA 4Q4OA 1XCWA 4WKAA 3GU9A 3A3HA 2WSKA 2W66A 1XLHA 3KOYA 2UBPC 3IGSA 3WKZA 1JYVA 1DE5A 3PNZA 2XVGA 2VFGA 3SRDA 3S9IA 4XTIA 2Y5SA 1JULA 2PU1A 1EO7A 2YBVA 3VZYA 2Y88A 1XYLA 1QWKA 3VIMA 5T26A 4ZSTA 1HP5A 2YYTA 1J0JA 2VUNA 2FZBA 2XISA 1ZL1A 1G6CA 4BA0A 2J79A 4PTWA 3I4EA 4GUGA 1X1NA 4XIMA 5B7ZA 2DJXA 2NXGA 3PPFA 3S2JA 4ZB2A 3W1XA 4X9YA 4YVPA 4FLRA 3ITXA 3Q67A 4LB4A 5MHBA 2OKTA 3DYOA 5BOOA 3THCA 1VJIA 2PDJA 2H9AB 3VD7A 4EANA 5KETA 1RK5A 2DT3A 1QPRA 4CEUC 1EJXC 3EB3A 4OZOA 1NFBA 1JGMA 3PZMA 1QI5A 1R7OA 1XG4A 3PUGA 3WUBA 4US5A 4R53A 1GQKA 1IGSA 1GPFA 2YR1A 3HIJA 4K39A 2VRJA 2NUYA 1UH3A 3SN4A 3W2LA 3B9EA 1JD7A 1M65A 2BHUA 2QR6A 3S2MA 3PTMA 5FJOA 4NYUA 4QM1A 3KHDA 1J01A 2XWDA 4OWGA 4IP7A 5G1TA 1JYNA 3QHOA 3SO7A 4C7FA 4YYFA 2VXNA 4AG0A 1AMYA 5TNVA 4JOMA 1PDYA 4TXEA 3ZMRA 1OFRA 5REQA 4AEOA 1XIMA 1JXKA 5BOEA 3A24A 4FNTA 4XK2A 1MFVA 2V81A 4GYPA 3H2CA 1TX2A 2XFYA 1OD8A 2GJRA 3LCWA 1PE1A 1EYEA 3OO2A 3KDNA 1KR1A 3OIHA 1PX3A 2B31A 3AROA 1X96A 4L80A 3CHCA 3P6LA 1BVNP 4GABA 4NRRA 3LBMA 2PWHA 3GNNA 2OT1A 4B3KA 4GVHA 4PCSA 3W0KA 4O11A 4ZTXA 3LHVA 5HWJA 5E0FA 2YLLA 2DEPA 3QR3A 3DH7A 1PJ9A 1G7UA 1P1XA 3PJUA 3VDAA 4RW5A 1IWPA 4LS1A 1JCNA 3CQKA 1K7EA 3M5ZA 3B3DA 3LYEA 2X1RA 3V0TA 5C2XA 2PRLA 2P53A 2Y7GA 5FEWA 1QXLA 4D6GA 1XR2A 3CWNA 4XV0A 5CBJA 5TF0A 2QT3A 2CLKA 3NQAA 4IHCA 3TLLA 2F6KA 2V3GA 1W5QA 2C0HA 4LF2A 3R11A 3CYJA 2RDXA 5C54A 4DZAA 1Z44A 5AYIA 3W1MA 1RD5A 1V0KA 3VIHA 4BI5A 3IUDA 1HJXA 3L67A 4WJ8A 3PZUA 3VNMA 1RCQA 3FW6A 1FKXA 2QCFA 1FBAA 2J7BA 4JKMA 3WDRA 5D9MA 2ZUWA 2Y8VA 4ILSA 3WBEA 1UZHA 1GOIA 1SFJA 3WUEA 4B15A 4JD4A 3F5LA 1DOSA 1Q85A 3WH6A 2CERA 4GX9A 1OFBA 2VCAA 4I3GA 4CQCA 3ABXA 3T0DA 1UHVA 4AIUA 2EPHA 1ITCA 5JIWA 3N13A 1FVPA 1CW2A 4GA8A 4LNYA 2AOSA 2RGLA 2E25A 3E1F1 4PCFA 1P48A 3B8SA 4NNAA 2IKIA 3VNZA 2YDSA 1ZFJA 5EMYA 2BGQA 2J8GA 4N7QA 3RMEA 4RJEA 1S3HA 5IDZA 2PURA 2PEVA 3IACA 4O4WA 4ZQRA 4F2TA 2BGNE 1FWEC 4S2BA 3FKKA 1UWAA 2JK2A 2J7FA 4CKQA 3ZLHA 1IF2A 1KGXA 4DYJA 1J0HA 2I5IA 1MDRA 4L65A 3FYOA 3O06A 4K3ZA 3WQ6A 3SSJA 4GD0A 3AXIA 3CPUA 5CPOA 2W79A 5I06A 2H9AA 1XG3A 3QXBA 5CSRA 1FA2A 5E93A 3W7RA 1QBBA 1UUMA 1LBFA 3MSRA 2UZ9A 2BODX 3CUIA 2XIIA 2ZRVA 3OU8A 1E6PA 2GVYA 4NQ1A 1XUUA 1GVQA 2PCQA 1TTJA 3APTA 4Q4RA 3KS5A 4LAUA 2PDGA 2Y5JA 2EPLX 3REQB 1TVNA 3S6DA 3W72A 2RFGA 1JD9A 2E6FA 3PZ9A 3O0FA 4UTJA 1NAL1 1CLXA 5I79A 1W3JA 1WA3A 4JTHA 3HG4A 4O13A 4O1FA 4G7FA 5JBDA 1BRLB 4MVAA 3UWZA 3UCCA 4OHQA 3L12A 4YMZA 3MANA 2C19A 3Q2DA 4HPHA 2E5CA 1V3KA 1R30A 4A3YA 3RPMA 3UFYA 1ME9A 4JKLA 4K37A 4DLFA 3BAJA 3ONCA 3N12A 3U7BA 4LXFA 3TC3A 3C4UA 2KX9A 2XVLA 3H22A 2VWSA 3TN3A 2YJQA 1KW1A 3AAMA 4WOZA 3GZ3A 2IMRA 4H9MA 2FHFA 3WDQA 1WDSA 4PSPA 4H9VA 1VJSA 1UQYA 3CT7A 4IL0A 1TA3B 4I7WA 3CZLA 4IMFA 3OA3A 4G8TA 2I57A 4RZ5A 1SMDA 1C3FA 5CGMA 2Y2WA 1KM0A 1HF6A 3ALGA 2PBOA 2IPJA 3FAWA 3GIYA 3QSTA 1DWGM 4EPEC 1AH3A 2X30A 2P1FA 3HG5A 5CPQA 3OGSA 1Q8AA 4LAZA 3OPSA 4W5UA 4H19A 1R2SA 1JRCA 4M81A 4F0SA 1NWUA 5HBFA 2WC4A 1SU5A 4JTJA 3NM3A 3W1TA 4NZFA 2DZPA 1B5TA 2ZXQA 2Z2BA 4IPNB 4AD1A 2WNWA 1PZ0A 3VD4A 5TD4A 2A4AA 4I9MA 1DIOA 1UWTA 4S38A 1XUZA 