3IJ6A

Crystal structure of an uncharacterized metal-dependent hydrolase from lactobacillus acidophilus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
303
structure length
303
Chain Sequence
LTKIDAYAHILPAKYYQKMLSVEPNIPNMFPFIKIKTLMDLDERLTKWPDQNTKQVISLANISPEDFTDSKTSAELCQSANEELSNLVDQHPGKFAGAVAILPMNNIESACKVISSIKDDENLVGAQIFTRHLGKSIADKEFRPVLAQAAKLHVPLWMHPVFDARKPDNNLVFSWEYELSQAMLQLVQSDLFQDYPNLKILVHHAGAMVPFFSGRIDHILDEKHAQDFKKFYVDTAILGNTPALQLAIDYYGIDHVLFGTDAPFAVMPSGADQIITQAINDLTISDKDKQKIFHDNYYSLIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF AN UNCHARACTERIZED METAL-DEPENDENT HYDROLASE FROM Lactobacillus acidopphilus
rcsb
source organism Lactobacillus acidophilus
molecule tags Hydrolase
molecule keywords UNCHARACTERIZED METAL-DEPENDENT HYDROLASE
total genus 103
structure length 303
sequence length 303
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3ij6A00
2VR2A 1M7JA 1R9XA 1JGMA 1E9YB 2DVXA 2UZ9A 4ZSTA 4C6OA 3RYSA 4DNMA 4LAOA 2DVUA 2P53A 4GXWA 1FWGC 3IJ6A 4G2DA 1A4MA 4QSFA 5CH9A 2W9MA 1XGEA 4D8LA 1A5KC 2OGJA 3URBA 3PNUA 2XIOA 3QGAC 1R9ZA 4IG2B 1XWYA 4H00A 1P1MA 4J35A 2FTWA 3IRSA 4RDWA 4DIAA 2A3LA 2HBVA 2GZXA 4EPKA 1J79A 4LFYA 2Z24A 4XAFA 4EPBC 2PAJA 1M68A 3MDWA 4LAMA 2D2JA 3IPWA 2R1NA 5HMEA 3B0YA 1UIPA 1RJRA 1FWFC 3MVTA 4HK5A 5G4HC 4H9UA 3URNA 1K70A 3NURA 3NQBA 2Z4GA 2IMRA 3GIQA 1IE7C 2ANUA 1KRMA 4B90A 1O5RA 2Q09A 4ERAA 3D6NA 4XD4A 2P50A 1EJRC 2O4QA 4IGMA 4IFKB 1I0DA 4C65A 4RE0A 3SO7A 3SFWA 4P5UA 3LS9A 3T81A 4QS6A 1A5LC 2UBPC 2WJDA 4WHBA 4XAGA 5LXXA 3WZ0E 3PAOA 3TNBA 3S2JA 3MKVA 3C86A 3G77A 4GZ7A 2QPXA 4B92A 1EJWC 4C6NA 4RDZA 3ITCA 3QY6A 1J6OA 4IGNA 3DUGA 2HBXA 3GUWA 3S2NA 2YB4A 2HPIA 3GG7A 3OJGA 3HM7A 4ICMA 3LSBA 1A4LA 1FKXA 1ONXA 2GWNA 3K5XA 3LA4A 1W1IE 2GSEA 2I5GA 4HA0A 5AKQA 3E0LA 3QY7A 4M51A 2R1MA 4C6BA 4QTGA 4LALA 2EG7A 3QGKC 1KRBC 3DC8A 1RA0A 3OQEA 4GY0A 1GKPA 2FTYA 1J6PA 3WMLA 1RK6A 4INFA 4C6FA 4R7WA 4CNTA 1V7AA 2Y1HA 3F4DA 2PGRA 3AU6A 3ID7A 4RDVA 4DZHA 3E0FA 4GOAA 4KEUA 4XAZA 3GIPA 4I6VA 3UR2A 1M65A 2OODA 1E9ZB 3EWCA 4J2MA 4YIWA 4CNUA 4CEXC 4DI8A 4HK7A 5HMFA 4UBPC 4CQCA 2F6KA 3AU2A 3TN4A 2Z28A 4IFKA 4C6LA 1NDYA 4LANA 1FWAC 1RJPA 3GTXA 3B0XA 1O12A 1RA5A 4MUPA 4BJHA 3LGGA 3OOQA 3UBPC 4PE8A 1GKQA 1EZ2A 3O7UA 3S2LA 3A3XA 3PANA 1A5NC 4H9VA 1BF6A 4H9XA 4R88A 4EPEC 3KM8A 3RHGA 4GY1A 4PBFA 2VUNA 2WM1A 3HPAA 4NP7A 3URQA 5E5CA 1EJVC 3UR5A 2Z29A 3V7PA 4H01A 4DI9A 2HQAA 3IGHX 2HPMA 1V79A 4L6DA 2E1WA 4CQDA 1ITUA 3TN6A 4C6KA 4RDYA 4CNSA 4G7EA 5HMDA 1KRAC 4EP8C 4F0LA 3FDGA 3RCMA 2VC7A 2QS8A 4XAYA 1DPMA 4JOMA 2YXOA 3N2CA 4C6JA 4C6MA 3UPMA 4IFOA 4GK8A 1J5SA 3K2GA 3LU2A 3ORWA 1WXZA 2WJFA 4IF2A 2E25A 3O0FA 4GX8A 1I0BA 1PO9A 3JZEA 2Z27A 5FSDC 3E3HA 3GU1A 4LCSA 2Q01A 4C60A 1WXYA 3MTWA 1A5MC 4Z42C 3IV8A 3OODA 2ICSA 2AMXA 2VHLA 3CS2A 2R1LA 1YBQA 4R85A 2EG6A 1YMYA 1EJXC 3GU2A 1NDZA 4B3ZA 2Z2AA 1KCXA 3RN6A 2GOKA 1EJTC 4KIRA 1FWHC 2GWGA 2YZ5A 4DO7A 1FWDC 1V77A 4CQBA 3MVIA 4H9YA 1PB0A 4F0RA 4GY7A 4GC3A 3OVGA 1YBQB 1FWBC 1XRTA 1ADDA 3LY0A 4B91A 4C6PA 2DVTA 4GX9A 1RK5A 4I6KA 2PGFA 1POKA 4KERA 4WVXA 1EJSC 2O4MA 3TN5A 4IQJA 1ONWA 4CEUC 3FEQA 4C5YA 4IG2A 1P6BA 1FWEC 4V1YA 2YB1A 2Z2BA 4G7EB 2R1PA 3URAA 4BY3A 4PCPA 3EGJA 4LCRA 2BB0A 1K6WA 2QT3A 1NFGA 1P6CA 2FVKA 5A6TC 1UMLA 2EG8A 1POJA 4KF1A 3T8LA 3E38A 3F2DA 2QVNA 1PTAA 3IARA 1QW7A 1V51A 4OFCA 2D2HA 3QY8A 4H9ZA 4WGXA 3MJMA 3GRIA 4LCQA 2Z00A 3A4JA 3GU9A 4ZSUA 3F2CA 1QXLA 4C6EA 4NG3A 2Z25A 4J5NA 1ITQA 3LNPA 2HNHA 4F0SA 3MSRA 4H9TA 3WYZA 4KETA 4AQLA 4DLMA 3F2BA 3PBMA 1R9YA 4H9MA 1RAKA 4IFRA 2ADAA 3ICJA 4IH3A 2OB3A 1K1DA 2D2GA 4XD6A 4PBEA 2RAGA 2AQVA 3K4WA 3TN3A 1FKWA 3ISIX 3E2VA 1S3TC 3CJPA 1FWJC 1A5OC 4XD3A 3PNZA 2R1KA 1UIOA 1PSCA 3E74A 3GTFA 4V1XA 4C5ZA 3AUOA 2OOFA 3IACA 1UBPC 3GTIA 4QS5A 3FDKA 3UF9A 2CZVA 2ZC1A 1EF2A 1ZZMA 3B40A 2Z26A 5FSEC 4GBDA 3F4CA 3OU8A 3CAKA 1V4YA 2G3FA 3LSCA 1GKRA 2FFIA 4UB9A 3A3WA 1YNYA 4KEZA 4LAKA 4ERIA 2VC5A 3BE7A 1HZYA 4RZBA 3LGDA 4LH8A 2PLMA 4TQTA 4QRNA 4KQNA 4XD5A 2BGNE 3NEHA 4QROA 3HTWA 3DCPA 3S2MA 4HK6A 4PCNA 1KRCC 3EWDA 2FVMA 1NDWA 2OQLA 4C6DA 1VFLA 4GYFA 2I9UA 3T1GA 4EPDC 2VM8A 1XRFA 1RJQA 1FWIC 4KEVA 3MPGA 4BKNA 2AQOA 4HJWA 4LEFA 2PUZA 3S4TA 4C6CA 4DZIA 3R0DA 4L9XA 3GTHA 4NI8A 4E3TA 1YIXA 4C6IA 2WJEA 4KESA 4C6QA 4DLFA 1NDVA 1EYWA 4ERGA 2Z7GA 1EJUC 3MDUA 4DYKA 1YRRA 2KAUC 1FWCC 4AC7C
chains in the Genus database with same CATH superfamily
