3IJ7A

Directed 'in situ' elongation as a strategy to characterize the covalent glycosyl-enzyme catalytic intermediate of human pancreatic a-amylase
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Directed "in situ" inhibitor elongation as a strategy to structurally characterize the covalent glycosyl-enzyme intermediate of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3ij7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ij7A01
2FH8A 2WPGA 3RIKA 2HISA 2DSWA 4J3XA 1KQYA 4F8XA 3VIPA 4OOZA 3CGTA 1VFMA 1KGXA 2DSKA 2ZWZA 3MO4A 1V6YA 5AYBA 2XFRA 2WBKA 1GVIA 2CIPA 7CGTA 1R7OA 1UHVA 2CXGA 2YA1A 1MQRA 5D8WA 5DT5A 1DWGM 1JI2A 1UD6A 3VMNA 1AMYA 3PTKA 1YQ2A 4IISA 1WDPA 5CZKA 5DFAA 1TA3B 2YFNA 4D6CA 1PX4A 3F5JA 2D0HA 3BGAA 5CQ1A 1PX3A 1FA2A 5A6AA 3VIHA 1OGGA 3SURA 3WKZA 3BLPX 2VX6A 2G3MA 3OZPA 3PZMA 4U5IA 2OYLA 5E09A 1J0JA 1F4AA 4MDPA 3TTYA 4AY1A 4FNPA 1K9DA 4JAWA 5CJ5A 2ZUVA 3VNZA 3BH4A 3PHAA 4P7RA 3W0KA 4HA4A 2WANA 5JBEA 2GJRA 4AWEA 1B3XA 3BVVA 1UWIA 2AAAA 2J7DA 1W9BM 2FH6A 3GNOA 5M3WA 2NW0A 2WXDM 2XVKA 4EK7A 3ZJ7A 2VR5A 1BVNP 2YA0A 1IZJA 4FK9A 1E5NA 1JFHA 5AY7A 1AVAA 1V6WA 3ECQA 2D3NA 3ZJ8A 1J0KA 4AMWA 5IXEA 3WL1A 4AZCA 2XYLA 1VJZA 1PJ9A 3OIHA 3HG4A 2X2JA 1TVPA 2WMFA 3QOMA 3DDFA 4NXSA 2W92A 3VINA 1NP2A 3CZSA 5A2BA 3VIJA 3BVUA 4KGLA 1V0KA 2V3EA 4UQ9A 1HF6A 1NOUA 3WEMA 3ZO9A 1E6QM 1KGWA 1MVYA 3W25A 3F4VA 1J0IA 3T0BA 3WH6A 3BXWA 1W3HA 2CETA 3A4WA 5HNNA 4JKMA 4RE3A 1R34A 4IUGA 1H5VA 1VRXA 1HL9A 1CXHA 1XC6A 3GH4A 4AYGA 4NXKA 5LYRA 2ZOXA 1HL8A 4UQBA 7A3HA 3CHFA 5ECUA 1ZJBA 4BQ3A 1N82A 1NWSA 2VZTA 4C7FA 1JZ8A 2C0HA 3ARWA 2YDQA 3L4WA 4P8XA 3OLGA 3WDHA 5E70A 2EEXA 4AMXA 2ZXBA 2VCAA 3MKKA 3UR7A 4WSJA 3A4XA 3L2MA 4JFTA 1W3KA 5BXTA 3M07A 1ZL1A 1NM9A 4HU8A 3CUIA 2QF8A 2EPKX 3MV11 1O6IA 1QOXA 1H3GA 3AHXA 2J7EA 5CLWA 2JE8A 1UYQA 3ARYA 4CU7A 4Z2JA 3BSGA 3LX9A 2GK1A 2F2HA 4W85A 4J3TA 2VX5A 3A6OA 4PCSA 2Y24A 3DHUA 1QBBA 2JIWA 3W24A 3BAIA 4AD5A 3CMJA 1QNRA 4JCMA 4UQAA 2PWFA 1J0ZA 2HVMA 5A8QA 3HMCA 2J7FA 1I1XA 4P7LA 2V38A 3VKKA 3OB8A 1W3LA 1HIZA 3MANA 2WHMA 1CTNA 2XN2A 2J7CA 3SEPA 2VJXA 3QHNA 4PBGA 4ZEPA 3G6LA 3CH9A 1BGGA 3BUBA 4AZ7A 4RE4A 3DX1A 3GXDA 3VGHA 3H54A 2WCAA 2D73A 4RL3A 4GQRA 3SCQA 2CHOA 3ALFA 5ABFA 3GXTA 4M1RA 2X2YA 1UKQA 1W9PA 4PCTA 3T2PA 1ISXA 5D9MA 2WHJA 4ATLA 3AOFA 1ZBWA 1G94A 2ZICA 3AIWA 3WF4A 3GNRA 1HJWA 1JI1A 2QMKA 4EANA 3PBGA 1UH4A 3BUQA 1RH9A 2VZSA 2O9PA 3BUPA 4PTVA 4W87A 2VRQA 3CLWA 1NWRA 1G5AA 4P7QA 4UOQA 3LXAA 1XSIA 1C8YA 2WC7A 1LQ0A 5HPOA 4GIAA 5LA2A 4CN6A 2X2HA 4IPLA 3EDJA 2J4GA 2CYGA 2ZUTA 1BVZA 2JF6A 2DPEA 1ISVA 3VIOA 3PZ9A 1JZ7A 1FFRA 4LYPA 1MW3A 4QFUA 3WNMA 1CGUA 5I5RA 1CWYA 2WMIA 1Q6CA 1PZ3A 2XUCA 3WMSA 1PX8A 1UR2A 4W7WA 2JEPA 1AQMA 3ZQ9A 4PMRA 2V5DA 5F7UA 4K68A 3UERA 4AW7A 2Y8KA 1E55A 3O2LA 2QLYA 3BLKA 1GW1A 4HOZA 1UKPA 4F66A 1UOKA 2WVVB 1UKSA 4GO8A 1WZLA 2GJXA 1VEMA 3IAQA 4EKJA 4WKAA 2FYVA 4PSPA 4W7UA 3WQVA 1MQPA 5DMYA 1JF6A 3QOKA 4AEFA 3WN6A 3WNLA 3TTSA 3WNOA 5M17A 1E6PA 1HN1A 1ZJAA 4AXNA 2DGAA 3ARSA 3POCA 3AQUA 5HDRA 3FN9A 2FDMA 4ATDA 1TCMA 5EBAA 4UFMA 2VUYA 2BS9A 3KLLA 3BMVA 1G0CA 1K9TA 4EE9A 1CNVA 2OSXA 3O9NA 4CKQA 1QHOA 3QGVA 1LWHA 1E40A 3OA5A 5JBFA 1OBAA 3WUGA 2D20A 1JZ4A 1EOKA 1WP6A 2C7FA 1ODZA 1GCYA 2XGIA 2E0PA 2DEPA 4PEEA 2VL4A 4ZE5A 5BWFA 3K8LA 4B3LA 2E40A 4C7DA 4DWSB 2EBNA 4CU6A 3I3DA 5CGTA 5CSYA 3LPFA 3VMPA 3WNPA 4DUWA 3PTMA 3CPUA 1E9LA 4E4PA 3AS1A 4FNSA 4P7OA 5GNYA 4PTMA 4TXEA 1WZKA 3B9DA 3BVXA 2X0YA 2XVLA 3FHQA 2F18A 3WF3A 3LPOA 3CHCA 3H53A 2OWXA 3A5VA 1JNDA 4AZGA 1QHZA 5CPTA 4H41A 3D50A 3A23A 2CEQA 3OG2A 1K9FA 3MSDA 4ACZB 3H55A 1J9YA 2VT0A 4HPHA 3U5YA 4TX6A 5GNZA 4MB4A 4U3CA 5A8PA 4D71A 2YKKA 1GUVA 1BFNA 5M03A 1BPLB 3D5HA 4AC1X 3GH7A 5ABFB 4JCLA 1QI4A 4UOZA 2YBUA 3WF1A 4KGJA 4B3KA 1W9XA 3CMGA 4OOUA 1HJXA 3WH9A 5BCAA 1KXVA 4W8BA 3WELA 3VM7A 1UD2A 4GO9A 1XD1A 1R7AA 2WNWA 5A6SA 5A1AA 4CN4A 1BYCA 3WEOA 3WNKA 5A69A 2QV4A 3MMUA 1C91A 1CGXA 3WD2A 1E1EA 5CPSA 3CHDA 3SUTA 1WNOA 1E72M 3IANA 1PPIA 2PBOA 2WLZA 4E8CA 3FW6A 3VX1A 4JKKA 3IJ8A 4HTYA 1H1NA 1GJWA 3NIYA 4V28A 5I78A 1LLOA 1XD0A 1Q6DA 2PI6A 1JZ3A 1TQWA 1UR9A 3FY1A 3HJEA 3DC0A 1V0NA 5BXSA 4BA0A 1DWHM 1GPFA 5D9OA 3MUY1 1DWFM 2DIJA 1F4HA 1V3MA 4JIEA 2J78A 3SCNA 5FL1A 3WUBA 3WFLA 1VJSA 1BLIA 2WMKA 1BF2A 3NYDA 3W4RA 4QLLA 4UQDA 2ZX9A 1V6XA 1UASA 3GZAA 1V03A 1Q6FA 2WZHA 1G1YA 4ZE4A 2YL6A 3NJ3A 2F7PA 1C93A 2WVTA 4FLQA 3OGRA 5JUVA 1QI2A 1CXLA 1DWAM 3OLEA 3PZQA 1E6RA 2XG9A 2BY3A 2EABA 2VRJA 4V2XA 3L2LA 1QW9A 3AHYA 2CHNA 3THDA 3ZMRA 3SCOA 1AQHA 1E5JA 3W6LA 5GNXA 1HJSA 1ISWA 3CZ8A 2CESA 4TVUA 4M82A 1TG7A 2DDXA 3PZVA 4XZWA 3DYOA 4ZENA 4HU0A 3VIMA 4OIFA 3CZGA 2BHUA 4JKLA 2XN0A 1X1NA 1E4IA 3W38A 3WF0A 4TTGA 1EQPA 2A3EA 5HOSA 1US2A 1TQSA 3W27A 4U31A 2Y2WA 2RGMA 3VDCA 1C8XA 3THCA 2UY4A 2IXUA 5DF0A 5CSUA 2XWDA 2W4XA 1UR0A 3W81A 1JAKA 4CVUA 2XJ7A 2JIEA 2X09A 3WNNA 3TTOA 1E71M 1VFUA 2JFEX 4UR9A 1JYVA 1GHRA 3ZJKA 1GHSA 1MXGA 4ACYA 3TOPA 3RM8A 1WO2A 1QNSA 4NRRA 4JFSA 4HPGA 1WPCA 2DIEA 1R85A 4AZCB 3VSUA 2UY3A 4UZUA 4M81A 2JEQA 1UR4A 4UFHA 4W89A 1GORA 1NP0A 4UZSA 