3ZIZA 2YYUA 1I2QA 3S5YA 3MP3A 4AFYA 2W6RA 1Z89A 2DZUA 3T2PA 2RDUA 1TPEA 3MBFA 3LCHA 1TPUA 1C92A 4FX7A 1OT2A 4GRSA 2PDYA 4X0VA 3T05A 3BAKA 2P3EA 1EUAA 3KXQA 4GX8A 1E6QM 3BC9A 4YU1A 3NQVA 6CGTA 1KFWA 4ZE5A 4IH3A 2PODA 2W4XA 2X2YA 6XIAA 3CAQA 1DEDA 3S4TA 4O1AA 1VBUA 4M24A 4NZ1A 1G1YA 2E9BA 1QNPA 3WL0A 1VHNA 4GGHA 3H2FA 4ZOBA 5E09A 5EGRA 1EF3A 1VEOA 1GG0A 3BLIA 2OWWA 3W83A 4CCDA 1TQXA 4IOTA 5I78A 5ABGA 4DBSA 2DUAA 3F5JA 3C8FA 4K1WA 2DIKA 4HSNA 4HB7A 3IPWA 1UA7A 1L2QA 3M0YA 2DT0A 3TOPA 1OCNA 1TVLA 1V3MA 1NDWA 3PC0A 4ZO6A 4S39A 2PWDA 2WV8A 3O0KA 3PFMA 2ALRA 4S3FA 3P81A 4QAWA 5AB3A 3E0IA 3NR0A 3HN3A 2V2CA 3SN0A 1KFEA 1UC4A 3TJXA 2I1OA 3NGFA 1JYXA 2CZEA 2AL2B 3ECQA 2QLYA 3W7OA 4E3TA 4F8XA 3W9ZA 3SUWA 2HJPA 2DUXA 3RPDA 3OQEA 2A3BA 3REQA 3NJ3A 1R2TA 1M04A 1GWJA 2OPJA 2G97A 4JCMA 2ZX7A 4ASTA 1U1JA 1XISA 1L9WA 4H6KA 3MKCA 3MSGA 3WQFA 3EX2A 5I3HA 3SGUA 5AC4A 2ZX6A 1LCOA 1MQPA 4CN1A 3VXGA 3LB0A 1SJAA 5AC8A 1EIXA 4P8UA 3NVDA 3DFOA 1UD6A 3L4UA 3HV9A 1EP3A 3O63A 3LGDA 4GVGA 4X22A 2ZXAA 2I14A 4UOQA 5D33A 2YIHA 4LX4A 1X97A 4H9YA 4ZFCA 3PZOA 2GVEA 2OJPA 1R3WA 2HPIA 1W1A1 3A22A 4DO5A 4URIA 5CPLA 1Q45A 4EVZA 3BJTA 1H0GA 1FWGC 3WBXA 2X7WA 4UTTC 3F4VA 1QVBA 5KINA 5CSYA 3OIXA 3U48A 1JZ6A 4QAIA 4OECA 3B4YA 2PRHA 4BF5A 3ARWA 2OELA 4EPKA 3URBA 1XDLA 4J3WA 4G1KA 1EF2A 3DOPA 5FAJA 1POKA 5A95A 3MV11 1UR9A 2QYGA 3GE7A 4WJEA 1AMKA 3OLEA 2ZOXA 1TV5A 4XZBA 3M7SA 3B0XA 3THDA 1J2WA 5BWAA 5CQ1A 3VGGA 1T7LA 1KV5A 3PZIA 5CJMA 5L6UA 4OKDA 4N0RA 1JCLA 1AD1A 4WXZA 1JI1A 4Q7NA 3E74A 2D23A 5IFTA 3LBOA 3Q37A 4QE4A 1KCKA 2VRQA 3R79A 2O55A 4HMCA 3M0HA 1UG6A 5HNTA 2ZZ2A 1ZAIA 3COTA 4XD4A 2PP0A 4GBUA 2NSXA 1ELSA 2XHYA 3TN4A 4IZGA 3QQ0A 3RILA 3MMDA 4I5XA 1KWGA 1ESWA 1GOKA 2V5CA 1BQGA 3ZR5A 3BLKA 1YDVA 3DN5A 1W3TA 4KRUA 4LB3A 3NVTA 4ZO8A 5HWNA 1W3IA 2R94A 4YL2A 3R7MA 1BSIA 3IV8A 4HNLA 4UMCA 3RCYA 4HA1A 1S5MA 2VI0A 5FKYA 2VZOA 5C9ZA 2BASA 4HNOA 4OT7A 3SIMA 4UTTA 2HROA 4ZBCA 4ZQMA 2D2JA 3DDMA 4PUWA 3L2MA 3GTNA 2FHCA 3IAPA 4Y2WA 5D37A 1PHWA 2CLIA 1E5NA 1OT1A 2PRMA 2YL9A 4D2JA 4UMAA 3BGGA 1OFPA 1W2PA 4GNVA 5K9DA 5H91A 2HXUA 5IM51 5TIMA 3K2GA 1OF6A 4S3CA 4NSBA 1U83A 1CI1A 2PZ0A 4Y9MA 1I60A 2YKKA 1SR0A 3UJFA 4AHOA 1R3YA 2YBUA 2YW4A 2GGGA 1KWKA 4WRHA 3WNLA 2E6YA 1NSJA 1W1TA 4N4PA 3KBWA 3K8MA 3AXHA 4HU3A 3R0DA 4JY8A 3ATYA 1BAGA 1K9TA 3ISIX 2ZRUA 4QITA 1DIDA 4E2BA 2P88A 5D09A 5C9UA 3OYXA 1MNZA 2PLJA 1TJ2A 4XZWA 1W9PA 2HEJA 2BGSA 3OHIA 3G18A 1CLKA 1NU5A 4KKXA 3R13A 1Q66A 3SFWA 4E4UA 2SFPA 3R89A 4Z17A 1ADSA 3DEQA 3WG6A 4QR6A 1FHUA 4MY8A 5HMEA 4NASA 3EBVA 4J1OA 4GH1A 3UNDA 1PBGA 4GYKA 1AVAA 4XISA 4Z1BA 1H2JA 3M41A 1XCFA 3KUMA 2INFA 1CB2A 1XQLA 4NJHA 4X2PA 3W7CA 3EDKA 2XN2A 4BHYA 3GNOA 4BZYA 3FJ4A 3NGJA 4REQB 3STGA 3VOGA 1NWSA 1KFLA 3QZ6A 3AZSA 4P7NA 3VNJA 3CV7A 3NL2A 3PWAA 5IBXC 3C3UA 2BMBA 3UG3A 4IP4A 4JTKA 3BMWA 1GORA 2VELA 1CGWA 3WLRA 5HWMA 3BE7A 4IQLA 3SGZA 3L4ZA 2CU0A 4H1ZA 1ZAJA 2WNZA 5KTLA 3W7DA 1LRQA 2VFIA 1X98A 3DG3A 3T0TA 2CLEA 2NSOA 5C0QA 3APGA 1JPKA 3EGJA 3NQMA 1P0BA 1TMHA 4G9PA 2DJLA 5BMWA 1M1BA 3A4JA 1THFD 3NOYA 2G4FA 2GUUA 5KMYA 5KZEA 3MUXA 