3IJ7A

Directed 'in situ' elongation as a strategy to characterize the covalent glycosyl-enzyme catalytic intermediate of human pancreatic a-amylase
Total Genus 178
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
178
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Directed "in situ" inhibitor elongation as a strategy to structurally characterize the covalent glycosyl-enzyme intermediate of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 178
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-08-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3ij7A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ij7A01
2ESCA 2DSUA 4YN5A 3PHAA 4JFVA 4AIEA 3PZQA 2VMFA 4L4PA 3VU2A 1C93A 3WQVA 2PBOA 2F1BA 2YOCA 1JYXA 3WF4A 4K68A 3PTQA 2XVNA 4TTGA 4AWEA 1V3MA 2D23A 4GINA 1ZBKA 2BHZA 1EHAA 4PYSA 2BVYA 4H8VA 3E1F1 3HG2A 1GQLA 4IM4A 3PZTA 3MU7A 1P6WA 2VURA 3CUJA 3WEOA 1TVPA 2WC4A 2D3LA 4W5ZA 1W1TA 3ZR6A 1EQPA 1VAHA 1JZ5A 2DSWA 2G41A 1V6WA 4GKLA 5A6BA 1VEPA 3GH7A 2BY1A 1JZ8A 3ARQA 4AISA 4PMZA 4Z2GA 1HVXA 1JNDA 1E1EA 3WQ4A 4Q7NA 3RM8A 2NW0A 1QNRA 1G01A 3L4YA 5DMYA 1UQZA 3VSTA 5HPOA 2YFNA 2D0GA 3SUVA 5A6AA 3HN3A 1ZBVA 4A3HA 3SCWA 1J0YA 5A69A 1V0MA 1W32A 4A3YA 3AHTA 1FA2A 3K8LA 4W88A 4PSRA 1NOWA 3DX0A 2F7PA 3BSHA 1TA3B 2VRJA 3WBEA 2GDVA 5A3HA 1JXKA 4WLCA 1IZKA 3CMJA 3BMWA 4M1RA 2BY3A 3VTRA 4OBSA 2BVDA 3I3BA 4Z2KA 4M56A 1H49A 4DWSC 1EIBA 2DT1A 2D22A 1JGIA 4MNLA 1ZJAA 1JZ3A 2QPSA 3NSNA 2F7OA 5CJ5A 3MV11 5A2BA 3GH5A 1NP2A 2BHYA 4FNPA 2V5CA 3WH9A 3LXAA 1XCXA 5M17A 1HXJA 1U33A 4OOUA 5GQBA 5LA0A 3AIRA 4X0VA 3J7HA 3WBAA 2J7HA 4MAVA 2WZHA 4AIOA 1RD6A 1EA9C 1V3JA 3VGFA 4W85A 2JIWA 4P8WA 4PUEA 3S5YA 2G8ZA 2E8YA 3CLWA 1UZ4A 4TX6A 2A3HA 4NXKA 4BS0A 2YBUA 2W91A 1QW9A 2UWFA 