5CGMA 4UFJA 3PZOA 1JG9A 2F7OA 4HMCA 5FIPA 4TTUA 1BG4A 2XSBA 2WAGA 3M46A 4M29A 3EJRA 1PEZA 1SMAA 2NSXA 3HU7A 2X8RA 1WZMA 2DH3A 1IV8A 1HVXA 2XFFA 4AZHA 4FNQA 1JYXA 2VQUA 1OINA 2CNCA 4KRTA 2EPNA 2D22A 2WC3A 1MFVA 2FHBA 2UWFA 2J7BA 4GQQA 1VBUA 1FP8A 3EJTA 3UG3A 4E2OA 2DQXA 3GDBA 5FOOA 2WHKA 1BQCA 3UG4A 4H8HA 1UWUA 2GFTA 2XPKA 4BS0A 3W6MA 1MFUA 2EQDA 4UCFA 5EB8A 5EFDA 2W66A 3WH7A 4OZOA 1OD0A 4JZ5A 3LRLA 2WBGA 4JHZA 4FLRA 2D23A 4ZFMA 4UOJA 4NX0A 1L0PA 3PZGA 1U2YA 2GK1B 1XV8A 4UFKA 3WUEA 4HOXA 1WDQA 3JUGA 3WQ5A 3LXCA 4WSKA 1CXEA 1BTCA 1V3KA 3WIJA 3EDEA 4JL1A 1B3VA 3MS8A 4YHEA 5A6BA 4P8VA 3RCNA 4OBSA 1C8QA 2WK2A 1EGZA 4UFIA 2J62A 4MTVA 3LRKA 3NSNA 2VVNA 2ZUSA 3AMGA 2W67A 1E56A 4D6IA 5DT7A 6TAAA 2ZXDA 1FH8A 1I1WA 5FCZA 1Q4NX 3CTTA 5KEZA 4XV0A 2DSUA 2BHYA 4BF7A 1HJUA 3AFBA 2CBJA 3BAKA 2GDUA 3A4AA 1C7SA 1B0IA 2VQTA 1CLVA 3WQ6A 5I79A 2VZUA 1XHGA 2E8YA 2DT0A 4YHGA 3WH5A 3ARXA 1ZBCA 4B9YA 3D51A 1BYBA 1OT2A 4U2ZA 4Z2GA 4L4OA 1H09A 2XVPA 3U57A 1HXJA 1B90A 1NH6A 4Z2IA 3AS3A 2EADA 2F7QA 3SCVA 2YLAA 1GQIA 1EDTA 2EO7A 3WH8A 3L4UA 2V3DA 1GNXA 2VC9A 3APGA 3HG3A 4HOWA 3MU7A 4D6EA 3LMYA 1HT6A 4KH2A 5A6BD 3K46A 3SCPA 5C70A 3FAXA 2FHFA 3W28A 1BGAA 3N17A 1UWSA 2DT2A 2WZEA 2A3CA 2Z1SA 2BVDA 4S3KA 4W5UA 1KWKA 1HJQA 4Y7EA 2J25A 1TVNA 2Y5EA 1KBBA 5M5DA 4OGZA 3D52A 4CUCA 3I3EA 1UD3A 3BUDA 3ZJ6A 3L4ZA 1EHAA 2WVVA 4X9YA 1W1TA 5C71A 2G8ZA 1EH9A 4Q7NA 3T08A 3L4VA 2VO5A 1E15A 5A94A 1EO7A 1LG2A 5I2UA 3VIGA 5BRPA 3AMKA 1B9ZA 4AD4A 4MADA 4CD5A 1KTCA 2WKLA 3IK2A 3DHPA 1LJYA 1NOWA 5AC5A 1OIMA 4W8LA 1B1YA 1QNQA 5TD4A 4CCEA 3J7HA 2ZE0A 4PMUA 2J74A 3ZSSA 4H7VA 2G3NA 4QCEA 3SUSA 2VI0A 2WMHA 3ZR5A 4D6FA 2WCSA 1GOKA 1M01A 5I3DA 4MAZA 2DT1A 2YFOA 1WKYA 1EDGA 1ITXA 1GOQA 4U33A 1XCXA 2GJPA 2ZX8A 1CYGA 4TOQA 2BHZA 3KWXA 1E73M 1QHPA 1UQZA 1A47A 1JFXA 4HZ6A 3GXPA 4MB5A 1UWQA 3GXIA 2B31A 3UESA 4D72A 2J75A 3VIFA 1KBKA 7TAAA 1JZ5A 1V02A 1SMDA 4BQ2A 1XRVA 4DWSA 1TFVA 2WKGA 3D4ZA 3ARVA 4NF7A 1JZ2A 3EYPA 2V3GA 4IM4A 3DX2A 2IUZA 1UQYA 4P7NA 4ML4A 1H4PA 3S5YA 1DP0A 2WLYA 3VPLA 4HMDA 2VZOA 3HZ3A 1H49A 1XCWA 4PRWA 2PF0A 2WZIA 4CD8A 1UA7A 1O7DC 1E70M 5A6KA 4MB3A 4W7VA 4HZ7A 4PTXA 1KFWA 1R8LA 1PAMA 2G41A 3SCTA 4NZFA 4QLKA 1C7TA 4A3YA 1RPKA 5CXPA 2X05A 2VCBA 4QLJA 1GOIA 5A8MA 3ARPA 1KCLA 1FHDA 1KCKA 3AYSA 1UZ4A 3WUFA 2W5FA 2E9MA 2VOTA 1CXFA 3GXFA 3ARUA 2XIIA 1G9HA 4J7RA 2PWGA 3AZSA 3I3BA 4HMEA 1E4LA 4R27A 8A3HA 1CGTA 1GOMA 3EMZA 3II1A 1Y7VA 5A8OA 1JYWA 1HVQA 5KZ6A 5BRQA 1V0LA 2ZX7A 4CN1A 5ABGA 3N1AA 2PWDA 4NI3A 5D9PA 1V3JA 4FF5A 4DWSD 1BG9A 2EAEA 1V6UA 3AMLA 3NDZA 4AZIA 4JFWA 3ZIZA 2X2IA 2FGLA 2QMJA 1QI5A 1JAEA 3VO0A 1ZS2A 3CZNA 3U7BA 1FHLA 1KXHA 1ITCA 3AYRA 2MANA 1WB0A 2GJXB 4URIA 3WL0A 1CBGA 3M7SA 3A24A 2Y4SA 1KXTA 3CUHA 3BAJA 3ARTA 3OBAA 4WJXA 3ZT5A 3BAWA 2EPLX 4AIEA 4KRUA 3POHA 1QWUA 1TZ7A 4MDOA 4WIWA 5BYWA 3MV01 4ATWA 1I75A 3AHTA 1BHGA 5A2AA 4LXFA 1Q6EA 3AIRA 1UUQA 1RD6A 1CXKA 2A3HA 4FNUA 1JF5A 1CENA 2J7GA 2D0FA 2DH2A 4MNLA 4BZYA 4LYQA 3VGBA 4NZJA 1K9EA 1HTYA 5I6SA 3D3AA 2J79A 5A95A 3BUIA 1BSIA 1QPKA 4PUEA 1SR0A 3CV5A 4W5ZA 3WD4A 2GVYA 2J47A 3DDGA 3RM4A 3VSVA 1M7XA 1VFFA 2AMGA 1WCGA 1HKMA 2YL8A 4MJ4A 2V3FA 4YN5A 3WDJA 3KEHA 3DECA 3F5KA 3A22A 2WM0A 1FOBA 4F79A 4ACZA 2QHAA 1E6ZA 3OLIA 1QI0A 1JDAA 4IPNB 4J3UA 1E6SM 1HP4A 2J8FA 2EACA 3AIQA 4XX6A 2FE0A 3SCWA 1M03A 2G4FA 1QW8A 1TA3A 4GINA 3ZR6A 2OYKA 3O6AA 4DUVA 3F5LA 4R5EA 1CZ1A 1VENA 5CG0A 4XZBA 3VDBA 3WD1A 3ZT6A 3VMOA 3VD4A 4DO4A 3ARZA 1TR1A 4M56A 1CDGA 2XIBA 3WBAA 3T2OA 3CC1A 2WCGA 2WHLA 4MPKA 3VOCA 2BVTA 3DX0A 3TONA 2PBGA 2ZWYA 2EJ1A 2DT3A 3NUKA 3DX4A 1E3ZA 3IAPA 2E3ZA 1W32A 1GZJA 1BYDA 1OGBA 1LWJA 1W1PA 3RJXA 1GVYA 1EIBA 1H0IA 1ZB5A 2WWCA 4TUFA 4LGXA 5A6MA 2F7RA 2VZVA 1UKTA 3KZSA 3PZNA 2VTFA 4N0RA 3WD0A 3BVTA 1UD8A 1KTBA 1JIBA 1XH2A 1NQ6A 4J27A 3EJUA 1ZU8A 3AI0A 3WEZA 1CGWA 1NWTA 2FHCA 2XTKA 1MQQA 1RP8A 3QR3A 1XYFA 4AZ6A 4D6DA 1X6NA 3ZOAA 1B3ZA 4PMYA 3SUVA 4P8UA 3VU2A 3B9AA 3MMWA 4B15A 1WZAA 1T0OA 3M6DA 1OSEA 4MB1A 1H41A 1UD4A 4LX4A 3T09A 2WMJA 6CGTA 4QCFA 4OBRA 4C7GA 3K4AA 2VVSA 1EHNA 4PMVA 1E1FA 2ZUWA 1PZ2A 4Z2LA 3CUFA 1XGZA 3WQ8A 1GJUA 2PB1A 1BYAA 1EOMA 3WDPP 4KMQA 3AROA 4F9JA 5I0DA 1E0XA 1E43A 5E0CA 3AZRA 1XSJA 1W9DM 3GBEA 2WB5A 1V3HA 2A3AA 4J28A 4FMVA 4H8UA 4OJYA 3WDIA 1XSKA 1ZBVA 3GTNA 4AIOA 1E4NA 4JFUA 1HKIA 1PIFA 5JIPA 3SCUA 2F1BA 5HXMA 3AS0A 1QNPA 2QPUA 1OT1A 1R87A 4QDMA 1MW1A 1IT0A 2BFGA 3T0DA 1EO5A 1E3XA 4PTWA 2CBUA 5E1QA 1H11A 1VEOA 2E9LA 2VMFA 8CGTA 1M04A 1JDCA 1JDDA 4LYRA 3WY3A 1E6XM 4AD3A 3VGGA 3U5UA 4N42A 3L4XA 2O9TA 3WDRA 3RPMA 3VD5A 3VTRA 1NOFA 3SUWA 1LL4A 4TVDA 1DHKA 4FLSA 3OGSA 4XB3A 1VAHA 3EJSA 4FNTA 5D8ZA 3AJ7A 3AIEA 3UEQA 2W62A 4P8WA 2OW6A 4PMNA 4MAVA 1CECA 5A6JA 3WFZA 1R46A 2E9BA 5A8NA 3VGEA 3OGVA 4WLCA 1LL7A 3ALGA 4Z2KA 4QP0A 3WF2A 2YIHA 5E6ZA 2J7HA 3GM8A 3WMCA 3CO4A 1D2KA 1GOOA 3K4DA 3W53A 2GDVA 1VFOA 1G01A 1U30A 3W26A 2CPUA 1W2VA 1Z32X 3ZM8A 5CPQA 1WDSA 4PSRA 1C3FA 4FNRA 3N12A 2Z1KA 4JL2A 4LPCA 1JYNA 3AXIA 1CEOA 1TQTA 4F9DA 3UG5A 4Q22A 3KL5A 3EMCA 3PZIA 2XWEA 3BAXA 3GXMA 5E6YA 3HG5A 4LQ1A 1DWJM 4OUEA 3K8KA 