3IJ7A

Directed 'in situ' elongation as a strategy to characterize the covalent glycosyl-enzyme catalytic intermediate of human pancreatic a-amylase
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Directed "in situ" inhibitor elongation as a strategy to structurally characterize the covalent glycosyl-enzyme intermediate of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3ij7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ij7A01
3AXXA 1D7FA 2OWXA 3HU7A 1AMYA 3VD3A 2ZICA 1OGBA 1JZ3A 3GXDA 3GBEA 2O92A 1L0PA 2ZXDA 4W85A 3W6LA 1QWUA 3PZVA 5A1AA 3TOPA 2XGBA 1IV8A 5A6SA 1ISXA 5FIPA 1GJUA 3VKKA 3NYDA 1CXKA 2YL8A 5C70A 3W53A 1XH2A 1MVYA 2F61A 2JIWA 4CCCA 4D6JA 1OGSA 1QI4A 2D23A 1S46A 1MWOA 1V3LA 1E5NA 2PC8A 2GK1A 4HMCA 4W8AA 3HMCA 4IPNB 3WNPA 1I1WA 4LYPA 1GQIA 3CUJA 1JL8A 2ZWZA 1H49A 3ARVA 4W87A 1TMQA 3VIOA 2EEXA 1SFSA 5JBDA 3UR8A 1QNSA 3WF2A 3W82A 5I6SA 2G3MA 2IGTA 4D1JA 3WDQA 2BHZA 1NH6A 3HG4A 1PZ3A 1K9FA 4J3SA 3AZSA 3PTQA 3GBDA 3H53A 5BRQA 3GH4A 1R46A 2DT3A 1GOIA 3VGBA 2VX5A 4CN4A 1RD6A 1QI5A 2ZX9A 3DYMA 2UY3A 4EANA 4CD4A 3EDDA 4AZIA 3L2LA 1BPLB 3VD4A 2BHYA 4WJXA 1BYCA 1H41A 3CZ8A 2VX7A 1V6WA 3AIUA 1A3HA 1UWRA 4WK9A 3N17A 2GSJA 3TP4A 1TQUA 1CXHA 3WY1A 2J4GA 4PCTA 2A3BA 3I3DA 4KMQA 2E9BA 1UR8A 4GQQA 2DSZA 5AC4A 1B3VA 1BG9A 1E0WA 3OA5A 4AD2A 2O9RA 5DFAA 1GQLA 3QHMA 2V3DA 3VMOA 1B3ZA 1Q6CA 1CEOA 1CGVA 5E0FA 2DH3A 1FFQA 3PZ9A 1WZKA 2VTFA 4UFMA 4HZ6A 3S6TA 5EBAA 4ZEPA 1LL6A 2E40A 2D0HA 4NF7A 2VRJA 2XHYA 3AMDA 1WZAA 1VAHA 4B16A 1V3MA 2YLLA 1KB3A 3UCQA 5EFFA 3TV8A 1W9PA 1EO5A 4PCSA 1D2KA 1C8XA 1JDCA 1E73M 1VIWA 1TE1A 4D6GA 3SCUA 3WY2A 5HXMA 2DT1A 5GQBA 4Q7NA 3ZO9A 1H09A 2DSVA 3VIPA 1BLIA 4JFTA 4UNIA 4M29A 1TQVA 1DWAM 3VSVA 4FNSA 2IXVA 5IFTA 1JNDA 3DDGA 5AC5A 3AHVA 5E6ZA 1C91A 2VVNA 2E9MA 2CHNA 2PBGA 2Q8XA 4AZGA 3VMPA 3RM9A 4JHOA 1JAEA 4LGXA 1MW3A 3VNZA 5D9MA 1KXTA 1OD8A 4FMVA 1WDSA 4AD5A 1W3LA 1C3FA 5BYWA 4CUCA 1XH0A 2DIEA 1LF1A 1XV8A 1LQ0A 1QHZA 2EADA 5DEZA 4WF7A 3WD3A 4XUYA 1L8NA 4FNUA 1QI3A 1CECA 1TA3A 2WC3A 3MS8A 1W2VA 4U2ZA 3W0KA 2VVSA 1UH2A 1AVAA 2ZUUA 3S2CA 3WH8A 3VIMA 5JIWA 1CGYA 4LQ1A 4DM1A 5HOSA 3CUGA 3SCVA 2DEPA 2XIBA 2J77A 1DTUA 2XM1A 4HOWA 3A4AA 1HTYA 2OSYA 2RGLA 4M80A 4EAMA 2W91A 3U7VA 4NI3A 1LG2A 1PX3A 3BUIA 5GNYA 3PZMA 1QW9A 4NRRA 3LPOA 4JAWA 1CNVA 4ZFMA 2Z1SA 5CZKA 1GOWA 4L4PA 4OGZA 1R85A 2Z1KA 4UOJA 3N11A 4Z2JA 4W89A 3A21A 3AIBA 5EMYA 3CZKA 4PEEA 3CZSA 5A2CA 1W2PA 5KZ6A 2FGZA 3AMLA 2EPNA 2A3AA 1KCLA 3BAXA 3T2QA 3WQ8A 1E40A 3ZJ6A 3WF3A 1B90A 3F5LA 2FH8A 1W1PA 3RJYA 1YQ2A 4XZBA 3WDJA 4WSJA 3RM4A 3WELA 3BVUA 1OINA 3AI0A 1QHOA 2YDRA 1OIMA 4QCFA 3LRKA 1IZKA 4H8UA 1VB9A 4F8XA 1JZ6A 1BGGA 3KLLA 1JNEA 3FAWA 3G6LA 3L4VA 3NSMA 4FNPA 3DECA 3AOFA 4EK7A 1M03A 1C7TA 2ZX7A 3LRLA 1DEDA 4B9YA 2VO5A 4ATWA 3WQ4A 3AJ7A 4HA1A 2A3HA 2J79A 5DF0A 2VCCA 4U31A 1EDTA 3TTSA 4CU6A 5HPCA 5E70A 2D2OA 2QF8A 4PMZA 1UWSA 1K9DA 2OWWA 3L2MA 8CGTA 4J3XA 2VQTA 4PUEA 4FLRA 2Y24A 4U5KA 4MNJA 4J28A 4TX8A 1Q6EA 3FN9A 2IXUA 2GVYA 1E4MM 3D4ZA 3FHAA 4IUGA 3IJ9A 1M53A 3WNKA 3GXFA 3ARUA 4TOQA 2BVDA 2UY5A 2F7QA 1UD2A 4P7RA 3U7BA 2YFOA 4AYSA 1W3JA 3AYSA 1QPKA 2O9PA 3KL0A 4CCEA 5C71A 1P6WA 1UOKA 2VCBA 3VM7A 3B9AA 3SCPA 1WP6A 4PN2A 4WSKA 1ITXA 2X09A 3UR7A 5E6YA 4UFJA 1ECEA 1JF5A 1US3A 3WQVA 1JYVA 4H8HA 1VFFA 2V5DA 3VO0A 5M17A 3LXCA 2QMJA 3ARWA 5A6AA 5JUVA 3SCQA 1JF6A 5JBEA 3BUQA 1CDGA 3N12A 4DUXA 3AMGA 3WH5A 3W24A 3PZOA 3ZJ7A 1CYGA 3DC0A 3WKZA 1JDAA 5LA1A 1GOOA 3VX1A 4X9YA 1MW0A 1V0MA 4TVUA 3IJ8A 4YHGA 3WL0A 6TAAA 2VZSA 3W6MA 1KFWA 2XN0A 1KGWA 3GM8A 2F7OA 4UQDA 1MXDA 3U57A 1UYQA 1JXJA 4BQ2A 3KL3A 4UZSA 5CLWA 4AMCA 1RP8A 4UQ9A 3WY4A 3T0BA 2GJPA 4PMRA 2VRQA 2J7CA 2J7HA 2D24A 3A6OA 3EBVA 4D71A 1BFNA 2FE0A 2F7PA 1EDQA 3VU2A 4IM4A 4AZ7A 3AS1A 3CLWA 5A3HA 1US2A 3EDJA 4NXSA 3K4DA 1JFXA 4NXKA 2CBJA 3AIWA 1HXJA 2XFFA 1KGUA 2DT0A 4CU7A 2WM0A 3AIEA 1HVQA 1UZ4A 3BGAA 3IAQA 1E70M 4KWUA 2BXZA 5M5DA 3PZNA 3N1AA 2WVUA 2VJXA 1M01A 1HT6A 2YL5A 1UD4A 3WIJA 3VOCA 3G6MA 3BCFA 3VDBA 4Z2GA 3VILA 2XN1A 3ZOAA 2WC7A 3GH5A 3VIKA 1HJVA 2ZUVA 5CJ5A 1DWHM 1OSEA 1HP4A 4MB3A 4K68A 3EJTA 1V0LA 3KZSA 1V3IA 1W9DM 1C8QA 3MSDA 1FHLA 1WDRA 2ZOXA 3WH7A 1XSJA 2WBGA 1TVPA 3A5VA 4PYSA 2BVTA 1B3WA 2F18A 4X0NA 4NZFA 2FH6A 4YN5A 3VMNA 4P8WA 1UH4A 4GO9A 1C93A 3DX4A 2JIEA 1DWGM 4W84A 4CU8A 1H11A 3EDEA 1BHGA 4F79A 2VNCA 3LPFA 3VDHA 5A8PA 1KXQA 3CZLA 3EJPA 1W9XA 1R87A 3AIVA 1UKOA 2BY3A 5KEZA 4DWSD 1SMDA 1UR0A 1BSIA 5ABFA 4QLKA 2XN2A 4MB5A 3S5YA 3BVTA 2F2HA 3CV5A 2VL4A 3WDHA 5D9NA 1UA7A 1JYXA 4MPKA 2PWDA 3EYPA 3B9EA 4C7FA 1H3GA 4AEFA 1J12A 4ZE5A 5A94A 3T2OA 2F7RA 4B15A 4DUVA 1WPCA 2XVLA 4J3UA 1QBAA 4XV0A 3BUPA 4AEEA 2EAEA 3WQWA 4UQAA 2D0GA 1Q6FA 5I24A 4HMEA 3WDRA 3EMQA 1TUXA 8A3HA 2WANA 2GJXB 2WMJA 1G0CA 2A3CA 3CZGA 4MB1A 4U5IA 4UOZA 1XHGA 3PTMA 4U3CA 4N42A 2X2IA 1RH9A 1G9HA 2PWFA 1QNPA 1VRXA 1UD6A 2FDMA 3WN6A 3WNNA 4AZBA 3KL5A 1G01A 1JG9A 1CXLA 4W86A 1MXGA 2C7FA 1ESWA 1X6NA 1XSIA 2VT0A 1FHDA 1H5VA 2XFRA 1JD7A 2OSXA 5DT7A 3A4WA 2J7BA 4KRUA 1KQYA 3WQ5A 1EOMA 3AXHA 3SCWA 3D50A 2X0HA 3DHPA 2JALA 4GPNA 