3PG9A 1VJIA 2E0PA 1OCBA 4H6KA 2WHMA 3LV5A 1I2RA 4R34A 4DNMA 2VWTA 1CXFA 3UQNA 5AC8A 1GTEA 2RDWA 1V3JA 3G1SA 4MYXA 2OGJA 4WDXA 4YTQA 4NKCA 1KM5A 4Q8VA 2GUUA 1Q8JA 4JFSA 3UXAA 3MMTA 1SGJA 4OJYA 3HJEA 4JHOA 2GJRA 3VCRA 1EOKA 4FAMA 4PRWA 3DFHA 1IR2A 3WL1A 4JFUA 3M5YA 1S1PA 1V8EA 3HPSA 4Q8UA 4DBWA 4AZCA 2AL2B 4FK9A 4OV9A 1KCKA 3LTYA 4IPLA 5U4NA 1H0GA 1V6UA 1VFMA 3P6LA 1K8CA 3R58A 4FEZA 2Z2UA 4MFEA 3CUFA 3J7HA 1GEHA 4US5A 1CW2A 3D6NA 1AJ2A 4H6EA 1G5AA 2X0YA 3CEPA 2J9YA 2V5KA 4P5UA 1DWGM 5FESA 4QR6A 1MRAA 2VZOA 3H6OA 4AZHA 4QS6A 4M6VA 5EFDA 3LMYA 5DRCA 4XSLA 4GH3A 2PS2A 3C86A 4B92A 3PB2A 4FLSA 1B3YA 4RDZA 3FNDA 4FR1A 3PBWA 3QY6A 3CC1A 4P8VA 5D30A 3QH2A 2FIQA 3NOYA 3TQ0A 1KTNA 3VU2A 3P0WA 1N7KA 1JFXA 3SADA 2ASHA 1LYXA 4F9DA 1IZCA 1MUWA 3OYXA 2CHOA 2BHYA 3S5NA 1JQXA 1QI3A 1CB2A 2WW5A 1WP6A 2YA0A 1BVZA 3AXIA 5G1MA 4N9DA 1PJ9A 3LM7A 3UR2A 4J2MA 3S83A 4GINA 5A8GA 5T26A 2NUYA 4YU1A 4D6JA 5ABEA 1ZUAX 1DJWA 4AWUA 3GYEA 3M0VA 1WPCA 1GT8A 4LUTA 4YWIA 1RVKA 3RHGA 1R2TA 2V38A 4Y7EA 4NP7A 2O9RA 2ZDRA 1HJWA 3IRDA 4DM1A 2Z29A 3B8DA 4GJJA 4RJEA 3EB3A 1TQJA 4H01A 4GUJA 3SSZA 2ACUA 4NUWA 4GXMA 1AL8A 3LZ3A 3IV3A 3W23A 3EPMA 4JTTA 1EWEA 1GOXA 3KVKA 2OKOA 3QMTA 1RXOB 5CG0A 1QNSA 4HA1A 1JCLA 4JQ3A 3ARRA 3GLCA 1NWRA 4WUIA 1UD3A 3PZTA 5BMWA 1OC7A 3NYDA 3TMQA 4AEEA 3LZ5A 2DU2A 1H1NA 2Q8XA 3K2GA 1L9WA 3WF1A 3PBYA 1E40A 2OX4A 3SCRA 4GX8A 3BOXA 1PO9A 2OG9A 3DDMA 1K7XA 4HN4A 4PBGA 1NY1A 2B81A 4HZ7A 8CGTA 3D3AA 3IV8A 4U2ZA 2AMGA 3N12A 3WFZA 1CEOA 3IVSA 4DWSA 1VLWA 3VIGA 3E02A 3AO0A 1TJPA 3GW0A 5IDZA 4ZOBA 5D32A 4JTRA 4AVNA 2VZVA 3VOCA 3ALGA 1UMYA 2ZUSA 4XKMA 5JBFA 3LY0A 4S2BA 4O0ZA 3UJEA 4NNBA 3HJZA 3STFA 4Z2HA 4GRSA 1ZALA 3WBXA 4FIRA 1DJHA 1LBMA 3COTA 4WJXA 1NFGA 4FLQA 2C71A 1ZENA 3R5EA 1DYSA 3E38A 5K7JA 1P0KA 5EY5A 2D2OA 4GG9A 3IK4A 3PTQA 2HCVA 4G1NA 5ECVA 8TIMA 3BW2A 3P5YA 2V8ZA 4OFCA 3P2VA 4HT3A 4HD5A 2VUYA 3QY8A 4UZUA 3BLKA 4A2SA 1H7OA 4BWLA 4TU1A 4C6EA 3CZ8A 3EZ4A 3V35A 4PH6A 2HVOA 1R9YA 2QUTA 1E0VA 3WEMA 3U2ZA 5LNSA 2A3HA 3BSGA 3VE7A 1CX9A 5BROA 5HOSA 5G1YA 1B4KA 3SN4A 4WDUA 1LWHA 5G2WA 1HN1A 1WAWA 1XHGA 2F7FA 2AQVA 2WSRA 6PTDA 2HS6A 3TN3A 1YNQA 3AYVA 5FEXA 4LYQA 3OGVA 2VVNA 3PBGA 4XTDA 3N4AA 1HKJA 3EKLA 3AUOA 3IACA 5CSUA 5LIKX 1GQLA 3Q2DA 3RG6A 3GG1A 3NFUA 2PD5A 3SCTA 1EHNA 2ACSA 5HUPA 4ASTA 3UWWA 1V4YA 4JN6A 3SB0A 4U33A 1ZBVA 2WC7A 1CPUA 4Q6JA 4J3ZA 2V6AA 2NVDA 4NX5A 1SZGA 4UR8A 4XQ6A 1GYLA 3AFBA 3DN5A 2XN0A 3AIQA 4FXFA 4YS1A 2BP1A 2H8XA 4JTAA 2GK1B 2A0NA 3NO5A 3BAYA 1YEYA 4AZ7A 3G0UA 3CHFA 4TVDA 1P0BA 3CPRA 2I9UA 2C7FA 4B3LA 2VZUA 1GHRA 3LXBA 3W73A 3SIZA 3N3TA 3DHUA 3UEQA 4C6CA 1QJWA 3EWUA 1GVIA 1LCOA 3R0DA 3GH5A 3QMRA 2WJEA 4PL1A 3F5LA 4X22A 1VLIA 3OGRA 1S1RA 2CWNA 3PFRA 2KAUC 5EPDA 2YW4A 3C2OA 1BYBA 2YDRA 3CTLA 3WDJA 3Q65A 3FVMA 1WOBA 1K8YA 1BTMA 1M7JA 1LRQA 4ZO8A 3EEZA 5JH1A 1G67A 5BRPA 1OFAA 3MUAA 4NJJA 2XGZA 3W88A 3ANUA 5C2CA 4BF7A 4JIRA 1DTUA 1KQZA 3P0XA 4H8HA 5I3HA 3LX9A 3NL2A 3W2KA 3VOJA 1GVEA 4F4RA 2E9MA 2O0TA 3NIYA 4DIAA 1PBGA 4F66A 5BNKA 4B9ZA 1J79A 4PULA 4IPPA 2OWXA 3WDIA 2Y5JA 3KWXA 3FA3A 2ZFAA 5M17A 2DV0A 2WZHA 2BG5A 3SUSA 1BD0A 1JIBA 2ZC8A 1WDWA 1KKRA 1UR1A 4Y96A 2FYMA 5FF7A 3B0YA 3MWAA 1X6LA 4DZ5A 2X05A 1FWFC 4HK5A 1A3HA 3EB2A 1XLCA 4KFNA 3SRDA 3S3GA 3NG3A 4PR4A 4B90A 2Y6ZA 3KTSA 4FX8A 4K3ZA 4LUTB 4Z2GA 2XPKA 3IUHA 3IIXA 4Q7NA 1HNYA 1ICSA 3P7YA 4KFPA 1H3GA 1CLXA 5AC7A 1I2QA 1P7TA 4Y8FA 4FX7A 2QPXA 3LLXA 2EJAA 4DJEA 1J6OA 2G96A 3VIJA 3S2NA 2ZUMA 1QI2A 2PLCA 4ICMA 5A6BA 3WMCA 5CC3A 4S2CA 5LA0A 4DRSA 4HHLA 3UNDA 3W24A 5LXEA 1VYRA 1LORA 4PMYA 5F1UA 4FP1A 3NO1A 3GH4A 4Q4OA 3VMOA 3EWXA 5EYWA 3EKGA 4W9TA 4NIRA 4LTSA 3GDMA 3LLFA 5A8PA 3PY2A 1V0KA 3H26A 4I6VA 3EAUA 5A6AA 3LDVA 2INFA 1XC4A 2QCEA 2X09A 5ABGA 1HJXA 2BFGA 1H62A 2FFCA 4DUWA 5DQPA 3CNYA 4IFKA 2VGIA 5E09A 1GVOA 3W2UA 2OLHA 3ZM8A 1NQKA 1FHVA 2Y8VA 1XLBA 2J8TA 1WBHA 3CEUA 3UD6A 1WB0A 4DWDA 1DJNA 2WM1A 5XIMA 1S2WA 2VZTA 1EOMA 4UR7A 4AHOA 1VQTA 3UR5A 1ZCCA 2OCZA 2XTKA 1JZ4A 1QAPA 4L56A 4DI9A 2X41A 2NT1A 3GXFA 3OLGA 2I1OA 1RALA 1UJPA 2G37A 3WQ5A 1UUOA 3RCMA 4PFHA 1ZBKA 3T0AA 3JUGA 3PSWA 3S6DA 5DX7A 5LKYA 4LUSA 4V15A 3E12A 3JRKA 1OGGA 3TZNA 2WQPA 4IMDA 3VMNA 4NASA 3ORWA 1F3EA 4NAFB 3BQ5A 4IIHA 3OHIA 2XWEA 3QOKA 1JZ5A 2QCDA 3WQ4A 1PZ3A 1UR2A 3S9YA 1R6WA 4UTJA 2FVLA 3WO8A 5DXYA 3GAYA 2JKEA 1YBQA 3A23A 4Q8TA 4RNFA 3K46A 2O9OA 3E5BA 1OM0A 4D1IA 2YZ5A 1WA3A 2JQXA 1VJSA 3VOHA 4GY7A 1TZ9A 1FWBC 4J7RA 3C5QA 3GR8A 3U3HA 4S3CA 2XVLA 2WNNA 5HQEA 3E0VA 4UNIA 3USZA 4GISA 3HGJA 3DG6A 4H41A 2Y85A 4O50A 1A0CA 5DT5A 3WQ8A 4G7EB 1WV2A 2R1PA 3NQMA 7CGTA 1ME9A 3BOFA 2QT3A 1P6CA 1TR9A 4JYFA 2FVKA 3W6YA 1ZQ5A 3AYTA 3DYOA 2WZEA 3HMJG 2X30A 4J3XA 1Z41A 3UZJA 3WENA 4Y6GA 3IARA 1D3CA 4S1FA 1W1YA 1A49A 1QW7A 3C3UA 4J3WA 4XKYA 6CGTA 4DYJA 2DSVA 2XIBA 5KZMA 5A69A 1J5TA 2D2HA 3A4JA 1B3XA 2WM0A 1XH0A 1GHSA 1EIBA 3BUVA 3V18A 1LRNA 5HUOA 1UR8A 2W27A 4Q4KA 5BWAA 1H7PA 1YPIA 3PBMA 1JZ7A 4RNHA 2QGYA 4IFRA 3A13A 3TJ4A 3TEVA 3W2NA 2VP8A 5CLTA 1XL9A 4CU7A 2D2GA 5D8ZA 3H8AA 1SW0A 3VIIA 1J0KA 3WELA 1TPH1 1S3TC 1GQIA 5D2XA 1FWJC 2G3NA 1K03A 1KGUA 4R3UA 5FJOA 1YTKA 4ZODA 3NDOA 3TVAA 3R1ZA 3N3MA 5C9UA 2ZC1A 3WLHA 5CG7A 8XIAA 1EF2A 3U5UA 4UQAA 5I3JA 3AMGA 3M7SA 4MNKA 3TR2A 3ITLA 3ABQA 4NJKA 1VAHA 2OR2A 2PLMA 3PBUA 4EWND 3HTWA 4MY1A 3W71A 4DUXA 3R11A 1A0DA 4XUGA 4R7JA 1XH2A 4LPCA 4EK7A 1VFLA 3BAJA 3T1GA 3SEPA 3PVFA 3WQPA 3WH9A 4YWSA 5TIMA 2W66A 3MZ2A 3S4TA 3RM8A 3G1DA 2FTPA 1YIXA 1X39A 5AC4A 1G6CA 1Z44A 3NPWA 5AHFA 4I5RA 3W7GA 3HQNA 1BFNA 1BXCA 1MFVA 3KL3A 2ZA1A 4ATDA 3RR1A 3MSGA 1M5WA 2VL4A 4Q8PA 3CGTA 1WCGA 2P3EA 4B9YA 1NP0A 3VKCA 1O94A 3JR2A 1S2UA 2VQTA 4XZHA 3N15A 3ERPA 4NZFA 2WPBA 2WKJA 3O63A 3MSYA 4KPLA 1YTDA 4MOZA 3TW7A 3SDOA 3H2OA 1IEXA 3WUEA 1I1XA 1VD6A 3AZSA 1H61A 1LL4A 3GBEA 3RPDA 4ZA0A 5CJNA 3QR0A 3ABZA 1Q45A 2ANUA 3H2MA 1ZJHA 4AD1A 