4EE9A 4LVBA 5H8PA 1W5NA 3VUPA 1RLDA 3JVAA 3NFUA 1UKSA 2VWTA 1SJDA 2B81A 3Q45A 2PLMA 2WKJA 5CH9A 4KCVA 3L0GA 5JH1A 4L1WA 3WMCA 5MKGB 6TAAA 4CN4A 1KM2A 4J7RA 3CAVA 4O8RA 1F07A 1N55A 1RQHA 2EHHA 4JTLA 3TWBA 2E7FA 2E1DA 4C6IA 4TVUA 5J04A 4PB4A 3N4EA 4EAYA 5DCEA 1BWVA 1A3HA 3AISA 2OB3A 4DELA 3RMJA 1JPMA 1NVMA 5TAOA 1VFMA 5I09A 2MNRA 3SR7A 3DENA 3PAJA 3H4WA 2X16A 4WHBA 3GBEA 4DF2A 3GTXA 5CSSA 4KPLA 1OGGA 1FWDC 1TV8A 5D04C 1OC6A 1TB3A 2XWEA 3ZWTA 2HPMA 3XIMA 1EEPA 1JZ4A 2DT2A 4R7OA 2VZVA 3NYDA 1V6UA 1JGIA 4GQRA 5A3HA 3DIPA 4CNUA 4XZNX 1VHCA 1T0OA 3O9NA 2YOCA 5G2IA 1SYTA 5IBXA 2QCDA 4GJIA 3F4CA 1M03A 4O1EA 4PBFA 1XJBA 4Q8TA 3CV6A 3EXTA 4UQ9A 2D2HA 3UGVA 5LHFA 1AJ2A 2WMIB 1MZRA 3TSMA 1X6NA 1PX8A 2FJUB 1QUMA 1BQCA 1EB3A 1FFQA 1GT8A 1TTQA 2V2DA 3BSGA 3AS3A 3OBAA 3AXMA 4FR1A 3F4NA 4GXPA 1SZRA 3KBMA 1V03A 3HA1A 3N2MA 3TR2A 2PDMA 4ADTA 4DUOA 2DPEA 1DQWA 3VO0A 1Y5XA 3TN6A 4P61A 3GXTA 5M3WA 1TMQA 3QKZA 1E1EA 3A4XA 4KEUA 1E6RA 3U57A 1JUBA 1OF8A 2YDQA 3T1GA 3RDKA 1FHDA 3O8AA 3TTYA 1Q63A 2QDEA 3U3HA 1XLMA 1CXIA 1HKMA 1QHPA 2BBFA 2VQUA 2G4JA 5DY2A 3TCSA 4NXSA 4IFKA 2Z4GA 3QY8A 5I03A 3W6MA 4A8NA 3NQDA 3WBWA 2A3CA 1EOMA 3IJLA 4QTGA 3CHFA 3ZLGA 1KC7A 4XKYA 2CEQA 4JL2A 3WF0A 4YTTA 1GOXA 4REQA 3W1LA 3GFZA 5FD0A 1DPMA 4EPBC 1EJVC 1NF7A 2INZA 3N25A 4LRSA 2XH2A 1UR0A 4AZIA 1JDEA 5CC7A 1C7SA 5AYBA 2ZDRA 3QYQA 2YSWA 3ARQA 3ERPA 5HQMA 2HISA 1T6MA 1E6NA 4B4HA 4DY1A 4HOXA 4L6OA 3II1A 1NY1A 2WZHA 3TH6A 4C1LA 4KIRA 4M5PA 3H55A 4I6VA 3PWIA 2DSKA 4JFWA 4GQ0A 1R0MA 1E0UA 1UWUA 4NF7A 5AHIA 1V6VA 3GFYA 1O94A 5U4NA 1XLBA 4O0QA 1KLZA 3KS6A 3I7SA 2ZQ0A 2VGIA 3BLDA 1GZGA 4OQVA 1US3A 3GXDA 1KKRA 1JCXA 3IIZA 1DQXA 4YWSA 1SW3A 1UP2A 4CD5A 2PD5A 2Y4SA 1HJWA 2BVYA 3LTPA 3L4YA 4QSHA 4GIAA 1ISVA 2A79A 4J35A 3LTYA 4L4OA 1V7YA 4GVIA 3JRKA 5M2FX 1J6OA 2IQ0A 4L4PA 2PTWA 1TTIA 4M1BA 5CG0A 4IX2A 1F74A 5JIPA 3NZPA 4TX9A 4JYDA 1OIMA 4BKNA 2X42A 2I9EA 2VHLA 5F4XA 5CSUA 3N9SA 3VIJA 5A6AA 4HMNA 2QGHA 4ML9A 1VB9A 2AMXA 2VX6A 3SZ8A 3BZGA 3MBDA 1YW1A 4XX6A 3U9IA 3EWUA 2O9RA 3M0MA 3W1RA 4MHBA 2ZZ1A 3C6CA 2Y8KA 3S5OA 1EC7A 2IPWA 1A5NC 2PD9A 4CQ8A 1UR3M 1J79A 4UTIA 3I4KA 4RV3A 2GZXA 1PKNA 4D6EA 1LM1A 1TZZA 3AIUA 1Q6EA 2ZVIA 3E12A 4RE4A 4DI8A 1G4SA 2XSAA 1SJBA 4DZIA 4EXQA 1ZY9A 5LGZA 4P2VA 3ZT5A 5FSDC 4PRTA 4MB4A 4W8AA 3ITCA 3E38A 5LIWX 2POZA 3PS7A 1CECA 3A6OA 3GYEA 1I4NA 1TKKA 3TAOA 4LGXA 4HJFA 4NZ5A 1S1PA 1H1YA 3TWAA 2J7DA 1OC5A 1B4KA 2J6XA 1OFDA 2PDCA 3HPZA 1PCWA 1WDRA 3VE7A 4MFEA 4ZL1A 4K1GA 1X1OA 3U5YA 3TU9A 4UXDA 1K02A 4LS0A 1ADOA 2VC7A 4H9XA 2WC7A 3PTQA 1RV8A 2ZUNA 4BK9A 1NP0A 3OA5A 1B3OA 2DVTA 2ZRZA 3CK5A 3B0VC 4ONVA 2PF0A 3GXMA 2F9RA 2OX1A 3M7WA 4JHMA 4RDYA 4KEVA 4GBDA 3VTRA 4X0NA 1YQ2A 3UU0A 2ZVRA 1MMFA 5JVLA 4PA8A 4GLEA 3L4TA 3EB4A 3A23A 1HN1A 1TG7A 4IXHA 3PSVA 3DBNA 2VQTA 2ZDSA 3KRZA 3TSDA 2EGZA 3SECA 2A6NA 1SGJA 3AWNA 1SR9A 2RHGA 4E3VA 3W6LA 2G3JA 2IKJA 2V3DA 5E6ZA 5DANA 5HPOA 3UJ2A 1LP6A 1E0WA 1YE4A 4KWSA 3PUEA 3AUOA 5T91A 2J62A 1TTPA 5A5WA 1E9ZB 1EX1A 3MSYA 3H2MA 1XM3A 2BY1A 5DEZA 4MNJA 1AW5A 1J6PA 4Z0JA 4I7VA 2CXEA 3QPEA 5I3KA 4NX0A 2Y85A 3V7PA 