4N42A 1QI5A 2CHNA 4WIWA 1DWGM 1Y7VA 4W7VA 3GM8A 3FXYA 1WDPA 3OLGA 1J10A 1BVNP 2J7EA 4EAMA 2DQXA 2WSKA 1E6SM 5FL0A 3GBDA 5LA1A 1JFHA 5I24A 5E0FA 3ZSSA 3FNDA 1KBBA 3D51A 2QHAA 4D6FA 4PCSA 3BVWA 3TTQA 3N13A 4GPNA 3B9AA 2DT3A 4HTYA 5M5DA 1GOQA 2WKLA 3W28A 3T2QA 2E4TA 1LQ0A 4V2XA 1LG1A 4FNSA 4D6EA 4U33A 4DUWA 2Y5EA 1E9LA 1ITCA 3VIKA 2W62A 1CGVA 2F18A 2FH6A 3SCRA 5BROA 1DP0A 3PZVA 4GQQA 2EACA 5BRQA 3GXPA 3PZ9A 1ZBWA 1TA3A 4UFMA 1R75A 1M04A 4H7VA 5A2CA 1XD0A 5BXSA 1HTYA 1UD6A 3OGSA 3BUBA 3VM5A 3RCNA 1V3KA 5EFFA 2OSWA 4CCDA 1UWQA 1GVIA 3BAJA 4HPHA 1E6ZA 3AMGA 5I78A 3ZQ9A 1GQJA 3BUDA 2YBTA 1XD1A 3VD5A 1HL9A 3H55A 3W82A 1WP6A 2BFGA 4C7GA 1PZ2A 1QI2A 1W3HA 3M46A 3NSMA 4HZ8A 4JAWA 3VNYA 5FCZA 1OB0A 5KZ6A 2YL8A 3WUEA 4NF7A 3ZO9A 1LL7A 2GJXB 6A3HA 4WKAA 1J0JA 1UQYA 4J3XA 1JL8A 3CZKA 5D9OA 4OIFA 3W24A 2ZE0A 2W63A 3TP4A 1VIWA 4QFUA 1PPIA 3K1DA 5E0CA 2B31A 3F5KA 2GJRA 4PMVA 3B9DA 4CU8A 3GXNA 4H8UA 4MDPA 3BGAA 1OT1A 1MWOA 1CEOA 4PTWA 1MFVA 1NM9A 1W1YA 2J8GA 1B3YA 1WNOA 2VC9A 3ARSA 4P7NA 2VX4A 3OBAA 3POHA 3VX0A 3UG4A 2IUZA 1HKIA 1JDCA 2WWDA 5IHRA 1CXEA 3OLEA 1LL4A 3T2OA 2WK2A 4S3JA 1FFQA 1UKQA 2BVTA 2EPKX 4UOQA 2F7RA 3BSGA 5CPQA 1OWQA 1RPKA 2VVNA 5KEZA 4JFWA 3VIOA 3VSVA 1ZS2A 1OIMA 4UQCA 1CECA 1CXIA 4J3UA 1HNYA 3EDKA 3DX4A 2WC7A 3DX1A 3CHDA 1E40A 5D9PA 1HKJA 1XCWA 3AJ7A 4DWSD 3NYDA 3WD3A 4JCLA 4CN4A 2QMJA 2DGAA 4BCEA 3DYMA 4QDMA 2EPLX 1CGUA 1C7SA 1JZ4A 5CSUA 4DM1A 5CGMA 1LL6A 1IT0A 3GYCA 5I5RA 2FGLA 3A22A 1KXHA 1QBBA 4E2OA 1R86A 1CDGA 1E71M 1E6RA 3CZGA 3JUGA 4B9ZA 3VUPA 1E3ZA 4GI6A 3K4DA 3PN8A 1WB0A 1EOKA 1YHTA 3D4YA 4B3LA 1EDGA 2VL4A 4MJ2A 1CNVA 2JEPA 4A4AA 4MADA 1NWUA 4NZFA 1R85A 1JYVA 1SMDA 4ATWA 2X05A 1UASA 2WWCA 1AVAA 4W8AA 1GOWA 1VBUA 4UQ9A 2CPUA 3BCFA 1QNSA 2GJXA 