2WMIB 2YDRA 1CGVA 3MI6A 2XM1A 1OB0A 5BXRA 2F1AA 4D1IA 3QHOA 4V27A 3MUIA 1ESWA 3AZTA 3N9KA 4MJ2A 3GBDA 3PZTA 4DO5A 3RILA 5IDIA 2VNCA 4JHOA 2XSAA 2WSPA 1CGYA 1DEDA 4H04A 2O92A 3S5ZA 1ISYA 4FLOA 1MW0A 4M24A 1XYZA 1HXKA 2YDSA 3T2QA 1MW2A 3AIVA 3MMDA 2BY2A 5ABEA 1W1YA 1MXDA 3RM9A 1J11A 1R47A 4TVCA 2F61A 1SYTA 4BQ4A 2O9OA 3MUZ1 5AYIA 2OWCA 1H2JA 2BNJA 5JBDA 3CIVA 2E4TA 5E0FA 3FNDA 3TTQA 2NT1A 4DUXA 3CUJA 2YA2A 5DO8A 1WDRA 1ISZA 3W37A 1SZNA 2VCCA 2ALWA 1VIWA 4CVWA 2X1IA 2ZUMA 4D6JA 3AHVA 2EPMX 3IJ7A 4RE2A 4UQEA 4CU8A 1V3LA 1IZKA 3KL0A 3BC9A 2OSYA 3L4TA 1SFSA 3HG2A 3WDQA 1CLXA 1J12A 3WENA 1J01A 2D1ZA 1V08A 3DX3A 5I23A 4HP5A 1HKKA 2AOSA 3CHEA 1EA9C 3AIUA 4AIUA 4GKLA 3RDKA 4E8DA 1QI3A 1XH0A 2Y8VA 2PWEA 3N13A 5A3HA 1FFQA 3WMBA 1D7FA 5DEZA 1GONA 4DWSC 1QBAA 3MSGA 3FAWA 1B3YA 4W88A 3VGFA 3CZLA 1ODUA 5EMYA 3UETA 2OLHA 3BSHA 4CD6A 4WKFA 2DSZA 3VDAA 2IGTA 4A3HA 1KXQA 1E0WA 5BXPA 2CCRA 1CXIA 4PMZA 1CIUA 1YHTA 2UY5A 4GI6A 3A21A 3E1F1 3RO8A 3VX0A 1KR1A 1OGSA 2CKRA 1UD5A 1E6NA 2ZXQA 4GZIA 3LRMA 3VUPA 5IFTA 1LG1A 3LXBA 1H0GA 1UH3A 1JD7A 2WSKA 3AICA 4ZXOA 5HPCA 1UG6A 1XH1A 2QPSA 4GXPA 2RGLA 2XN1A 5D9NA 2OSWA 4JFVA 2X0HA 2WVUA 2CBVA 3BCDA 3K8MA 2ZXAA 2CKSA 4AISA 4CD7A 4MNMA 1W9UA 2YBTA 3EMQA 1VB9A 1UR1A 2FGZA 2XVGA 5A2CA 2EPOA 5I77A 3WSUA 2J8GA 1JXKA 3QHMA 2ESCA 2ZIDA 5LA1A 4XUYA 1AQ0A 4UTFA 1JXJA 5C8BB 4WK9A 3IGUA 1OWQA 3AIBA 5E9AA 3ARQA 3A3HA 3N15A 1UKOA 1EXPA 5EFFA 4W8AA 4U5KA 3AXHA 1PIGA 2WW5A 3VM5A 2BV9A 1C90A 1HNYA 4OKDA 3S6TA 4AYSA 1US3A 4B9ZA 2XGBA 1HKJA 3MUAA 3GH5A 2A3BA 4HA3A 4BQ5A 3UR8A 3LPGA 2O9RA 4PUDA 1VBRA 1W91A 2ZUNA 1UWRA 3TA9A 1K6AA 4GZJA 1UZ1A 1QX1A 2VX7A 4AEEA 1TE1A 2WMGA 4PMQA 1FH9A 1UWTA 3DYMA 4KWUA 4AMCA 1UR8A 2NT0A 5GPRA 3FXYA 3WBEA 3LPPA 2J77A 1OCQA 3NCOA 2W61A 4GPNA 1FP9A 3WY2A 1B31A 3VIKA 3VVGA 2UY2A 9CGTA 1KWGA 2BXYA 4J3WA 3WY1A 2GUYA 3IJ9A 5I24A 3CUGA 2CERA 4WKHA 1GOWA 3DYPA 2VURA 2D24A 1S46A 3NSMA 1WE5A 3KL3A 4H2CA 2TAAA 3VNYA 5IHSA 5HBFA 1DTUA 4HZ8A 3WY4A 1RP9A 2WVSA 3ZT7A 4DM2A 1V6VA 5IHRA 1VEPA 1DWIM 1KGUA 1KQZA 2C8NA 1NWUA 1FH7A 4CCCA 1PBGA 2WWDA 1LF1A 3ZSTA 3SIMA 4A4AA 4NSBA 4W93A 3S2CA 3SCRA 1KR0A 1GQKA 2W63A 1J0YA 2JF7A 4HA1A 3AS2A 3T0AA 4GI9A 1WAWA 3VGDA 2EXOA 4CD4A 3B8SA 4AD1A 5ABHA 1V02E 4CGTA 2G3JA 4NZCA 2OW7A 3L4YA 4Z2HA 3TV8A 5AC4A 1HJVA 1E4MM 3WD3A 3UCQA 5GQBA 3G6MA 4X0NA 1JZ6A 2YJQA 3EJQA 1JL8A 1MWOA 3CZJA 3N11A 3SUUA 1W1VA 2ZUUA 2VRKA 5CLTA 3SCSA 1HWWA 2XM2A 6A3HA 5FL0A 1GQJA 4YPJA 2D0GA 2WC4A 5A6LA 2YOCA 5FD0A 3AHZA 3U7VA 2PWHA 4GI8A 1OM0A 4AZ5A 3D4YA 1L8NA 4D1JA 2E8ZA 4EAMA 2YL9A 3W29A 2XVNA 3AISA 3B9EA 4AZBA 1VF8A 4AD2A 4M80A 2BY1A 1B30A 2CITA 1QNOA 1CPUA 2Q8XA 1E0VA 5D4YA 2YLLA 3CZEA 3ARRA 4M8UA 4NRSA 3GXNA 4L4PA 4J3SA 3K1DA 4UNIA 3W82A 4X0VA 4H8VA 1TMQA 2VX4A 1V0MA 2DSVA 1JD9A 4PMXA 2F8QA 4U2YA 3VIIA 3KLKA 4PN2A 2XHYA 1M53A 2OWWA 1ZBKA 3BLBA 1A3HA 4U3AA 4B16A 5LA0A 1UH2A 1O7AA 1LL6A 1C92A 1V3IA 3WQ4A 3PTQA 4BCEA 1OD8A 2G3IA 1Q6GA 4ZXLA 3PN8A 3BAYA 1P6WA 3TP4A 1TQUA 1R75A 2D2OA 1B2YA 3RMEA 3EJPA 4QAWA 1GQLA 3AXXA 4D6GA 2BY0A 1UA3A 5FKYA 1ECEA 3VD9A 1KB3A 2D3LA 2BXZA 3OLDA 4TX8A 5IFPA 1R86A 1JNEA 2XFYA 4PMDA 2BVYA 4MNJA 3N04A 3CZKA 3FHAA 1D3CA 4CCDA 1J10A 3BMWA 4W84A 4WF7A 3AMCA 1U33A 1TQVA 1NARA 3EDFA 4J3VA 2VR4A 1J18A 1EDQA 3KE0A 3AMDA 1B3WA 4PMOA 3BVWA 4D6HA 1BAGA 4DO6A 4DM1A 3VILA 1HX0A 2IXVA 1X6LA 3EDKA 3RJYA 1QWNA 3EDDA 4AD0A 1MYRA 2PC8A 3OZOA 1W3JA 1PS3A 4GZEA 3GNPA 2GSJA 3A47A 4W86A 1QVBA 2YL5A 4MNKA 1TUXA 3VDHA 2ZX5A 5JIWA 1HP5A 3VSTA 1R33A 4UFLA 3HN3A 1W9VA 3NSXA 2W91A 1J0HA 2OYMA 4UQCA 3GYCA 2JALA 1JGIA 4S3JA 3EBVA 1OIFA 4PYSA 3BCFA 3CBWA 2WYSA 3WQWA 1EQCA 3PZUA 2V5CA 3N18A 3VD7A 2CBIA 2ZX6A 5BROA 3NDYA 1W2PA 3VD3A
chains in the Genus database with same CATH superfamily
2LU3A 2WPGA 4OM0H 2DSWA 1H8OA 1JRHL 1NCAH 3A67L 2AXFA 4HALA 5DHVB 3UCRA 5FB8A 3AQDA 3DV6B 1KQYA 2Z0IA 4OHQA 4XQ6A 3VIPA 3W7DA 1OQXA 5CBJA 4QRRD 4AYDC 3D05A 3L45A 3WLSA 2VISB 1AGCB 1XX1A 4JY5L 2QCDA 2QDDA 2XBDA 3NK4A 3X3GH 4BWLC 2A83B 1CFTA 3LKNA 1D9EA 1OE2A 3P9MA 5IUSA 1XF5B 2CIPA 1FAIH 3L5WA 2CPCA 4YHZL 5IQ7L 3G24A 3KVLA 4XSLA 5DCDA 4KNTA 2BVQA 1I2NA 1JS4A 5FESA 1G0DA 3FTGB 4Z95L 3BLLA 4AG4L 5G2NA 1RKRA 4WUUA 5HHOD 1OQOA 3WJJC 1LDPL 1BWKA 1E1CB 4YDIL 4L64A 1HINH 2X89D 4BK5C 3D9AH 5F7AA 3L3GA 5H8DA 5TQ0H 3ZO0A 3K71B 3T1WA 2ITFA 4YCOA 3WFDH 1JZJA 5AVXB 1MHPH 1ODAA 1WDPA 3PB2A 1D8CA 3AY4C 3FF7A 4XVUC 4D6CA 1J86A 2B5IC 1PX4A 2NY7L 1A6TA 3F5JA 4IIFA 3BGAA 4YGAB 4BRVA 3HM7A 5J3HC 3L9BA 3H2CA 4IPPA 3WGVB 2OMZA 1EL3A 5A6AA 1X5LA 1YEJL 4FFZA 4MNQE 4MMYA 1D5MA 2H3KA 3TIEB 3BLPX 3BP4B 2I9TB 3OPSA 5E9NA 3Q6FA 5J1AB 3PZMA 5LHEA 4TMPA 2BM3A 2HCVA 2B81A 1BQLH 4NGHH 4L8SA 1RVGA 4WJEA 5E09A 2NY2D 1P1MA 2XZZA 3QH3B 3MO7A 3C6LA 4Z7AA 2GGGA 5CJ5A 4NZ1A 3VE0B 4NN7C 1XF2A 1JNLL 2EDFA 4NZTL 3KUMA 1G69A 4Q0XL 5MHSD 4I7VA 4MYPA 3W0KA 3C61A 2WANA 3QA3A 4R90L 3UDWC 4HCHA 5C0IA 3EX3A 2GJRA 1FFTB 4FA7B 4AWEA 4E3VA 3KPRB 3I7SA 5C07A 2H9GA 3MC0A 4C6JA 4KVNH 4WU5A 2NNRA 3RIFF 2TODA 1PMYA 2FH6A 1ERNA 1MQKL 4IRZH 1FZOA 2GFBB 4NNAA 2NCEA 2G5BA 2QCEA 