4DYEA 4HVXA 4KF1A 4ATDA 2QQ6A 3KL3A 1TCDA 1XYBA 4XZMX 3AHVA 3MP5A 3ABOA 1NARA 3RLUA 1PL9A 2QCMA 5EBUA 2J7CA 4IG2B 2DH3A 3O05A 3ZOAA 3U6WA 3PP7A 4EF8A 3DHFA 1SO5A 1K4GA 1O12A 3W07A 3TSBA 2NX9A 1F6KA 3R0UA 2J8FA 4DO6A 3IEBA 1CEOA 5CC5A 4UTWC 3NL6A 1QPNA 1VAHA 3EYPA 3LV5A 1M6JA 3PBYA 3NZ1A 4E4FA 3AYVA 2LLEA 3ES7A 4K6AA 1G69A 3EWCA 1LG1A 4NX5A 2OT0A 3T81A 3RGTA 4AX6A 2D2OA 2ACUA 4AWSA 4H8NA 2E40A 2YZRA 4LT9A 2RDWA 3ITVA 5FJIA 3TNOA 4HZ7A 4F40A 2TSYA 4Q4SA 5LNUA 5AVNA 3H4GA 4WVXA 2ATMA 4Q8MA 3RM4A 1PSCA 3TDFA 4HOZA 3UR7A 1E9YB 1G4TA 2FH8A 4D72A 1J18A 3CV1A 1XLGA 3FDGA 3OLGA 3CUZA 3I6EA 4E6MA 4JN7A 3BOXA 3HPFA 4FNRA 4G1NA 1KFJA 1KRAC 2HNHA 3B9DA 1K8YA 2O92A 3R8GA 4KQNA 1H50A 1Q5MA 1J5TA 4UZUA 5L9FA 2VDIA 2G37A 2V9DA 4JFVA 2WVUA 1RR2A 1R46A 4QLKA 2QJIA 1CTNA 1JF6A 5KSWA 1E6XM 4IT1A 5FSEC 1W54A 2FVMA 1QRQA 3A9BA 4LFYA 2G0WA 3KTXA 1CNVA 3BLLA 2Z27A 1H3GA 1QNQA 3BW4A 2V30A 3UZXA 1EWDA 3M0XA 5E5CA 3EX1A 2CCRA 4R88A 3MI2A 4JIRA 4XAZA 3GNXA 3TCEA 4DEFA 1Q4WA 5FACA 1S1RA 2V5JA 4HN8A 4GIYA 4UC5A 4NZCA 2TAAA 1VF8A 4HSOA 1ITXA 1OYCA 3RAOA 1TFVA 3QW4B 4FO4A 4HA4A 3MU7A 1ZJBA 4WJXA 3BAYA 2D2GA 3ORWA 4WOQA 3MCNA 4HA3A 4NNBA 4A3HA 1GZJA 3V5OA 2CESA 3S83A 3LM7A 2VR5A 3QGVA 3W7KA 3WLQA 3U4AA 4UTWA 3R1ZA 1YADA 1EJSC 3SBFA 1XXXA 2DQWA 3HGRA 4M1RA 5E1QA 3F2CA 1B31A 2G41A 3R58A 4H7ZA 3E3HA 2C1IA 3ITYA 3F03K 3QH2A 1EHNA 3LRKA 3LPPA 5A6KA 1D9EA 5HAOA 4GZEA 2AAAA 1NJJA 2OGYA 4D71A 5I77A 1LT8A 5FJPA 2GK1B 1CGTA 4CQDA 1E1CB 3LY0A 3PVFA 4UFJA 2VGFA 2Z1VA 2OO6A 1VIZA 4C7DA 1C9DA 1M9HA 3VD9A 4MYAA 1SFLA 1QPQA 1FY6A 4MDPA 3SADA 1HNYA 3OZPA 2Q71A 4B4FA 2PI6A 1DWAM 2VC6A 3JR2A 1H41A 3UESA 2Y7FA 3CYVA 4AISA 3FSTA 4J3SA 3A4AA 4NI8A 4GJJA 2QIWA 3CH9A 4CD6A 1K77A 3ONBA 4QS5A 3L68A 4V15A 3L21A 5EKYA 4S3EA 2IPGA 4IIHA 4E2OA 4PUMA 1MUMA 2E5DA 4C6NA 1AG1O 4UTLA 4KGLA 2ZWZA 4R7WA 1Z41A 4L5ZA 5J8LA 3VIGA 4QDWA 3VOIA 1ISZA 2J47A 3H53A 3NQEA 3DGBA 4RE2A 4QCEA 3THQA 1XH0A 1SSGA 3NM1A 1ZLPA 1IEVA 3DG7A 2HE5A 3LS9A 1JZ3A 5A2AA 1W3NA 3GRIA 4Q4QA 5A2BA 4X9SA 3GAKA 1K3UA 1RH9A 3KLLA 3LQLA 1OFOA 2CLHA 3KW3A 4PCTA 3ZVHB 4RK8A 1XRFA 3LRLA 1JAEA 4JZ5A 3O1NA 3PULA 3WH5A 1JI2A 2PDHA 3KE0A 4U31A 3KAOA 4LCSA 3MMTA 1XI3A 1QI3A 3PAOA 1PZ3A 3GHRA 4TVCA 5C9XA 2NQ5A 2C0AA 1T8QA 4N02A 1A49A 4AVNA 4XO7A 1IT7A 3M0KA 4JICA 3JZUA 1VLIA 3KWSA 2WVVA 3AICA 3SCQA 2NQJA 3TYCA 3VNIA 1YXYA 1VFLA 1VPQA 3YPIA 1FH9A 5C71A 2FDMA 1TIWA 5CPMA 1QAPA 4WXYA 1FRBA 4Q4PA 1TR1A 4FXJA 2WKGA 1UWQA 2JQXA 3VGHA 3NZQA 3B9NA 2I7GA 5A6BD 3KHJA 4IPIA 1HW6A 3PANA 2XH4A 4B5UA 4FF7A 3R25A 1OC7A 4MOZA 1VBJA 1H7NA 3LRMA 9XIAA 2JGQA 2BS9A 3AIRA 4TUFA 3GG8A 1VGAA 1OBAA 3HO8A 5GNXA 4BCEA 1WXZA 1SO6A 3OOQA 3TW9A 1PYMA 2OQHA 1C7TA 4XZ9A 3JZEA 3O3RA 4JX6A 4A29A 3P8IA 2ZX8A 2FLIA 1XW8A 1OG6A 3SCSA 1BFNA 2GGEA 2Y0FA 1FWRA 2FFIA 1K6WA 2Z24A 2PA6A 1EH9A 3EDJA 4IIFA 2WVTA 3GXIA 1PO9A 5C9WA 1G7VA 3VX1A 3O2LA 5GNZA 3ZJKA 2RH9A 2P10A 3LHUA 2PLKA 3QV6A 4GG9A 4I6KA 1L8NA 2Q8ZA 5DMLA 1TX0A 2C1HA 1E55A 2CZ5A 2YCIX 4HHPA 1DHPA 3TC6A 4AWTA 1R2RA 1V0MA 3V5FA 5GPRA 4GI9A 4Q6XA 2GOKA 1GKRA 1L6FA 4FOUA 2DDXA 2CITA 3S46A 4JY9A 