5E1QA 2V3FA 7CGTA 8CGTA 1OD0A 3AHYA 1RH9A 2VZSA 3ZJKA 5A6SA 1E0XA 2ZUSA 3ARWA 4JL2A 4DUVA 5A8QA 2XFYA 2WCSA 1MYRA 2W4XA 2WVSA 1UR2A 4GZIA 5CZKA 1I1XA 4HZ7A 2WANA 2X2HA 1ZB5A 4BF7A 4E8CA 4XZBA 3EJRA 2CIPA 3AISA 1CLVA 3ARRA 1NH6A 3PBGA 2VQTA 4M82A 1E70M 3NSXA 1V02A 2J79A 1UWRA 2DPEA 2VOTA 3D50A 2VZTA 3WQWA 5HPCA 2EADA 2XUCA 1GJWA 2HISA 4HMDA 2DDXA 1K6AA 3WH8A 1UD2A 3M07A 4AY1A 2OLHA 1ODUA 4WSJA 1E6NA 4ML4A 3CIVA 1H0GA 5IXEA 2QPUA 3D4ZA 3WEZA 4QLLA 1Q6FA 1JD9A 4ATLA 2EABA 9CGTA 3SUWA 2XWEA 1R47A 1FHDA 5M3WA 2XN1A 4AD5A 3MO4A 2J4GA 1TQWA 2MANA 1KTCA 2WHKA 1C92A 2XVLA 3B8SA 3RMEA 3TTOA 3W81A 4MB1A 3U7BA 3FW6A 1R8LA 3WELA 3K46A 1OGGA 2O9PA 3AICA 5LA2A 2WLZA 3ECQA 2VRQA 4PEEA 3SUTA 3SCPA 5EB8A 1HKKA 1N82A 2JE8A 5CLWA 2VQUA 5AC5A 4U2YA 3A4AA 4TOQA 1X1NA 2ZUTA 3RO8A 1KFWA 2AMGA 4B9YA 3BLKA 2CNCA 1E1FA 2PC8A 2WCAA 3SUSA 3CHCA 1V03A 2X8RA 3CV5A 4FLQA 5E6ZA 3AOFA 1MXDA 4LYRA 3QGVA 1HKMA 4D6IA 2WXDM 2CKSA 1GVYA 3GXFA 4FK9A 1OCQA 1NP0A 1ISZA 1BHGA 2WZIA 3VD9A 1W9VA 1A47A 4W86A 5ABHA 1GNXA 1IZJA 1DTUA 3LRMA 1TQSA 1J0IA 2WMKA 2FHCA 4J3TA 4W89A 2CESA 2X2YA 2Y8KA 4TTUA 2A3CA 4ZXLA 3BAWA 1UH2A 3OB8A 3GNRA 4BQ4A 1PJ9A 4PMNA 3OG2A 4B16A 2CERA 4MB3A 4ACYA 1BYDA 1FH7A 1A3HA 1WO2A 4AXNA 3NUKA 3EBVA 1JIBA 3BAIA 1EO7A 4FNRA 3VOCA 4WF7A 5LYRA 1BF2A 2X09A 2DH2A 3F4VA 1E73M 5ECUA 3CZNA 3UCQA 4AMCA 4ZE4A 2OSXA 3WFLA 3BAKA 2ZX6A 4JIEA 3AIEA 1TCMA 2XGBA 4KGJA 3A23A 1X6LA 2X1IA 5JIPA 1EXPA 3ARVA 4AMWA 1QVBA 1CIUA 1CPUA 2D0FA 3VDHA 4F66A 3WNKA 2DSVA 2DEPA 3MSDA 4HP5A 2J74A 1HJUA 4DO5A 1O7DC 5A6KA 1UKTA 1B3XA 3SURA 2VZUA 3W53A 3K8MA 4XV0A 4WSKA 5C70A 1WKYA 1KGWA 3AXXA 1JXJA 2D2OA 4HPGA 1H3GA 2WKGA 5CQ1A 1B30A 3EJPA 5TD4A 5CGTA 1D7FA 3KE0A 1ISVA 3KL0A 3ZR5A 1C8XA 1TZ7A 2EBNA 3RILA 1GHRA 4AZIA 