2P50A 3T2OA 2ZX7A 1W2PA 3ARVA 4QX4A 4AD2A 3HMCA 5JVLA 3BV7A 4E2OA 1E4IA 4O0KA 3WZ0E 4F0HA 4K8HA 1TG7A 4ONVA 1A5SA 2B4GA 2CPUA 2DDXA 4LC8A 3W38A 1FA2A 3FLUA 3LSBA 1VCFA 4WXZA 1O66A 4HA0A 3V36A 2X0HA 4M51A 1JZ6A 1LOLA 4CQ9A 1E4NA 1UOZA 3V1PA 5A1AA 4GO9A 4QNWA 2W91A 3SY8A 4GI6A 3ATZA 3WNMA 4HMDA 3EOUA 3EX4A 1W9UA 3UZWA 4DZHA 2QJNA 1X1OA 4LAZA 4GOAA 1O5KA 5DCDA 3W7LA 3WMBA 4DI8A 1GGOA 1W56A 1H0IA 1F8IA 1C3FA 2D69A 3EX1A 3CL6A 5EMLA 3PZMA 1BYAA 1UQZA 4W89A 4PE8A 4FSAA 1JPHA 3WF2A 2XHYA 4HNLA 5LA2A 1NJJA 4EAMA 3B05A 4H9XA 3CUZA 4ENLA 3NL6A 4UMBA 3WLOA 3FKKA 2AGTA 2QJJA 3EWWA 5EMUA 4QAWA 3M0ZA 5TF0A 1MEIA 3KRZA 1OGBA 3AYSA 4HB7A 4IXXA 3HN3A 1UCWA 3KOWA 4GLEA 2OT1A 4DPQA 1O68A 2E1WA 4CQDA 5DMLA 4UTMA 4RKAA 5EB8A 1EX1A 3M16A 4JFWA 3TW6A 2VFFA 4R5EA 4UTTA 3PZNA 3M0JA 5RUBA 1GVQA 3EX6A 2GQ8A 3APTA 1R38A 1QHOA 2OU4A 3UWVA 3NQ7A 2PDNA 1PWMA 4L1GA 1J01A 3ZWTA 4B4HA 1UZHA 3BJSA 2R24A 4UNKA 4JQ2A 4GACA 4L1XA 4LUSB 3TLLA 4XK2A 1VYSX 2WMIA 3T9PA 1XIIA 3TE9A 3A4WA 2VHLA 1VC4A 2D22A 2PWEA 3QW4B 2OSWA 3HPZA 3W9ZA 3ES7A 2PPGA 2D24A 5CBBA 3VKBA 2CLLA 2WBGA 1SO3A 1ZU8A 2G0WA 2VC6A 4QG9A 4AWEA 3PTDA 3EXTA 5I79A 4O4WA 3TCEA 4N4QA 1TZ7A 2ZBTA 3PSVA 5AHMA 3S6TA 1P4CA 4JFVA 1M53A 1WDDA 1M7XA 3C2EA 3WF3A 3NZPA 4KERA 1ZAJA 1MSSA 4CD5A 2G95A 3HZ3A 4QDWA 1G4SA 3GVRA 1JD7A 2VYOA 4YVPA 4Y90A 4TXEA 2BB0A 4MG4A 3LHZA 5A6TC 1F76A 4AC1X 2CNCA 3VILA 2CZFA 4EXQA 1OK4A 4JTKA 4PCSA 4CQAA 3AMCA 1SJDA 2BWGA 2Y7GA 4OZOA 1PTAA 2V81A 3LHTA 4BI7A 3L23A 1K7FA 4AHQA 1V7YA 3KZPA 3GRIA 2JF7A 1TE1A 3G3MA 1OIMA 4L4MA 1IT0A 4HHMA 1ZSXA 3T44A 1XIFA 3EDJA 2HS8A 4H9TA 1TTPA 1BVWA 1X1ZA 4CD7A 4FLOA 1IT7A 2GPTA 5AYZA 3OA5A 4ACZB 1FH8A 3GXPA 4P61A 1ICPA 2ZUNA 3GVGA 3ISIX 2QEZA 2PI6A 2ZA2A 4QJ3B 3HFYA 1TV5A 1EGVA 3PP7A 2VOMA 3E74A 1Q13A 3CK5A 4B5SA 1V3KA 4TV6A 3FDKA 2X1UA 5DY2A 2LLEA 2E6DA 3AZTA 1JZ2A 1J18A 3VKDA 2I7GA 3MC5A 5EL1A 4O8AA 1Q6CA 4GBDA 1P0EA 4XBKA 3OU8A 4PTVA 1B3OA 2XIMA 4ZQNA 5E0FA 1CZ1A 4KEZA 1UB3A 3NL3A 1UR3M 3UZYA 2WLZA 2G3IA 2JEPA 3S1XA 2X8RA 4LH8A 4EF8A 2FQIA 1ZL1A 2OO6A 1IZJA 2BSLA 1VF8A 3PWIA 2AQWA 5CBIA 3VK5A 3YPIA 2BASA 2G4FA 4CVWA 3NQ8A 4EPDC 4ICCX 2AKZA 1RJQA 1G4TA 3AXKA 1M7OA 1GVSA 4NI8A 4CCCA 2FZNA 3CT7A 1EUAA 1GG1A 1GCYA 3T8QA 3KP0A 4KKXA 2DZVA 4UTWC 3QPZA 1YRRA 2EKGA 4NZJA 4AC7C 4AW7A 3WJZA 1DHKA 2ZZ1A 2GLKA 3F7JA 6A3HA 4LAOA 2RGMA 5AYBA 3CB3A 1OX6A 1TVPA 3TOYA 3LK6A 4E2BA 4BI5A 2R8WA 4Z2KA 2A3CA 4HBKA 1SPQA 2DW6A 1F74A 1BG9A 2HBVA 2I14A 4UR9A 1ZP4A 4QISA 4UOQA 1FHLA 4H8UA 2ZVRA 5REQB 1E3XA 4F2UA 4EPBC 4HZ6A 3MDWA 4V28A 3MP3A 3UJFA 2PRHA 4NU7A 3MI3A 3WH6A 1QATA 1F9CA 2WHLA 2WWDA 4PMRA 3ZYZA 2YCIX 2IW0A 3G8RA 4CN4A 3B8SA 1FCVA 3LHYA 4L64A 1DWHM 1UH2A 4N0RA 3P3BA 3O16A 1JPMA 5A2CA 1OGSA 1EP3A 4LRTA 3VM7A 3SFWA 5I02A 3PUEA 2GFTA 5BOOA 4P8WA 1DE5A 2I5IA 2PGEA 1VFOA 3NNTA 1AMYA 1KM2A 1C7SA 2PU0A 4ADTA 5T8GA 3GE7A 1KB3A 3VIHA 5CPNA 1KNWA 3IAQA 4MLRA 2FKPA 4UFHA 3T42A 1VCVA 2WSPA 4EF9A 3CZLA 4WOQA 2GSEA 3VFCA 1BSLA 1VS1A 4GYJA 3FA4A 2ZRWA 3DIPA 4WDTA 5A8OA 4ZR8A 4KRUA 4C6BA 1SFJA 1KWKA 4I7WA 2EG7A 4JHZA 4IPNB 4A3QA 4MAVA 3H2FA 1XIHA 5E70A 3NQGA 4LNCA 3UA4A 2FGLA 1GW1A 3CHEA 1MZRA 4OTKA 1H5VA 2PGRA 4EXBA 4ZE5A 5F2IA 2PD9A 4AMCA 4JIPA 2Y24A 4YYFA 1QT1A 1OT2A 5AVNA 3GIPA 3AXXA 3QC0A 1ZPTA 5DELA 4WJEA 3Q4DA 2NSOA 3VAVA 1JGIA 3GTXA 5JIPA 4XO7A 4K68A 4MYAA 2OQYA 3LYEA 3W1XA 1W1A1 4R88A 4O16A 3GXDA 3GXNA 2P76A 2PWVA 1UR0A 3G1VA 4H04A 4Y9NA 3V7PA 1UKTA 4IGSA 3N4FA 5HNTA 1V79A 3WQEA 4O1FA 1E43A 1S5MA 1EBGA 1K4GA 3VXGA 5ENLA 2FJKA 1RCXB 1UWIA 3AZRA 2PF8A 5HMSA 3WFAA 3WJXA 4QXIA 4IX2A 1EPXA 4WIWA 2J88A 1B2YA 5IFPA 1E1CB 4QSHA 5MF5A 3PUGA 4UFLA 2ZE0A 2BY2A 3R0UA 5AHEA 3ITTA 1A5MC 2OSXA 4JPGA 4FX6M 3TR9A 2AMXA 1XYCA 3MW7A 4D6HA 3TTOA 4YNGA 3A9IA 2VFDA 2TPSA 4JGDA 5HK4A 4S39A 3BLFA 5E93A 4WSJA 1EA0A 2HV5A 3TJIA 4DO7A 3HG2A 1FWDC 3MVIA 5JUVA 4UIOA 1IHIA 4H4IA 2V3EA 4WGHA 3KHDA 2F38A 2DP3A 3ABOA 3STGA 5HA7A 3P8JA 1KBLA 4MFDA 4RR4A 4GUIA 5C9RA 3N1AA 4E8GA 3IJ7A 4Q4MA 4E38A 3V4BA 1B57A 3GC4A 2YFOA 4FNTA 4V33A 3H24A 3NQDA 2JE8A 1DORA 1SJAA 3AIUA 2PA6A 1UG6A 1ODZA 4Z08A 1E71M 4TTUA 4XISA 4GZJA 1J0HA 1TWSA 4I5UA 1DKWA 3TYBA 1RBOB 3GDTA 5H1WA 3OGSA 3VC6A 4ALDA 1PZ1A 1HIZA 2OYMA 1ZHAA 4WR3A 3BJTA 2BXZA 1CGYA 3SQMA 4B3KA 1UW9A 4C1KA 1S5TA 4PTDA 5EMJA 4UQEA 3CQ0A 4X2RA 3EOLA 4MPQA 2CLPA 4LB4A 3M41A 1FCUA 1OHLA 3GHRA 4AZCB 4GQ0A 3W2LA 1G7UA 3L4TA 2DUAA 5AY7A 1DEDA 2Z1KA 2YL9A 3ARPA 1KA9F 7XIMA 3GNRA 3GC2A 4JNZA 4HPGA 4IWWA 1DXEA 2AKMA 4R9OA 4ZXOA 2XFRA 1ISVA 1L8PA 1P48A 4LVAA 4ZB5A 4JTLA 1UYQA 3M07A 4PYSA 1HZYA 2CLOA 2Y0FA 5E0CA 3E1F1 5K4ZA 4GE8A 4MY8A 3UESA 4DO4A 3DFOA 4HZMA 1QNQA 1K9EA 4JR5A 3C56A 4NF7A 1IXPA 3ZOAA 4A21A 1QK2A 1SUXA 1JDEA 1EIXA 2D0GA 4JKLA 3U7VA 2F2KA 3IJIA 4LU0A 5H2ZA 3CQHA 4TX8A 2HDJA 4AZIA 1UZDA 4DZIA 1VBHA 1V3MA 4L9XA 5A6LA 4A2RA 1OD0A 1BQCA 2J7GA 5D33A 2VDGA 2JIWA 3MHFA 2NW0A 3BLIA 3M9YA 3W1UA 2FPYA 3DU0A 3KRBA 1MQRA 3L4YA 2DVXA 1KFLA 4C6OA 3FEMA 4D6DA 1ISZA 2PDMA 3H70A 2XVNA 2E8ZA 3NQFA 1EB3A 3W86A 3JVAA 2ZRZA 3IJ6A 4JTFA 5I3IA 3KOYA 5CSSA 1HF6A 3QGAC 4HIBA 3K8KA 1XWYA 3CYJA 4H00A 3MWCA 1PTGA 2OT0A 1B5TA 3CV2A 