4EKJA 1HX0A 2AOSA 2E4TA 1WNOA 3QGVA 1ISYA 1CZ1A 3B8SA 1AQMA 3TTQA 4JL2A 1WKYA 2NSXA 1HJUA 1GW1A 1MYRA 3SUWA 5CPTA 2CYGA 2CKRA 1FH8A 1NP2A 5IDIA 1KBBA 3F5KA 1W3KA 1JIBA 1V3JA 4WKFA 2WCAA 4GQRA 2BVYA 4L4OA 2WW5A 3T2PA 1O7AA 2CCRA 2E9LA 4GINA 4DWSB 1UHVA 1W9VA 4AXNA 4AD0A 2CPUA 1AQHA 1VFUA 3GNPA 1NARA 1WDPA 2DSWA 2NW0A 1BG4A 1PX4A 5E09A 4HPGA 4J7RA 1VJZA 2DSUA 1EO7A 5ABGA 2WLYA 1J0KA 3ZJKA 3POCA 3WEOA 5I3DA 5A8MA 3PZIA 4CKQA 1GHSA 3WEMA 1OBAA 1UR4A 3LXAA 4HZ7A 1ODZA 4YPJA 4TTUA 1KR0A 3RPMA 3DYOA 5FCZA 4P7LA 1JDDA 1V6VA 4MADA 3OLIA 4MJ4A 3SUUA 2WMFA 1F4HA 3AS2A 3CZEA 2XFYA 2XGIA 3SCRA 3VD9A 3WNMA 1GVYA 4RE3A 1R7OA 4E8DA 2ZUWA 2W62A 1M04A 1W3HA 1V3KA 1QNRA 2ZUMA 2EPLX 4TVCA 2VI0A 2BS9A 3VIJA 2AAAA 3L4ZA 1EGZA 1PX8A 3CPUA 2WHMA 3WUFA 5D8WA 1XYZA 4B3LA 3CIVA 4HZ8A 1H4PA 2XVGA 1LL7A 4DUWA 1CXIA 3AHTA 1MFVA 4D72A 1D3CA 3CMJA 2W63A 2FHCA 1W32A 3AMCA 1SZNA 5HNNA 4BQ3A 1ZL1A 2ZXAA 3WEZA 2WZIA 2J47A 1W9UA 4AIEA 4URIA 1JYWA 2D0FA 3PN8A 3SUTA 3L4WA 1B3XA 2UY4A 1DHKA 1V02E 3GNOA 3UG4A 1I1XA 5DT5A 4OOUA 1FP8A 3FW6A 3OG2A 1UZ1A 3APGA 3LPPA 1E4NA 2PB1A 3BLPX 1E0XA 1PS3A 1UH3A 2WSKA 3GXPA 3M7SA 4H04A 2YBTA 5A69A 3N04A 2C0HA 4MJ2A 1E6QM 3K46A 3BC9A 1FA2A 1ZB5A 2WMHA 4IPLA 1MW2A 3NIYA 4CN1A 3MU7A 2EPKX 3L4XA 5GNXA 3WENA 2J75A 4V27A 1GHRA 3WD2A 2GUYA 2QPUA 3WDIA 2GJRA 1JI1A 4KRTA 3CHFA 3EMCA 4MB4A 1WCGA 3VM5A 1GONA 4BF7A 2D3LA 2PBOA 1CGXA 3OB8A 1TG7A 4UQCA 2ZXBA 4PMQA 3MKKA 1CXFA 2NT1A 3GNRA 1R86A 4XB3A 3MMUA 1QX1A 4ACZB 3WMBA 1OCQA 1OWQA 3KE0A 1PIFA 1MQQA 2WVVB 4AMXA 3WF4A 3AS3A 2QPSA 1BQCA 3U5YA 3KEHA 1E6PA 3MI6A 1HL8A 1JZ2A 3VINA 2HVMA 4LPCA 1NWTA 4DM2A 3RMEA 4W5UA 3BAWA 4W88A 3M46A 1B3YA 4AZHA 3WH6A 4HU0A 4WKAA 2VCAA 1QVBA 3OGRA 3ZIZA 1K9EA 3GDBA 3AMKA 3IJ7A 4JZ5A 1IZJA 1NOWA 3PHAA 1OT1A 1CGTA 1GNXA 1CLXA 4OJYA 1BYBA 2J7DA 3M6DA 3FHQA 2CETA 2WZHA 4WLCA 1TZ7A 3RCNA 2RGMA 4HTYA 2Y8KA 3W26A 2VR4A 1UKQA 4JKMA 3KLKA 2WK2A 3F4VA 2WMIA 4RE2A 1BGAA 3RJXA 1HIZA 4QCEA 2G8ZA 4AZ6A 3ZR6A 1U2YA 1GOMA 1W1YA 3NCOA 2WVSA 4C7DA 2J8GA 4OUEA 4AD1A 2IUZA 4EE9A 3QHOA 2NT0A 1QI2A 5CG0A 3LX9A 2BHUA 4UQBA 3BLKA 3OLEA 4NZJA 1HN1A 3VDAA 4BCEA 4TTGA 4D6HA 1FOBA 2JF6A 1EHAA 2D22A 2MANA 4RE4A 1E43A 3VIHA 1KWGA 1A47A 2G3NA 2F1BA 3BH4A 3HZ3A 1GOQA 1UD3A 2V3EA 7A3HA 1NWRA 3QOKA 7TAAA 1E9LA 2YDSA 4IISA 2G3IA 2XIIA 4E2OA 2TAAA 1UA3A 3WSUA 1U33A 5A95A 2YKKA 3PBGA 3ZSTA 1E56A 1GQJA 1OB0A 1JZ4A 1R7AA 1JZ7A 2YOCA 4HPHA 1J01A 2ZE0A 5C8BB 4GI9A 1PAMA 2VX6A 1KXVA 1E6XM 5D4YA 3VX0A 3II1A 4PSPA 3GXTA 2XJ7A 4MNKA 4E8CA 2W92A 4Z2IA 4H7VA 2AMGA 2CHOA 4WKHA 4DWSC 3D5HA 1XSKA 5E9AA 4PTXA 3PZQA 1KWKA 1B1YA 3BUBA 1PZ2A 3A4XA 2PWHA 2XWEA 1HKIA 1UD5A 1E0VA 1UWIA 2OYMA 3DYPA 4ZXOA 3DX1A 4AIUA 1VJSA 3VDCA 2YA2A 5CGMA 4PBGA 1HKJA 3SEPA 1EH9A 4QP0A 4FK9A 1E71M 3W27A 5TD4A 5AYIA 4GXPA 1E15A 4P7NA 4ZXLA 4UCFA 1GZJA 3FNDA 4LYRA 4PSRA 1XRVA 1OD0A 2WPGA 3SCTA 3T0AA 4A4AA 1WZLA 1VEMA 5FL1A 3RILA 2XSAA 3CHCA 3W29A 1B30A 5A6LA 2J7GA 4W7WA 3WF1A 4RL3A 2XUCA 4C7GA 3RDKA 2X2HA 1HJQA 3O6AA 3GXMA 3WF0A 1QNQA 2V38A 4FLQA 3HJEA 1UKPA 2YA0A 3MV11 5IXEA 4JKKA 4D6DA 1E3XA 1ISZA 3MSGA 1CWYA 1ZBVA 2VZVA 4CD7A 5JBFA 1Q6GA 2Y4SA 4KH2A 2CIPA 5BWFA 3VD5A 1UWTA 5JIPA 3WD0A 4YHEA 1DWIM 2BFGA 1E6SM 1V02A 4CVUA 3DX2A 4DO5A 3CUHA 1EHNA 5BCAA 1NQ6A 3IAPA 2X1IA 2XYLA 4FLSA 5FL0A 3JUGA 3A22A 1EXPA 5BRPA 2VX4A 4U2YA 1GJWA 2J7EA 2YL6A 4CCDA 2JE8A 5F7UA 1ZS2A 1E4IA 1V6YA 1J0IA 3WNLA 2ZUNA 1H0IA 2DQXA 4PTMA 2XSBA 1TVNA 5FKYA 1VFOA 4J3VA 1CGWA 3ECQA 2XG9A 3BCDA 1E6NA 3OGVA 4GZJA 2VRKA 3SCOA 4TXEA 1HXKA 2OW7A 4P7QA 3N18A 3TONA 2CERA 5BXSA 5E0CA 4GZEA 4M82A 3ZQ9A 3ARPA 4JHZA 5A6JA 2D3NA 1ISVA 1RPKA 4N0RA 3TTOA 1HKMA 1XYFA 2WHKA 4W93A 3L4UA 2Y2WA 4PMDA 5CPQA 2J74A 3AXIA 1GCYA 2E0PA 4KGJA 3CUFA 4U3AA 2XVPA 1NOFA 2CESA 1GOKA 5A2BA 4QAWA 3ARSA 4OBSA 2WYSA 3DDFA 4FNTA 3CC1A 3SCNA 1V03A 1DP0A 1VEPA 3H55A 1PEZA 1BVZA 4V2XA 3VSTA 1B31A 3ZSSA 2VOTA 4JKLA 1R34A 3LMYA 5LYRA 4B3KA 5CQ1A 4FF5A 5I5RA 2WVTA 3K4AA 2X05A 2FGLA 2GJXA 4GI6A 1KBKA 4M56A 1FH9A 2WSPA 5I2UA 3WBAA 2GDUA 1FFRA 3E1F1 3OBAA 4X0VA 1BYAA 2FYVA 5A6MA 3AHYA 2DIJA 5BXRA 1LJYA 3AISA 1I75A 3A23A 2UY2A 2DT2A 2QV4A 1UR2A 1KTCA 5CXPA 3B9DA 1F4AA 3WFLA 3BSHA 3D51A 4KGLA 5I78A 1CGUA 3POHA 4FNQA 2CEQA 3GZAA 1XCXA 1K9TA 4W8LA 3OZPA 1KXHA 2W4XA 1TCMA 3O2LA 4A3HA 3ARQA 1UKSA 2X2YA 1LL4A 1O7DC 3WH9A 2ALWA 4MDOA 4UR9A 1EA9C 1GUVA 5D8ZA 1CLVA 3BVWA 1KTBA 4AD4A 2GDVA 5DMYA 4JFVA 1PIGA 3EJSA 1W1VA 1O6IA 4UFHA 3RM8A 5A6BD 4DWSA 3PZTA 1E72M 4AZCB 1N82A 4AIOA 4HMDA 3AHZA 9CGTA 4DO6A 1E4LA 1BYDA 3L4YA 1HJXA 1V6XA 2WCGA 2CBVA 2A3EA 4Z2HA 3CUIA 1HJWA 3WNOA 4CD5A 3WMSA 4JFWA 3ZT5A 1EQCA 2XTKA 4GI8A 1YHTA 3EJRA 1JYNA 4W8BA 2ZXQA 1VFMA 1ZBCA 5A8QA 1NOUA 3SUVA 4W5ZA 1GPFA 1TR1A 2CBIA 1ZBWA 5IHSA 5BROA 3HG5A 4AD3A 3A47A 2JFEX 1JFHA 1R47A 3NDZA 1H2JA 1J0JA 2GK1B 4JIEA 1RP9A 4UQEA 2XWDA 2OWCA 4PTVA 3MUIA 1E1FA 1UASA 3BAJA 2WWCA 4F9JA 1C7SA 1KCKA 3UG3A 1MQRA 3VGDA 4QDMA 3BAKA 3AYRA 1Y7VA 2BNJA 2WXDM 3BXWA 1GORA 1GVIA 4ATDA 3OIHA 4MNMA 3DHUA 2E8YA 4H8VA 3K1DA 5I23A 4UTFA 3DX3A 2VUYA 3CMGA 1ZJBA 5CLTA 2HISA 2WAGA 