3VDGA 4O1BA 3IIXA 2FJHA 4F3FB 1BVNP 4D0CA 3GDMA 5KTEH 2DD8H 5IGXL 2X4PB 4K3GA 5LIUX 1P84K 4NJ9L 2PDIA 2AERT 4Z18A 1O9VA 3CXDL 1WA0X 4A7GF 4M3JA 1FXQA 1ZLDA 4XD5A 1SJXA 3TCSA 3W9EA 1EJOH 1MCRA 3V5HB 3WL1A 1PJ9A 4PJ6A 3OIHA 4AJYV 3HG4A 3B9KA 4L6DA 4TSCL 1WUNT 2YAHA 1Q3NA 4FSAA 3LG3A 2IG2H 4E9VA 3VYLA 4NXSA 4QHLA 5I3GA 2BNRD 3PWNA 3V0JA 4F57H 3VIJA 4GSDL 2RHEA 3BVUA 1G6RL 1IB5A 3VFRB 1V0KA 3JU2A 3CN0A 3ES6A 4UQ9A 1T4KA 1LE5A 4L4JA 3THQA 1WWWX 3M0IA 4ZNEA 3VA6A 5J9PB 4PU2A 3VFPA 1I3UA 2JJVA 4JDZB 2GK0B 3T0BA 2FGBA 3HGJA 3FFCE 3T8LA 3VFVB 4HZAA 3QEQA 1GVRA 3BXWA 1UP2A 5DRWB 4XN2A 5KBDA 4LB3A 2H8ZA 2OI9B 3A4WA 2NY4C 5D9SA 4NFBA 1NAMA 5G5DB 4JKMA 3QFJA 1QEXA 3HB3B 5KITA 3LSCA 1GPOH 2HT4C 1JPMA 4IUGA 1NCCL 3I85A 4KFZC 3VXPA 2QNEA 2H6RA 1CXHA 2XV0A 4HHGA 4C6CA 4RDQG 4Z7VB 1BVWA 3QZOA 3BJFA 1KC5L 4HUUB 5I17B 3QP3A 4BFGA 4QHPA 2ZOXA 5I6OA 5A2KH 4ODVL 4ILDA 3WQWA 3FV9A 3B1TA 2YLKA 3JWDL 3VI3A 4TO8A 1ZD6A 5DMKA 4CNPA 1J9SA 2IQAB 5C9RA 1PZ5A 1B0RB 4PBXA 5AB2A 1ZJBA 3T0XA 2DVXA 1NUNB 2G3ZA 4BQ3A 1N82A 2VYRE 3O41A 5J0BA 1JZ8A 5JOPD 5KBMA 3AG4B 2GDQA 3FTVA 3NCWA 3ARWA 3QBTB 4J23A 4L23A 5IM7B 5GRXG 5I74B 2YDQA 3GVWA 4P8XA 2OGJA 5CEZE 4LLMB 1AD0A 1RK5A 1EO8L 3OMNB 4L1GA 4J8RA 4AMXA 1PWLA 3L3JA 1JVOA 3WQFA 2FX8H 3QXTA 2AQ3A 3K7UA 4JFTA 2ZCKH 1TV8A 3C5ZD 4W9IC 5DUPL 3M07A 4KQ3L 1AQFA 3G0SA 5BRZE 3KP0A 2P0IA 5F9JB 4X4YA 2QF8A 12E8H 1JSYA 3C60B 3FFDA 3LHPL 2C9RA 3MV11 5IR1B 1JZEA 4XN8A 4W70A 4G8IB 4BFRA 4FXGB 1W17A 3P4NA 1NGQH 1AKJD 2XQBL 1VRSA 2APSA 3NJKA 3O0RH 3VD1A 3ARYA 1UYQA 4JPIB 3MLYL 4Q6YA 3ZYIA 2WQPA 5LAXB 4NNXA 1EGJA 5HGHB 4ODXB 2CLZA 4RXGA 4J3TA 1P7QD 3V4UH 1A3LH 3UWQA 2H8PB 2PCQA 4PCSA 3E0IA 2Y24A 1TV3A 2JLPA 4F8NA 2QQ6A 3W24A 2YPLD 5FFLA 3GIQA 3TYCA 3UY7A 4JY4B 3GTHA 4L8DA 3ITXA 4ROPA 3MXWH 1AQKL 1J0ZA 2DBJA 1F3EA 1KYOK 2ICWI 2ZDSA 1RZGA 5A8QA 5CKGA 4YQXL 4ADGA 4K39A 1H3WM 5SX5K 4HYTB 5L7XH 4UTKA 5KW9L 4A2MA 2BH0A 3M1BA 2ACUA 4JZNB 3FFCA 1N5AA 4PJXB 4V2CB 1ZVNA 4N2HA 4C6EA 1Q9OA 1J05A 3MANA 1CFTB 2DPKA 4O2EA 1I9JL 3JQOB 2HTLC 2X4TA 4F9PA 3QHNA 5HHNB 3U0TB 2FR4B 1QR7A 5EEVA 3CHVA 4ZEPA 1NCWH 1HU8A 4JO3H 2ZOUA 5JMRA 3CH9A 4RE4A 5LIXX 2CUHA 3GXDA 1N6QL 2O4QA 4WI3A 1OM3H 2WCAA 1J9TA 4I1NB 3H2WA 3QMRA 1I53A 1N5YH 4PCPA 5CZTA 5DUMH 3AB0C 3R13A 4IRJD 5CMAA 4HH9A 5JH2A 3UYCA 1V27A 2P24A 3GXTA 1WIPA 3FSVA 4M1RA 2X2YA 5T1DL 1KLGA 1UKQA 2R1WB 1MFBH 3GSOB 3QPXL 2QV5A 5DZNA 4K3DH 3QXDA 2QF7A 3MJ7A 2Z2AA 3BJSA 5ILTL 1FZKA 4UR7A 4ATLA 4LSQL 2F8XC 1S7SB 1XLMA 4Y2DD 5GGRY 3AOFA 5L6YL 4UBDD 3GHRA 1A3QA 1AXSA 5B1AB 3S5LG 2OMNA 2BLEA 4HWBL 2Z8WC 2IXQB 3WN5A 2VD8A 2QT6A 4X7EC 1RH9A 4O54A 1IWBA 3QWOB 4HIEA 4L5FH 1MJ7H 3OMAB 4X80H 2GGHA 4U1SA 3TZVC 1ZHKB 1UVQB 3CLWA 3OKOA 1YEEH 3MLXL 3N41F 4KKRA 4G6KH 4R53A 1J1OL 4KXCA 8FABB 1LQ0A 1UZ6F 2DWEB 2XQYG 4GW4B 4DJMA 4ONGH 4F2MA 3OEXA 4GLRH 3E6FA 5FHAH 2EJAA 1Q1PA 2Q7YA 3MJWA 3WEXB 3ZN6A 3MRNA 4BFJA 3RTQB 4Z3TA 5MEPA 2YCEA 4GY0A 4P2OC 2ZUTA 4JLRB 4YHIB 5TNVA 2DPEA 4IKIA 5T1MA 4FYQA 4QNEA 3KOXA 4WZ9A 5EU6A 2RAMA 3NN8A 3H7VA 1ZPLA 3NZ8A 3ZTDC 4F5CE 2QADB 2QVIA 5F4WA 2ILLA 1A6ZB 1EGMA 1FDZA 1S5VA 3HMWH 1MW3A 2F8VA 1KB5L 1Z7JA 5LGKA 3QEUA 2QIWA 1GVFA 3VXRE 2XXCB 4FFWD 4E41E 4FERA 2WMIA 1PZ3A 4NYLA 3WMSA 1AC6A 3ORWA 3PFQA 3PUGA 5DTFB 2MQGA 4NN5C 2GK2A 4PCKA 2WNKA 1TVBA 4PJ5E 3P40A 3RHWK 3LBCA 4O1AA 1SUJA 3V9EA 3UABA 3W9EB 3BZEB 5DELA 4K68A 1SUHA 1N3NB 2WZTA 4RZKA 4BSJA 1HCFX 2CO6A 5I5MA 5DT1H 4RMBA 2XIOA 2VJ8A 2I5YH 4GSQA 5CBAA 2Y8KA 3RDTD 2VLKD 2KMWA 3BLKA 4HUWA 1M6JA 3VCCA 2ADJA 4APQA 3PPFA 1HGWA 2OI9C 7PAZA 3APTA 5JH1A 3QYNA 3S9IA 2VQ1B 1A7OL 1S9YA 1ETZA 1UKSA 2WVVB 4YHOH 5DEGB 4XZNX 2YBRB 4GO8A 5ABZA 5B8CA 4ZX4A 3RLUA 4JJ5A 2NZIA 4E6MA 1WZLA 2AVFA 3OVGA 4Y5VC 5C0CD 2O1AA 1WJ3A 3GF8A 3Q9PA 1M6OB 5F7MC 5J9PA 1WWCA 3OZKA 2WTOA 3CV7A 2A79A 4HWBH 4EKJA 4GJ1A 1HAWA 4WKAA 4C56D 4HN4A 1QP1A 2XRAH 5EULV 2AJ3B 3IE9A 4LBRA 3U46B 1FE8L 4DX3A 1WAPA 5HHOB 1NGXB 4PJ7B 1MQPA 1KEGH 3QUYA 1WS7A 4OR1A 4DQAA 1U3YA 3TTSA 5DFTA 5HUPA 3L3KA 3IFOB 3QPXH 4LKCB 3U7WH 3WNOA 5H2BA 1ZJAA 4Z3JA 2P0OA 1IBDA 2YAEA 4HU4A 3W86A 3ZDZE 5IIEA 1CI3M 3OGOE 4M8VA 4XPAH 4BWUA 1RBLA 1UBPC 3EWZA 4W9DC 4DP2X 2DJLA 3I6LE 1BFOA 3GNXA 4E0RB 3FN9A 3MNMA 3V7AE 1BXCA 1NF7A 2FDMA 2DAVA 3IIPA 5ANMA 4X42A 4YHEA 5EBAA 3IDYB 3U9WA 4B5XA 5L4FA 2C0AA 3GO1L 2AABL 2QQKL 4KIEA 2FX7L 2NX1A 3CMFA 2ORBH 1TIMA 4I0PD 4JRYB 4KXZI 3ZDXF 4M62H 3O9NA 3P5ZA 4HGXA 1OAZL 4UOW1 1OGPA 3CFUA 3QWNA 5D93C 4O1CA 4BKLA 4S1DD 5J1SC 3KWWA 5FAGA 1PBYA 2V68A 3PLYA 3QY6A 4FZIA 1TTPA 1CZ8H 2D20A 2IBGA 1PQZB 3QO0B 1JZ4A 1EOKA 1TPUA 4G7EA 4XIAA 1Y6MR 1XLKA 3UP1A 5FXCH 2DTSA 1NDGA 2MNJB 3SAZA 4CNOA 8XIMA 5I3IA 1UACL 2ZG2A 2E5BA 2C7FA 1ODZA 1XPGA 1Z41A 2Y3NA 4F93B 5DEJA 1Z66A 4YX2L 3R2GA 1CVRA 4ZE5A 1HL4A 4OLVL 4LRNL 3GYRA 4PODA 2OZ4L 1YPZF 4DWSB 2XZ7A 3LIZH 1G87A 2XLLA 2ZT9C 4XNDA 1TRIA 3FK4A 4URKA 1A3LL 2CG9X 3I3DA 3P5YA 3V4UL 2NZLA 4TPRH 4Y4HB 3WO4C 1R0MA 1T96A 4YAQB 2JKXA 4Q7DA 1YSOA 1HH9A 3U2JA 3VMPA 2G60H 2X1QA 3PHSA 2HH0L 5F7YC 5LN8A 1WTGT 1NGQL 3K13A 1CLOH 2EKJA 4Z3GA 2L7EA 1K3IA 3HPJB 3B0YA 