5CGMA 1IF2A 2NVAA 5CQ1A 2V5JA 3VD4A 3QV7A 5JQ9A 4XZBA 3WQCA 1W3HA 4OBTA 3VIFA 3ENLA 2PWGA 2XM1A 3GB6A 3JS3A 4HJFA 5FEZA 1S2CA 1RPKA 4W4QA 2WKGA 3R13A 1UIPA 1IZKA 1F7BA 5C54A 5HNNA 4AZBA 2PRLA 1L6WA 1QVBA 5E6YA 2QCCA 3REQB 2XSBA 4H8NA 1IE7C 4FOKA 4ERAA 3AXMA 2YCJA 1B31A 4FO4A 4O1CA 3VO0A 3KS5A 1JR1A 3WLTA 3AS3A 3GW3A 1NWUA 3SO7A 2AL1A 4JTGA 5I3KA 3I68A 3P61A 1JPDX 1VKFA 2UBPC 4M6QA 3GR7A 1JF6A 3SR7A 3PAOA 1UBSA 1CCWB 3FX4A 1I1WA 4L80A 3DUGA 1BYDA 3LMZA 1KFJA 2YB4A 3FY1A 2HPIA 4H19A 1BXBA 4QEEA 4HA4A 1A4LA 4TO8A 1TA3A 1QMLA 1JAEA 1OY0A 3GBDA 4JKKA 2ISVA 3BAXA 3S1GA 3CLMA 3NJ3A 4MB3A 3VIKA 3WD4A 4ROQA 2F84A 2FTYA 3WIJA 1RCOB 5FKYA 4YHGA 2HISA 2WV8A 4PC8A 1XDMA 3OYZA 3IJLA 3VOFA 3TROA 1WXJA 3EWCA 4JN8A 3KBNA 2VRQA 4CNUA 3GXTA 2UY5A 3R6IA 1QFEA 3G5EA 3TU9A 3W81A 3BW4A 1A5CA 3RAOA 1GONA 3W26A 3EDDA 3ZR4A 1NDYA 3TNOA 4LANA 3LOTA 3PPFA 1CNVA 1TX0A 1M7PA 3I4KA 1LL6A 3H4XA 5BU9A 1BVNP 4QAIA 1H7NA 4UTWA 2PP3A 3A3XA 3TTYA 1EYEA 1SJCA 3CQJA 3F03K 3ZLHA 2E6YA 1L6YA 4IP7A 2F9RA 3NGFA 4HOZA 3UJ2A 3N13A 1LLZA 3IANA 3W22A 2QCLA 3C0JA 4LF2A 3A4XA 3MMUA 5L9FA 1TPB1 5CBJA 4M56A 1H7RA 3GX9A 1WDPA 1IEQA 4XAYA 4FF5A 1XQLA 1DPMA 4QCFA 2BOFX 3WLQA 1NVMA 4Q32A 3Q67A 4H7ZA 2ZICA 2XN1A 1HXJA 1KM3A 3GZ3A 4UFIA 1JRCA 1PX4A 2J75A 2NUXA 3TV8A 4IF2A 4B5VA 3B03A 1C93A 3M43A 1MI3A 3CWOX 1X7IA 4Q8MA 4A6GA 1JXJA 2RKXA 4CUCA 5BOEA 4Q4SA 1EUNA 3TLQA 4EVZA 1KM0A 1UD6A 2IPGA 3ITXA 2VWSA 2F2HA 4Q8WA 4KIRA 5D03A 1UQYA 2TMDA 4OUEA 4K36A 1RP9A 2VD9A 2WYSA 1EO7A 3AHXA 1TB3A 1Q6RA 4B2DA 4R9XA 5FACA 3W83A 2PGFA 3LPGA 4O13A 1FOBA 1OCNA 4JICA 2GJLA 2C18A 2WVVB 3IS4A 1OQFA 1AFSA 1VFSA 3IIPA 1XFCA 4JCMA 4MWAB 3QFWA 2Y2WA 3GNPA 2TRSA 3PUDA 2E8YA 3G6LA 2E77A 1AW2A 3F2DA 4ZENA 3WLMA 1DIKA 2C79A 2YBUA 3FXYA 3AHYA 5HPOA 3CT2A 3PZGA 3WF0A 1TMLA 1VPQA 2ZKMX 3R10A 3GU9A 4N9CA 4YTUA 4PTXA 2ALDA 1TPEA 4DJEC 1M01A 5MHBA 2UY2A 1YHTA 3MSRA 3RCYA 3M46A 5A3HA 4M29A 4PMOA 2EPLX 4ATWA 3CUIA 3DECA 3ICJA 3K30A 4IH3A 5FJPA 2OB3A 2E1DA 1T99A 1JZ3A 1DJXA 1BHGA 3FGCB 3RO6A 2G8ZA 3R43A 4C91A 3E49A 3KTCA 4H3DA 3E2VA 3SQLA 3IIVA 3WBYA 1FBAA 4IIBA 5D02A 3FYYA 2WCGA 2OGYA 1JCJA 3NO3A 1UBPC 5D2WA 1WKDA 2QKFA 2V9DA 2VQUA 4QS5A 4BCEA 1EHAA 1LUCA 4GNVA 5FCZA 5H6HA 4GI8A 4M1BA 1S38A 4I90A 1UOKA 1VEPA 1XLJA 3F5KA 4HNTA 3LPFA 4FIQA 5IM51 1XM3A 1I2OA 4LEQA 1ONRA 4GO8A 3R8HA 3LGDA 6ALDA 3GNDA 4TQTA 5EMKA 3AS0A 1OG6A 4L9ZA 3DC0A 1J2BA 4A3HA 1TREA 3EMCA 4FF7A 3WQVA 1J11A 2Y63A 1X98A 3UFYA 4KEVA 1EFZA 1XRVA 1LP6A 2H3BA 3T2PA 1OFDA 1Q65A 4LEFA 3BGAA 3PM6A 3MCOA 3KVMA 3E2QA 2Q02A 3DKJA 2MANA 4X63A 1A5AA 3P74A 1VJZA 3NQEA 2VR2A 4A3YA 1E6ZA 3QGVA 3VD9A 1DQWA 2YBTA 4HKPA 4JAWA 1T41A 1IIGA 1MVYA 3PNUA 4G56A 1EGZA 3GSMA 5FF3A 1W3NA 5KMYA 4O1EA 3VGFA 5JMUA 1AG1O 2C13A 1UA7A 7ODCA 2XH4A 2BY3A 1EP1A 1FDZA 3HBLA 3APYA 4LAMA 5CAKA 3DXIA 2E9BA 2C15A 1RJRA 4EAYA 3URNA 1X8FA 1JRBA 4XBJA 3FJ4A 1KRMA 1E9IA 3CUGA 4FNUA 4Y9PA 5HINA 5IHRA 3DENA 3W37A 1OT1A 3KE0A 3N2XA 5CSRA 1IWPA 3S8HA 3E5PA 4O1AA 5DANA 5F4WA 3NYZA 5K2ZA 5T9BG 4J1OA 5DRIA 1QOQA 2WJDA 3H7UA 4GVIA 4PMVA 3L2IA 3SUTA 2QJMA 4GKLA 5B7YA 1DWJM 1N82A 4QP0A 3KBVA 2A1YA 2C1GA 3AMKA 1UKQA 3SCVA 5BMXA 3GUGA 3HGRA 3M5VA 3B97A 3PFMA 1QR7A 3LPPA 3WH8A 2GJPA 2UY3A 1R30A 4JTJA 3QHNA 1ZJAA 3N18A 3WNLA 4DYEA 3M47A 1E6SM 2ZTJA 1JD9A 1M6JA 4HNOA 4C90A 4WF7A 3UW6A 1UA3A 2ZXDA 3IJQA 4LW7A 4NZ4A 3DC8A 3WN6A 4OKDA 9XIAA 4IQLA 1RK6A 4ML4A 3TXVA 3HIJA 4WY0A 3S47A 1F05A 3T6CA 3N2TA 3QMSA 4NSBA 3OVQA 1OFPA 1GK8A 3B3DA 4P7LA 2O7QA 3MUZ1 1KFEA 2OODA 2D1ZA 2JKAA 4E2VA 4ZMGA 2DJLA 5K9CA 2F6KA 1JF5A 1EXPA 2C3ZA 4KMQA 2PDCA 4BA0A 3I65A 1TV4A 4PCFA 2IPJA 2XVKA 4PTNA 1DIEA 1RY8A 1C8QA 1LG1A 2CXEA 4O53A 3WJWA 2JF6A 4O19A 3SW6A 3W4RA 1SO4A 1BLIA 2ZYFA 2KX9A 3DGRA 4S3DA 2A79A 3GG8A 1RSCA 3N2BA 1KV8A 2YLAA 4NJIA 2J9XA 1XUZA 5EMYA 3RO8A 1ITUA 4NJGA 2XH7A 3RRAA 3ANYA 1TIMA 4HTBA 4H7CA 3RXZA 1V6WA 2QS8A 2VTFA 4C1NB 3NZRA 4N4PA 4JOMA 4ML9A 3WG6A 2YDSA 4XX6A 3S6OA 4E3VA 3MCNA 1XLFA 2PTDA 1XSKA 4IICA 2XU2A 1I0BA 3C0SA 4TR9A 3SGZA 4WXYA 5CC6A 1Q6LA 3P82A 4KCWA 2FB3A 3R79A 1AZ1A 3PS7A 5HDRA 4OE7A 3KBWA 5AYYA 3AJXA 4HSNA 1YE6A 4UQ9A 2XVGA 1RZMA 2NLIA 3B4YA 2GOKA 1EJTC 1ISWA 4N6EA 4D1JA 2CEQA 2HMCA 4J9JA 4UQBA 5GNZA 1E72M 1HX0A 4HCDA 2CZDA 3HV8A 2YCLB 4OGZA 4LUJA 3VDBA 2NX9A 3R4IA 2B0MA 1O1ZA 2QNEA 3BZGA 3MZNA 3UJRA 1XIJA 1P6BA 1FWEC 3L65A 3SRHA 5F4SA 3BGGA 1XINA 1UZ1A 3XIMA 3T8LA 2XN2A 1D8CA 3K8LA 4GPNA 3C61A 1KLYA 3WSUA 1QCWA 2DH2A 5DCBA 1KFCA 1DE6A 3CH9A 1R3TA 4ORIA 3ZVIA 1EBHA 4A35A 4CNOA 2VENA 1XBZA 2BZNA 5IBXA 4CN6A 2D23A 3UCCA 3W7KA 2QJGA 2YPIA 4A4AA 3FHQA 2C16A 1Q8AA 1J0IA 3EB4A 3T08A 3MKKA 1A5OC 3VTRA 2W6RA 2J62A 2WCSA 3MB9A 4V1XA 3SCQA 4LYRA 1VCGA 2BDQA 3BL3A 4YPJA 1A53A 1QK0A 3SJNA 1J9YA 1PWLA 4MVAA 6REQA 2QCMA 3ATYA 3V5OA 1Y8BA 2F6XA 3VDGA 4UMAA 2B7OA 2OPJA 2REQB 2VNCA 3TC3A 3GKAA 5U7SA 4UB9A 4YJ5A 4LAKA 4EIVA 4ZQMA 5FJIA 3TYEA 3VCCA 3IVTA 3HA1A 3H7VA 3QQ0A 3POCA 3OZPA 3APGA 3OEXA 5LNWA 1RV8A 4R27A 2ISWA 4PSRA 1C9DA 1IV8A 3WK1A 1EPVA 4JIIX 1QNPA 4BKNA 4S3KA 1SSDA 1VBRA 1TJ0A 4NX0A 1KV5A 4ZQPA 4Z2JA 1NDVA 3HOJA 4EOUA 2GDVA 5XIAA 4QHRA 4DYKA 4ZOAA 2WMKA 