1E1EA 1QWNA 5HPOA 3WUEA 3T08A 3WL1A 2ZX6A 1W9BM 2QLYA 3GTNA 2D1ZA 1R33A 1CBGA 3A3HA 2JF7A 2ZX8A 3CZNA 2D73A 5A6BA 4GIAA 4R27A 2PWEA 3SURA 1VENA 1MFUA 3UESA 1FH7A 3AZRA 3CZJA 4ZE4A 2X8RA 1UR1A 4GO8A 1R75A 2YDQA 3VUPA 2ZIDA 3VIFA 2D20A 2J8FA 4M81A 1CPUA 1V3HA 3WY3A 3EDFA 4UFLA 1J18A 1IT0A 1C8YA 2CITA 4HP5A 5M3WA 1UWQA 4UOQA 3FY1A 4MAVA 1DWFM 3EJQA 4HOZA 3ALFA 5A8NA 1X6LA 2EBNA 2VC9A 2ZUTA 2EACA 4JFUA 1TFVA 5HDRA 4BS0A 3H54A 1CIUA 1VBUA 3ARRA 1TQSA 1OM0A 3CHDA 3VGHA 3VTRA 1BAGA 1HL9A 4D6IA 4HA3A 1K6AA 3VGEA 1WO2A 3IANA 5IHRA 3GXNA 4OZOA 2CXGA 1OT2A 3ZR5A 1E6ZA 3AIRA 2OYLA 3VGGA 2X2JA 1J0HA 1JZ8A 3SIMA 2BY2A 3UETA 4ACZA 3ALGA 3VGFA 3I3EA 2WVVA 1HJSA 1ZBKA 2GFTA 3PZGA 5BXPA 2ZWYA 4R5EA 3GYCA 3VIIA 3MUAA 3NSNA 2PWGA 3A24A 4GZIA 3SUSA 3L4TA 3BMWA 2V5CA 1E6RA 3HN3A 4BQ4A 5D9OA 1QBBA 4ACYA 3MO4A 2O9TA 2J62A 4M8UA 3QOMA 3FXYA 4MNLA 3IK2A 5I0DA 3UERA 4AMWA 1CENA 4A3YA 1H1NA 5A8OA 1UG6A 2WHLA 1Q4NX 3N15A 2EPMX 3WD4A 3EMZA 1AQ0A 3CGTA 2YLAA 1W91A 4CD6A 4DO4A 4JCMA 1TA3B 3AROA 4AC1X 5AYBA 4Z2LA 1UKTA 5E1QA 2VR5A 1J11A 1HKKA 2ESCA 5HBFA 3QR3A 1E5JA 2EXOA 1QHPA 4B9ZA 3AHXA 3UEQA 4TX6A 1HNYA 4J27A 2DDXA 1C92A 1EIBA 3VVGA 5D9PA 3WD1A 4PMOA 1LG1A 3WQ6A 4FNRA 3W28A 1LWHA 4NX0A 4AY1A 1NM9A 4J3TA 3MV01 4UFIA 2E8ZA 1G5AA 3M07A 4NSBA 4P8UA 4LXFA 2WLZA 3WUBA 4ZENA 1B2YA 1JD9A 2OW6A 2XPKA 3WBEA 2EO7A 4TUFA 5LA0A 2CBUA 3ZM8A 2J25A 3T09A 1NWUA 4E4PA 4MDPA 3LRMA 4W7UA 1G1YA 1EQPA 3UG5A 1VF8A 3ZT7A 1UWUA 2FHFA 3THCA 3K8MA 2J7FA 1UQYA 3CBWA 2EABA 1U30A 1R8LA 3TTYA 1JXKA 4H41A 5ECUA 1WAWA 4NZCA 2CNCA 1UD8A 2O9OA 3D52A 1QOXA 1NP0A 1XH1A 3D3AA 3WMCA 2WMIB 2OYKA 2CKSA 4PMVA 3VPLA 1EOKA 4D6EA 1XD1A 1BVNP 5ABHA 3EDKA 2VQUA 4W7VA 4BQ5A 2DGAA 4ATLA 3GXIA 2G4FA 2BY1A 1NWSA 3AIQA 1E55A 2F1AA 1CTNA 1HF6A 3W37A 2YL9A 3MUY1 1GQKA 4WIWA 5CPSA 3BSGA 2DSKA 2Y5EA 3CO4A 2VZUA 3MANA 3K8LA 1TQTA 4HU8A 4QLJA 1XGZA 1JZ5A 5LA2A 1LLOA 2VMFA 3W38A 1B0IA 4D1IA 5EB8A 2JEQA 3RIKA 4AZ5A 1V08A 4XX6A 1JI2A 2DH2A 4PMXA 4QLLA 1OGGA 1V6UA 2EJ1A 4OKDA 2W5FA 1LWJA 4OOZA 6A3HA 3OZOA 4TVDA 3TA9A 4BZYA 2PI6A 1MW1A 1EDGA 1ITCA 1UUQA 4JFSA 4J3WA 3LPGA 4S3KA 1Q6DA 2BXYA 1VBRA 2ZUSA 4HA4A 3HG3A 1QI0A 1ZJAA 3BVVA 3ZJ8A 5ABEA 2G3JA 3PZUA 1X1NA 3NDYA 2EQDA 4GKLA 2UWFA 3MMWA 4PRWA 4S3JA 1W1TA 5CSUA 3WDPP 4CVWA 1H0GA 4PTWA 5EFDA 2W67A 3AICA 3RO8A 3DX0A 1SYTA 4LYQA 2YJQA 4PMNA 2YIHA 2WWDA 1ODUA 2WNWA 1HP5A 3ZMRA 1UR9A 2BV9A 1HVXA 3MUZ1 2XVKA 2FHBA 1KQZA 3W81A 5GNZA 3QHNA 4OIFA 2WKGA 4CGTA 5I79A 3ARTA 7CGTA 3T0DA 2OSWA 1J9YA 4AYGA 2WCSA 4P8VA 6CGTA 2QHAA 2WBKA 1ZU8A 3N9KA 3CTTA 1UQZA 3J7HA 1PBGA 1XC6A 1QNOA 3AS0A 1KR1A 4UFKA 2WMGA 4PUDA 2VURA 1OIFA 4BA0A 1WZMA 1SR0A 1BF2A 2OLHA 1Z32X 2X0YA 3AQUA 3F5JA 3KWXA 2J78A 4MTVA 1QW8A 2ZX5A 1B9ZA 2PF0A 3SCSA 2WZEA 3BMVA 1J0YA 3K8KA 3N13A 3VNYA 4NRSA 5GPRA 3ZT6A 3ARZA 3PTKA 4Z2KA 2EPOA 4FLOA 4D6FA 3AFBA 4P8XA 5DO8A 1XD0A 2WC4A 1G94A 1JGIA 4JL1A 2VZOA 3NSXA 4H2CA 3CH9A 3W25A 1CXEA 2YBUA 2WHJA 1VEOA 1TQWA 3ARXA 2XVNA 1J0ZA 4M1RA 2WMKA 5IFPA 1XCWA 5FOOA 2B31A 3I3BA 1MQPA 3O9NA 5BXTA 2YFNA 3VSUA 4D6CA 1C90A 2VZTA 4Q22A 2E3ZA 2Y8VA 4P7OA 5AY7A 3OGSA 3THDA 2G41A 4V28A 3BAYA 2WB5A 4ML4A 2WKLA 3VD7A 4JCLA 4UZUA 3NJ3A 3S5ZA 2V3FA 4F9DA 3ARYA 3CHEA 2DPEA 3VIGA 2YA1A 3BUDA 2V3GA 3W4RA 1T0OA 4MAZA 3EJUA 3AZTA 2QMKA 5M03A 4AWEA 3U5UA 4M24A 3MMDA 1DWJM 1HWWA 1V0KA 2XM2A 3FAXA 1JAKA 3OLDA 1WB0A 3IGUA 5A2AA 5I77A 3D4YA 1KGXA 2W66A 3NUKA 4CN6A 1J10A 3BVXA 5A6KA 2F8QA 4OBRA 4Y7EA 4HOXA 5CSYA 4PMYA 5ABFB 2C8NA 4F66A 1V0NA 1M7XA 5FD0A 1PJ9A 4QFUA 1E3ZA 1BTCA 1WE5A 2BY0A 3GH7A 3WUGA 4XZWA 4CD8A 4LX4A 2JEPA 1WDQA 1ISWA 1SMAA 3WFZA 3OLGA 3HG2A 1FP9A 4AW7A 4PMUA 4U33A 3BAIA 1PPIA 3BLBA 4AISA 5CGTA 3LXBA 2W61A 4AZCA
chains in the Genus database with same CATH superfamily
3Q8CA 4FQCL 3KP1A 1DQWA 4TL4A 2F58L 4XMVA 1S3KH 4DP2X 5LXXA 3W6LA 3IGAB 3OKOA 4JEQA 1ADSA 1BF6A 2IPFA 5CCJA 1RQEA 3MCMA 1VYPX 3G5XB 3S9DB 3PY9A 2P5ED 2ZWZA 4PJ8C 4NHCH 2X28A 4QIRA 5MEQB 4YJZL 4LDEB 4FXSA 1SFSA 4GRMB 1JXGA 1ALDA 5KN5B 3QQ3B 3QYCA 5KUKA 3TZFA 2OOGA 3OAYH 2C9RA 2Y7QB 3H2WA 4FDWA 4CN4A 4S3GA 1JGUL 4NZRH 1CFSB 3LDBC 4JHBA 2MIZA 2Q86A 2EDLA 4DJFA 3IJIA 4DJEC 1J9TA 1L0QA 1Q6CA 3QRFM 3EYSH 3ITVA 4W9GC 4EIGB 3O05A 4HZ6A 4GKSA 4G6AC 5EEXA 5JHDA 2H3XC 4NF7A 2VRJA 1UC6A 3CTLA 1VGKB 5T1LD 5EFFA 4WUUB 3MKVA 1G0XA 4P0DA 1TE1A 2OJ1A 3PWNB 3T81A 3PWPB 2H4EA 1AR1B 1NCIA 4NRXA 4AQEA 1WJ3A 4F91B 1L6PA 2Q8XA 1RUAH 4U1MA 2IKIA 1FQ0A 4AD5A 4FIRA 4FXGA 1XV8A 3E2RA 3LSOA 4M6QA 4FX5A 2HRPL 4LYKA 3SQBB 4YFDB 5HJDA 5FHAL 2YBGA 1W2VA 4BJLA 1XL4A 1AVAA 3IN0A 1NCAL 4JFHE 1JNLL 1K8DA 1IYXA 4AQOA 1OZTG 1GOWA 5AW7B 5D1ZD 2QDGA 2Z1KA 3EJYD 3Q6FB 2V82A 2DIAA 2AQVA 1PDZA 4PEEA 1MCLA 3CZSA 2R69A 2Z0UA 4YHLL 5GZNA 1VP5A 4A66A 2AJZA 3IRCA 4Q9CA 4FQIH 1QPNA 1J8HB 1NGQL 5GSVA 1UJQA 4NPJA 2A6NA 3UY7A 4KDWA 2GQ3A 1CVSC 5HR6A 1TQJA 1Z9MA 3C2VA 3TMLA 1LUCA 1OK4A 4FNPA 1KNOB 4Y4KD 3IXTB 2DAVA 1G4MA 1UM5L 5M95B 5LGXA 4JGMA 1M3JA 4CNIA 3QQNA 3QORB 4OCYH 1AQDA 1A6TB 3RO6A 4Z0BL 4M7LH 3W0WD 4M7SA 4MFEA 3MCKB 2ID5A 3LJ3A 4JFOA 3HC0B 4PUEA 4FLRA 2NMSA 