3QM3A 4UNLA 5KEZA 3HQNA 1WPCA 4FNUA 1D3HA 3B40A 1H7OA 1R9XA 3ZM8A 5XIAA 4QDMA 5T8GA 3C0LA 1DJIA 1WKFA 5FF4A 3GVRA 4IMDA 3J7HA 5BXSA 1XBXA 1ZP3A 4WSJA 1UKQA 1EP1A 3NPXA 3PB2A 2V3FA 2AQWA 4JDYA 1TRDA 4FLSA 2VD8A 4M51A 2X05A 1EX5A 4C91A 1UP0A 3T8QA 3FIGA 4CCZA 2CFFA 4I9AA 4G56A 3PBUA 2GL5A 3NZRA 3QBUA 2ZFAA 1E73M 2Y62A 4W7VA 1CXLA 3Q4DA 3G3DA 3H6OA 3WEOA 1IXPA 3IVSA 4Y9OA 1BVZA 1K1DA 3MDWA 3G1HA 4L4MA 4KW2A 2QJJA 1DJHA 5G1MA 4FNPA 4F3HA 2CBJA 2ZRYA 4KBXA 2JEPA 2E77A 4LUSA 4KETA 1W5MA 2YA2A 1DKWA 1Q6QA 3L0KA 2QEZA 3ARTA 1RJPA 2QUVA 3ZVHA 4AB4A 3BG5A 3P60A 4JCLA 3WF3A 1LOLA 1NDYA 4AAJA 5E0KA 3SY5A 2J9ZA 1SO4A 4O8AA 3LA4A 3MO7A 3G2GA 3B8IA 1W1ZA 4TQTA 1YDOA 2RKXA 3FA5A 2OEKA 1OX4A 3EKGA 4ZFMA 1K9DA 4UUIA 1HKIA 1KD0A 3FYPA 1JDAA 5LNRA 1SW7A 4GYFA 3MUCA 3B8TA 4MAZA 2I5QA 2WHJA 5A2CA 2VX5A 4GI8A 1EHAA 3LXCA 2DQXA 4Z1YA 1BWLA 1TV7A 2EF9A 3LXAA 1D3GA 2ZXDA 1J9YA 4LH8A 1Y0EA 5T9CE 2D24A 4M6QA 4M82A 3W24A 4AMCA 4OUIA 4FHAA 3PM6A 1P5BA 3ABZA 3CEPA 2AGKA 3T08A 3VU2A 3EWBX 4QGCA 3CT2A 1YIXA 5CC6A 5D2XA 1QWGA 4O19A 4PR4A 3QQWA 1QOXA 2YFNA 4JIEA 1HGYA 3HF3A 2A7RA 1LUCB 3MTWA 3NQGA 3AIQA 3UYCA 3G22A 4JQ2A 3AYRA 3V1PA 4XBSA 3NO3A 3H2AA 3QLDA 3TYEA 1XD0A 4PB3A 4PEKA 3OYZA 3BVJA 3E02A 2X2GA 4ICCX 1H49A 3B0UX 1OQFA 4AD3A 3RIKA 3H7UA 3EDEA 1B3ZA 5EB8A 3FGCB 5FF7A 3G0UA 2OSWA 1HIZA 1A0DA 4M7SA 2YDAA 1M3UA 1R3QA 3CZKA 3WFZA 2QNEA 1FWSA 1E4MM 4WY0F 1TE1A 4RNHA 3KDOA 3LCIA 3W1QA 3CIWA 5AOUA 3URNA 1YDYA 3L7RA 2HMCA 2ZZ5A 3GD6A 4HZ8A 3WBAA 4MLRA 4NYYA 1KCLA 2ZC8A 3EKLA 4GOAA 2BXYA 1QPOA 3BTNA 2QV4A 3H21A 3IRSA 1FWJC 3H7VA 2GQAA 2H3DA 1A0CA 4XVDA 1SUXA 4TU1A 4JTFA 3UPMA 4R7JA 4S23A 4OFCA 3GUWA 4O14A 3GUGA 3ZJ7A 3CQIA 2PLCA 1R7AA 3RLGA 3H8AA 4P7OA 2CW6A 4L7ZA 3WMBA 4A3QA 2EKCA 3JS3A 3SSZA 2OQLA 1UWIA 1B4EA 2JKAA 5I23A 3UXKA 4NRSA 3HQ1A 1KBLA 3CZ8A 3G8EA 3BOLA 3W7QA 1NWRA 4HZ6A 3EMZA 1XPYA 1OK6A 1E43A 1Q7QA 2A1YA 4DO7A 3QFEA 4GISA 2OYKA 3KP1A 5HJYA 1LJYA 2A3HA 1L6GA 4K7VA 3QOKA 3AMLA 3ZO9A 1QT1A 2Z1WA 2WBKA 4H41A 1IT0A 5DLCA 1UROA 2A0NA 3AMKA 1KB3A 3SRHA 4AY1A 1PKMA 4WLCA 4G7EB 1KRMA 4JKKA 1HJUA 3VIPA 1EBGA 4W84A 3AZTA 4I5UA 4NT0A 3BJFA 4HNCA 2CNCA 4M29A 4C65A 1ONXA 3AYTA 4CD7A 4DJDC 1QTWA 4CCCA 2PU0A 1XLJA 1E4IA 1E6ZA 2VVNA 3UZZA 1D3CA 3VGDA 4UFIA 2ZYFA 3HQPA 2BHZA 4H4IA 1AQFA 3WD0A 3GZAA 4NILA 1A5MC 1VRDA 2HK0A 4Y7EA 5CJNA 2V38A 3VFLA 5C5YA 1GQNA 1AW2A 3W7PA 1GVSA 3QR0A 4US5D 4HBKA 1DJXA 1KTBA 2A85A 3PHAA 1A5LC 4O57A 1W9BM 2FPVA 4ACYA 4MY1A 2R6OA 1GPWA 4C6DA 3MCMA 4CGTA 3HMCA 1Q6FA 4FX6M 5A8GA 3CUGA 3A12A 1QOPA 1FKWA 5LNSA 4OV4A 4EKJA 1E0XA 3GHSA 1LL7A 3HB9A 5ABHA 4EAMA 4O0ZA 2H6RA 2FB3A 4JN6A 3TLQA 4E8CA 5C7HA 4OVXA 3R8RA 3ARYA 1TJPA 4IGMA 1X38A 1XRTA 3H24A 1LT7A 1Q4NX 4R85A 3ARRA 4FS9A 1GHRA 3ZR6A 1SO3A 3N6HA 4MPQA 3WF2A 4ZO7A 1A50A 1BYCA 4HK7A 3WDHA 4X61A 1CIUA 4LBRA 1MZHA 1LUCA 2A2IA 2WMGA 3AO0A 2WMFA 4AWEA 5H1WA 3LV6A 2OWCA 1QNVA 2GUYA 2W9MA 1D8WA 1QW9A 1R9YA 3QZEA 2VEFA 2BOFX 4N6EA 3DHUA 2OVLA 4JFTA 5EMKA 4HJWA 4H01A 2GLKA 4NP7A 1S2UA 1WYIA 3GDRA 2QVHA 4UQEA 4LRTA 3N14A 2WQDA 1UZ1A 3PY2A 4LC8A 1L8PA 1OEPA 4NY2A 4JTEA 