1B0IA 2Y4SA 1D8WA 2XIJA 3MP4A 1UKSA 2Z6IA 3VZXA 1W5PA 1YQ2A 3ARWA 1XGZA 1XIMA 2CBIA 3CMGA 1FWGC 3NPUA 4Q4PA 1MXDA 5CH9A 4R33A 3W6MA 3HQ1A 1VRXA 1K9DA 3N2MA 3BCDA 3LGEA 2FZDA 1HO4A 4AYGA 4HMEA 3K1DA 3C8NA 5I06A 1L8NA 3NR0A 2HWGA 3N25A 2A3LA 2OLAA 3F4WA 2INZA 3VIPA 1LLOA 2YXGA 4UC5A 3N4EA 2Z24A 2PAJA 1MDLA 4I7VA 3ZR5A 1XLEA 4DJDC 4Z1CA 3L68A 4I9AA 4U28A 2BTMA 1IYXA 2UY4A 3MVTA 2FMNA 5AHIA 3NSNA 3VNYA 1K70A 5IXEA 2ZCGA 4MGGA 1EDTA 3EXRA 3CO4A 1E5JA 1V5XA 1S2AA 1EKOA 1TCMA 1F4AA 5BXPA 2VEPA 3MI2A 4RE0A 1ZP3A 1FFRA 3LS9A 4EE9A 5I78A 5C70A 3T81A 3UYCA 4BQ5A 4A8LA 3P80A 4GGBA 5LXXA 4DX3A 1K8ZA 2XUCA 4L1WA 2ZXQA 1Q7QA 3M64A 4IGNA 4RL3A 2D3LA 1AVAA 1ZJBA 4DBSA 1CXHA 1H4PA 2EF9A 3VMPA 4HZ8A 3P93A 4JN7A 2WHKA 1AW5A 4IGHA 1U5VA 4IUOA 5CZSA 1R3QA 1QRQA 2R1MA 3KVLA 3W28A 2FH8A 5D09A 1XBYA 1D7FA 4DJDD 3OQEA 4AAJA 2DSKA 2DQXA 4HA3A 3MBFA 3NA8A 1TJ2A 4O17A 5HWMA 3PZOA 4HHHA 3SY5A 1FWRA 1OSEA 3CU2A 1WBJA 1NAL1 1Q6DA 3NPVA 4HOXA 3VD7A 3S5YA 2A2IA 4IPIA 3CV6A 4WJ8A 1TMHA 4M5PA 2VVSA 1GUVA 1Q6GA 3R8RA 4DXVA 2AAMA 3N9KA 1FWAC 4PMDA 5FJJA 2V68A 1PEZA 4URIA 4JX6A 5MKGB 4LVBA 4LVGA 1A5NC 1GOWA 3DOPA 5A6SA 1AK5A 1UR9A 4HPNA 3RJYA 4PTWA 3SCWA 2FB2A 3I3DA 4UTTC 4WK9A 2A6NA 3W7CA 2PDWA 2FDMA 2CWXA 2J24A 3G24A 3L0NA 3W74A 4XIMA 3W7DA 4L6DA 7A3HA 2X40A 3H2NA 3QV9A 3L4ZA 4X9YA 1ELSA 2J7BA 1ZY9A 1N2VA 2PGWA 5CPMA 2G3MA 1HVXA 3O0KA 3PZ9A 2ALRA 3AC0A 3CUXA 1R86A 1QPQA 4W93A 3U8GA 1KCLA 4P7QA 3V16A 1M9HA 4GQQA 4NYUA 4JTQA 3W76A 5DT7A 3CZKA 3ZVHB 3GNNA 1E9LA 3CIWA 3QPYA 1TPC1 4N9EA 1MZHA 4QBXA 3LI0A 4Q8QA 4F0MA 4YN5A 3KBJA 4KWSA 1OFBA 2ZX5A 3TSMA 5AC5A 3CL7A 1PYMA 3GDBA 4MADA 5FEWA 1FUYA 4H9YA 1BQGA 3V75A 3WX7A 4UTKA 3T40A 2P5NA 1YBQB 1GVFA 5AYXA 4IX0A 5CJ5A 1SMAA 3UWQA 3CPUA 1PKYA 1SJBA 2DVTA 4QITA 1VFFA 2DORA 4IZGA 4WVXA 1EJSC 1EZWA 3TJXA 4JHMA 2XISA 3K8MA 4ZO6A 2XFFA 2OLSA 2YL6A 3W6LA 4U4MA 4K7YA 2WSQA 3EDKA 3VNMA 4LBUA 1PX3A 2P10A 4Q4QA 2VJXA 1WE5A 5LYRA 1R3RA 2Y5SA 4RW5A 1OC6A 1OFEA 3ANVA 4UTFA 3C0QA 3KUMA 5C71A 4ZSUA 3ZLGA 1AD4A 2R94A 4UOZA 1SW7A 1ECQA 2HNHA 5I24A 3G1XA 3GVVA 5A94A 4PUDA 1F73A 3RK8A 3W02A 2D0HA 3MY9A 1ITXA 1XLIA 2I16A 2YSWA 4M7TA 2HVMA 3W7HA 4XVEA 4PBEA 2OZ0A 3TSDA 4FNQA 1XKJA 1PKMA 5CEWA 1U2YA 4XD3A 4E8CA 1OK6A 4GC4A 3W7JA 6XIMA 1R2RA 4KWOA 4X2PA 1LQ2A 4OV4A 1UIOA 4HYRA 3DGBA 1E6QM 3L5MA 4LNYA 2C1HA 3L67A 4KFOA 3VNDA 4HU8A 4HMNA 4XG1A 2V3FA 4A8RA 4Z2LA 1W2VA 4UCGA 3QN3A 1ENUA 1XSJA 4J3UA 8XIMA 5A8NA 2YCLA 1CYGA 2WQDA 1NOUA 1W5MA 3VX0A 1M3UA 4JZ5A 2QUVA 1GEQA 1PZ0A 3UNTA 4PMNA 4XD5A 2HE5A 7TIMA 2GQ3A 1HUVA 1FRBA 3LCLA 4LV9A 4O1DA 4GVHA 4PCNA 3ABXA 3MI6A 4C6DA 5PTDA 3H12A 2J6XA 2Y89A 2OWCA 3RLUA 2OWWA 2ZX8A 1PDZA 4JIEA 3LXCA 3WDHA 1KXHA 4YLWA 2PUZA 3SZ8A 5HATA 1RHCA 4C6IA 1SZFA 3H54A 2QCNA 3A5VA 3I7QA 4UQCA 3KOZA 2VR5A 3F5JA 3UT0A 2BNJA 3NQCA 1OWQA 3WLKX 3QZ6A 2J27A 3CZJA 5HWNA 5D4YA 3DFQA 3DZ1A 3BMXA 1W3JA 2QMJA 4AY1A 3TQVA 2DVUA 1TJRA 3U0HA 1E1FA 3VKAA 3TA9A 3O05A 4D8LA 3URBA 2YL5A 4ROPA 4IG2B 2QF8A 2DZAA 1EP2A 3PJXA 3LTPA 3CBWA 1ISYA 3RLHA 1N55A 3FHAA 4EWJA 1D3GA 1DWIM 1REQB 3M0LA 2Z0IA 5HMEA 2H9AA 2O9PA 3KDNA 5LNRA 3GDLA 1DJYA 2HNEA 2PMQA 3GIQA 3TH6A 3UGRA 1O5RA 4IXHA 3VKKA 1ML1A 2J7CA 5GJPA 3ONCA 2CHRA 5D38A 2V3GA 3W84A 2FHCA 5E0KA 2DZUA 5D2VA 5I3FA 1KXTA 3NPXA 5C7VA 1JAKA 4TTGA 3ARTA 3W29A 4FS9A 4Z1DA 3RU8X 1QO5A 5T91A 4QM1A 3O6DA 4OECA 1FKXA 2VC9A 3LQLA 5KETA 1OF8A 4A22A 4UTUA 1AQHA 3PB0A 1J0YA 5EKYA 3Q37A 3D5HA 4O1BA 3Q94A 5LZLA 2DT3A 1MEHA 3W7OA 1R3VA 2Y7FA 1MUCA 2F6UA 3ZMRA 1Z89A 4INFA 2YJQA 4KS0A 1A5UA 1R5YA 4WCJA 3E0FA 5I23A 2QCHA 2VFEA 4GNKB 1IGWA 2VXNA 3R94A 1W9BM 3AIEA 1OB0A 3DI0A 4NI3A 1I4NA 4MKVA 2DIJA 3MO7A 2Y62A 1OBAA 2B31A 3UP8A 4NQ1A 4IIEA 3AS1A 3H4GA 1ZGDA 4C6LA 4PGLA 2QHAA 3VGGA 1J8VA 3OOQA 3UBPC 4EANA 1ICQA 3EMZA 1M1BA 1G0CA 1TIWA 4H9VA 3FOKA 5G5IA 2AAAA 2BS9A 3GY1A 4JNYA 1E0XA 3QTPA 4WQ6A 4GFSA 2HQAA 1V02E 3FK4A 3EDFA 1JCYA 1SYTA 4EP8C 3FDGA 3ZLFA 1XX1A 3AWNA 2YXOA 3TJLA 1XPGA 2D73A 4N6FA 1TJ1A 2ZWZA 5GNXA 5KINA 3GIYA 1Q4WA 1H1YA 2HK1A 1BGAA 2Z27A 1MYRA 4Q33A 2J7HA 3GU1A 4GFIA 1XF0A 4BZYA 1Q6EA 3H21A 4N42A 1NWSA 3UVAA 1THFD 2TSYA 4GKTA 1KR1A 1NDZA 4RLIA 3RUBL 3B9EA 3BDKA 4FNRA 4L6OA 2XWDA 3VM5A 4DN1A 3TTSA 3NQ6A 1RR2A 5M2FX 2GWGA 1K9TA 3WK0A 3QTGA 1QO2A 1DQXA 5CZTA 1FH9A 1XYLA 4DJFD 3C3NA 2OJPA 4Z1YA 2ZZ7A 4B2DD 4GX9A 5AC6A 2DT0A 3G1YA 4PB5A 3L5AA 2ZZ4A 4E6MA 1B1YA 4IQJA 2J4GA 1FP9A 3O15A 4L61A 4LXFA 1JZ8A 4V1YA 1VENA 3U2EA 1WUFA 1H63A 5CPOA 1UPMB 2WLYA 2A21A 4RW3A 3HURA 1K6WA 3VIOA 1FHDA 3P67A 3GVWA 3STCA 3RMJA 1CTNA 4MF4A 1O7AA 2ZRUA 1JYNA 4HOWA 2G50A 4PUNA 3TQKA 5AZ1A 4J3VA 4MB1A 2VGGA 2XVPA 3NWRA 4LGXA 1C90A 2WCAA 4JYDA 4WGXA 1FDYA 2WMGA 4CU6A 2JIEA 3B8TA 4IL0A 4KH2A 2Z25A 2FZBA 3LNPA 4DXKA 5A2BA 2ZTKA 1ZAIA 1NOFA 4OU1A 4ZE4A 3USBA 1H60A 4IQDA 3UCQA 8A3HA 1JL8A 3C4UA 1C8YA 1QI0A 1K1DA 3A9BA 4H2HA 1JDDA 1U1HA 2CLIA 3I3EA 3W7QA 1K6AA 1F3TA 4ZBCA 2VEKA 5DFAA 4CKQA 3PNZA 2WSKA 3NZ1A 4OIFA 3PR2A 4G8TA 1VEOA 4B5XA 1TCDA 4UFJA 2HEJA 1FP8A 3UF9A 4MWAD 2DT2A 4AD0A 2IKHA 3AJ7A 4QDPA 4GI4A 3H7RA 1ZAHA 3CAKA 3LSCA 3W01A 3SUVA 4JCLA 2PFHA 3W72A 2IQTA 3S5ZA 3PPHA 4DM2A 