2BP5M 2V5YA 1KIPB 2YAOA 1DKWA 4D9QE 4LPXA 3UXDA 4LGSB 4LPYA 5CWSA 3EA1A 2VDQB 4PTMA 4K23L 3MUHL 1S3HA 4AVOA 4TXEA 1WC7B 2Y5QA 2EYTA 3B9DA 3BVXA 3EGXB 2XVLA 1NOAA 2PYFA 3FHQA 3FQTB 1M7DB 3QG6B 3CV6A 3O45A 1WH0A 1RU9H 4ZMYA 2BNRB 2PDWA 3T4AC 4O2EB 1G7PB 3NGBC 1AANA 2RQEA 3RL1A 3A23A 4FP8H 3ZGHA 4U0QB 2CEQA 2P42B 2K0RA 1K9FA 2P48B 1YBQB 3CZFB 5BUGA 5FF3A 4ACZB 3H55A 2AQ1A 5I02A 4N3UA 3U5YA 4G7YL 3KS5A 5KYUA 4MB4A 2YR1A 3JWDH 1E50A 3QJZA 4APXB 1GKRA 5DQPA 1J5TA 3W39B 2DZVA 1VGAA 3SDCA 5AALA 4KUZL 2OFJA 3AT9A 3MHFA 1FO0B 4P5TC 4G80A 1KIUB 6REQB 4AC1X 4QXTA 2DZPA 5IW3A 5EA0H 3SY0A 5CM1A 4GKOA 1R3VA 3HE6B 1O6SA 1GZQB 1NCCH 4I0PC 2CNYA 1P7HL 1TTBA 2MOGA 3C9NA 2XTKA 4YYCA 4UOZA 1IC5H 1MLCB 2BX7A 2ZRZA 3NZPA 4IRJA 1BZ7A 1W9XA 2YD0A 4S39A 1TIUA 2CQVA 4WTWA 5C0FA 4OOUA 2AAMA 3ZDYB 1W72A 4PRBB 4ADSA 3UGXA 3EFFB 1KXVA 1MF2H 2CLLA 4WI8A 5AW2B 4NP4L 4E9XA 4HSNA 1S7TA 1X5MA 5I16B 4EPKA 3N3MA 1WITA 1P7KA 2A9NH 4ONHA 4NRXB 4FR1A 3Q9QA 1RK1B 3QQWA 4I2XE 3UIZA 4CN4A 2X4RB 2GWGA 1A1OB 3HG0A 3GI8H 4IM8A 3RWDA 3SGJA 4OF8A 1FSKC 4H8WH 5JOEA 4CBPA 5I0WA 4GAYB 4FZEH 3GIVA 2KDGA 5PAZA 1Q0YH 2H32B 5CAYB 3HC2A 1ZK9A 3MMUA 5IF0B 4OCNC 3L81A 4FQ2H 1AW2A 4D94A 2IALB 2OULB 3CHDA 3DBXA 3SUTA 4EAYA 3SDYL 5KJ7E 2EKCA 4AZ8A 3R89A 3N14A 1XXXA 4YBQC 4HN8A 3N06B 4LAQL 3TN0C 1PSKH 2Y1AA 5GS0C 1WBHA 4E8CA 4UYPA 2X12A 2GSHA 3HUJA 3SRFA 3VX1A 1TTCA 4Z7VA 1EFZA 3CVBA 3VA8A 4JO2L 4PJHB 3G9VA 3FDWA 4KVPA 4DGVH 3NYZA 1XEUA 2ZTBA 4XWGH 5CIPB 4KVNL 4K5NA 1ITBB 3T2NL 4AJ0A 4GIOA 1Q6DA 1Q7MA 4K07A 1LT7A 3SFWA 3VVWA 3FY1A 4BF9A 5IKCB 3AGVA 5F89B 3O11A 1O7VA 2KHAA 3S35X 5BOFA 1W8EA 2ALAA 2W3ZA 1AXTH 3IBEA 4LCCA 3UA4A 4BA0A 4YJZL 1W5OA 5BXSA 1DWHM 4APQB 4OD2A 3N41B 3VNKA 4PJGB 5D9OA 4ZUVA 2FT6A 1TYGA 3MUY1 1F4HA 1WKDA 2ISVA 3B4UA 4K94H 4LUIA 3ISRA 4AF0A 1R3JA 3MJMA 3O06A 3TC6A 2G4JA 1TMHA 2OMTB 1WICA 5K39A 1BQLL 4NGHL 5IBTL 2J78A 3SCNA 4IBSA 3M7FB 3TO4A 1Z0MA 4KDTA 1CLZL 2ADGA 4TQPA 3R6IA 3WUBA 5JHLL 5I15L 2IPTH 1VJSA 3W1LA 1KLFA 1F8IA 1HHJA 3AQYA 1AZUA 3SJVD 2KL6A 2GBAA 3DIFB 1AGBB 4GEJA 3U2SA 1KEML 1YTKA 4OTKA 4RDZA 3SCMC 4YHYB 3N73A 2UZPA 1UWGL 4PHZA 5TTRA 5BWAA 2NY7H 2R7EA 4DAGL 3FKKA 1ZLUK 2YL6A 3IDIA 2Y6SD 2E7BA 3KM2A 4XD3A 1Q0XH 1IEWA 3UPCA 5D7KD 5E1IA 3GVGA 3NTCH 3ME3A 1BF5A 3NG3A 2GG1A 3BV4A 5C9WA 5DJYB 4MHHI 1DWAM 4AFYA 4ZMTA 1RZMA 5HWNA 2XG9A 1GG0A 1SUXA 1BFOB 4G1EB 4ZA0A 3CEPA 4ZL1A 2MCAA 4Y5XA 5EEWA 1QAPA 4MHBA 2EVIA 3HNVL 1LDPH 4IOFC 3S36X 4MMZB 4PTUA 1GTEA 4R3SA 2OQHA 3MC5A 2V69A 3OZ9H 2X9WA 4C59B 2CHRA 1KMGA 1NDMB 3FB6B 5ENWB 1LLWA 3QUXC 3ZMRA 2HQAA 1OSPH 3GRIA 3THDA 2WUBL 4WJ5B 3WUZA 1S9KC 4DPBX 3MRDA 4NHUA 1FAIL 4OJAA 5GNXA 3WE6B 3RPTA 3STEA 3ULUL 2R91A 3S96B 3Q67A 1HJCA 5IESL 2W0UA 1BQ5A 1MWAH 2BW5A 3VOGA 1VYSX 3OV6A 2J6VA 5F6HJ 1IZCA 4HNTA 2Q0ZX 1W0WA 4XZWA 2VGFA 3NMEA 3EYOB 4OIFA 2VLKE 1F74A 1KCVL 1H7OA 3H70A 4LJ3A 3QH2A 3NRQA 2XN0A 1U6AL 1DZ0A 4N9GA 2V2WA 4NM4L 2IWKA 4UUJB 5DUBA 5I1GH 3U0PA 1E4IA 1NSNL 2E56A 1F76A 1RK6A 3H0TB 3EO0A 2XWJB 3KDMA 4ZJ9A 1C1EH 2OU4A 1Q9LB 2Q3OA 3DIVA 1CBVL 4GKZB 1WX0A 3SE9H 4X9BA 5CMAB 2VXVH 3T44A 3QS3A 4Q89A 2RGMA 2PPCA 1EBPA 2PRMA 1T1YB 1SNRA 2UY4A 2WJFA 2YN3A 5C07B 1SLWA 2G4EA 4XO7A 4PL2A 5L8JB 4XKMA 5BO1L 2JKNA 4DEFA 4ODBD 4Z9KB 5CSUA 1JJUA 1T5WA 2AKRB 2NR6C 3ARGD 1FZJA 5CF3A 3V35A 3GHEH 5CC5A 4A8NA 3W81A 4PG9A 2VM8A 5ADOH 3WS3B 1JAKA 5FW8A 3D34A 4CQCA 4WKZB 2NZ9C 4JX6A 1QLRB 1QPRA 1L3WA 2X09A 4P5KB 5D4JA 3WNNA 2NXYB 1I8AA 5C0CE 3VFTB 3VFWB 3VFSB 4LSSL 4TOYL 4MNHB 3TA3B 1E71M 4YZWA 1LDCA 2JFEX 2FJFA 1VC4A 1A2YB 1GHRA 3DBPA 4EX4A 2PDBA 1MCOL 3AM8C 2DKMA 1BZQK 1GHSA 5CP7B 4ACYA 2YAQA 1WO2A 3VXRA 1QNSA 3DI0A 2YCKX 4U1LA 4IIHA 3TYEA 1EC8A 8FABA 1NAML 3VRLE 1CVSC 2DIEA 3T0EB 5BO0D 4YXGA 2OL3H 4MWAC 4XVJH 9RUBA 4A38A 4QRPE 1PLGH 5K59F 4NJHA 4MXWL 4J3OC 5KAQF 5SX4H 2ICEA 2ODIA 4AH7A 4GUHA 5DZAA 5I73B 3VCLB 4PMFA 3ZHFA 1WUEA 1WA1X 5FUOL 1VCFA 2Y63A 2PKDA 4P06A 4ZFZA 3GJEA 4GAGL 5CGMA 4LF1A 4NUJB 5FJTA 3IDMA 2JK5B 5FGCB 1JG9A 1GZQA 5MEQA 1M9SA 4FQLL 2F7OA 3ARFA 4KTEH 5D7SL 4HZMA 4Q8OA 5JMUA 3HOJA 3WQ6A 5LIWX 1SFJA 3T6ZA 3SGEI 1IM9D 2NXHA 3V5FA 1BG4A 1EUAA 2ZRVA 1FWEC 2B1HH 1ASPA 3B2MA 4JO1L 4M5ZL 3PF3A 5I1CH 5AVZB 3G1VA 3G6JE 3VOHA 4B90A 2QVTA 5LNDA 3BZGA 3V1HA 1ILSA 1TPXB 2XXGA 2YGVA 5MEND 2W9DL 3EJRA 5BV7C 3RGVC 5IMOB 3UPRB 1HK6A 3VI4B 1PYFA 4HJWA 4HUWB 2FZMA 1A02N 4LUJA 5DRZA 1Q5MA 4PRNB 1E7VA 4GEIA 3TNNB 1TCDA 1MIEH 3WIHL 4X5XA 2YW4A 4IGHA 2RD0A 3EOTH 1OINA 3KOZA 2CNCA 2EPNA 3QHTC 4DNMA 1U8PB 1Z44A 2D22A 3BLIA 2QR6A 3FX4A 1A6AA 4LARH 4I9JA 1MFVA 1NJ9A 3GLDA 2W59A 2UWFA 3UZZA 1BMWA 3P67A 3X1NA 2EXYC 4GRMB 2J7BA 3BX7C 1FP8A 3RA7L 1QTPA 1R9XA 4GY1A 5CJMA 3LSOA 1P4CA 4Z7NE 4DNLA 4L80A 3C2OA 1MCPL 3I74A 4J4PA 3FONA 5AEAA 4P3DA 4C4UA 3KWTA 5CILL 1G84A 4H9XA 3NO1A 3V6ZA 4X5LA 1EJFA 3PAYA 4KRPB 3SQLA 1BQCA 2XWRA 4H8HA 1SOSA 4K3EH 4LAZA 2J13A 2JKAA 5IIEB 2OM5A 3DUUA 5EB8A 3PL6B 4TUJB 2VCOA 5EFDA 1E0OB 2W95A 4NBXB 4NO5B 4X6CE 4X98A 3Q1SH 4NCDA 4X2UA 3QUMA 1CI5A 1CB2A 3D18A 1SHWA 4YSSA 2OV0A 3APYA 3WH7A 4KEZA 2WKOF 4G72B 4JZ5A 2X1PA 1JCMP 