1XL9A 3FGCA 1QFEA 4AUBA 4DJDA 1GJPA 3IV3A 3BQ6A 1C29A 3QLLA 4JYEA 4L9YA 3UJEA 3NOEA 3AFBA 3WQCA 3CTLA 1IV8A 4NVTA 3C0QA 3HG3A 4HMDA 1BPLB 1RVGA 4A2RA 3W7LA 4ZO9A 1FHLA 2WPGA 4AC1X 3WIJA 3RRAA 1UC5A 4J2PA 5JQ9A 5CZTA 2QJMA 3QC3A 4ZENA 3RU6A 3TVAA 4S3BA 1KXHA 3C0JA 2GWNA 2OTDA 3VM5A 3OZOA 2REQA 2CC0A 5KZDA 4BEQA 4F9DA 1MVYA 3L9CA 3IUIA 2VCCA 1IZJA 3KBJA 5BOFA 5A6BA 4JFSA 4DWDA 1W5OA 3A3XA 2WWDA 4IGNA 1LBMA 2AAMA 4GCXA 1VFSA 2OZTA 1ISXA 1HVQA 4Q4KA 4DRSA 2Z2UA 4GXWA 3TQKA 2HBXA 4Q6JA 1JXJA 3G24A 3S1XA 4F0MA 1UR1A 3NPVA 3MDUA 4DNMA 4NNCA 4RDWA 4XWUA 5CKSA 1K8XA 2WZIA 4J2MA 1DYSA 2QIIA 3B0YA 3M6DA 4NAEA 4HHMA 4IMEA 2D0GA 3OHMB 4DO4A 4A2SA 3B06A 4IPLA 3IJ7A 1OFAA 4YCPA 3B8UA 4LSBA 2ZUVA 1DJZA 3LPFA 3BV4A 2WLYA 3S9ZA 5LIYX 5H8MA 2FZDA 4K68A 3U2OA 4LANA 4WY0A 1YTDA 2ON3A 1H51A 2OYMA 1SZEA 5E9AA 3TYAA 2YA1A 1S39A 3AS2A 3SUSA 2ATSA 1J93A 1KKOA 3BCJA 1XINA 3DKJA 3ZQ9A 4RLIA 3G1VA 4U28A 4DPPA 4C6CA 5KZMA 3N18A 2BLEA 2J66A 5E9XA 3GG1A 2ANUA 5CPTA 4IJCA 4F48A 2XFFA 1VFFA 1GQLA 5J5RA 1ECQA 4ZOEA 3MWAA 4WDUA 4LAMA 2ZUSA 3LNPA 1MRQA 5M5DA 5A94A 3F2DA 4HPNA 1NDZA 2IKHA 4JEJA 4KH2A 2EPOA 5XINA 1HJQA 2C6QA 1H5YA 5AC6A 1VYSX 2EJ1A 1OB0A 1TJ0A 5I3GA 4OIFA 1O4UA 1Q8JA 3V3WA 3BCFA 2AQVA 3H2EA 3W7EA 1J0ZA 3ZJ8A 4HK6A 1FCVA 1F3WA 1BGGA 3QHNA 3R94A 3UWUA 3PF3A 1GVRA 3TYUA 3KVMA 1TV4A 3AMCA 1H7XA 3C2EA 2WJFA 3VGEA 4ES4A 4GCAA 1F2JA 4IF2A 7TAAA 1V08A 4L1XA 4QJ4B 3S1UA 3XISA 2QDGA 1HKWA 3LN3A 2ZE0A 4TTUA 9XIMA 3LX9A 3AYSA 1ZB5A 4UFKA 5DCBA 4ZQCA 1JCJA 3T09A 3GW3A 4OTKA 5CGQA 2ABAA 2BTMA 1A5CA 3BURA 4WDTA 1DL3A 4OOZA 4Q8NA 5GQBA 3P62A 2EQDA 1XFCA 1A5SA 3W82A 1FWBC 3PB0A 5GJMA 3LPOA 4OJYA 5AVHA 4MFDA 1XQKA 4B2DA 2HS8A 1QO2A 1TMLA 1KR0A 2BSLA 1ITUA 5HMDA 3TTSA 1XGEA 5AZ0A 1EFZA 4F2UA 5I2UA 3R10A 1B57A 4O28A 5K7JA 1ME7A 1F7BA 4Q8WA 4XZLX 5DBUA 3GG7A 4C5YA 2WSQA 1U2YA 5REQB 1XYZA 5RUBA 4DWSD 1I2RA 2GJNA 4NG3A 4FP1A 1OK4A 1U33A 3N29A 4IJRA 1CB7B 3P2VA 3ZYZA 1E4LA 2XG9A 3W22A 3UW6A 5KZ6A 4RR4A 1UZ4A 1G4EA 3OBKA 3NPWA 3DYPA 1HQTA 3GXPA 2ZA1A 4FOJA 1O5XA 2GGJA 3F5KA 3UY8A 4HA0A 4XTDA 2FIQA 5CGTA 5IHRA 4PUJA 3MUAA 1EC9A 3AJXA 3LZ3A 4LBSA 3K46A 3UXAA 2A7PA 3IWPA 2A3EA 3GH5A 3DERA 4MIMA 3W7MA 1NFGA 1PZ2A 3W73A 1U1HA 2HK1A 4AC7C 2ZX5A 4RCXA 5T9BG 3GNDA 3QHMA 3UF9A 3UWYA 3V18A 1WX0A 4ZQOA 3WO8A 5FAGA 3V1HA 4QLLA 3VKKA 5CG7A 2ASHA 1YXCA 2IQDA 1RD6A 2Z6JA 4Q8OA 1ITQA 4N9EA 1WE5A 5LIXX 3QPYA 4LOCA 1TJ1A 2XFWA 3ZSTA 3WLJA 1XPGA 4D6JA 1TJRA 1RSCA 4YYCA 4UOJA 4KCUA 4FX8A 1NOFA 2BY0A 5HUPA 3W2KA 1JZ7A 4F0HA 4S3DA 5K2ZA 4XD3A 1JZ2A 1E9IA 1YPIA 1JPDX 2IPFA 2XTKA 2E1WA 1QK2A 3EPOA 1LROA 1W3KA 3T2OA 2QUNA 4MWAC 1XLAA 1KTNA 3WH7A 4H8HA 4DVOA 2EO7A 1ICPA 2ZKMX 1Y5VA 4OBRA 1DXFA 2A5HA 3VCRA 1PIIA 2O9OA 4G6CA 1JL8A 1YEYA 1IT8A 2OQYA 4PH6A 3IJ8A 4PL2A 4DXKA 4FOKA 3I6RA 3WK0A 4YLWA 7ENLA 4DUWA 1DJWA 5EBAA 3O6AA 1WUFA 1RXOB 2QF7A 2ZUUA 3ITLA 2WCAA 3SAZA 3CQJA 3G1SA 4ZMGA 1KM6A 2DW6A 4GI4A 1E3XA 3CO4A 3E2RA 4B5XA 2VR4A 9CGTA 1AQHA 4TX6A 2OLAA 4E0CA 3T2QA 2FZ8A 4S3AA 4PMDA 4FMVA 9RUBA 4GY7A 3USBA 2VTFA 1WCGA 1M7JA 5IFPA 2G95A 5AHLA 3DFQA 2WMHA 2WBGA 4FR6A 