4JTDA 3BMVA 4GD0A 1OYBA 1YDYA 5E9XA 2PDLA 4KGLA 3WQWA 2CKSA 3CYVA 1M41A 3NEHA 3QJAA 1VP5A 2O9TA 3EWDA 4MTVA 1VR6A 4GYFA 1DHPA 3MO4A 3V5FA 1LOSA 5JH2A 1GZJA 1VIZA 3LM3A 1JYXA 2B7QA 4AH7A 1Q2RA 4I9TA 1U22A 3BSHA 5IFTA 1GJPA 2ZZ3A 2EO7A 4MY9A 3WEZA 3GTHA 4G1KA 3W2MA 2YGYA 4DLFA 4IMGA 1HKIA 2CCRA 4M80A 1WKEA 3RCNA 1XLGA 4KWWA 4IPJA 2J6VA 5DMMA 2HXTA 3EA2A 1UJQA 3MYOA 4ZSTA 3LNMA 2Z7KA 1HJUA 3PBVA 5HJXA 2RH9A 1WNOA 4G2DA 4FOUA 1LWJA 3VDAA 5TBOA 4AYSA 1XGEA 2DUXA 2JALA 3H2EA 3OZYA 4GUHA 1XICA 2VX5A 2IQ0A 3VNZA 3CPGA 4MNLA 2BOGX 5AHLA 1S5WA 1GZGA 3U48A 3MYPA 3WBWA 5F7UA 1B3ZA 1JPKA 1KXVA 1OFOA 1XBXA 2DW7A 1KBJA 2R1NA 3TWAA 3FVDA 5HAOA 4GHRA 4K37A 2VKZG 4HU4A 5FIPA 5CPSA 3OZOA 5KITA 4XD4A 2WOQA 1MRQA 2L5HA 4O0QA 1BWKA 2FZMA 3H23A 2VEMA 3TMLA 1W1ZA 4UQDA 1G94A 1OEPA 4GI9A 3O8AA 1TWDA 4RNIA 1X96A 4TMBA 3QQ1A 1W3KA 4BQ3A 2W61A 1T96A 3TNBA 3G1FA 2WWCA 3PZQA 3WD0A 4J2PA 3TYUA 4K1GA 3RRXA 1TPFA 2CFFA 4D6IA 4M8UA 1UUMA 3PZUA 3E0LA 5FF4A 3KW3A 4W8AA 4I8DA 3L2LA 1PKLA 3SM0A 2PC4A 3AAMA 3N6HA 3RLVA 4UNLA 1T5AA 1Y5VA 4TUFA 4JQAA 3TC7A 2YLLA 4NILA 3DHFA 4R7WA 3VIMA 3RILA 1K7EA 2V0TA 1SM9A 2GGHA 3WDRA 3VI2A 3C6CA 2GSJA 1R85A 1W31A 3GR4A 3PULA 2G5WA 3MU7A 2AOSA 2RHGA 3EEGA 3OIHA 2XH2A 4I3GA 3O9NA 4CQCA 3NZGA 3GHTA 2WMHA 1O12A 4GIEA 1RD5A 4MUPA 4AVOA 3AOFA 3THQA 3UPBA 3BPWA 2XYLA 1QI4A 3TDFA 1UWQA 4DUVA 3KM8A 3KCLA 5IBXC 3UXDA 4Z17A 4LWWA 1QI5A 3G18A 1T8QA 3DFYA 3OO2A 2E5DA 1V93A 2NV1A 3IGXA 3VABA 1E6NA 1R8LA 2J8GA 3ZIZA 1DV7A 4HP5A 1Q2SA 3TN6A 4LAUA 4C6KA 4BF5A 4G7EA 3W7IA 1CXIA 1H09A 5GPRA 2J7EA 5BWFA 1U1UA 2QJIA 5I0DA 2Q6ZA 3AI0A 3DHDA 1Z7AA 3C2FA 4JDBA 1EGMA 4C6JA 2R14A 4C6MA 3BLPX 3ECQA 4WRHA 4MAZA 1E6XM 1W9PA 3TK7A 4F40A 4RNJA 3UG4A 4DWSD 2DGAA 1TKKA 2RFGA 3RDKA 4TV5A 1B9BA 5FJRA 2YDAA 3JZUA 1K4HA 4E0CA 2Q01A 5A8MA 3DX5A 3IJ9A 4AD4A 1NTHA 6TAAA 4RUBA 1LLWA 3CS2A 2C1IA 1V6YA 5CPTA 1GQNA 2X7WA 2E67A 4ZGYA 4OBRA 4AD3A 4EKJA 5I3GA 7TAAA 1V3LA 4GCXA 3WJYA 2YA2A 1X97A 2FZ8A 5EA9A 2NXHA 1LF1A 4GCAA 1YXYA 4WLCA 1UP3A 4P7NA 3ITYA 1POKA 3DYMA 2O4MA 4CD4A 2IKIA 1XC6A 4ZCWA 2EPMX 2ZX6A 3UPWA 5BCAA 1OZMA 2DPEA 4NVTA 1VYPX 4PCPA 1AA1B 4W87A 4FZIA 3ABSA 3SIMA 3B8VA 3VGDA 3AHVA 2VGFA 1KKOA 4JL2A 2I17A 9CGTA 1K9FA 2NQJA 3DG7A 1XPYA 3SGUA 5M5DA 1U5JA 1QPRA 2GSHA 3BANA 2PODA 1A80A 3UU0A 1NFPA 3RNDA 3U57A 4ECLA 5E1QA 3IK2A 1TWWA 3ES8A 4H9ZA 4PFMA 1K8XA 4QQ3A 3T7VA 1P6WA 2XSAA 3LHWA 1RLDA 3BG5A 3ABRA 3NSMA 1ITQA 1YDOA 4PA8A 3VD5A 1VPXA 3PWGA 4X3ZA 3N19B 1OCJA 4AY7A 3F2BA 2PC8A 4XO6A 1UD8A 3CV1A 3WDQA 3CXOA 3FIGA 2DH3A 1R87A 2ZQ0A 1NARA 3S9ZA 4GJ1A 1ADOA 5C6MA 2DZSA 4OUIA 4S3AA 2XSXA 3CJPA 3L4VA 4PRRA 2R1KA 4UXDA 3UXLA 3ZJ8A 4U31A 3LHUA 3CAQA 2OOFA 2ZUUA 4UFKA 3VDCA 3PPGA 2C0HA 2W92A 2V82A 3CM4A 3DYPA 3WUGA 2QPSA 4W7WA 1ZZMA 3RX2A 3MKCA 2NT0A 1UASA 4GIRA 3AHZA 2G3FA 1WKYA 1QNRA 4IMEA 1PL9A 1E5NA 2GGIA 3FGCA 3WQOA 3BMWA 2V2CA 1XFBA 5FD0A 4LBRA 1RD6A 1YNYA 3D47A 3QPEA 2QDDA 3QHMA 4RZBA 5TNVA 1Y7VA 4NAEB 3NM1A 3ZVHA 3EWYA 3WQGA 2J8FA 3L4WA 1L0PA 5D9NA 3UXKA 4PUJA 3K4AA 3STEA 1AH0A 1ZBWA 4B15A 2RUSA 1D7KA 2FPTA 3BZJA 3BG3A 4MJMA 4CCEA 1MO0A 4YYCA 3BWWA 2ISFA 4K2SA 2VCCA 3AALA 4M6UA 2OOGA 1SR0A 3FKRA 1FVPA 2PLKA 3AIRA 3SCPA 4HN8A 3NXFA 2J9ZA 3MUCA 2POZA 7ENLA 1KM6A 3OZMA 4LV4A 2WAGA 3LLDA 3B0VC 2QAFA 1L6GA 3CWNA 3LHVA 3GAKA 5EGRA 3RPTA 4GVGA 3FV9A 4PUMA 1H5YA 1CXLA 4GXWA 1Q7ZA 3LERA 4PZVA 5HJYA 3BICA 5G4WA 2CLMA 2X2YA 4QSFA 4HNCA 4CGTA 4GWEA 4U10A 3G8EA 1B54A 3ARYA 4QIUA 5XINA 1XDLA 5SWUA 3E96A 3WNNA 5FL1A 4DAIA 5FL0A 6REQB 2DEPA 2WZTA 3S1VA 3MV01 1EDQA 1W54A 2IPWA 3A47A 4MSSA 3W1RA 3LB0A 2BVDA 3SY1A 3AQUA 4M0XA 1H2JA 1E3ZA 2D2JA 4IHCA 3CMFA 1G7VA 2QUMA 3AISA 5C9XA 1KR0A 5AN7A 1WZLA 4ZFCA 5G4HC 4G6CA 3U5YA 3WUFA 1VFUA 4WEVX 1OFQA 1AQFA 4DJED 2JKPA 1E6RA 3A24A 4Y9MA 3CH0A 2PDGA 1UD5A 5A6BD 3WQFA 4XAGA 3S2JA 3MKVA 1EJWC 1XYBA 1KFBA 1DJZA 1QTWA 2DY3A 2F61A 4Z0SA 2AGKA 2IUZA 4CQ8A 2J78A 2FGBA 1XG4A 5J8LA 3BAKA 1W1IE 2KZHA 5LGXA 3S0CA 2DT1A 3EX3A 2TAAA 4L6HA 3MS8A 3UGVA 3N6JA 3KTXA 4MPKA 1OYCA 1ZTVA 2PEVA 2PTYA 2OX1A 3FA5A 1B30A 1FWTA 2Y1HA 4AWSA 2P0IA 2YKKA 1F07A 4GYPA 4XAZA 2C8NA 3QZEA 1WYIA 1F6YA 3P62A 4POCA 3WLPA 2GYIA 4ATLA 3WD3A 1U5HA 2Z28A 5REQA 1BKSA 2WC3A 1RJPA 1TA3B 1YADA 3BVJA 4XZWA 2OYKA 3SN1A 1H49A 2GDQA 1P5BA 2R82A 4IJCA 4Y2WA 4Q8NA 3TFXA 3FW6A 1UP2A 4RZ6A 2GJNA 3KAOA 2PF0A 3ARQA 1Y0EA 2CC0A 1TTJA 3CQKA 3TUUA 3ZT6A 4RDYA 1H11A 2QUNA 2GDUA 3OLEA 1J96A 3KEHA 2I5QA 3NTYA 2GGGA 4RXFA 3HG5A 3UPMA 4A29A 3UA3A 3VNLA 1J5SA 4DF1A 5ABHA 4NZ1A 3GC5A 1EF3A 5D9MA 4XTIA 2OXNA 2NZLA 3E3HA 1XR2A 3ITOA 4UMCA 3WK2A 3RX4A 2VX4A 2YBVA 4RX0A 1OZQA 2R1LA 3NEVA 3PZIA 4B16A 3TP4A 3CV7A 4JTUA 3SBFA 5CPQA 2NSXA 6ENLA 1UUQA 1PIGA 2WPGA 3L5LA 1X6UA 2VCAA 3THCA 1E56A 2QW5A 4XBSA 1XRTA 4O57A 3T4CA 2CIPA 1ADDA 4C6PA 3FSUA 3SFKA 1BKHA 4DY1A 3TN5A 1HGWA 4WKAA 2B7PA 2V2DA 3CIVA 1HW6A 3R0KA 5BW6A 2Z2BA 1W9VA 1BXNA 1NSJA 3DFTA 3OG3A 4RZ4A 2ZRXA 4DBUA 1UMLA 5D2YA 4H2CA 4E5TA 1FHUA 1D2KA 1MWOA 4LVDA 2YXXA 1QPOA 3RPMA 3C2VA 3EOEA 4MHBA 2D20A 3R2GA 3KXQA 1IEWA 2ACQA 2XGIA 3ZR6A 4AUBA 3QM3A 3B9AA 1UH4A 1XYMA 2OEJA 1LDCA 2FDSA 1QXLA 4NG3A 4RPPA 