2Y7QB 3UYRL 1XX9C 3VXGA 2EDNA 1AY1L 5EOTA 2D23A 3KPPB 1DO5A 3N3TA 2YARA 2NY1B 3CFCL 4KZDL 4Q22A 3TC3A 4PB9H 1L0PA 2WCPA 3MNZA 2JCCE 5C0DA 1ACZA 3DIPA 3PZGA 1I7ZA 4KFNA 1BIIA 1AHWB 1DE4A 2QGCA 3KJ6H 4ZUVB 2M26A 4HOXA 4XP4H 2AANA 3QUZD 4YGVB 2ZZ6A 1V5JA 4F0KA 3WQ5A 3AW5A 4WSKA 1C16B 3TEUA 4DN4H 3WTXA 4U6VL 3WIJA 4TUOB 5GZOC 2AEWA 1NFDA 3QEGH 4OBSA 3W0WB 1ADQA 1C8QA 3KW7A 2WK2A 1YEGL 4LNRA 3VXSD 4DGYL 4IGBD 3S1GA 3HS8A 4Z78A 2R1YB 4GBXC 2J62A 2HVKB 1ZDQA 4JFED 3AUVA 5LCVA 4BHUI 1OFQA 3LRKA 5DEFB 3A12A 3NSNA 1G0YR 5AC7A 3A6BL 1K4GA 1K8IB 2Q1EA 1YN6A 1E27B 2FWSA 3ATEA 3CFNA 5FYKL 2ZUSA 3UMTA 5D1QB 1G7LB 1TTGA 1SDYA 2QUTA 1OTSC 2NV2A 3GM0A 3OG4B 1U5HA 4ZXBA 4HJ1A 1JMZA 1E56A 1UXMA 2NY2C 2YCLA 4D6IA 6TAAA 5MEOA 3SGKC 5DJYA 1I1YA 1KDIA 1S5IL 3ARBA 5DWUL 4DFHA 3BICA 3VE7A 5FCZA 3UTSA 3OKEA 1CD1B 5L8LB 1TWZA 3P60A 2WLNA 2BSSB 4FFWC 3TVMC 3GKAA 3AFBA 3TTEA 4GW5A 4OGXL 2CBJA 2QUNA 3CQIA 1UM6L 4JYEA 1RHHB 3A4AA 1PDYA 1H62A 3ZLFA 3GMOA 4HKXB 3TYGH 4BK8A 1J1XL 4OVVA 1CYXA 1TITA 1ZPTA 4OZGB 4TTDC 5IG7B 3MJ7B 5DQ9B 5KVDL 3LBMA 2E8YA 3GYEA 1COBA 5E9DD 4Z7IA 2EUXA 5CG7A 2X6MA 1YHPA 4ZFOB 5A8GA 5D7IA 4DETA 3UTPD 4AYFB 2Z2BA 4I3SH 3UC0L 3LCHA 1AGEB 1G9NH 3CT7A 3S1WA 1OAXH 2X87A 1GY1A 3V8CA 1QSFE 1FWJC 2QAFA 4DN1A 4YSAA 4KJWD 3IETB 1SXCA 3VI4F 3TWCH 4MTMA 2YC1B 2HN7A 4NDMB 4QRUB 4YL4A 2IMRA 3FFOA 2X0SA 3STCA 1ZMYA 4WUKL 2VEFA 3AS3A 1SFDA 5K9KA 3WKNA 1KJ2L 1QACA 1A8JH 3UH8A 1DO6A 5ALBL 4LT7A 4NRYB 1H8LA 2F7IA 2XA3A 1GQIA 1EDTA 1KRBC 2INFA 3IS4A 3O3AB 3CG8A 2QQNH 2HTKC 1I7UA 3BQUC 2CCLA 3SPGA 3TBCA 1FFPB 2F53A 3C09C 3GUTA 4JFFD 3SY0B 5AOUA 1BCIA 2B2XH 2YR3A 3L4UA 2V3DA 5EO9A 1CLYH 1F3RB 1CDUA 2MTAA 4PW9A 3RTQA 2BSRA 2YK1H 3FS9A 4D6EA 4QOKD 2WP3O 1NBVH 2R2HB 3HG1D 2CBOA 3QFJB 5AZEH 3QWRA 2X1TA 4EF3A 1S7TB 4MQXC 5I16A 4N4QA 2HJLB 2F5BL 5CZSA 1I3GL 1JGVL 4I89A 5ESVB 2FHFA 2PXYD 1UFUA 1YDOA 1XWYA 3FUMA 3GR8A 4GJJA 3S37L 4YFEA 1UWSA 3L68A 1I3RA 4R7NA 1V8EA 3VI3B 3E3QE 2DT2A 1CE1L 4S3KA 4IRSB 2J88A 1OTTD 1HJQA 2ZRYA 3DX9A 3BUYB 1EZVY 1V55B 2H3NA 1DN2A 3VXRB 1A14L 1GGIL 4KQ0A 1GSMA 1KBBA 2X9YA 4WDTA 1KV3A 3F2LA 4LNCA 5M5DA 2K4WA 2ZOKA 3CPLB 5E7BA 4IJ3C 3EOEA 4CUCA 2NWSA 3CQFA 4LSDA 3OJ2C 3BUDA 4HK7A 1TSHA 1N8FA 4X9YA 2WVVA 5KUMA 1LLAA 4U1MB 2NX9A 3D12B 4Q7NA 4MZ3A 3RKDD 1FNGB 4XX1G 1HHKB 4WZHA 3F62A 4HHLA 4ERGA 2BGNE 2QHLA 4IMKC 3NQKA 2VO5A 3KPRD 1B54A 1LQ2A 5INCA 5GS1C 3AY4A 5F9OH 5IB1A 3M0YA 3TMLA 3CQHA 2LFGA 1TR9A 4IMLB 1X5KA 3GSRB 1LG2A 4QE1A 1LP9E 2WTPA 2I25N 3D2UA 4KUCD 1OOAA 2NTFB 2TRSA 4AD4A 3V7MA 1BRLA 1G6CA 4CD5A 1KTCA 4GI4A 1CICD 5MKGA 5AC5A 5JMOC 2HXUA 3G3MA 1CDYA 1E4WH 2MQ0A 2YPKB 4ODXA 4XVEA 3EZ8A 2ALRA 1OVZA 5GGSA 4OFIA 4RQQB 4W6XB 4WO0A 2FO8A 1H6FA 5CINH 4KJWC 1JPFA 1QSFA 3LTPA 4PMUA 3KBFA 5C09E 1LEGA 2HRGA 1A9EB 2Z31B 4LCCB 4QHNB 3ZSSA 2BOGX 3N4FA 3V36A 4H7VA 3FKUS 1QZ1A 3GRWL 4ETQA 3TPUA 4OIAA 4AY8A 3PWJA 1CE1H 3MBEA 1HXYA 1POJA 3QXAA 1M01A 3TJEL 4E36A 2WLIA 3NIFB 4MAZA 2DT1A 4IMEA 1OF6A 1GEHA 3K2GA 1GOQA 3MYJA 4LIQH 4R34A 1DJWA 1US0A 5ITBL 2ZAIA 3N0AA 4A7GA 3DUGA 3FA3A 3ECVA 2X53A 5E2WH 5IW6B 1EHKB 4TOQA 4ELKB 2Z7YA 3KWXA 3N9GH 1E73M 2YPVH 2FX9L 4IQHA 4QXUL 5GVJA 3QS2A 3IM1A 2KX9A 3ERPA 3MZTA 2YK1L 1OANA 4LKXB 4R7XA 1TELA 2P8CA 1I2OA 3MHUA 2OAAA 5D2NC 5E03A 4PJIF 1KXVC 4D0BA 4LV9A 5I0YA 3MYZA 5KYNA 1XGRB 3QJUB 1TCRA 2VLRD 4BQ8A 5DXYA 4F1ZA 3UESA 4D72A 4HNUA 4PM1A 2F6UA 3VIFA 2RAGA 4EBQH 5LHFA 2KLRA 4M61A 5AVWB 3QDGE 1KBKA 3KJ4B 4MZIA 2R23B 1S7VB 1YTDA 4TYUA 1JZ5A 1A3RH 4M1BA 1SMDA 3EJYC 5D05A 2DLFL 4XKYB 5ICYB 2WZ6A 2WKGA 3DVGB 1F4WL 4L4VA 3HF3A 4NF7A 5AYYA 5C2CA 1NGPH 4LRSA 1FKXA 1IILE 3N40F 1E5CA 2XZCL 2PLTA 3DHJA 3V6FB 4JNYA 3TF4A 4MMWA 1SEBA 4YWIA 4J4PC 3NK3A 3LBOA 4AWUA 2K8QA 1Y5WA 5C2XA 2WLYA 4UINH 1R3TA 4L4MA 1ALDA 1SYSA 2GABA 4PJFF 2XUWA 2Z35B 2NUYA 3T0EC 4JKPL 5D5MB 3VE9A 3LNPA 1O7DC 4IU2A 1NANI 5BUPA 1ITUA 3UWWA 5HR7A 4IMKA 1XKJA 4MB3A 3IJDA 4LALA 3GTXA 3S4SG 5FEBA 4JREB 1J88A 1IKNA 3BJ91 5GS3A 3LGEA 1M71B 4X4XA 5DEFA 3GMMB 4XT1C 4X7TB 2G41A 2ZOLB 5SX5H 1FAKT 3RYMA 2N01B 4A3UA 4IGBA 1I9IL 4FQJL 2V7HB 1CFQA 3BOFA 2A7RA 1V7NH 2VCBA 4QLJA 2QUUA 3EIFA 5C0RL 1F1GA 1EAPA 4FPSA 3PNZA 3PS6A 3QKZA 1T2XA 3ARPA 4JDVB 4NKDA 4JREC 5T3ZL 5T3XE 1KCRH 4JB9L 1JPTL 4YHLH 1TV2A 2NQJA 3EHBB 1HFUA 3ML8A 4OZGE 3N44F 4WAFA 5GZOA 2W5FA 4HQVA 4L5ZA 1RD5A 1G6RB 1EDHA 1ZV2A 5I3KA 2VKWA 3CFBA 3CZUB 4WJG3 4Q4OA 4WWNA 1CXFA 2QCFA 3FB7B 4KKLC 1O75A 3B2VH 3NJGA 2E75C 4MLIA 1G9HA 5C1MB 1S5MA 1T8XA 4MLRA 3I3BA 1OLZA 5AHNA 1HQ4A 5EY5A 3KHDA 2QULA 4LSUH 5HHMB 1Y1UA 4K7YA 3CAQA 5D7IB 2Y1YA 2NLYA 5SWSB 5KS9E 2XG5B 2OS7A 1E6JH 1JN6B 3BZDA 3II1A 5DJZB 1IYXA 25C8L 4QX4A 3OJDB 4ZFGH 1MMFA 2A4ZA 4QY8A 3WLHA 5A8OA 1AY1H 3ZDYE 4IL2A 3QQNA 1REQA 1YEFL 1JFQH 4HVBA 3VFNA 5J6HA 1V0LA 2ZX7A 5F9WC 3U2CA 3D7PA 4ELDA 3O4LD 4Q4RA 2J44A 2PWDA 4X0KA 5LG6A 3JV0A 5JPMA 2EAEA 5DD3H 4KO6A 1TPEA 3ATZA 4JKNA 4MMZC 1R3IL 5LBGA 2WZPA 3U25A 4GBDA 3KDPB 2YXWA 4RGOL 5AENA 2FGLA 4JTQA 2IALA 3NJFA 4KHTL 4OW6A 4HMNA 1FVEA 1QI5A 2YO3A 4D9QD 2X4UB 3QUYB 4LNVA 3S4TA 2O26U 3E6EA 1THCA 4X61A 