5CJBA 5BMWA 2HTLD 1Z0NA 3T65B 1GC1L 4MA3B 3SCPA 4OV9A 1EV2E 2C1OA 2ATPA 2VR9A 5DWPA 4UIOA 1U2HA 5F7YC 4TSBL 2QJJA 3CHSA 2PFHA 5CGQA 5A6AA 3GSNH 5JBEA 3QDMB 2NR6C 1YPXA 4WI2A 2QGEA 1QMLA 3FT4B 3I85A 3WKZA 3SBRA 4FQXC 3QEGL 3H9HB 4BGLA 2JSFA 5EMLA 3MLSH 1RK1B 3T6XA 1MSSA 4PMRA 2VRQA 4MDIB 3UAJD 3CYJA 3LKSB 2VFHA 2HKHL 4QRFA 3T0VA 3QMSA 1GXEA 3H2NA 3FT3B 5IVOA 4YO0B 4KZEH 5FUCE 3GI9L 2DT0A 3FU7B 3K72B 4AVIA 3VFVA 3MXVH 4Y4FC 3VOJA 1NDTA 5SWUA 2ETWA 2R1LA 3LHYA 1F18A 4L0ZA 4IMFA 4OLZH 5FF6A 4XVSL 5CN1A 1GGTA 1C8QA 1DJGA 3TLQA 1BVKA 3UGVA 1EQWA 3DENA 4BDVB 4L4TB 4X6CB 1ULVA 4WEBL 1AYOA 4LCWB 1PKQB 3U2JA 5IVXA 3RVTC 2VNCA 3VDHA 3TEUA 1EFQA 1F97A 4W4NA 5I3KA 2ZSWA 2NYKA 1PLBA 2K8MA 3VW3H 3BSZH 3IDYC 3BLLA 1HJCA 2FSEA 4CRPA 3QZMA 1WV7T 2QEZA 1AS8A 4OECA 1VFSA 4UOW0 3UJFA 1ZDQA 1NMCC 4LARH 2DI7A 4RGND 1ZHKA 4HCFA 5A5WA 3WLQA 4Z42C 3HI5H 3TJLA 3LN4B 2FX7L 3FQTA 1P1ZA 5ERWB 2BERA 4UINL 1R3HA 2DWSA 3BUPA 2WLLB 3ARFB 1TU2B 4HMEA 3OZKA 3HE6C 5CEZH 1TUXA 2GJXB 2WMJA 3VE9A 1YVLA 1XHGA 3W11C 4XPBL 4GUIA 4N42A 1K6QL 2AXHA 5EF2A 2PWFA 3D0CA 5EV7A 3S4SA 3WNNA 4HZAA 1FVPA 3IIVA 5KBPA 5D09A 1X6NA 4HWBL 4NY2A 1RMFL 2J7BA 2X4RA 2X6AA 4N28A 4EN3A 3FTZA 1MUCA 4RFOL 3OQRA 1QLFB 3SCWA 1XGRA 3TJHC 4YHPA 4HVXA 3MXWL 3GINA 1HX0A 5GZOD 3OO2A 1A6UH 5AVTB 2C4FU 3QQ4A 4BK8A 2CWRA 5KOMC 5CPTA 2E9JA 5HHQB 1SOSA 1JWUB 4M61A 3HE7A 3ZDYB 4L4OA 5CHNA 4DWSB 4XXWC 4FHAA 1UHVA 2FT7A 4TVPE 4HJGA 3U83A 2BP1A 4AY8A 1V5XA 1A9BA 1NDGA 1A2YB 5BPPA 2V69A 3EH4B 4EDWH 1EO7A 1AZ1A 2GC7C 1UZ8A 2XKNA 4ES9A 2N56A 3WEMA 3W7DA 3KM8A 4O5LL 3F7PC 1T8XA 1LILA 2OO0A 2PDCA 2WMFA 1KBGL 1WDDA 2VXVH 3L0KA 4W81A 5EULV 2Q02A 1KYUA 4AMKH 1DVJA 4K39A 4PW9A 1MFNA 2R2CA 1BBJB 2IBBA 3PWJB 5EU7E 1VZGA 3DUUA 4JQVC 1BRLA 3T4YB 1U8HB 3LS5H 3CLEH 4DGYL 5EUOE 4D72A 1AD0B 4JR5A 4JFQB 4BQ3A 5F7EL 3USBA 2I07A 4KTEH 4ORGA 4P4RA 1HKWA 2X6CA 4CDGC 3BFQG 5FO7B 5A43C 4C6MA 5E99H 3ONCA 1CDCA 4TV3A 1E0XA 3VFTA 1WBXA 3C6LD 1H3PH 3LH8A 1A7NH 1ZB5A 3HPJB 1YNQA 3FBQA 3WDIA 4GXVL 4MMXA 1KELH 2EC9T 2ZPKH 4U0RC 1KT2B 3TMQA 3OB8A 3KGSA 3U4BL 2QUVA 3BN9D 1PY9A 4I87A 1NUFA 3NJIA 4PPTA 3DURA 5D04C 1A5FH 3SPVA 3FU6A 5KUMA 3MMUA 4YPGB 1JHTA 2OR9H 2IOOA 1OX4B 3O2WH 5DJ0B 1UB5A 4H4IA 4H1LG 1NEPA 1ONXA 3VINA 1IAIH 2E7DA 1MHCB 4XAWL 3S7GA 4OFCA 5HR7A 1B3IA 4BSJA 1R3WA 3FT1A 1MUWA 3CHOA 5CBBA 4NZ4A 3RY5A 1Q13A 4S2SA 3OGRA 3GDBA 3NH7H 1JGDB 4PH6A 3GR7A 1A4AA 4JFXB 1GR7A 1U8NA 4NQTA 4KT2A 3KXFB 4XC3L 2GJ6D 3TO4C 4GFTB 1EEPA 5I0XA 1TDQA 4Z3TA 5CPNA 4H1LA 1BGAA 2ON3A 2W79A 2XA3A 4GFIA 3B3IA 4LKCA 4Z76A 3NAAH 4P2RD 3SD2A 4WNJA 4EBQH 1Z42A 3OAUH 1DJQA 7REQB 1J48A 2QTEA 1KTLB 1SXAA 2Y36H 3WJWA 5F96H 3WAJA 1EHAA 4X0KA 4Y16D 4RMWA 3GYRA 3NCMA 4UTBH 4UQ3A 2G3NA 3LB6D 4HU2A 5DZOA 2Q8ZA 5EBWB 4DEFA 3W85A 3BEWB 2J5LB 1OWRM 1XSOA 1PAMA 3IFNH 2VO8A 4WHYG 1E5UI 3QZWG 3US9A 5F2IA 4ZMAT 2QELA 3NEXA 4HUXA 2WQAA 5B7YA 3A4XA 4MZ1A 2OL3A 2PXYA 1A80A 5CGMA 2P8PB 3QCTL 5JIQA 3W57A 2KH2B 1UCBH 2ARWA 4FK9A 4PM1A 4K23H 2I9UA 5ENWB 4D9PA 3L1OH 3DETD 4G7QB 4WU7A 1RZJC 4P59H 4BUGA 4UU9A 4MNGE 5SX5H 4I5XA 5L9FA 2B2XL 3VRJA 4N5EC 5EUOA 3MV11 1WBJA 4JM2D 4N85A 1Y0LA 4ZMNA 3KTXA 4Y4HD 2WKJA 3S2JA 1UWTA 4YHEA 2BFGA 1UMYA 3U4AA 1JPHA 3CUHA 5ESAA 3GK0A 1FGVH 3VCRA 5F7UA 2X12A 3GD6A 4HKJB 1AKJD 1G4EA 2P5NA 5DZLA 4J3VA 1A4BA 2HX9A 2PKDA 5DT1H 4ELMB 5IWLC 3JWDC 2QAFA 4L18A 2CERA 3G0XA 3SJVD 1ISVA 1FO0L 1KCRH 5D7IE 1NEZB 1KCVL 4MASA 4M5TA 4U1IB 4D2NA 1NDVA 4LSQH 1Q7MA 2Y5TB 3U9UB 1E50A 1Q38A 1NOFA 3KJ6L 2FBOJ 5J9PB 2R8WA 4X4ZA 4FNTA 5TNVA 1SO6A 1RIHH 3QARA 2KKQA 4V2XA 3QIWD 4O1EA 4JKLA 3ZSSA 1TOXA 1R34A 2AABH 5KOVC 3JWOL 5DRXA 4OV5B 3K4AA 5K3VA 1XGTA 2NW3A 1YECH 3W1QA 3M1OA 2WSPA 5LAXA 3LKPB 5JIIA 1M7IA 3CQIA 2X4OB 2V2XB 4BKNA 3WJYA 2OXGA 2IDTA 2YEVB 3GS7A 1YUHA 1M7DB 1JGLH 1F4AA 1GYCA 4P57A 4M93C 2VC2B 2N1TE 3NSJA 5C2GA 5CJMA 4TLUA 2GK0A 5C0DB 5FECA 3ULVL 1W8GA 1K9TA 4W8LA 5FUZH 5ECVA 2PDUA 4KVNL 4FYSA 1H50A 3V9FA 1CDHA 2ALWA 3O11A 1CK0L 2IWFA 4YLCA 4CNTA 1CLVA 1AH3A 1W1VA 4E9VA 1QRQA 3LMJL 2UZXB 3G0SA 4O1FA 2X4SA 4AIOA 4L9LC 2ICES 2VN5A 5F93C 2DMHA 4G72B 4QLRA 1TIUA 3MJ9H 1HJWA 1DXEA 3E0GA 3IMUA 1YHTA 3TA4D 2ZXQA 1U3HD 3E0FA 3AM8A 3I68A 2AXFB 3G6AA 1WYIA 1RUKL 4AU0A 5LGJA 1TB3A 1H8OA 2HE5A 1UP2A 3D08A 3BAKA 3IXAA 3PK7A 4RFNC 2WXDM 4WO4C 3WKPA 4KK6D 5BO1H 1DKWA 1ORQB 1BFTA 1PZCA 2I14A 1X5JA 4B5SA 4AENB 3EUUA 3I7QA 2WAGA 4HCRH 3GHTA 4KDTC 3BK0A 3WL1A 2WZ6A 1S7TA 4MHHG 1JWSB 4JX5A 3C8KA 1U8IB 2WQVA 1FCCA 3VFMB 3CFKA 4G1KA 1UZHA 3CMOH 1NMBL 1BG1A 2X4QB 5IB2A 1NGYB 3M47A 1U83A 3EXLA 4M81A 5E08H 3H6JA 3WY3A 3LVTA 2DYSB 2EG8A 2B0SH 1SJCA 3NZSA 1YXDA 3AG3B 1P5UA 1W16A 2Y3NA 3GIZL 3VXOA 3PGFH 3RZCD 2H6OA 3RDTC 2OTUB 3QUMH 4DKEH 5AEAA 1HXYA 1MUJB 4Y16C 4X7DC 4IFRA 3AIRA 2OYLA 3ESUF 4TV6A 4M4PA 4ACZA 3TA3D 2GFTA 3S35X 2GHWB 5DZPA 1AGBA 5D7IA 5B3NA 2EILB 3CX2A 5HDBE 3RJDA 5DJAB 4GQ9L 4PJFE 4NP4L 4I1RA 1XL6A 6REQA 1FXQA 3IGKA 2HH0H 1W91A 4GP5B 4HKBB 4DO4A 1HQRB 4WWKD 3ELQA 3VXUA 4HLEA 3AB0B 4B60A 4LSUH 1T0MA 4J27A 1P7TA 2RH0A 2R1MA 1YNPA 5KANG 2ZCKH 2E8ZA 4NSBA 6FABH 1SHWA 2AQTA 