3PZNA 1VFMA 4AZ7A 2V38A 5A1AA 1MW2A 3SCNA 5IFPA 2ZXBA 1MW0A 1S46A 2G3IA 1W1VA 1WAWA 2OW7A 3EJTA 1JDDA 4X9YA 1RP9A 1UD4A 4TX8A 4FMVA 4C7FA 1R7OA 2F7QA 1J11A 1CGXA 2E40A 4ACZA 3BVVA 3BUPA 4AIUA 4NRRA 1UWIA 1DWJM 1R33A 2CCRA 5HOSA 1CYGA 1BYCA 3MV01 4DM2A 3HG4A 4PBGA 2VCAA 2YDQA 3WL0A 1UA3A 3EMCA 3AS0A 1UWTA 3GH4A 3KL3A 4UOJA 1BVZA 1XGZA 3IJ9A 4W5UA 1G1YA 4GO8A 4UQDA 1MW3A 1KGXA 3TONA 2V5DA 3FHAA 1W9DM 2J8FA 4MB5A 4Q22A 4DWSA 4U31A 1V0KA 3TOPA 2WMGA 4LPCA 4TVDA 1QWUA 3DX3A 1E6QM 1VEMA 1UKSA 2CXGA 2G3MA 1ODZA 1JF6A 1R87A 2BV9A 1GORA 2W61A 1US2A 1XH1A 5A94A 4HU0A 4U5IA 4XB3A 1V3LA 1KQZA 3AHVA 4MNJA 1UUQA 2FHFA 1TQVA 1HJQA 1D3CA 1SMAA 3QR3A 4MPKA 1QX1A 5DT5A 3PTKA 3DHPA 5A6MA 4LYPA 3AROA 1V3HA 2QLYA 3AMCA 4JFSA 2XG9A 4MDOA 1QI3A 2WHJA 1E4NA 2Y8VA 1CWYA 3MSGA 1HIZA 3WH5A 1KB3A 3A47A 1KR0A 1R7AA 3WDIA 1WZLA 1E3XA 3FAWA 3WD2A 1XYFA 3AIWA 1ZL1A 2UY4A 2WPGA 3GNOA 3D52A 5A8MA 1I1WA 4PMOA 1TQUA 1E6XM 3VDAA 4LX4A 2PB1A 3W26A 2OWWA 2DT2A 3N9KA 5I6SA 2WM0A 3MKKA 5CPTA 3CZJA 4UNIA 4AW7A 3WDRA 3AYRA 1E15A 2BNJA 4WK9A 3OZOA 3ARUA 3ZT5A 1F4AA 3BVUA 1LWJA 2E0PA 5ABGA 2YDRA 1JDAA 2YKKA 4AZ5A 4UZUA 4AZCA 1U2YA 3K4AA 2NSXA 1GPFA 3BAXA 1XH2A 2D20A 4NXSA 1ISWA 3EDJA 3VGHA 4J28A 3CHFA 1QNOA 3CZ8A 3AI0A 3N18A 3WY1A 1UH4A 2JF6A 1LWHA 3PZOA 1QW8A 3WQ5A 4UFJA 1UWSA 4UFLA 1M53A 3HZ3A 4B15A 4UFIA 2O9RA 3VO0A 2EPOA 1W91A 1L8NA 1PS3A 4YHEA 5BRPA 2W67A 3CUHA 1W9XA 3W25A 3GZAA 1UH3A 2Z1KA 1JYNA 2ZUWA 3L4WA 1GW1A 3L4VA 3VKKA 7TAAA 5HXMA 4OZOA 3AIQA 3ZT7A 1DHKA 4D72A 1BLIA 4PRWA 5FOOA 3MMDA 2FDMA 3PTMA 2GJPA 2ZX5A 3ARYA 3FHQA 4IISA 3U5YA 2VX5A 2J7GA 4W8LA 5I79A 3HG5A 5DFAA 1V3IA 4XUYA 4HA4A 1QNQA 1V0LA 4UFHA 2XIIA 1UR1A 1BFNA 4NRSA 2JALA 2WCGA 4KRTA 1MFUA 2UY5A 1C8QA 5I23A 3VM7A 5FD0A 1WZMA 