2NY4D 1U21A 3C2SA 4GY7A 4QSHA 5DLCA 3U7BA 1ZY9A 2CBMA 3OX8A 1RZJC 4Q6IB 3ITGA 3OG3A 4S23A 2P5WA 4CC1A 1ACXA 4C5YA 2MANA 3VSQA 4YHYC 3SCMB 5FO8A 1WB0A 4FHKA 1ICTA 4N0FA 4Z0BL 5A2FA 1I8KA 2GJXB 3DJRA 2EXSA 4HIQA 1I31A 3AWGA 3CFJA 1N59B 1KIQB 4G43B 4YIQA 3VH8A 1CBGA 4NO2A 1FVPA 4TX9A 4NAJA 1JNNH 1AKPA 1M7JA 5IKCA 2OTUA 1L0QA 4O4YH 5KG9A 1UW9A 2NXZB 2WQVA 3BE1H 5LGHH 1N12A 3V8OA 4I2XA 2AJXL 1TLMA 2IVFC 1ICQA 2J4WL 2K6YA 3HGRA 2DV0A 2Y4SA 2XXFA 1O5KA 2WLKA 2Q8BH 5C0BA 1IXPA 3GSQB 1FYHB 3SOBL 4HW6A 3OBAA 4WJXA 4MJIA 5IBUB 1TXKA 3UWEA 3CDGB 1GGBH 4HKZA 3QJHB 3ZX1A 4BFIB 3QRBA 4FKEA 5GS1B 3Q6GL 4AYEC 5D7SH 5JHDA 1M7IB 4FQLH 4MAYA 2OELA 4AW4A 3MRKB 4WK2B 1TZ7A 4FF9A 4WIWA 3MV01 2HMIC 4ATWA 3AHTA 4GXWA 3WKMH 1AGBA 4MY9A 3GMPB 5A2AA 4I87A 3IMBA 5C9JB 3QARA 5CR1A 3CX5J 3QN3A 3HRZA 4A22A 3BD4A 4OUUB 4F8LA 4IF2A 3SW6A 3BWUC 3DXIA 1DQMH 2IH3A 2ZUQC 3FQWB 1DXIA 3H26A 2XH4A 3R18A 1KBJA 4M7LH 2A3HA 2OL3L 4KJQD 4AG0A 1W54A 4I18C 4UV7H 4ZOAA 3WI9A 2BZNA 3CQKA 3BSZA 3Q94A 3VGBA 4NAEB 4YWSA 3GFUA 2MRYA 4LLYA 5IP4A 4TV3A 2Y69B 3LNGA 1GMEA 1IGCH 3LRSA 3LKRB 1NCTA 3KCOA 1BSIA 1VCBC 4HISA 3VU1A 4O11A 2YUXA 1SR0A 4W5ZA 4LASL 5CWSB 5DC9B 5FB8B 1QFOA 4KXZH 2E7HA 5A6BA 1NDMA 5LUMA 5LAPA 1FWHC 1PVNA 2Y6TE 1Q72L 1U2HA 3GI9H 3MYJB 3OC5A 2FZNA 4ONVA 5C0AD 1M7XA 4HCFA 4IJBA 3GHEL 1A4LA 1WCGA 1OALA 1HKMA 4GIRA 4MJ4A 1JVNA 3GUFA 4NO3A 1UIPA 2V3FA 3OAUL 5BO1H 1FGNH 2BSLA 3U30C 2WQXA 3BQUB 3A22A 2WM0A 5F93C 1FOBA 2I7GA 1KLUB 4AT6A 5BS0D 1JTPA 3EUUA 1CDJA 3OLIA 1XGRA 4QS6A 2VXVL 1TRDA 1AZCA 2ZOOA 4JFHE 4WW2B 3OWEA 4AGLA 4IPNB 1WFOA 4J3UA 1AS6A 3M5ZA 4DVRH 3U2EA 3UZQB 5C3LD 3SGDI 4D2NA 4XAKE 4E4FA 5TGBA 2H2PC 3LS4L 1U95B 3B2DC 3BW9B 5FYKD 5FUZL 1PSCA 1GJIA 2MNWA 1QFEA 3V5DA 1TEGA 1TA3A 3O3BB 2BVPA 3M44A 2BK8A 2OYKA 3CHSA 3VKBA 2E7MA 1RMFH 3WEBA 3U0WH 1A6TB 1X9RA 4OLZL 3RGVD 4R5EA 1H6UA 2ESVE 4R85A 5ERWB 1ADWA 2APXA 3CB8A 3SY8A 5EF3A 2JKJA 3DHMA 1P7TB 4PYHA 3VDBA 3WD1A 4JHAL 1DXFA 4KQ4L 1TLKA 3BWSA 2E6FA 4A7TA 4XNYH 3ZT6A 3W2NA 2AK1H 3FA4A 3MP3A 1NDTA 2VLJA 5FAAA 5FK9A 4EPBC 5HHXH 3TVMB 3VMOA 3VD4A 1TWIA 2VDPH 3QUHA 3ARZA 1LEKA 4JQIA 3HNVH 2BS71 5I8OH 3BN9D 5EFIA 3NBNA 4WGXA 2HRPL 4PJ9D 3EB2A 1D9KB 1J7VR 3HW7A 3LMJL 3CC1A 3T2OA 4LHUG 3WBAA 4YN3A 2ZOLA 5IROD 4BWWA 1QFWI 5FF2A 3O3AA 4NQSB 5ESAB 3MFGB 2WHLA 4MPKA 1P1XA 3O8XB 4HWZA 2BVTA 3TONA 3NRPA 2PBGA 5DZOA 4Q6JA 3ISIX 3NPZB 4P4KB 3T0WA 3MWCA 1JWMB 3DX4A 3DBXB 4DBSA 1E3ZA 1ZGLP 4AZ8B 1R3LB 3B8UA 4Y16D 1GZJA 1YY9C 4ZZFA 5K33A 1NFDE 3W1TA 3UBFA 1NFIB 1CLZH 1K77A 5HA7A 4GKSB 2APFA 4GQPH 1YPXA 3UP8A 5EKYA 4R96A 1L5GB 1WKEA 4H9UA 1ZB5A 1DSWA 3M0JA 1T6WA 5HGAA 1QBLH 4TUFA 2ENQA 3IDNA 5SWSE 2E86A 2VZVA 3WFEH 5A6MA 1XCTB 5KS9B 4JQIH 5LLIC 5CIPA 4A2GA 1S78D 1CICB 1U92A 1WZ1L 1Y07A 2VTFA 3IU4L 4GMSH 4MKTA 4OM1L 2ICES 3UTOA 5EDSA 1S9XB 1Z9OA 5BRBA 1IF2A 2AI0L 2B0SH 2SODB 4JFOB 1H7NA 4G9FA 2YX0A 5DJZA 5E2JA 3QPZA 4UUIA 1MEXL 5FJJA 4PRIB 4XMUA 2ZOTA 3MREB 1G9MH 2QZQA 2Q6WA 1PKNA 4J27A 4PBVC 3LI0A 3PBWA 3UZXA 4ZPTA 1ZAIA 1XSOA 2CW6A 1CGWA 1VLIA 1NWTA 1B5TA 1OAQH 3RDTC 1XGQB 3L5IA 3PL6C 3INUH 3D09A 3VFRA 1MQQA 1LQAA 1ZUAX 3CQ0A 4GABA 4QNPE 1SR9A 1XYFA 4AMKH 3BN3B 3TN5A 4AZ6A 3T2LA 3ZKXB 1W0YT 1N8ZA 1X6NA 3E9UA 2OQYA 1UATA 2GJZA 2P5ED 2G2NA 3IDYC 5DK0B 3ZOAA 1B3ZA 3QW3A 3P4LA 4PMYA 3U9PH 1EEQA 4PAZA 4FMFA 5IHWA 3MMWA 1P43A 4GSRA 2VDOL 3OOQA 5GGSY 1ZT4B 1RUQH 5HDOA 1S2UA 1H41A 1HIMH 2X2UA 2A77H 2R7EB 3UZJA 3N4AA 3EYSL 2NY5H 2OP4L 4FQ2L 1FWSA 1U8LB 1BBJB 4M5SA 4QCFA 2DLHA 3P73B 1QA9B 4NBZB 4ZUUA 2VVSA 3WUWG 1Q0YL 1EHNA 4Q7IA 5EBWA 2YMOA 3QJVB 4PMVA 3JWOL 1BF6A 1E1FA 4P05A 4X98B 3LKSB 3F04A 3PHOB 1XGZA 3AWFA 3JSSA 4EVZA 4HUKB 3WTYA 1OPOA 1LP6A 1MEWA 2P5WD 2PB1A 4M5PA 5I00A 4AQ8C 1NCJA 2EIMB 1YLVA 1GYAA 1EOMA 5I3FA 2MHAA 2DQEH 3PDDA 4KMQA 3AROA 4F9JA 4HGMA 3FJ4A 3Q8CA 2R9HD 5E0CA 2YPLB 5FA3A 1ZE3H 3AZRA 3LM3A 1UWEL 1NIAA 4S3DA 4LLUA 4XBJA 2MFNA 2B59A 5CU5A 2G2RB 1JPSL 3O4OC 5EC2A 7ENLA 4J2PA 4P57A 4J28A 3F00A 2XV2A 1WFTA 1YNTA 2MTPA 1ZBVA 4IEFB 1CF8H 2VSMB 1UJTA 4MAYB 4NI6A 3D39E 4P8QA 4QT5B 2J8UE 4AENB 4BQ6A 4AIOA 1NPJA 5I73C 4XAPA 4JFUA 3EBGA 4JQ3A 2AV1A 1MG3C 3SCUA 5ESQA 1RLDA 5E8NB 1QNPA 1EAOA 4OIBA 5JIDA 1YN6B 3KPOB 1EWHA 4OCXL 5LBSH 3ZDZB 2BBFA 3R7QA 3NJNA 4DZ8A 4M7LT 2LVEA 4U1NA 3AQZA 5CZXD 2TPSA 5HGHA 4YOKA 3OKMB 3B1UA 2DLGA 1LOQA 3R0UA 3Q0HA 3NT0A 3P3YA 3RVWC 2APBA 4KNQA 3ARBB 4JM4L 4PTWA 3LB6C 3UO8B 2CBUA 1H11A 1VEOA 2FIKA 4JG0L 1CLKA 3B37A 1XQKA 3PPCA 2EE6A 5FPIA 3P9LA 35C8H 5J12B 1AACA 5LSMA 2BIIA 1L9PA 1T20B 4Y9FA 4HKXA 1JPST 1X8CA 4OZGA 5IG7A 4ABVA 4RZ4A 3GVQA 2RH0A 4XD4A 4A3QA 1A4CA 1CFVH 5FC9A 3VGGA 3G0XA 4N42A 1ES0A 3JWOH 2VL5B 2WN3A 3MRPB 3NM1A 1CLOL 1U4FA 3RPMA 4GIPD 4PJCA 4NRZA 4ELME 5I3JA 4R9XA 2HVBA 1DHKA 4DPPA 3CXOA 3UTSE 4XB3A 3LEVL 3TU9A 1VAHA 1T6BX 2ZWLT 3GSNL 5GSRB 1QRNE 1Z42A 3WH8A 4A6GA 3IMSA 3F7KA 1XHHA 3H9ZA 4OAWB 1VQTA 3EXSA 2H9GB 2C1IA 3QI9D 4BDVB 4DQOH 1U22A 3M0ZA 4AMCA 1M1SA 1WFJA 3BWZA 4HULB 3RLHA 5DGRA 3VCLA 4H9TA 2HNHA 3IB4A 5E5LA 3WAKA 4YX2H 4P8WA 2NYKA 4FXRA 1P6AB 1EANA 5TGBB 4RDWA 1CDIA 1M4KA 