4LVDA 3W25A 1C8YA 2QF8A 2CWNA 4O54A 4AZ5A 2IXUA 1H62A 2YZ5A 3QW3A 4Y90A 3WQWA 4H9UA 3OGVA 3V35A 3KOXA 3G77A 1FXPA 1U5HA 1XS2A 3UVIA 1K8CA 1S5NA 1Z6KA 3KTCA 3OGRA 1WDPA 1T41A 3EPNA 3CAKA 4GO9A 3P5YA 3NIYA 3CQ0A 2IS7A 2OKOA 1PKLA 1I0BA 5HR6A 2QPUA 4UZSA 3EA3A 4AXNA 3VILA 1WBHA 1REQB 4AEFA 4GHRA 5MF5A 4YTSA 3IVTA 4O52A 4MWAA 4YCOA 1BWKA 3G0XA 1PWMA 2PDXA 1QPKA 2ALDA 5GVJA 2QVNA 1TIMA 1F6YA 3TTOA 1RCXB 3W29A 2E0PA 2JF7A 5A8OA 4GK8A 1ALDA 3T4CA 2XYLA 3UZJA 5CZ0A 4YHGA 2D20A 8A3HA 3GR4A 3FA4A 1VS1A 3NXLA 3GM8A 3HFTA 3WNMA 1UMYA 3GTFA 4NJJA 1S2WA 1ICSA 4ORIA 4HN4A 1SVDA 4HU8A 3BWWA 2XVPA 2GQ9A 1RP8A 1Q3NA 4RE3A 5HANA 1JQXA 1LQAA 2QMJA 1GOMA 1U22A 1XP3A 2P0OA 1N8WA 3NDZA 1VP5A 2XIOA 3CWOX 5AKQA 4H00A 2GJPA 1I1XA 5F1UA 2UY5A 4RDZA 3INPA 3WFLA 1PEZA 1WDQA 4S2CA 2NLIA 4PUDA 3W1UA 2DZSA 4IPJA 3CMJA 3OTRA 4JR5A 4YVXA 2Q09A 1A4LA 1FCBA 2GPTA 1SZGA 1C91A 3TJLA 1P0EA 4FALA 3EXSA 3I65A 2YPIA 1DWHM 1R8LA 2JKEA 3EX6A 1H60A 3BGAA 1O66A 4RXFA 4WIWA 3MHGA 5F2LA 4P7QA 4JEQA 1XDJA 3N4AA 1A3XA 3WK2A 2XGZA 4CCEA 2DZXA 4LUIA 3GHUA 3ID7A 3THAA 4DWSB 1VQTA 2E3ZA 3ATZA 3OLDA 1EOKA 5I3IA 4TVDA 5HPCA 2DSWA 3RLHA 2CZDA 4YTUA 1TVPA 1E70M 2HV5A 4LYRA 4U4MA 3MZ2A 3ME3A 3OZMA 3IGUA 3VA8A 4MDOA 2PWEA 2O9PA 3N04A 4MGGA 3LERA 1IEQA 4Z42C 5D02A 2F2KA 1MEHA 1JUKA 2WM0A 1LDCA 6XIMA 3QEZA 1XLIA 3BH4A 1BEUA 3W75A 2O4QA 3GDMA 2BNJA 5F1VA 2C14A 1BYBA 2PDIA 3BOFA 1TREA 3AHXA 3SCPA 4NIRA 1JJKA 1GYLA 1HFBA 5F2MA 1EZ2A 2YXXA 4WKHA 3NSXA 1CCWB 5CLWA 5I7GA 1GGOA 3T42A 3RPTA 3CUFA 3SUTA 1BTMA 4D6HA 2X1SA 2JF6A 5HJLA 2P0IA 4QG8A 3V16A 4C6KA 4HTYA 2DSUA 1AZ2A 4I9TA 4LVAA 3SW6A 1TWDA 3CNYA 1VRXA 4LUTA 4LTSA 1P0DA 1EBHA 1QW8A 3CUHA 1XCXA 1HJSA 1UR8A 3M0LA 4AIBA 2WPBA 5F4WA 3ZVIA 1KFCA 3BK0A 4GPNA 3MZNA 4DWSC 4ZB5A 4RX0A 4Z2JA 4N2YA 3SCRA 2PPGA 3BARA 4O53A 1RBOB 1YKWA 2PDUA 2YXOA 1ZBCA 3W27A 3OJGA 1HJVA 3FHQA 1K8ZA 4PULA 2C3ZA 3MI3A 3GC5A 1REQA 3IUHA 3VMPA 3HU7A 1Q7MA 2CBVA 1XBVA 4TO8A 1M5WA 5G2HA 4MPKA 1O7AA 4ZXOA 3KVLA 2BVTA 2JE8A 5PTDA 3POCA 2FQIA 3UERA 5ECUA 1FUYA 1HL2A 4WKFA 5B80A 1XIIA 1L0PA 3TTEA 2PTDA 3DX5A 4DAIA 1UIPA 3DECA 1RJRA 4WF7A 2XIQA 4GVFA 4NZ4A 3ENLA 3BAWA 2Q3RA 3SUVA 3WMLA 4Z2HA 1LLZA 3LZ5A 2VFDA 1TSIA 4U5KA 5DQPA 1X8FA 1MWOA 3B03A 2VENA 1ICQA 1OABA 2HWGA 1QR7A 3VDHA 2PF8A 3CLWA 1NF0A 5HXMA 5FL1A 3MCOA 2CBIA 3GWQA 1ZZMA 3OBEA 4JTIA 2Q8XA 3BGJA 3PR2A 2HVNA 2VMFA 2WQPA 3H12A 4ZE4A 3WNNA 1OGSA 3WFAA 1DIEA 3A5FA 2C18A 2WC3A 2B7QA 2CLMA 3D3AA 3RG6A 4B5SA 2OO0A 2C71A 3WZ0E 1AJZA 4O1DA 1JZ5A 4NUWA 4JQ3A 4Y8FA 1BXNA 1QO5A 5BRQA 4N9BA 3OZYA 1F3EA 4EXBA 2O56A 3M43A 3GQYA 4DWSA 4DXVA 4MTVA 3WH8A 4ZGYA 3UR5A 2PDWA 1P6BA 2O7SA 1FDJA 3HM7A 3L65A 4TTGA 3PZNA 3LQGA 3IARA 3A64A 3QR1A 2G96A 2NX3A 3E5BA 3T40A 2OG9A 1IWAA 1RBAA 3E0FA 4GUJA 1R87A 3ELFA 3HV8A 1ZAHA 2ACQA 3WUGA 4GZJA 3V0UA 3G6LA 1MSSA 3CPRA 3ZT7A 2J7GA 1YXDA 4KWWA 1T8XA 3W02A 3G6MA 2FPTA 3E2VA 4CVWA 4EF9A 4K38A 1KM1A 2HTMA 5FOOA 4GNKB 1NH6A 4D1JA 2NZLA 4KEMA 3BO9A 1UBSA 3KZSA 3GYCA 3SQMA 4MKSA 1QBAA 1IEWA 1Q6GA 3FSUA 4Q8VA 5DCDA 4W86A 4O10A 3DFSA 3C2OA 1D7FA 2YCEA 1EXPA 4CQAA 2PDFA 2QPXA 5AN7A 