4HZ6A 2JFEX 1HP4A 4J7RA 1K9TA 3BVXA 3DYOA 1BG4A 1VFFA 2QF8A 2J25A 2YA0A 4FNUA 1J0HA 1GJUA 1OGSA 1PZ3A 4UTFA 1B90A 2C0HA 4EK7A 1HL8A 2EQDA 1E6PA 3WDQA 1CZ1A 3WY4A 6TAAA 1FHLA 7A3HA 3VD4A 2OYKA 4NX0A 5A8OA 4URIA 4XZWA 2J47A 4YHGA 4UQAA 3GNPA 4ZEPA 3WQ8A 4AD1A 4J3VA 2ZOXA 5BXRA 4F9DA 1XH0A 2OWXA 2OYLA 4PTXA 1PEZA 2G3JA 2OWCA 2C8NA 3GTNA 4TUFA 1WZKA 3W29A 4PUDA 2J62A 3AIVA 1W3JA 1KCKA 3DDFA 1J9YA 1OD8A 1EHNA 3U7VA 1BGGA 1JZ7A 3TTYA 2J7BA 1KTBA 1AQ0A 2VUYA 1JI2A 1HX0A 4BA0A 3SCTA 1VB9A 3W27A 1OINA 1V0NA 2XFRA 4UR9A 3VGGA 4JZ5A 3K8KA 1E4LA 1BYAA 2G3NA 2D24A 3ZJ8A 2WVTA 3A4XA 1XYZA 4P7OA 2YA1A 3N12A 1CXFA 2XFFA 1EQCA 3EMQA 3VD3A 3ZJ7A 1NWTA 1CGTA 2WMHA 4JKMA 5A95A 8A3HA 4OGZA 2YA2A 1KXQA 1HJXA 2WNWA 5AYBA 1SR0A 3A6OA 4WJXA 4C7DA 4F9JA 4FNQA 2VCBA 1NOUA 3VNZA 3AZRA 3M7SA 3KWXA 3H54A 4D6DA 1V02E 2VI0A 4FNTA 3CMGA 4MJ4A 1OIFA 3HMCA 1E5NA 4ZE5A 4ZXOA 4JHOA 1LLOA 1WDRA 4QLJA 2ZX8A 3WUBA 3S6TA 3VDBA 4GIAA 1GOMA 4M29A 4XX6A 3A5VA 4B3KA 2DIEA 4PSPA 4M8UA 2W5FA 2XIBA 5DF0A 1B9ZA 4AD2A 1QI0A 3VPLA 3WY2A 4AD0A 3IAQA 2CYGA 2RGLA 3KLKA 3D5HA 2WSPA 2Y2WA 4FLSA 5AC4A 1HVQA 1UOKA 3IAPA 3SIMA 4D6GA 4GI9A 3KEHA 2DIJA 3LMYA 1FFRA 2CBIA 4CVWA 3VSUA 2W92A 1VJZA 3EJQA 2PWEA 1PAMA 3WDJA 3AMKA 1EH9A 1KQYA 3VILA 4RE3A 3I3DA 4X0NA 1UWUA 1BPLB 3AXIA 3PZIA 3IGUA 2WVUA 3WUFA 1CXLA 1CXHA 1ZJBA 3EJSA 1R46A 2VR4A 3WIJA 3QOKA 1W9PA 2PWFA 3MMUA 1XSJA 4RE4A 4JHZA 1DWIM 2OSYA 1J0ZA 2VVSA 1MQRA 1VJSA 4WKHA 4W7WA 3WSUA 3OZPA 2XGIA 3SCQA 1E55A 4GQRA 2EPMX 3WENA 4M80A 5FL1A 1H0IA 1H09A 1TE1A 1AQHA 1QHZA 4QP0A 4NZJA 4AMXA 1M01A 2GK1A 1OT2A 2XJ7A 1C8YA 1K9DA 1G94A 3BXWA 4J27A 1MQQA 5IFTA 4KWUA 4W93A 1UR9A 3CGTA 1VBRA 2J7DA 4P7QA 1UZ1A 5E09A 1V08A 1B3VA 1LF1A 1B3ZA 3THCA 1JYWA 2GDUA 1WPCA 1UR0A 4HMEA 3ZSTA 