4C4KT 1SZGA 4MKNA 4JM2C 4MGXA 3FUIA 5KSAB 1G87A 4MDPA 2NY7L 4E42B 3UG5A 1YN6A 3SECA 4P2OA 5D7KD 2Y70A 2IOIA 1RPUA 1QSFB 1G6CA 1U95B 1J05A 4HNLA 3ANVA 1TSIA 1QOXA 3GB7B 5GGTH 3E7JA 3LG3A 3AY4C 4K3DH 3FU0A 4K8HA 3FCSB 4W7VA 1EDYA 2DGAA 4OH2A 1AXSB 2K3HA 1N68A 2LE9A 4PJCF 2G4FA 1A3WA 3AG4B 1BWMA 4DCQB 4FG6D 2O4EA 2KZBA 3MP5A 2EXWC 4GH1A 1XIBA 3VA2C 4Z1CA 1JZ5A 2CD0A 1R0MA 8PAZA 1KG0A 3NDZE 3T5WA 1PG7L 1BQSA 3QB7C 3QFJD 2PI6A 2BCMA 4JDVA 3PUDA 3SO5A 1KN4H 3KPLA 2GAZA 4DZIA 4RGMC 3WLSA 1G7QB 1IC7L 2V17H 2YHGA 4JZOB 4FA3A 3L8QA 5IB5B 5I8KH 2PTDA 2OZ8A 1ZSHA 2GUOA 2ZOOA 3ORWA 3W2MA 2QDHA 5HWJA 4Z0JA 5DEGB 5KTEL 4ONFL 1MJ8L 4Q4QA 3UZZA 3DFHA 4R83A 4L4VE 4QHRA 2FHBA 4PJXE 3VQ1C 1PZ5A 4HV8A 4OM1H 1L0XA 5GGRB 7CGTA 2PLMA 3UA4A 4CCZA 3GQYA 1ZU8A 3CTTA 4UM9A 1RJYA 4DFIA 1NIEA 3WXVH 3IKKA 1U2CA 4EOWH 1NF7A 1FYTD 1DQDH 5E00B 3B1UA 3S88H 3B2VL 1WAPA 4DLFA 1GGIH 2R69L 1QOQA 1WD8A 3FBKA 3MMEB 3F7RA 2OLHA 2GTQA 3BO8A 2ZX5A 4E5XA 5C09D 3VNMA 3BDYH 5DU7A 3VI4E 5HINA 3B2UC 2BX7A 1W54A 2A7BA 2V9QA 3NA4A 3FTVA 3QIUA 5IGXL 3M1CA 2HDJA 4P8XA 2WC4A 4A55A 1JGIA 1A22B 2Q76A 3INUL 4MDJB 1RK0A 1WH0A 1SUXA 4JPGA 3HRZA 4PLKD 1VJIA 5H2BA 2QHRH 4OLVL 2BP8A 2BVOA 1AGEA 4Z7VE 3N44B 3CFJB 3N73A 3QJAA 2XIJA 1B2WL 3BUDA 5KZMA 3N2TA 5I06A 1K8IB 3ZTNH 5LBGA 1KGXA 3MJGX 5HPMA 4UB9A 1M7XA 1WKEA 1PJ9A 4WK2B 3PWUB 2RFXB 2GUBA 4AW7A 3J07A 1YHPA 5DUBA 5IW6B 5HGAA 3S9IA 4AXWB 2CCVA 3DC8A 3VXSB 6PAZA 5IMMA 1KB5B 2R59A 3BH9A 4NKMB 4W85A 2OVLA 3N0PB 2XGBA 3N43F 2YD2A 1OM3H 3EPNA 3GDKA 4HBKA 4XWGH 4HIIB 4QJ3B 1IFHL 3PAUA 3KBEA 4K6AA 4LEXL 2W81C 2YEZA 4PJHE 3HMCA 4KI5D 5HI4C 4JOMA 1I1WA 2XZ7A 1GQIA 4GCAA 3UWZA 5J11C 1GA2A 2H3BA 4KKBC 4PRPD 2YXFA 1YBQA 2FLBT 2ZA2A 3N9GH 1QNSA 4ZOEA 5GS1C 5F88B 2VWTA 3HUJF 4MJIE 3FA4A 4YUEH 4I5UA 2WBJA 4QY8A 4J23A 5ESVB 2ZKXA 4H25B 1FVDB 4AZIA 4DQOL 3T4WA 5D72L 1G9EA 1NBZB 1OFBA 2R1XB 4PCTA 3B40A 2Z27A 2GGEA 4L4VA 2VISB 3IVKA 1P4IL 3SJNA 1QUNB 5KVDE 2E56A 4ZEPA 2E40A 3LCYA 5I73C 1XH3B 1S7WB 3WJXA 3DV6B 4ANUA 5CSSA 2ZF8A 4U1NB 3ZTJG 3B9KB 2CO4A 1J8RA 2NUXA 5GQBA 4Q9QH 1MCJA 2FEJA 1H09A 2DSVA 4XB7A 4LCCC 3FGCA 4KS0A 4LSTH 3LCWA 1MNSA 2DZUA 5TBOA 5JW4M 4FG6C 4ALAL 3NZHL 4Q8VA 4ZR8A 5K1JA 3TIEB 1HEJC 1NL0H 4I18A 3BAEH 5HI5D 2Q6WA 2WC3A 2VVSA 1R3JA 4LQ1A 1EZVY 1DTUA 3ZKNC 1MCNA 5BVJB 4S3AA 1ZALA 4GSUA 4K7PX 4KK9D 1KF9B 1OK0A 2ZRUA 5GJTL 3GMQB 3SE6A 3QR0A 2Z6FA 5CZKA 2H1LM 2BP0A 3DJRA 3FQUB 1OL0A 1TE6A 2V81A 3CO8A 3AMLA 4QEHA 4MQXD 5B39G 4CVZB 1AO7B 1NAML 2X40A 5D1XE 1JWMA 2BG5A 1L4IA 1SPQA 2VR6A 4L3ED 4R90L 1OINA 1HH9B 2NY0C 3KHJA 5C0FA 2F19L 5IROC 1J1XH 1BF8A 3ENEA 1FWTA 3NJLA 1FG9C 2GSIA 1Z2KA 1NC2D 3CT7A 4MCZB 2VO5A 4KX7A 1RZMA 4GEIA 5MEPB 3WLWC 1YYAA 1QKZH 4XE5B 2XSKA 4LBRA 1WA0X 3N41B 3L2MA 4F9PA 5HJ3A 2DBLH 4PJHA 1EP2A 3IU3A 4PWIA 2IXUA 4JQ1A 3D4ZA 1XI3A 1UTDA 2Q5BA 2A6DA 3VWKC 4H26A 3AWGA 1TELA 1RV6X 4AYSA 1XM3A 3MYJB 1U1UA 2JNZA 2VCBA 3VZYA 4MJIA 4MJ5A 5C9ZA 3F65A 4UFJA 3PBUA 4MD0A 1FGNL 1PSKL 2A4CA 2DZXA 1XEUA 2VDLH 3IFLL 3US0A 4EVNA 3BUTA 4JZJA 1Q9KB 4FG0A 3O2DA 2OMVA 1RVFL 1Z3RA 4HALA 5HVHC 1W8OA 5INCB 1A0DA 3DHMA 1G7VA 3W6MA 2F7OA 1R3KA 3U48A 4AMCA 3BOFA 1A5LC 4HSQA 3ZDZE 2G0WA 2J7CA 3QWNA 5TGBA 3MU3A 2DV6A 1NANH 2P7TA 2Z92B 3OIXA 3IT8D 4XP5H 3BP6B 2A6KB 2NV1A 4CU7A 4PUBL 3LH9A 1ET8A 3LQAL 1U92B 2DYRB 4LVNB 3VDBA 3SY8A 1GT8A 2W0KA 4GCXA 3F12B 4MB3A 4QR6A 5DCDA 3S98A 3OHXA 2PDHA 4L5ZA 2FX8L 3GIQA 4X0NA 3TPUB 4ODTH 1JPSL 2BVQA 2H0JA 4LB8A 3NJNA 1IGJA 3D39E 3GM0A 4PGDB 3MBXL 5IQOA 4KK5C 3CIWA 2XG4B 5TQLA 2R2HB 5J6HB 2ICSA 3KH4A 1W0WB 1LNUB 1GS8A 5DHXB 4PV8A 1BSIA 3QWRA 2AV7A 4G42B 3KJ4B 5TIMA 4YAQA 4TVPL 1VD6A 4PRAB 3OZMA 3SDXE 3B6SA 1T5KA 5FFGA 5T1MA 2P88A 4UIMA 4L8SB 1KM1A 5D1XA 1FDLH 3VE0A 2FATH 2MEJB 3EMQA 2ATMA 3Q9QA 3PTMA 4Q8WA 2ZC1A 5C3TA 3KPQB 3KBNA 2OL3L 3MV8D 1B4RA 1TJPA 1TPUA 1LO2H 3SE8H 3F83A 3DO4A 4TTDC 4HJJH 4GG6F 4KCUA 3P8JA 1A7RH 3WQ5A 1J5CA 3EWXA 3CVIH 4YN3A 3SW6A 4JANB 3FUNA 5F6IB 1EXUA 4UNVA 4HC1A 4HHAA 4NNXB 3GJFB 1AQMA 4L1SA 2QIWA 2NSXA 1PZAA 3NCYS 3ZYOA 3FSOA 1ILSA 2CYGA 4IRZL 5L9DH 1ZHBA 1IBDA 1N9PA 4ZQMA 1F11A 3UZVA 1WBYB 3KOXA 5AUMA 3SKJH 4H0LC 3LZ5A 1PX4A 1F8TH 3VYPA 1NFPA 3TJEL 4G9FB 4H88L 1OEPA 1VERA 2WLYA 1HYSD 2JKWA 3S34L 2BSED 3PZIA 3R94A 4DOHE 4HZ7A 1ODZA 4L64A 2BRRH 1YC8A 2WZ5A 3AZUA 5GIRA 3SUUA 1GZPB 3KPSD 5FYLL 4DGIH 3FO0L 3DHDA 5JXED 4ZPTB 3NL5A 1KM5A 5CGYC 4C60A 2WLIA 1L2UA 2A5UA 5DXWA 4C6FA 2WHMA 5T5FL 2WQXA 1EK3A 1JJKA 4IIHA 1B0WA 1KLUA 3W7MA 4H4NA 3D2UD 4MQSB 1LL7A 3N2JA 3K0YA 3AHTA 4KXDA 4JUTA 4XPAH 3FYYA 1MHHA 4Z7QB 1UGKA 2W63A 3Q9PA 4Y2NA 3IJLA 4B41A 4FAAB 3NN8B 3GNOA 3UG4A 4CADA 2W65A 3L9RA 3T9PA 1NQKA 4H6EA 1ZIBA 4U6HA 2C1IA 4MWAD 3M5ZA 4AOFA 1I1FB 2F1EA 3L4XA 2VGFA 3RB7A 3PP3H 2ORBL 1INQB 2H6PA 5DR5L 3D39A 2ZXBA 1I7UB 1PL9A 2PRLA 3GUWA 4K2SA 2DFAA 3GMOA 3PHOB 2ZWNA 4XPFL 1JZ2A 1ETA1 3IIZA 2A73A 5DYOA 2YCEA 3BAWA 1DQTA 4O9HL 1IT9L 5L8KB 3SDXA 3NEEA 4HUWB 3T55A 3NP4A 4V2CB 1DIEA 2NX9A 5IESL 1MDRA 1L7IL 2W9DH 1FHGA 1LWRA 4GIYA 5JR1H 2X9XA 4LT7A 1NJ9B 4IU2B 3WHE0 4KJPC 1A1MB 2OT0A 4HGMA 2QR6A 4MRCA 