1A5UA 1RQEA 1T96A 3MMUA 4AZBA 2OLHA 1F5ZA 3RX3A 4O16A 2Z1BA 4FXFA 5EA9A 3TYZA 1GKPA 4BI6A 7TIMA 4U10A 4XKMA 4JTAA 1Q2SA 2Y8UA 4GJ1A 3CV2A 1OIFA 4K2SA 3FN9A 4JQ4A 3WN6A 4H6QA 1WOBA 3OB8A 2OSYA 3MVTA 2ZA3A 1O6IA 4M8UA 3FAXA 4KEZA 2MUCA 3CXOA 5ABTA 1WOAA 3GG0A 3TOYA 5HDRA 4QJ1A 1B2YA 4S3GA 1XKJA 2OEMA 4X2RA 5I00A 5TQLA 7PTDA 2HNEA 4EIVA 3CHVA 1IEXA 3LU2A 4RUBA 5D32A 3W23A 3GR8A 2A21A 4BJHA 1OCQA 1V79A 4N9CA 4CNNA 1S38A 4RZ6A 1XIGA 3WNPA 3TX9A 2WKLA 2XH7A 3IANA 4B91A 3KVKA 2VUYA 4I7UA 2X1IA 1ZHAA 4O18A 4PL1A 3T0CA 5DBTA 4D6CA 2W27A 2X7VA 1RP9A 1YLVA 3EEZA 3KOZA 2FZMA 3NPUA 3NXFA 3V36A 5BXRA 3UETA 4ZR8A 1I45A 5IOBA 3GS6A 3WEZA 3VCCA 3L4XA 2W92A 4LJ3A 1NOUA 4PODA 3LMYA 3CQHA 1XV8A 4MY9A 3ARZA 3BG3A 1Q6LA 1FWHC 3KEHA 2J78A 3HJEA 1UOZA 3JW7A 4JN8A 1W3LA 4CNTA 5EU9A 5HNUA 3GXFA 2O4MA 4IISA 1EUNA 4UR9A 3TK7A 4QE1A 4KCTA 5D8ZA 2VZTA 1PZ1A 1VKFA 1FFRA 4UR7A 4GINA 1E6SM 4P8VA 2F2HA 4OOUA 3P0XA 5ABEA 1YE6A 2J24A 4HHLA 1FWWA 3VNLA 1V02A 4PTDA 5D30A 1QI4A 2EBNA 1GW1A 4LYPA 1CXKA 2ISSA 2YXGA 3KFTA 3CMGA 3TONA 3C2YA 2OMAA 2VO5A 1YBQA 1DORA 2VGBA 4KFNA 1HTIA 1CGVA 4A35A 3OW1A 1TWZA 3IIXA 3M6YA 4UFMA 1H11A 4MJ4A 4HPJA 5LZLA 3M0VA 4BI7A 1EPXA 2FB2A 4IWWA 1PB0A 3M1ZA 3P84A 1SZFA 3SGGA 3M47A 4J3TA 3HFYA 3P82A 4AMAA 8RUCA 1VBHA 3S1VA 1H1NA 3GU1A 3QOMA 8XIAA 2VD9A 1VIWA 3CUJA 3L5MA 3RHGA 4A8IA 4DJFC 2PTXA 2QCDB 4GC3A 4EPDC 2IKGA 3UWWA 2Z7KA 1JAKA 3FCPA 3QFWA 4YNGA 3WNOA 4DIAA 1SM9A 4AZCA 1U5VA 4KT2A 2PTYA 1F8IA 5FJUA 1OINA 2OZ8A 1XICA 4ALDA 4PE8A 1HO4A 3GDLA 4FNSA 4ADSA 2QKFA 3O7UA 1ML1A 1ZBWA 2R8WA 1H0IA 2QJGA 5HMSA 3GK0A 2OYLA 2E9MA 4HYVA 1W1YA 5BROA 1YPXA 3VPLA 2YFOA 1JCYA 3FX4A 3MA8A 1BXCA 2EXOA 3TXVA 2Y63A 2WJZA 4V1YA 4H6RA 4X60A 4PN2A 1WNOA 1WUEA 1TWWA 3MT1A 1R3VA 3T0AA 4AD4A 1M7OA 4AU0A 3JUGA 1RJQA 1G5AA 1OYAA 1V77A 4I8YA 2FFCA 1R5YA 1RLCL 1I1WA 3SI9A 3NQFA 3RX4A 1B3VA 2CKRA 3SM0A 3RYSA 2BFGA 2DZBA 4HU4A 1HG3A 3IGXA 3H54A 2CPUA 4JHOA 4P8WA 3T8LA 4QDPA 2EPMX 2R1LA 4E5TA 3OG3A 1W56A 3DFPA 4JS3A 4W8BA 2DVUA 3VIFA 5HR7A 2Z1SA 1Q6DA 4ZEPA 4IFKB 3GX9A 4JNZA 1EJRC 3NQ8A 3FHAA 3P74A 4H83A 3ITOA 2OOFA 3EEGA 4QCFA 4AIEA 2VEGA 3QV8A 4QJ5B 1PXGA 3WD3A 4BR1A 1Z48A 3TJIA 4XKYB 4EOUA 3DFTA 4JTCA 3RO6A 3STPA 4QG6A 4LVGA 5K3VA 3TW6A 1MW0A 3UWQA 2F8QA 2WHKA 1ZUAX 2VC9A 2J7HA 3OLIA 3W7HA 1US0A 3AZRA 3RU8X 1GOWA 2QCEA 1R3TA 3KL0A 3GC2A 1X6LA 4JXCA 4M3PA 3RF9A 2HE8A 3ES8A 3DG6A 4DJFA 2NQLA 3S8HA 4AZ6A 1UKTA 4R3UA 3VE9A 2WMJA 3WMSA 3DAQA 5H2ZA 3CL6A 3UPWA 3CBWA 6PTDA 5CXPA 2WSRA 2FH6A 3AALA 4MYXA 4XD6A 1GQIA 5HUOA 2VOMA 1AL8A 4DJEC 1UOKA 2DU2A 2RJHA 4WD0A 3EMCA 4IFOA 5SWUA 5G4WA 5CAKA 3T78A 1TELA 1XYAA 1A47A 1T99A 4A8LA 4K8GA 1AA1B 2EG7A 1AJ0A 2WZTA 2X1TA 3KP0A 2FPYA 5D9NA 3CB8A 4HQVA 1EJ7L 2FTYA 5C55A 1KXTA 3VKDA 2H8ZA 3DFNA 1RPXA 4TV6A 3WQ8A 2PGWA 4UTHA 3GBDA 3L4VA 2HSAA 4B9YA 2B7OA 2WM1A 3QTGA 4V28A 1NOWA 2G3NA 3LI0A 1KBJA 3R2GA 4FK9A 3NAVA 2QUUA 1I2OA 4Z2KA 2Z0IA 3BMXA 2QULA 1M68A 4RE0A 2BP1A 2YCLA 1P7TB 5HQEA 5EL1A 2V67A 4ZOCA 3WJWA 3E96A 2DIEA 3THUA 3POHA 4B92A 4TV5A 1WKDA 4D8AA 2C7FA 4PUUA 3SY1A 3KX6A 2DP3A 3MJMA 3AQUA 1EGZA