2YLAA 5GNZA 3QOMA 5JBEA 2GVYA 3CH9A 5DT7A 2EAEA 3MI6A 3QHNA 3MUZ1 4HOZA 2BXZA 2NT1A 5GNXA 4PMYA 1XC6A 1PBGA 4AEEA 1E56A 3PZGA 2J77A 1CBGA 2DT0A 4F8XA 1E4IA 4QAWA 2VX6A 4ZENA 4BQ3A 2WB5A 2BHUA 4ACZB 4ZFMA 4UCFA 2D73A 3POCA 4CCCA 1Q4NX 1K9EA 4P8VA 2DSZA 3SEPA 3GDBA 3S5ZA 3WD1A 2IXVA 2WAGA 3VMOA 2XN0A 4L4OA 2EO7A 5JUVA 3WNOA 4OUEA 5DO8A 3W6MA 1IV8A 3OLDA 3VGDA 1TR1A 4H04A 4P8XA 1BQCA 1H41A 2ZUNA 1TMQA 5A6LA 3N1AA 3SCUA 4DWSB 2WMIA 3WH6A 3FY1A 4JKKA 1B31A 3NIYA 4CVUA 2X0HA 5D9MA 2YJQA 3AZSA 2XSAA 1NQ6A 1GHSA 4GI8A 4PCTA 3GXTA 2E8ZA 2GUYA 4CD8A 3DYPA 3A24A 2Y4SA 1JZ6A 2XVPA 3WKZA 1UD5A 3CZEA 4NSBA 4Z2LA 5ABFB 3SCVA 3IJ7A 2FHBA 3N17A 3T08A 3T2PA 4CCEA 1O6IA 2VO5A 4V27A 3RDKA 1F4HA 4HA1A 4PMDA 1V6YA 3EDDA 3O9NA 3VIPA 1RP8A 2PWDA 1HJVA 1U30A 3AS3A 2XWDA 2CETA 4R27A 1ITXA 3WF3A 1SZNA 3VIHA 3N04A 3QHMA 3AXHA 3TA9A 5AY7A 2WW5A 1GOOA 3AIBA 3O2LA 1DWAM 3AYSA 2WMJA 3AHZA 2J7FA 2PI6A 4CN6A 4MNKA 1KWKA 1E5JA 3O6AA 3NDYA 2EJ1A 3CPUA 1GQIA 2G4FA 5GPRA 4FLOA 4MB4A 1T0OA 4AZCB 2WVVB 3WMSA 2OYMA 2ZX7A 2VTFA 1AQMA 1HF6A 3NDZA 2XM1A 1XRVA 3AHXA 1VFOA 3VMNA 2FYVA 1H2JA 2ZICA 3DECA 3UR8A 2BXYA 2CKRA 2X2JA 3U57A 2IXUA 4U3CA 3APGA 2VNCA 1QBAA 1HWWA 3UERA 5ABEA 4HU8A 3M6DA 3VINA 1KXTA 1HP5A 3MUIA 4AD3A 4D1JA 1X6NA 4IUGA 1BSIA 4H8HA 2F8QA 1B1YA 2XYLA 1SYTA 2X0YA 5E6YA 1UD8A 1QHPA 1PX8A 4AZ6A 4DO4A 1TG7A 2EPNA 1UR4A 1E4MM 2E9LA 4PTMA 3AIUA 3ZMRA 1UR8A 2XVGA 4P8UA 1VF8A 4YPJA 4W8BA 3UR7A 3WUGA 1Q6DA 4U3AA 3L4XA 1Q6EA 1XSIA 3RJXA 2WMFA 4CU6A 1PX3A 4QLKA 4EANA 1W3LA 3CBWA 3BLPX 1J0KA 2ZUUA 4CGTA 2XPKA 3ALGA 1JI1A 5ABFA 3W38A 1QPKA 1R34A 2ALWA 3N11A 1CTNA 3G6MA 1BAGA 3LXBA 4H2CA 3WNNA 4FF5A 1TQTA 3GXIA 2PWHA 3TV8A 2E9MA 1C91A 1WDSA 3CZLA 3CHEA 3VIIA 3THDA 1UD3A 1VFUA 3S2CA 5GNYA 3UESA 3WD4A 