3BPOC 2I5IA 3DI1A 4AZ6A 1XIGA 2YPVA 3K6FA 3L3OA 2JELH 3WI9A 5D7LE 4Q9RH 4DPQA 3QHOA 1S7SA 2OSLB 5ISZB 2X6BA 2GITA 1BD0A 5K9QI 3O3DA 4A6YA 3QKEA 5XIMA 5ALCL 2R1KA 3MGTB 5F9JA 4AEOA 1ONRA 3VXPB 5DY3A 3T8XB 3KHQA 3EO9L 3CQHA 5KYWA 1NSJA 1V5JA 5AWNL 4DVRH 5KSVA 1GQJA 5CCHE 5J8LA 1LDPL 4BXSV 4QXTA 3C8FA 1OY0A 4ANXA 5D4YA 4JO4L 5AC8A 4K8GA 3MNZB 3GXTA 2XJ7A 2KZ1B 2V5KA 2GQ9A 1OCJA 3UZEA 1NCCH 5AAPA 4C5ZA 1W3IA 4QRPD 2M26A 1PXGA 4PTXA 3PZQA 1B1YA 2XWEA 2LOEA 1GIGL 1HKIA 4PJEF 2X0WA 4HUKB 4MZIA 1U8PB 3FONA 1HDMA 1EH9A 4XKYA 2OMAA 4LJ3A 4NWTH 3BUYA 5AYIA 4Y88A 1GGOA 2R24A 2WAHA 3QUYC 4EI5D 3EJZD 1XRVA 4WWID 4X5RA 3PF3A 1AFVL 5EWIH 2XSAA 2DM7A 1HFBA 4ZMZA 2X1TA 3GBML 4Z7OF 4RL3A 5CR1A 4G8EA 2IGFH 5I6XC 3QYNA 4C7GA 4X6BA 1KRCC 2EUWA 5FO9B 4JKKA 3TZVA 3PWPE 1Q7QA 1B0GB 1NZRA 5IHWA 5JIDA 3F5WA 4CD7A 4XHJD 4KROB 1SFJA 4E0RA 2A6IA 4YS1A 4KXZH 5E6IC 3UQNA 5GS2D 1AOZA 1NQ6A 3UGXA 2P5WD 4JBSA 3WLBB 4ZSUA 4CCDA 5D2XA 2Y88A 1IU1A 4RZ5A 2V7HB 5B3JE 3QDJB 5FM5O 3SPJA 3KPMB 4G70B 1E42A 1BFOB 3N18A 3G5YB 2RALA 3N4EA 3G3DA 5A6JA 3RMJA 4HPJA 3BV7A 3UYRL 5TPWH 1O5KA 2ZZ7A 3B56A 3TE9A 4WUIA 4PMDA 1KLFB 1JRHI 3RTLA 3E49A 4KGJA 3VOFA 1YRKA 4OBSA 3X11B 3WTTA 3X13A 2NSMA 1MRDL 1CDIA 3PAJA 1J8HE 4Y1SA 2ICEA 4GI4A 4ZMTA 4GGHA 4ZUTB 3WBAA 4X0VA 2FYVA 4G8FA 1WYJA 1MQKH 1G7HA 5FAGA 3KZ8A 1P0EA 5HYFA 5KSBE 32C2B 3BW3A 3L2NA 3RLGA 1C29A 1REQA 3QZLA 4G7RB 5D7LA 3HS0C 3GTXA 4DN4L 4A2EA 4GWEA 3Q2CA 1B0RA 1QO3A 3K0WA 2NX3A 3L7EB 4KFOA 2K7QA 2DLFH 3D87B 5JPNA 2DDQL 2IOMA 3CAFA 3MUXA 1KJ2H 4AUYA 4LOCA 2CUAA 4UT9A 3K4ZA 1E72M 4BWTA 1IVLA 1VRSA 3X12B 3SDCB 3STPA 1IEHA 3VFUA 2MH4A 4RZBA 2J2ZB 2G95A 4GRLD 2RDUA 1CYXA 3BWWA 2BW5A 4NUWA 3DPDA 3O3EA 3C0JA 1I8MA 1QNZH 1WXZA 3HG5A 4LKXB 4JN6A 1R47A 3CPLB 1J0JA 2CO1A 4IBWA 2Q20A 2PSNA 1I7RB 1SJBA 4ZFOA 4HIPA 1M6OB 2WBXA 4NM8L 4RMSA 5F9WC 1QUMA 4IICA 4HJ0D 1BZQK 3KPNB 3U0WL 4DUOA 3M1BA 4L8BB 1QWNA 3LYEA 3GHUA 4KRMB 3VG9B 5REQA 4U0QB 1BXUA 3CHVA 2BM3A 1ITBB 2DWTA 4LOEA 4B9JA 5KWYC 4MA7H 2EVIA 3PWPA 2ZIDA 1PKYA 3F4CA 1N2RA 2QPEB 4H9VA 5DZVA 5E8EB 1BMGA 4M6VA 3C08L 4RBPH 4HOZA 5EU3A 1O75A 2HTMA 2FLIA 3V0SA 1P53A 4OR1A 4AKPA 3PVFA 4DP1X 4M3HA 1FHVA 1FYHB 5GJPA 5IHRA 3GSNB 4LCWE 5D71H 1L9TA 5IIEA 4L6OA 2EG6A 4XNZB 3VFWA 3EXSA 3K2IA 4HJ1A 4PJ9B 2NY6D 4XMLL 1TPDA 4XO6A 5BXPA 1HG3A 4R5EA 3NSNA 4NQDB 4AWSA 5E2WH 2INFA 2J8UB 1Q9WA 4LL1A 5E4EC 2XETA 4X9HA 1A4CA 2VYOA 4IOIA 2AF2A 1QBBA 4W68A 3MO4A 2LVEA 1N8ZA 4OGXH 1W1IE 43C9B 4AMWA 3L5WA 1Q4NX 1UQSB 1YMMD 3TXAA 1LT7A 1QLRB 1UKTA 3CWOX 1JRHL 4JDTH 2QAPA 1OSPL 3ERPA 3VD1A 4EI5C 3HPLB 1FL6B 3BMXA 4XP6L 4MSWB 1BM3H 3FN3A 5LNEA 1HNFA 2NDGA 5KSBA 2B4CH 5CJ8A 4AVJA 2R6OA 4ABUA 4R33A 3OJ2C 1FWCC 1KLYA 2VE6B 5IZ7A 5TK4A 4E4PA 4Q7IA 2QGYA 4I9AA 4AVKA 4HWZB 1X97A 3H26A 1ZLSH 3D0VB 2K1MA 1GYNA 2P1FA 4PA8A 1FBIL 1C8VA 5B7EA 1Q65A 3RNKB 1NP0A 2ZAHA 4TL5A 4A2LA 1OPGL 3T65A 4Q14A 4D6EA 5K4ZA 2FTAA 1XLCA 4MCYB 5FCSH 4D0BB 4BQ5A 2V6AA 4MA3A 5E56A 3UTOA 1Q94B 3D46A 1WHPA 1R3RA 3HQNA 3MROB 3WKMH 3DX9B 4IUOA 1S2AA 4Y9AA 2OMUB 3CSYB 4AV5A 2XN9D 3VFGL 3M4HA 2O5NA 4QLJA 1XGZA 4NO0D 2RCSL 3W38A 2MKWA 4N9OB 3ZJAA 2QBWA 3FT4A 1JI2A 4NKIH 5CP7B 4WW1A 1QNVA 2PC4A 1QLEH 5IMLA 1DORA 3VTMA 3RAJH 4BZYA 3LHUA 1YPZF 4J3WA 5E23A 2EHHA 5HY9B 4MAUH 4HAFA 3HG3A 3ZKSD 2UXTA 4X7CC 3O45B 4LGSB 3WDPP 3P54A 4DBDA 4CVWA 3AICA 5EC1B 5DI8B 2VDKH 2I9EA 2VDPH 5IB4A 2YIHA 4R85A 2BFVH 3EO0A 1RERA 1S7VA 1DTNA 1MWAH 2A83B 3I6EA 4Y1AD 4OIFA 4ZW6A 4ILSA 6CGTA 4AUUA 3N9KA 35C8L 2EDEA 3PREA 1N6UA 3SRDA 3AS0A 2OPJA 1YEJH 5MERA 1Y5WA 3LA4A 3C0SA 3MLXL 4YTRA 3H21A 2LGNA 3L1FA 1AJ2A 1TJXA 1M7PA 1TJGL 1MCOH 2AK4E 4XCEA 4XNYH 2O6DA 5IQ7H 4JJOA 4TNFA 1HQ4B 1GVSA 2EPOA 2OP4H 2EXTA 5C5YA 1NWPA 4KTDH 4QEGA 1F13A 2C5DC 5C0EA 4IMKC 4FR6A 3VFCA 4DJMA 4NUGL 1AL8A 5DMKA 4HG4J 1VEOA 2EGZA 3QC3A 1XUUA 4WDUA 4FGMA 4HLJA 3KLAB 4AGPA 1WFOA 4OJEH 1NCWL 2E27H 1E6JH 2BJML 4H0GA 3HM7A 3X14B 3CDCA 2R82A 3ARFA 1TU2A 4GW1B 3QUZB 3E02A 3KXFE 4DBSA 2REQA 3L9CA 1Q0YH 4ZXBD 4QRQB 4FFYH 1C5CH 1KJVB 4M24A 2HKFL 3NM1A 1EO8L 3AQDA 1EANA 4LSVL 4Q3MA 2A3LA 4B53A 1SDDB 2HEJA 1X7TA 5FXCH 2X1OA 4MGGA 1XDLA 2KERA 5LO7A 4XRCA 3REQA 2BY0A 5KAQF 4PMUA 3RUGF 4PI2A 3M0JA 4Z7IA 1MIML 3O2DL 5HHQA 4FFWD 3BYYA 4PW4A 3UTSD 4K3GA 3KCPB 1PYWA 2ZC8A 4HQVA 5IP4A 3UCDA 4F7CB 5A1AA 3L13A 1CFMA 5F0LB 5SV4A 2YL8A 1XH2A 1TO3A 1IARB 4CCCA 2JIWA 3QAZC 1PL3A 1W0VA 4RKAA 1SYVB 2OTDA 4PHXA 1OQOA 4MZ2A 4M8QA 4ODXB 1QBLL 4F93B 3QV8A 1EC9A 5I6SA 2R4SL 5F3FA 2IWGA 4GXFA 2YN5A 4F1SA 1R5IB 1I1YA 1A4JB 2NY4B 1QI5A 2VLKB 4EANA 1F02I 3VYNA 3VD4A 5D1ZC 5EEWA 1BYCA 3B3BA 3EJYC 3R8QA 2GSJA 1ZEAL 2ZF9A 5MHBA 4OCWH 3UCRA 1G7PB 4OQTL 2O9RA 5DRNB 1I8AA 1YY8A 2EDXA 3CEUA 1XGYL 3TR2A 9XIAA 3SFKA 4O28A 2FJGB 3BQUB 1YUKB 4BKLB 1MCFA 2YLLA 3H56A 1T1ZB 4GMTH 3JR2A 3BP4A 4Y4KC 3SCUA 2DT1A 1CR9L 1CDBA 2ZCHH 3TGXA 2AK4A 2BH0A 3CJJA 1D3HA 3OPSA 3VSVA 4FR1A 5IFTA 3D1MC 2ICWB 5FR3A 4NN7C 2X6MA 3GLZA 2PYEB 4BCXA 3DSNB 4KQ3H 1VLIA 2MQCA 1TQCC 4MLSA 2HTLC 3WSQH 3MS8A 4U2ZA 2VLLB 4JW3A 4M5ZL 4KEUA 4CL7A 5LN4A 3QPYA 4O8RA 1ZWIB 2XIBA 