2ZOXA 3LRMA 4NZ5A 1ZRQA 4ZTXA 4ZTYA 2DIEA 5KZDA 4P7OA 3MANA 5DMYA 1D3HA 2VX7A 2WVTA 4NAFA 4FPSA 3QR3A 1RUSA 4MWAE 4FXSA 3BAWA 1L6FA 4IUGA 5GQBA 3RJXA 2J77A 2ZDSA 1GQKA 3EYPA 3DBNA 2RAGA 1HL2A 3FXGA 1J12A 4PMJA 1GVYA 3INPA 3GS6A 1G4EA 1W3TA 1TV7A 4PL2A 3KBSA 3OPSA 3STPA 1KFWA 1HFBA 1Z32X 4MZYA 4C1LA 3WNPA 3GTIA 2ABBA 1LBFA 1DJIA 3B40A 3WCZA 2Z1XA 5FSEC 2VEFA 1KWGA 1JXKA 4AIOA 1SFLA 2WO5A 3VE9A 4XIAA 3R12A 1R47A 2VC5A 2QDEA 3VGBA 4S3FA 4PMQA 4JY9A 3U4AA 2O55A 1AMKA 3SURA 3ARSA 1L2UA 1VBGA 4KQNA 3RMEA 2VURA 4ZQRA 3E6EA 1NDWA 2OQLA 1J2WA 4XWUA 2OZ8A 4UFMA 1XRFA 5D9PA 2EXOA 4JEJA 1X38A 4J3TA 3A64A 4HJWA 4MJ2A 1EQCA 2VFHA 4IMAA 5LIXX 3EPNA 1NU5A 3EA1A 2EKCA 1TQXA 1AJZA 5EBAA 1DQUA 4AB4A 5I6SA 3PAJA 3GG0A 3M1ZA 4AZ5A 2V2HA 1YDVA 3I6RA 5GJMA 1UC4A 1ECEA 2PWHA 4W85A 4DBEA 3VFLA 2PB1A 5I07A 3KDOA 3NQVA 2BHZA 4DPPA 2MUCA 1A4MA 3UZZA 1A5KC 2CBUA 1RPXA 2CU0A 4UTHA 3HGSA 3LQGA 1TTIA 4L4OA 2A5HA 3V3WA 1V02A 1DOSA 4RDWA 1OF6A 1R46A 4YL2A 4GQRA 2BODX 2E68A 4EPKA 1DVJA 1MNZA 3GDKA 4CCZA 1KTBA 4X0NA 1W5QA 2TYSA 4RZ5A 2BVWA 3M7WA 5A8QA 1LTDA 4M19A 4KEMA 1XIEA 3EBVA 4QE1A 3LCFA 4H9UA 1JCNA 2BX7A 4QDMA 1V0NA 2Z4GA 5BYWA 3P84A 2NQHA 1O6IA 2QJHA 3KVJA 2O4QA 2VRJA 3M0HA 1PVNA 4GNJA 4PN2A 2ON3A 1AQ0A 3M0KA 4MNMA 1QWGA 3EWBX 1J0ZA 5FAJA 2OMAA 1US0A 4CVUA 1CGXA 3G77A 4B5NA 3DKLA 1BG4A 1TO3A 4W5ZA 3KX6A 4LT9A 1YE4A 1EL3A 4Q7BA 1UC5A 3BG9A 4X9SA 1TZZA 3HF3A 1YX1A 1I8JA 1TUFA 4E4FA 1MW0A 1B3WA 1W6TA 3QYQA 1GOKA 4BS0A 1EJ7L 3O3RA 3T0TA 5TD4A 3S9IA 2VELA 2ZZ5A 3SCNA 3I10A 2QV5A 4FALA 4Q6XA 3ZT5A 3QKEA 4C6FA 4Y9OA 5LNVA 2BVTA 4W8LA 3I4EA 2Y8KA 1T40A 1Q4NX 1KBKA 1R7OA 5HNRA 3RM9A 2OELA 5HQMA 3KRUA 1IXQA 4RE3A 3N17A 2YA1A 2E28A 2CZ5A 4BQ2A 3AU2A 3HGOA 4HU0A 4PRTA 1LQ0A 4G7FA 5IHSA 5HQLA 2XIIA 1XJBA 4JIQA 4KGJA 2WHJA 3IVUA 1IIHA 4HNNA 1UROA 1R2SA 3PANA 1PDYA 2ZADA 1ME8A 2HSAA 4RE4A 3TWBA 1GYMA 4M3PA 3URQA 2XZ9A 3P8IA 4GZIA 2PDIA 1E1CA 1V08A 1PKNA 4KCUA 4BEQA 1HJSA 4CNSA 3ZZ1A 2V5CA 3AS2A 2VC7A 1W3IA 4R53A 3QLLA 2VR4A 4XSMA 3DESA 2DQWA 3DFNA 4IIDA 4XVDA 4M81A 1OVDA 2G41A 4AG0A 1JVNA 3KP1A 1VHNA 3LU2A 1VRDA 3TAOA 3OHMB 5A6MA 2Y5EA 5FSDC 2G3JA 5ABFA 1XS2A 3C52A 4KCVA 2HXUA 3E9AA 3OG2A 4AFYA 2CBVA 3O6CA 1MQPA 2G4JA 4HQVA 3DI1A 3W25A 2PLJA 5DEZA 4F2BA 2BXYA 1UD4A 1XYAA 4FLRA 1UP0A 1OX4B 1JDFA 1LUCB 2Z2AA 3DERA 1FY6A 1KCXA 3N6QA 1P43A 4YVVA 3GHSA 4RK8A 4CQBA 1CLKA 4O10A 1Q6FA 3NOEA 4NZCA 2ODOA 4QLJA 3OVGA 1W1TA 3LBOA 2W63A 2DZPA 4EXAA 4MB4A 4B91A 4IOTA 1W1PA 1TTQA 1RK5A 4OHQA 1A3WA 1GW9A 2VEGA 2BGQA 3QSTA 4W7VA 1ONWA 2JBMA 2YB1A 4O15A 3URAA 1H7WA 4LYPA 1DJQA 4H83A 4AD5A 2ATSA 5KZ6A 1BWLA 3TKFA 4LOCA 1FWNA 4S3GA 2AL2A 1TMQA 4A8IA 1UPPA 2IS7A 2O7SA 9XIMA 4GIYA 1DIOA 1L6SA 2CHNA 2CW6A 4LUIA 4MZ1A 4P2VA 3B9DA 5BU6A 2EQDA 1CGUA 4JTSA 1KLZA 1CENA 2CLFA 1MW1A 3RX3A 2GQ9A 2PWUA 4JDYA 4ILSA 3IAPA 3U4FA 4HTYA 2IXUA 1RH9A 4GZEA 1KC7A 5LA1A 4GH1A 1XLDA 3W87A 4WY0B 3W7NA 4G9PA 2A7NA 1MQQA 5K9XA 3AYRA 1US3A 1SZNA 2Y7DA 1Q3NA 1W8SA 1PSCA 1QPKA 3E0WA 4NJHA 5D04C 4GXPA 2CKRA 3BLEA 3PC0A 3QVQA 1FXQA 3VUPA 3A22A 4ZB2A 4F0KA 1MW2A 1EEXA 1H1ZA 2OQHA 3HU7A 2VI0A 5LNUA 1FWSA 4K8GA 5E6ZA 3TFCA 3ARXA 4DXXA 1CIUA 2XINA 1HO1A 3CZGA 1VFHA 1FWWA 1SW3A 3THUA 4NT0A 4HK6A 3MJYA 1NF7A 3L9CA 2E3ZA 2V3DA 4RV3A 1EC7A 3HO8A 1UD2A 3CHDA 2CLEA 2AQOA 1QBAA 4DZAA 4BQ4A 5C7HA 1VGAA 3W7RA 1P1XA 4Q8OA 3GK0A 3BARA 1BF2A 4FXRA 4JIHA 3NUKA 4C6QA 4NL1A 3OBEA 1GJUA 5G4EA 2WBKA 2A7PA 2PP0A 1MNSA 5FEPA 1K3UA 4LUYA 1NF0A 2ACRA 5M1TA 1Z69A 2UZ9A 4TIMA 2OZ3A 3A4AA 1XYFA 3NAVA 3LBCA 1C9WA 5CAHA 2QIIA 4JXCA 3DFPA 2Q3RA 3WF4A 5DBTA 4M82A 4PUEA 2CITA 2W9MA 2WXDM 1O5QA 4JKMA 3PHAA 1YPXA 4JQ1A 4NNAA 4C7FA 1VFTA 4YCPA 2V63A 4LYKA 3PUOA 1TPVA 3UXIA 3IRSA 3ZQ9A 5HR7A 1S2VA 1BYCA 4FR6A 4Z1BA 4QE5A 3WDPP 3QXBA 1OFRA 3KRSA 4GIAA 5L6UA 2QMKA 4ZO9A 4XZLX 2QR6A 4I9JA 3UWEA 1F3WA 1KM1A 2X0SA 1S5VA 2C14A 1YXCA 2BY0A 1JCMP 3PTMA 4HMCA 5AECA 1MEWA 4MDPA 3NURA 3A3HA 5J04A 2RGLA 2ZX9A 5JXQA 2Q09A 1HL8A 2Y7EA 3W00A 4IFKB 2Y70A 2Q3OA 3E0IA 5HPCA 2YOCA 1U1JA 1A5LC 2ZWYA 2PSNA 3P5ZA 2GJXA 4I9MA 3TC6A 3UG3A 3FYPA 4IMCA 4Q4RA 5JBEA 5C0QA 1BRLB 3WH7A 1PCWA 2C91A 1TWZA 3W3OA 3GUWA 3HM7A 3NXLA 4AIUA 3UR7A 2G97A 2ISSA 4NHVA 5EFFA 3HPFA 1TFVA 2I5GA 1WZAA 3VVGA 3CAWA 2OEMA 4U5KA 5IDIA 3MT1A 3QGKC 4P8UA 1GKPA 1J6PA 3AIBA 3WMLA 3WK3A 4IP5A 3DH7A 4J40A 3UY8A 3T4WA 4JBRA 3OBAA 4IIFA 3ID7A 4RDVA 1SO6A 3WKZA 3LCWA 1GZ1A 3WL0A 1RLCL 2VDHA 1F5ZA 4YIWA 3RU6A 5HMFA 4HK7A 1FCBA 3S5SA 4NXSA 2V69A 4PUKA 5KEZA 3FSTA 3B0XA 2W79A 1E73M 4BJHA 3LGGA 2P8BA 2UWFA 4V2XA 5LIUX 4HYVA 4M7SA 1BF6A 2FPVA 4NNCA 4N02A 1RBLA 3DHPA 1W1B1 4QJ5B 2NLYA 3WD1A 3WUBA 4WD0A 2QULA 1QOXA 7PTDA 3GQYA 2NVCA 4ZEPA 3EOSA 4IQEA 2ONEA 4EACA 3QOMA 3S42A 3VDHA 1IQ8A 4S23A 1LG2A 3RITA 1KRAC 2R9RA 1TELA 3P14A 3LRLA 4JQ4A 2QYGA 4OT7A 2A3EA 3E2RA 5DMNA 3DBPA 2ZZ6A 2H3DA 3CO8A 4IT1A 4TOQA 3ZXWA 5DCEA 3MCMA 1SVDA 2PDYA 1WXZA 2WJFA 2PWFA 3BLOA 3JZEA 4L5ZA 2NX1A 1JYWA 4C60A 3GZAA 3IIZA 3MSDA 4AZ6A 1MXSA 2ICSA 1O4UA 2VZSA 1UWRA 4R85A 1E0TA 3GU2A 4H6RA 3FJNA 1U30A 1UKPA 1V0MA 1V77A 2IKJA 5D9OA 4MMWA 3OTRA 1VZWA 4X61A 4D6EA 1LWIA 4S3EA 3L0KA 3Q58A 2VO5A 4TX9A 