2K6ZA 3FL7A 3LZRA 2K3HA 3CSGA 4NLHA 1D5XA 5CJOL 4AQEB 4AMKL 3G8EA 5TBOA 1DQKA 5DDHB 3WFZA 5CPNA 3W1MA 4OBTA 3VD2A 4PUWA 1FBIL 1ZJHA 5F1IA 4Y1TA 1EZLA 5BZWB 5IVXF 4YXKL 2HPTA 5F6IB 3HBLA 1FZKB 4ADTA 3ULUE 3U0HA 1X9QA 2VH5L 4Z3HA 4Z2KA 2HROA 3EPOA 1ZVSA 3JTSB 1NJJA 3D5OF 4BFNA 3LQGA 1JXFA 2Z8SA 4I0PA 4N2GA 3UXFA 2AI0H 2B0SL 2HKAA 2QELA 3HAEB 2EIZB 5TE6L 4EQ3A 1V7AA 3OJDA 5F9AC 3HMXH 1MCQA 3NJXA 4FOMA 1WZ1H 3DRTA 4YDJA 4GMSL 5I1IH 2FX7H 5JUEH 2CLPA 3S5NA 2AABH 2QQKH 3PABB 1JE6A 2PU1A 1RUKL 3OVQA 1D6EB 2JB5H 3HKZA 1OV8A 4HIEB 4NZ8A 1VFOA 1MY5A 4QRQA 5C0NC 1U30A 1B6DA 2CR6A 2Y61A 5T3XH 3W26A 3FPYA 4N6RA 2V5KA 1Z32X 4MD5A 1WDSA 4XPAL 4RMSA 3VI3E 4YHML 4IW4C 4LB8A 4REQB 5JW4R 4FNRA 3PK7A 3N12A 4O16A 1EQWA 3ZHLA 2JEQA 2Q87A 1KN2H 3OPZL 4FFTA 1JYNA 2J43A 3DOIA 1FV1A 4W9FC 1SSDA 1CEOA 3NCJH 1KEGL 3LGDA 4N9DA 3LUTA 4P3DB 1TQTA 3K72A 3CH1B 4H25B 4N8VB 4PI2A 3MJ8B 4NC2B 4TLTA 5CCKL 2GOKA 3R0NA 4P3CH 1JRHI 1MHCA 2JKLA 3LZLA 4PRPD 4NQDD 4QYAA 2EO1A 1TQXA 3KL5A 3N2OA 1EP3A 3PJWA 1H7RA 4IQLA 3SJ3A 4LEXL 2CLFA 5E6YA 5HPMB 5B4MC 1MCKA 3DOSB 1KPRA 4IOSD 4OUEA 2VDPL 3PB0A 3FK3A 3CXHK 1OCRB 4U6HA 4Y5YC 1OWWA 4NQXA 1F7BA 1CGVA 2HLFD 2YDRA 2ICSA 1LMIA 3VW3H 2XM1A 4E0CA 5LNRA 1ZOXA 3Q01A 4XNYL 2G3FA 2F1AA 2W63A 1IVTA 2YAPA 5B38G 3QHOA 3WKYA 1MFMA 4KTDL 1ZXQA 4I2XB 5DT1L 3IDXL 3I02A 2ESVD 5F0PB 3PF2A 3TBWB 4ZPTB 3FMGL 4RNRA 4EACA 2ATKA 2J5LC 4Y89A 2NQCA 1OCZB 3II2A 1WBYA 1XQ4A 2F74A 2UZIH 2VDNH 4QD2E 4YGVA 5IDIA 4PGCB 3O6DA 2FGWL 3V5CA 3VKDA 4M1CD 3JVGA 4DZBB 1XIDA 3TN0B 3HTLX 2XSAA 4DHLA 4Y4FA 2HJFA 3D85B 3FZUD 3KRBA 1CGYA 4NO0D 1CK0H 1F3DH 2ADFL 1OX5A 1WXYA 2O92A 4HKBB 4PWEA 4ZW6A 3S5ZA 3SDCD 1S7QA 2OXHB 3WLLA 2R2CA 4G1MB 2UZIL 1TPDA 3DOHA 3TGXA 5D1QA 3PWUA 4Q97A 4FLOA 5EMLA 4M24A 4KK5D 5AW8B 3HE7A 1XYZA 2X2GA 1A1NA 2YCIX 1RURH 1Q94A 2Y6SC 2CLOA 1P6BA 2I16A 2DB8A 4LLDB 2KZWA 4LLYB 1JV5B 2NY4B 3IDUA 4NPKA 4UDUA 5D4QA 5DJCA 3GZOA 4KI5F 3VKJA 3ZLHA 4YVVA 3GIZL 3QY8A 4N25A 3GMOB 2H4EA 4BQ4A 1MDAA 1JWSA 4UNUA 3QDGB 3L7FA 2VERA 2GJ6D 5C3TA 3G1RA 3TFXA 4JX0A 3KGUA 2OEKA 4KXAA 2CZEA 4YE4H 1TJGH 1WFUA 5E0FA 5K93A 1LUCA 4P3CL 5L6YH 1PKYA 2G2RA 2UYLA 5JYMA 2Z7UA 1DE5A 1ME8A 3EH1A 5ACLA 5D2VA 3CUJA 3NCJL 2H32H 1SVZA 2FZ3A 2YA2A 4XODA 5DO8A 3W37A 1ZGDA 3IETA 3OPZH 4K3DL 2H9AB 1KG0B 1MFBL 1OTUC 1KV8A 4CADA 4MJMA 4BHYA 5IFAL 4ZS7H 3VXTB 1NC4D 3CN1A 2H2SC 3DG3A 2VR2A 1A5OC 3IJ7A 1D5BA 3JVFC 5ESQB 3G1YA 3KYMA 4CU8A 3MO1B 4ICMA 3BP5A 4NKOA 5F1KC 1OM3L 3GQFA 1QLEH 3QA3B 3BW9A 3ILEA 2JB5L 1KGCE 3KL0A 1QSEA 5T8IA 2WZMA 3NQDA 3RZCD 3NXFA 4UMAA 1S3KH 3S8WA 3GSOA 2SFPA 4JO3L 3MNDA 1ZSDB 4K5OA 3TIDB 4DESA 5IV2B 5KSBE 1EAPB 4O9HL 4US5D 3SOBH 5CJXA 3RLGA 2BSRB 4YAQA 4RUBA 1J12A 5DSCB 4L4VE 1V08A 3F2CA 5I3HA 4S1RL 1HKKA 4IQJA 3BE1L 3LN5B 3TV3H 4F0LA 1OD7A 1TDQA 4GKLA 1IM9A 4PGDB 4RDVA 4M1CC 3S36L 4M0XA 3RDKA 2YSSB 4NY2A 1SW7A 2BSEA 5CEYB 4JQ4A 3R7RA 1HCYA 3NJLA 4HPJA 1DVJA 3NOEA 2PWEA 4IUOA 4XXWA 3OMIB 4ZW5A 4LU0A 4DJDD 3A6CL 4I3RL 1JMXA 4GJTB 1Z6KA 2IF7A 3D47A 3D25A 2VLKB 3BIAX 4A2EA 4DF0A 5K9OA 1OSYA 1XIWB 2G0LA 4PJCB 4QGYA 4BE5A 3KLDA 1TNNA 1GONA 4L0PB 4I5RA 4DQOL 4NQSA 4DWSC 1YO4A 1XGUB 3BPOC 5D7LE 3MSGA 1B3YA 3I6LD 4TQTA 1SGJA 5F71A 3PP4H 1T0NB 4HS3A 3KBVA 4L3EA 1VPYA 5IHBA 5MEPB 4KHTH 1QYGL 2P28B 3VCRA 4U1MA 3S5LB 2N1KA 4RBPH 3UETA 4WEBL 3PBUA 1GHFH 4IG2A 4MCYB 3DH7A 3NTYA 1FVDA 1QATA 2B5IB 4X60A 1EEYB 4TVPD 5F96L 3FCTB 3LHPH 1XQLA 5DJDB 4KWOA 12E8L 3U2ZA 3F7VA 3ZE0F 1SM9A 5FOBA 1A8ZA 1S5HA 4MJ6B 4A3HA 4LWWA 4PB0H 4WY7L 2FVMA 4EI5A 3UNDA 1YEFH 2FX8L 1F00I 35C8L 3IFPB 2CCRA 4PMZA 4QYOA 4WDWA 3F7LA 2ATPA 1YHTA 3GIYA 4JG0H 4XHJD 1TJXA 2WIIB 4XISA 3GSNB 3A21A 4HIJA 4TVPH 5TDPB 1LE9A 4LUSA 3UO1H 1T80A 2PUQT 5AAPA 3QSTA 4IKJA 4KDVA 1M2OA 3CU2A 3QNYB 1VZGA 3U6XS 1OGSA 4I9WE 5FO8B 3NPVA 3SE3C 5DJ2B 5FLVA 1S9YB 2CWRA 1QU4A 3PWJB 5I06A 1HXYB 5LBSL 1URLA 1Z9PA 1BX2B 3RWDB 3LHVA 4AC7C 1LK2B 3QEQE 5AHLA 3LRMA 2A74B 2E3VA 3CVCA 3T7VA 1W1ZA 4O00A 3BIKA 4U7SA 5HHME 1UGNA 3IJYA 4YR6B 2R4SL 3LEYL 5D7IE 5ICXB 4ZX3A 5I6XC 1JRBA 2FVLA 1AE6H 3QZNA 2IMNA 3PGCA 4NC0B 2JJSC 3S4SB 1BFVL 3VQ2C 1N8IA 1W1IE 1RZJH 3FO2A 3X14A 1II4E 3FRUA 3RVXD 2R1NA 2V9QA 4JFVA 2G50A 2X0HA 1F8TL 3U9UA 1IFHL 1FHNA 1QWHA 3BCDA 3FFDB 3K8MA 2PGWA 1RJCA 3CNKA 4XCEB 3VACA 4BCXA 4BCZA 1W9UA 2XKNB 5DXWA 1VB9A 1NEZA 2FGZA 4P5UA 3KVQA 5IB5B 1DVYA 3MHZA 1EFQA 1G6RH 1IL1A 1A4JA 1PJWA 3K81A 3MRHB 2EDJA 3VWJC 5HI4D 3ZDXB 1TJ2A 2EDLA 2E6JA 4R7JA 3T0CA 3QFGA 3P3RA 4GK8A 4LP4A 3EJCA 2FSEB 4CNIB 1F56A 4FA3A 2SEBA 2ZIDA 2YGNA 3KEDA 4TLUA 5FKPA 4A63A 2OP4H 4D8OA 1EYWA 1XYCA 4CVXB 4HH8A 2WP3T 1NGPL 2L3BA 3NGJA 4LTSA 2TMDA 2CCWA 4PCFA 4QRRA 2B4CH 4NP7A 1R3KB 5KYWB 3TQ0A 4ACPA 1F4WH 4AF0B 1IGTB 4Q9QL 4KCVA 2HUHA 4Y2DB 3GHTA 1AJ0A 1ML0A 1Z9SA 3BZ4B 3MTXA 4JDEB 1IE7C 1A3RL 1UROA 2VDPB 4PJAF 3FOKA 3ARQA 3M8OL 3A3HA 1UKOA 3SPCA 1AMXA 1I0BA 4JZNA 4N4YB 5J6SA 1IQ8A 1EXPA 1OC5A 4W8AA 1A7QH 4PFHA 3LEXB 4G8GA 1AD9A 3Q2NA 4NP9A 5EZIL 3RTQC 3IARA 4U5KA 3RF9A 3PXHA 4I5BA 2W1NA 2CKBL 3VM5A 2WW5A 3KCLA 1Z3RA 2WYTA 2BV9A 2AKMA 1NWPA 3IUIA 4OKDA 4BD4A