1G7JB 4HOWA 4HC1L 4FFTA 4ZMPA 3DN5A 1KXQE 3F4DA 4KUZL 4X8XA 3KXFA 1INDH 4NRRA 3DVNB 2D7TH 2X7LB 1IKFL 3A21A 3WFEH 5IK3A 3K71A 2O4QA 4X5XB 2WB1A 5KJRH 2MNRA 5HGGS 2QDDA 2KQMA 2KHAA 3QAQA 5ILTL 4BFBD 3QC0A 4BSVB 1KCLA 2AITA 1VGAA 1QSZA 4HK5A 1E40A 1B90A 12E8H 3ISIX 7REQA 3ZTEA 4GB9A 3RL2B 2F5AH 1I8JA 5HDQH 4HCIA 3UAJC 4K4KA 3B8UA 4L2YA 3IJEA 3FAWA 3G6LA 4U6VL 3NSMA 3KHDA 5C9JA 1H63A 4HNUA 2X0VA 1T6VN 4ZO9A 1EUAA 4LMQI 1UYWH 4FB7A 1T6WA 3BEWA 4IMLA 2J79A 1RXOB 2UY7B 3DFNA 1MZRA 1HGYA 4V15A 2VQTA 1A1NA 1JMZA 4MNJA 3VXQA 5A7EA 3UXDA 4IZGA 1H7XA 1GVRA 2DYPB 4F3FB 3WHE1 1XF0A 3CH1A 2P8PA 3TLRA 4RFEB 3IJYA 3PANA 3HRPA 1P6WA 5TE6H 1O94A 2PUZA 1NCUA 2HCVA 1CI5A 2V5DA 3VO0A 4ZXBC 4RGNC 1A3ZA 4NKCA 2OODA 1L7TL 3TVMA 3W24A 3PZOA 5KW9H 4QQ3A 4KRPB 4X6EB 4X9YA 3QIBB 1NEZG 3Q65A 2V7NB 4J9JA 3DERA 4EUPH 3BIBX 2Y9RT 3DTXB 5CLWA 3TC9A 3IDMA 3SGJA 4ABVA 1MNZA 2JJTC 4HT3A 3OA3A 2YWZA 2BMKB 3QZWA 1D5IH 3GSOB 2G0KA 3VK5A 3N50A 1GPOH 2XFFA 4M48H 5ES4B 3ARGD 4LPWA 3T6CA 4JG1L 3UMNA 1YJDC 3FU5A 4U1IA 4Z2GA 4ZUWA 5GZOC 3UBPC 4DHGA 1BOYA 3EJTA 1IAIM 1JPGA 2M8XA 3GS4A 2YPVL 4DGVH 3CUPA 2Z3FA 1TVPA 8FABB 2F18A 3PJXA 4ZBCA 1C93A 1NFGA 2AHIA 4R2GB 5F1NB 2ADJA 4DK3A 3RI5F 1KXQA 4A6YL 3FB6B 2VH5L 2F9BT 1Z9SA 3P77B 2AJSH 3I6GB 3AIVA 5LIYX 2OBGA 2X4OA 3ZLFA 2X30A 4K3JL 2O4MA 4WI6A 4LCVA 2NXZB 5GGSY 3RKDD 5DURB 1YEGH 4OUIA 1UZ6E 4MXVF 4XUGA 2GL5A 3LIZA 4F20A 5AFAA 2A1WL 3T8LA 3QYSA 3B8DA 4ZMVA 2Z7UA 1M2VB 1J12A 3QUMB 2J6EH 1UZGA 1Q85A 4M51A 4NSKA 2PDMA 3WDRA 4A7GF 4F7MB 1AJ0A 5FV2A 2TMDA 2R2BB 4FL4B 1OGAB 4AZBA 4IX0A 2ERJB 1MXGA 1FFPA 3MGOB 1FHDA 3VXGA 4A22A 4YVNA 4KRUA 1A5SA 4JTKA 4A8NA 1XLGA 3U79A 1EX1A 2QFRA 3MLUL 3W23A 5CC7A 5DELA 3V3WA 1DEEA 2E4TA 3E2QA 1DQMH 3GO1H 1SZRA 3C6LC 3B0PA 2VDGA 5DZJA 1MYRA 3ULSA 1NP2A 3IGSA 4FABL 4H2HA 4S11A 5GRVK 2EXSA 1YEFH 5TQ2L 2ZG1A 1KFBA 2ZRXA 1WRFA 3NO5A 3T2PA 1R4XA 4AXNA 5E9NA 5GGVL 5AVRB 3BN9C 3CZFA 1KPVA 5I1GL 4GG9A 2I60H 2F0CA 2V0AA 4LCYA 3T0XA 4OFQA 5I3DA 1IO4C 3QXDA 3EBGA 4TTUA 3VFMA 1E0TA 1HWHB 4BZ1L 3W73A 4OD2B 1ORSB 5G4HC 3GNMH 5CBAB 4H40A 5IW3A 4FOMA 4C83A 2H2SD 4N20A 3LKOA 4XQ6A 3RU8H 3OWRA 3HHSB 3GSVA 3MHGA 4WXYA 2PTZA 3GMNB 2EIJB 2C18A 4XVEA 1RLCL 1KIUA 5AVNA 3WJSA 1TETL 1EF2A 4YSEA 4MNGA 2CDEB 4HUCA 3SBPA 4HS3B 1E28B 2IQAB 4C91A 4QG9A 3QF0A 1Y1UA 1MFVA 2IKHA 1W32A 1SZNA 3I50L 5KMYA 4I3RH 1N12A 5I1DA 3VGAC 3SN1A 4F7PB 5GGSB 2XZQL 3APGA 4RWYL 1UVQA 3EH1A 1J6OA 1FA2A 3NIYA 4IM8A 1JS4A 5DQJA 2FPVA 3LB6C 3ECBB 5JDSB 2GJRA 4L56A 4KRTA 1HQRA 3D85A 3VM5A 2XPYA 3U9IA 3WK1A 3UXKA 5ESQA 4AX7A 1SBSH 1I8IB 5KVGH 4AMXA 4UT9L 1DLHB 2VERA 2DVTA 4G8GB 5AZ0A 1HL8A 1MJJA 1FLRH 4XAKE 3V0IA 2CWXA 2UWEF 2PGFA 2A0LD 1O6SA 1B3YA 5E51A 4GE8A 1KCZA 3DI0A 1ADDA 4RVBA 2XH0A 2VCAA 3UTTB 3GVGA 3O81A 3KTSA 2W9EH 2FR4A 3PS6A 3OVRA 1FC2D 3DETC 4PWFA 4DFHA 5C54A 4XD3A 3GZKA 1FFNA 2CETA 4FCAA 5HHNA 1AR2A 4BQ6A 4BK9A 1BAFL 3KLKA 4G8IB 4ZFOL 2ODOA 4QEEA 3RJXA 1DCLA 4QCEA 1GOMA 1WBZB 3FCSA 4GG8A 6PCYA 4Y4HC 1AXSA 2YC1B 3UPAA 3U7WH 4MFDA 2JTYA 3GMPB 2NT0A 4GOAA 4NRZA 1LE5A 4LFYA 4U49A 5KITA 2FO8A 1TTQA 3U9PL 4U3HA 4YR6B 3HZ3A 3O3BA 1A5MC 3RGVD 5JPMC 3FC8A 4DVBA 2C16A 1J9CT 1ZXKA 2TAAA 3WSUA 4QDPA 2DZWA 1FFTB 5EMKA 5DEFA 1TJ0A 4JQXA 5CJOH 1G7QA 3L3GB 4CW1A 4US6A 3OQ3B 2VD8A 4GI9A 5FO2A 5FYJL 1XFPA 1E6XM 2F8IA 1XF1A 1OYBA 4E8CA 2Y1ZA 4U1KB 3P0VL 3RIAK 4HZMA 5E8NB 1JNNH 3LTPA 1TJ1A 1I9IL 2EE0A 1P84K 3EGXB 4B7LA 3RKDC 1IQWH 1E0VA 3QIWC 1OYCA 2YA2A 1DL7H 2JKNA 3NGJA 3Q7JA 3IIXA 2HVJA 5BOJA 2A4ZA 1NCDH 4IH3A 2YCKX 3FNDA 1ICSA 4KNQA 1WZLA 3DGGA 4B9CA 1B30A 1BIIB 5LQBH 4W7WA 4M7LT 3O63A 2XG5B 2W0PA 1ZVSB 3TCLA 3RDKA 2CBPA 2WZPD 1CWVA 2VIRB 2BZCA 1OK8A 4RQQA 1KA9F 1JHKH 3C5XA 1NF0A 4UWMA 4K2UL 5CJXA 1T99A 4D0DB 3OOQA 4WDXA 4HJFA 4OI9A 1VFLA 2I7OA 1E9OA 4DTGL 3HEIB 1TV3A 4PREB 2P8LA 5E2JA 1J0IA 3ES6B 3EUDA 4PTMA 4HYRA 1MHPL 1BQLH 1BJMA 2ZOUA 2QT3A 1T0NB 3CPRA 4WD0A 1VFOA 5F9AC 4UDTA 4P48A 3BCDA 1T1WB 2P3YA 2VM9A 1XDTT 4MKVA 1THAA 1T83A 2EF9A 5BXSA 4UUIA 3CFJA 2D3NA 2EIDA 3PHSA 1OYAA 1U3HC 2R0WL 1SNRA 4PJFA 3MODL 1ITQA 1MFDL 1NDMA 1RR2A 2G96A 2NQZA 4RAUA 4JTUA 3CC1A 5JYLA 1V03A 2IQ0A 3FJTA 4JY9A 1MKFA 3NO3A 5SX4H 2EH7H 2RJHA 3FT2A 3D4CA 4AI7A 4YDVA 3LMYA 4G1MA 4KK6C 2X3AA 4Z8FH 2VDOH 3V0FA 2QPDB 4YSRA 1QSED 2EXYD 1FFRA 1BZ8A 1BYAA 1GSKA 3VE7A 3EF7A 5JOFA 4AAJA 3KRZA 4AXWA 1DFBH 4KPHH 2FUTA 5TK2A 2DICA 4NNAA 2X1XR 3P9LA 5C0AD 4H8WH 5T9BG 3I7RA 2DQUH 4H9TA 1WCBB 4IRJB 4HIIA 2YXWA 3GZAA 2FJKA 3SBWA 3LKNB 2HRLA 3JV4B 1H19A 2PO6A 3HZKB 3QW9A 4PJCB 3VSQA 1CQYA 4UOW1 4NAFB 1JMXA 3RZCC 4JFVA 5DXYA 3GSWB 2RD0A 5HYJE 2VDRL 4LAZA 4LLDA 1E4LA 2VFIA 3QCVL 4C4KO 5F88A 3ZLHA 2C3XA 3CBJB 2BASA 5F1UA 4OU1A 4P9MH 3TA3C 1LOLA 4W8BA 1ND0B 2MOVA 4DZ8A 5ITBH 2CBMA 4P05A 1X5LA 3NDZA 1H2JA 1W72A 1S2EA 1WTLA 1RP9A 4P46B 5IV2A 2NCEA 3BAJA 4HPOL 2PEVA 3TN0A 4K36A 5GS3A 2Y0SA 3EOBA 1R3SA 2A0LC 4WWKC 1T7XA 2Y7OA 4FO4A 4X5LA 3D34A 1UM4H 4KQ4H 4EF8A 1W9BM 1XH3A 2Q8AH 3WFCH 3LN3A 1EMTH 3SOBL 4WWPA 1XX1A 2PCEA 2PW2B 3HVNA 2W07A 4PJXA 2OMXB 4OKVB 4OIAA 3OV6A 3KDNA 2CITA 2HVBA 1RK7A 2HXUA 