1I60A 4PMZA 3CL8A 3NVDA 3VPLA 1Y65A 1JI2A 3I7SA 3FEQA 1YNPA 1PIIA 5AVHA 1QNVA 4ZO7A 4PCTA 5ABFB 2A6LA 3FFSA 4UCFA 1VBUA 4LCRA 2ZIDA 2GK1A 1O60A 2H90A 2EG8A 1POJA 5DO8A 2NQLA 1XQKA 1E70M 2VFIA 2D0FA 4AVFA 1XKYA 5CPLA 1XRSA 3O6AA 3GO2A 2EJ1A 3NL5A 2H9AB 3CLWA 3G1AA 4LCQA 3NZQA 3LUTA 2GVGA 3RR4A 3F2CA 2XDFA 4J5NA 2WANA 1CI1A 1W8GA 1OADA 3ELFA 2EHHA 3IWPA 2QPUA 1ISXA 1S5NA 3MV11 1PV8A 2PWDA 1PZ2A 2PCEA 1AQMA 4HPHA 1ZNNA 2CBJA 1FQ0A 2XFYA 1QHPA 3BAIA 1ZB5A 1E6PA 3A12A 4U3CA 5C9ZA 3S2CA 4IP4A 4D9PA 3G1HA 4J27A 4YCOA 4C5ZA 1NM9A 4IMFA 3R89A 1LJYA 2HRWA 1O5XA 3BO9A 4F9JA 2PDKA 3QFEA 1GKRA 1AJ0A 1XIDA 2FZ9A 2FFIA 3B0PA 3KZSA 2QQ6A 4NRSA 3VD3A 5HNUA 5KTLA 5DN1A 2BBFA 5GJNA 1T7LA 3H2AA 4BK9A 1OINA 5LIYX 4AISA 3AUJA 3UZXA 4AY8A 4LS0A 4CLMA 4QRNA 3WJSA 3HG3A 3B06A 3S2MA 4CD6A 2ZRYA 4MJ4A 1GPFA 3UCDA 1N8WA 1CLVA 4U2YA 2V67A 5A2AA 1S46A 4O54A 3ZS4A 4RV8A 4UWMA 4JTHA 3DEQA 7REQA 3LRKA 4LB3A 4QGCA 1UHVA 1BAGA 4L65A 4IIGA 1E4LA 1YKWA 1OCQA 4RXGA 1R7AA 3CASA 1IXOA 4A05A 3NCOA 2Y8UA 1CBGA 1WUEA 1K02A 1DL3A 2HVNA 2VX6A 4TVCA 3LD5A 2RJGA 3BOLA 1PTDA 4GYKA 2VMFA 3AROA 1UWUA 4LS1A 2UV8G 4JD4A 2VCBA 1JUBA 2FHBA 2XIOA 4MDOA 1A3XA 1WZKA 3TTEA 3G2GA 4IISA 2XGBA 4QJ4B 3QSRA 2B7NA 4B5WA 4P8XA 5G1TA 4DVOA 1W37A 2E6AA 3AICA 4ZB0A 5K3VA 1ADSA 2X1RA 1W1VA 2RJHA 4XAFA 3CAVA 3CHCA 1RQHA 2R6OA 3IPWA 4PB4A 2E40A 5GVJA 1XXXA 4K38A 2XJ7A 4LRSA 5D2TA 1FDJA 1HKMA 3TA6A 1KTCA 2IMRA 2QF7A 4XZMX 1EH9A 3SECA 1QW9A 3Q45A 5C5YA 3LCXA 2J66A 4W8BA 1F4HA 3MP5A 4GGHA 2RDUA 1WDRA 1XSIA 4FMVA 3R8GA 3G22A 1PUDA 1DJGA 4JFTA 3T2QA 1LM1A 4JX4A 4JTIA 4DO6A 1WKFA 1PS9A 4DAFA 2IPFA 4GZ7A 3I3BA 3W0KA 4M1RA 4C6NA 3S1UA 3MQTA 4PMXA 1Q7MA 5C8BB 3HB9A 2HBXA 4XKYB 1SQ7A 2HE8A 3GG7A 1BTCA 2BLEA 3GYCA 3EMQA 4D8AA 3OVRA 1KBBA 1AH3A 1JCXA 2PBOA 2REQA 1QDSA 1GYNA 2CERA 1RP8A 2BVYA 3WLNA 1HL9A 3UYIA 3IJDA 4UOJA 3TOPA 1DBTA 2GQAA 6XIAA 1Q6QA 4G5DA 1M65A 2QIWA 4NY2A 4WSKA 1WZMA 2CZEA 4KCTA 5IOBA 3V0UA 3EOOA 4XZ9A 2ZXBA 4D6GA 4A3UA 3MHGA 3LEPA 4PSPA 3TN4A 3F4NA 3OBKA 3T0CA 4XB3A 1SZRA 1WAUA 5C55A 1N8IA 1DWAM 1A50A 1Q85A 3R7MA 3SCOA 3H22A 3LTSA 4L4PA 1TE6A 1B4EA 3BCJA 1QWKA 1RCQA 2VUNA 4PBFA 3WLJA 1OD8A 4I7UA 4O11A 5H8PA 1HG3A 4J4KA 2ZE3A 3UERA 2GVLA 3B4UA 3TX9A 3QKZA 4UTLA 2HPMA 2YZRA 1CXKA 2WSYA 4CCDA 3H4WA 1EA9C 3VA8A 1XLMA 2Q71A 5DY3A 1TUXA 2WZMA 2QDGA 2NQZA 1CWYA 4IL2A 3CZEA 1HQTA 1S3HA 5HJLA 4W86A 5CJMA 3K13A 3OIXA 5J5DA 4AXNA 5F2MA 2NXGA 1P7TB 1XCXA 2E25A 3O0FA 5AYIA 5LHFA 5I2UA 1UWSA 1ODUA 4QG8A 4HNVA 3N9SA 4MZ8A 4Z42C 1Z48A 5KSWA 2J74A 3QBUA 4LVFA 2X1SA 4XZNX 1GOIA 1EDGA 1YMYA 3T05A 3PN8A 1EQPA 1E15A 1KFKA 2WC4A 1G01A 1ZS2A 4FOJA 3VGEA 1AH4A 3TYAA 5K4XA 2WVSA 1X7FA 1H51A 4DHGA 1PB0A 4GC3A 3KLKA 4LY8A 1LT8A 1O1HA 1KO0A 4Z0JA 2VD8A 2QGHA 4ADUA 1Z6KA 4CU8A 1JUEA 1LROA 1NOWA 1WOAA 3IUDA 3EGJA 1TVNA 1K77A 4AEFA 1XLAA 4TVUA 1TRDA 4W84A 4BFAA 2PCQA 1V51A 3ONBA 5AFDA 1A47A 3QYSA 3XINA 2Z00A 3LI1A 1TPWA 3WYZA 4KETA 4BHYA 4H7VA 2PDHA 2GUBA 2CLHA 2P8CA 3ZJKA 4JX5A 4K8EA 4N2YA 4OOZA 3VUSA 3W82A 4O52A 1PHWA 2JK2A 4GBUA 3CTTA 3WLIA 2VRKA 4NRRA 2J7DA 4LF1A 4LJ3A 3WD2A 1SZEA 4WX2A 3BK0A 3BQ6A 3VNJA 2EBNA 1MDRA 1ZFJA 3UG5A 3LN3A 3EDEA 1HKKA 5CXPA 4ES4A 2YX0A 1FCQA 1CGTA 5EBUA 1Q63A 4QNEA 1Q66A 4KWUA 4RPQA 3K1GA 3A3WA 4Z1AA 1UH3A 7REQB 2WKLA 2EPHA 4A3RA 1LOQA 2BGNE 2IKGA 1KRCC 2DIKA 2FVMA 2PE4A 3C2YA 3QQWA 4AIBA 4OOUA 4JYEA 4L7ZA 2NV9A 1R3SA 1B9ZA 5IRPA 1DXIA 4DBDA 4DQWA 4E3TA 4KESA 2I9EA 1LRTA 4Q7IA 5DF0A 3AMDA 1C7TA 1DWFM 4HU3A 3EKZA 3W1NA 3QEZA 2FH6A 2OVLA 3IGUA 2GOUA 2JEQA 1JGMA 1EO5A 4AU0A 1TPUA 3GDRA 1M03A 3I6EA 3QW3A 5I09A 1NIUA 1FX6A 3QHOA 1OX5A 3GFZA 1JDAA 2XZ7A 1JDCA 3B8WA 1R9ZA 5J5RA 4U3AA 2PTWA 3WEOA 2WMIB 4L4LA 5CSYA 2WVUA 3N9RA 4MM1A 1H41A 2GZXA 3KL0A 3IGSA 1C8VA 1OJXA 1XI3A 1SSGA 4LFYA 1PX8A 1SO5A 3T55A 2CETA 1XGDA 3UWYA 4W5UA 2GVYA 1W3LA 3ARUA 1KBIA 3H53A 3B04A 1Z8AA 5F4XA 2ZUVA 4FNPA 3IIOA 1GJWA 4AX6A 4US5D 2OEKA 2W0UA 1G9HA 1DP0A 1L2QA 3M44A 1F61A 3VNIA 4IM4A 3LENA 1JI1A 3L4UA 3UWUA 1I0DA 4WSHA 1GG0A 2NWRA 4KW2A 1NFBA 3IJ8A 3SRFA 5D8WA 3A21A 3RIKA 3SAZA 1PHQA 1QW8A 3F1QA 5B80A 4WHBA 2E09A 1BWVA 2E7FA 4AIEA 3ITCA 2HROA 4X0VA 3SUUA 4YTTA 4TX6A 3SCSA 5CGTA 3OJGA 1XLKA 1W9DM 1B90A 3EXSA 5A5WA 3K5XA 3LA4A 5I3DA 5DLCA 2WMJA 3QY7A 1WQ5A 4AHPA 4YXGA 4QTGA 3HQOA 5CCZA 4LALA 1GVRA 5K9DA 2PDPA 4JNMA 4O12A 1UWTA 1W5OA 1TX2A 4ACZA 1V3HA 4RE2A 3SGGA 4XUYA 1X1NA 1W0MA 4YTRA 4LQ1A 4J3SA 2GGJA 1VHCA 4CEXC 1GQJA 3PJWA 1E51A 2ZRVA 3TCSA 1XUUA 2A3AA 1TV3A 3JU2A 3KS6A 1ALDA 3ZO9A 1EZ2A 4J28A 2GUYA 3FAWA 1D9EA 4YVXA 2V5DA 4E2DA 2WVVA 3GHUA 3T07A 3W85A 1PIFA 3HPAA 4IJRA 2EPKX 3N11A 3ZSSA 4FA3A 3SN0A 4LBSA 2EPNA 1NELA 4MNJA 4F0LA 1T0OA 1UZ4A 3BSMA 4D2JA 1MXGA 4M24A 4LS2A 1IEVA 2P3ZA 2Z6JA 1W9XA 5LSMA 3N2CA 4E8DA 3QV6A 2DZTA 1GWJA 3VCNA 2BMBA 1DIDA 4PTMA 5M03A 1V6XA 2PDBA 4MB5A 3H55A 2OO0A 4QQUA 4KRZA 2PDXA 1KGWA 2DZWA 3OLDA 2X1TA 3MTWA 4GVFA 2Z1SA 1I9CB 3WH5A 3FN9A 3PK7A 5HXMA 1NP2A 2ZA3A 4ZOEA 3D0CA 1FWHC 3GFXA 5E9AA 1QBBA 2W67A 3O1NA 5CZJA 2ESCA 3GH7A 3T0BA 3BLLA 4LC6A 4F0RA 3LCGA 1EXBA 1HJQA 4QLKA 3N34A 2FJUB 4MKNA 3AIWA 4C7DA 3ME3A 1F8MA 2YCEA 1W17A 4RCXA