2RDWA 2CGRH 2EACA 2V68A 3W2DH 5ICZB 1A7PL 2KDGA 2BSRA 5LDSA 3VGEA 4FTVD 4QRTB 3VI4A 2VP8A 5TDPA 4D8PB 2VDLB 2NQ5A 2YD8A 4NHUB 5HHOD 4I6VA 3TNBA 1D9KA 2ZJSH 1RA5A 1AI1L 1E6OL 2PWGA 3WJZA 5E94B 4GZIA 2IPUG 4XNQB 1CBVL 3GMQA 4ACYA 4MNLA 5CEYA 5KSWA 1EJOL 3N15A 5FF2A 5F7HA 4JHWH 1KJ3H 2RUSA 3DJZA 5BJTB 5E1QA 2NZ9D 4Z7VA 5ICYB 2ARJA 3HBQA 3M17A 4JO8A 1QHPA 3H42L 4B9ZA 2GZXA 2NPLX 4DKFH 5HVWA 2DDXA 1X38A 2H6UA 2EYTB 4QT5A 3NJKA 1Q66A 3WN5B 4YHYB 4J3TA 4QF1B 3M07A 4G5DA 2QSQA 1JD9A 4GGBA 2VELA 4IW4C 4I6KA 5JW3H 4GY1A 3UJTL 4QTHA 2J27A 3CXDH 3CX5J 3T09A 1VF8A 5EO9A 2BNRD 3WU1A 1JXKA 1VFBB 4UB0H 2VEKA 5EUKA 1VCFA 1E65A 2PR4H 2PDWA 3KCWA 5HYJA 2DLHA 5B4MD 3UD6A 5EYWA 5ABHA 3N1MC 3TKFA 2VQUA 5B39A 2CJUL 1MFAL 3AIQA 1F8MA 4EWJA 3NPXA 1U8KB 1GW0A 1TV5A 1SUHA 3TYGH 3HUJB 4M7ZC 2ZWKA 1HHJA 2I5QA 3RXZA 4N87A 4DYJA 1KMGA 1M1BA 5EB8A 3KLHD 1Q45A 1C08B 2C14A 3R19A 3WLHA 1W5OA 4PLKC 5KVMC 1S7UB 1MW1A 4JFSA 5FYKU 5FESA 3RYSA 1I8UA 4Z1PA 4AWTA 4FALA 1BZ9A 2P8MB 1YXCA 2EQDA 2Q6ZA 5HANA 1T1XB 2UWFA 4QKXB 5F72S 4E3VA 3U25A 3B1TA 5AOLA 1DV7A 1HHIA 3UGRA 2Z92A 2E7MA 4Z7QE 5K9OA 2HKAA 3BP6A 1UR9A 2XNAA 1XTLA 3E3QC 3ARED 1O0VA 1E1CA 3S8WA 3ULUD 3HB3D 1BF5A 4FZ8L 4NGHL 3UWYA 3WTVA 3ZE2F 2NZLA 3V0JA 1U92A 4X99B 5DTFB 3AT8A 1W2KT 2RBLA 5HHMD 3DO3A 2DQEH 4MXWH 2R9RA 3GXUB 4G9DB 4BXVA 3N6QA 4BA0A 3NZUA 1BF2A 1CX9A 3LQGA 1Z32X 3F5JA 3MRKB 3D18B 3WMLA 1JERA 4GSDH 1JNHB 1OHQA 5F1IB 5DXXA 4OLWL 4XI5D 2HAZA 4XIMA 3CN3A 2JQAA 4P5TA 1IM3B 2VSMB 1VLWA 3NSXA 4KI5C 3R1GL 1OAJA 1TQWA 1VFTA 1FZJB 2O5ZL 5FOOA 5FYKD 3NIGF 2I9TB 2VZTA 3CLMA 2E3ZA 3T42A 4Q33A 4F27A 1G7LB 2DZAA 5CZJA 1IKNC 1LO5B 3S5ZA 4PJAE 2GJZB 1SQMA 1X5AA 3T3MB 4AZ8A 3VIGA 3IKCB 3HZMB 4P61A 4XNUL 5JOPE 2RMNA 3OTRA 2VLRB 3PWIA 4R26L 3UCCA 3VXTB 4XPTL 3IGUA 4DO7A 4X4YB 4PRBB 4HKXB 2C3ZA 5ADOH 2ZRZA 1ASOA 3WHXB 2VKXA 1WUZA 4RSVA 5L4IA 2Y85A 1PBYA 4NNXA 2QVIA 3ECVA 4TF4A 2X0UA 4TOYL 3AXXA 4XBJA 1C12B 2QVKA 3GFZA 4XTDA 1T03H 5RUBA 1G9NH 3MRNB 4BQ9A 3ECUA 3BVNB 4RLIA 1WGOA 2OX1A 3FRUA 3V7MA 2VXQA 4K1GA 4GBXB 3GMLA 4KKLD 4FSAA 2GEEA 1FRBA 3W53A 2YRBA 4LF3A 2D23A 1V3LA 3BGFC 1WWBX 2X4UB 1H49A 4U1HB 1TMQA 1L9OA 2BCKB 4JO1L 5HI5C 1AXTL 2EEXA 3ATBA 4HFUL 4QJ5B 2A5HA 5SWZD 3WDQA 2QVMA 1X7QA 3AZSA 3OB0H 4O57A 1JCKA 2VD9A 4OVXA 2IDSA 4QXGH 3ZS4A 3OR6B 4KK9C 2R83A 1LCOA 3GLCA 3DYMA 5A7BA 5JIMA 3SE9L 3L2LA 4WJXA 4EIBA 5DHVH 1P9MA 1U5JA 5BS0B 4GW5A 2A3BA 1RUPH 1BXBA 1BG9A 4MQXC 4JQ4A 3WIHH 2Z65C 3QHMA 1O5RA 5CBJA 3VMOA 1U42A 4OZIE 3A4DA 3F6IA 2VTFA 4QRRD 2GGHA 4PR5B 4RIRB 3LS4H 2ATAA 3U7AA 3NRQA 2VGBA 3S36L 5EU6E 1UPPA 1C8XA 3L21A 3MLTB 4HS8L 1SN5A 2EDTA 3KGUA 4N9BA 4JFTA 1AL7A 2MOQA 4U1JB 1UWGL 1TJRA 4AZGA 4OI8A 3N19B 4XOEA 4LSBA 5I6OA 1EERB 3EOYG 1OZQA 5CPMA 1WLHA 1WDSA 5ACMA 4U6XB 3LCXA 5LXGH 2HUEA 2ZP9A 2IS7A 1L8NA 4JTHA 4IPPA 4AT6B 1MCBA 5BZDB 3BLOA 4M7KH 4Z95L 3W1XA 2J8TA 2ZUUA 3QZAA 1CGYA 1KPUB 2HLAB 3UZWA 2PTTB 4EAMA 4JFDD 5MEOA 3U7VA 4NI3A 4P2QD 2G30A 3BUIA 1NCBL 2YD3A 1MLCA 4PJAA 5CSZA 3QUXA 5AYZA 5EZLA 5CWSB 3MYPA 1OCZB 1P6AB 4LASL 3VRLF 1OP3H 4PRDA 5DJZB 4BUHA 4Y9MA 2NNCA 3VNJA 1E5ZA 1FWHC 4Q0XL 4XMWA 2FD6H 5A2CA 3HBZA 5BQ7A 2APWA 4OJAA 5EU5A 3KFTA 2FVNA 3VRIB 4HBCL 2FX9H 5H35A 2JIXA 4B3VA 4ZI8A 1NLBH 3FQ2A 3IE4A 1K02A 4GG6B 3RM4A 1ZCRA 1TRDA 5GRXG 2H1PL 1JUKA 1WKFA 5ACLA 3BVUA 3EGDB 1XHHA 2E7LA 3Q0HA 1RLWA 1YNTA 1T5WA 2AEOA 4W9DC 1M56B 3O4LB 2Q8LA 3KRUA 1TVBB 4OCSH 1RZ7L 3SCMB 2YKLL 1MCKA 4XI5C 1EDTA 1G6RH 4Y5XB 1T41A 4KEZA 1QR4A 3L3JA 5HP5A 4U4MA 3BH8B 3FHAA 3W2LA 5DD1L 2WJFA 4WDIB 4P3CH 3USZA 4N8CL 2Q1EA 2BVDA 4XH2A 3JWDH 4PJGB 5TDNB 5C71A 3WL9B 1I3GL 3VM7A 2J8HA 1WP6A 2IADB 4WSKA 2AI0L 2X09A 4LVOC 3BZ4B 4XAZA 2DI8A 1TITA 5D6DA 3QEQB 3SR7A 2XA8L 3N1GC 4YHML 3DJSA 1PKOA 3LNDA 4PP2B 4S38A 4IHOB 2JF1A 1KJ2B 3QZPA 2VL5B 3RWFB 4F37K 4YHGA 1MNUH 5HQMA 3GHBL 2OTWA 1KGWA 4XBMA 4OM0L 1OCRB 1MREH 4F40A 1LL1A 4GQ0A 4OZIA 3WLBA 3E6FB 3BT0A 4MZYA 4WUUE 3A6OA 4DP9X 3EBVA 2H32H 2R0ZH 5JQ6L 1FORL 4XISA 2F7PA 1NUNB 4WI4A 3C8DA 1L6GA 4J3OF 4NXKA 1HXJA 5EU6A 2WM0A 5LZLA 2R1PA 5I15H 3GPEA 4NZUL 2J8UE 3CHPA 2EDFA 1W56A 2X7VA 3BCFA 3CT2A 4EJ1C 5D93C 3T0EB 5CJ5A 5F6HJ 2GIMA 2FECI 2F6AA 2XY1A 1PW3A 4OSUL 3HC4L 5EO1B 2EUZA 1IEAB 2BGQA 4IDLA 4G7VL 1NFBA 1OOWA 3DRTA 4Y5YA 5IUSA 5IJDC 4FRWA 2YUXA 3RU6A 4LNCA 3WG7B 3EJPA 4IIQC 1R87A 1HYSC 1PLGH 4C6CA 4F8PA 2BSBA 3H70A 4WU5A 1WS8A 1XCFA 2F2HA 4JFYB 2IAMD 4HDIB 4IIBA 5HGHB 4V1XA 1H3GA 3F58L 5JXEC 2DQHL 1FVCA 4GJIA 3L7EA 4N2OA 3HLAB 5C0BB 2GBVA 5IHZB 2A3CA 3CZGA 4AEIL 3SY6A 1QNPA 2C6QA 2FDMA 4ADUA 4NIKB 5E03A 4JQIA 4HKZB 3IGAA 1WFIA 2FQIA 5DZAA 1AMKA 1EX5A 3LERA 3O6DA 4WCJA 3G5XA 3B0XA 4QOKB 1NIBA 1CZ8L 1LQSR 4PGCB 4XMKL 4F0LA 3U82B 5GRWA 2B3RA 2ZXEB 1D9EA 4LVHB 4MWAC 3V35A 5BV7L 5LGHL 2GBTA 5MEQA 4XGZB 2DWYA 1LEKB 1BJ1J 4GRMA 4ROQA 4U7KA 5KN5A 4MBOA 3NABL 1OFQA 3QQ3A 4F2MB 2B1AL 2FEDD 4URKA 1M6OA 1VFUA 2Y7QA 2NW0A 4AGNA 5LNSA 1CFSA 3QDME 4JN1H 4PJEB 4CC1A 3Q37A 3POCA 4GKOA 1UFGA 3G3MA 3W7IA 4LPTA 2CLVB 3HBGA 3KYKL 5GHWL 1SQ2N 2MPAH 4ZOBA 5L2KD 1HNGA 2HJKB 1MDTA 5L88L 4Z7OB 1E4XH 5I18L