1JNEA 1TFVA 3A3HA 1E43A 5CSYA 1KCLA 1FH9A 1SFSA 1FP8A 1UHVA 4TXEA 3GXMA 1H11A 3OGVA 4GXPA 5CPSA 1PIFA 2OW6A 2XVKA 3BLBA 4W87A 2BS9A 1JF5A 1KBKA 2GSJA 2WVVA 3FN9A 4PMQA 4FLRA 3W6LA 5D8WA 2XTKA 4IPLA 1EGZA 2D3NA 2CBVA 2F1AA 5CG0A 3VVGA 1AMYA 3T09A 3VIJA 5IHSA 2YL9A 1VENA 1W1PA 1NOFA 1UKPA 2VRKA 1EOMA 1VEOA 1JZ2A 1YQ2A 1K9FA 4H41A 4CUCA 1MQPA 1HT6A 4HMCA 3CTTA 2O9OA 3WNPA 2E3ZA 5BCAA 4HOWA 1CGWA 4S3KA 4W7UA 4AYGA 3MUAA 5I77A 3VMPA 3LXCA 4KMQA 4AZBA 3A21A 3PZMA 1NWRA 1CGYA 3L2LA 4UQBA 2XM2A 3L4TA 1QWNA 1EO5A 5AYIA 4BQ5A 3AQUA 1FP9A 4OBRA 1LG2A 2J75A 2VR5A 1UA7A 5JBFA 1GQKA 2CITA 4Z2JA 2CBJA 5BYWA 1O7AA 3OIHA 1DWFM 5C8BB 3AMDA 4OJYA 2VZVA 1DEDA 2UY3A 1J01A 3ARZA 5E9AA 4AYSA 4R5EA 4TVCA 3ZOAA 4BQ2A 3ARTA 1WZAA 3EDEA 1QNPA 5D4YA 1QOXA 4AEFA 4CD6A 4D71A 3TTSA 1J12A 2DSKA 2VX7A 2ZIDA 1ECEA 3PZUA 5I0DA 4M81A 5FKYA 2Y24A 4UOZA 5EBAA 5BXPA 1G5AA 2RGMA 5CLTA 5A6JA 3ARPA 2WYSA 4KGLA 2F61A 2JF7A 6CGTA 4QCEA 2ZWZA 1E0VA 2BY2A 3VGBA 5BWFA 1Q6GA 2AAAA 1ISXA 3T0DA 4OOZA 1GUVA 1W9UA 3WEMA 4BZYA 2IGTA 2ZXDA 4JCMA 4D6CA 1JAEA 3EYPA 2QMKA 3IANA 3OLIA 3ZIZA 2ZUVA 3AS1A 5HDRA 3SCSA 4RL3A 5BXTA 3WMCA 3ZJ6A 5A6BD 4JL1A 4U2ZA 1US3A 4U5KA 1QI4A 5A2AA 3KZSA 5D9NA 2V3GA 3RM9A 1PX4A 3CUGA 3D3AA 3EMZA 3HU7A 1MVYA 1B3WA 3G6LA 2TAAA 3UEQA 2V3DA 2EEXA 3VX1A 1OBAA 3W4RA 3DDGA 1GONA 2GK1B 1XV8A 4CD4A 3OGRA 3WMBA 1BYBA 1ZU8A 3WF1A 3N15A 1W2VA 1M03A 4CD7A 3LX9A 4LQ1A 5A8NA 3MS8A 4D1IA 2FH8A 1UG6A 2VJXA 4D6HA 3NCOA 2BY0A 4W84A 4OKDA 4PMXA 1WE5A 1V6XA 3A4WA 1TUXA 3VGEA 1BG9A 1E72M 1FH8A 3T0AA 2PWGA 2GFTA 2WBGA 2XHYA 4JFTA 2F2HA 2YIHA 3RJYA 3UETA 3CC1A 1OSEA 2XSBA 4UZSA 1JG9A 2E9BA 3VIFA 4M24A 4HA3A 1MXGA 4QCFA 3BMVA 3H53A 5D8ZA 3FAXA 2WZEA 4DO6A 5E70A 1G9HA 3I3EA 2FE0A 3II1A 1JAKA 4D6JA 1I75A 1GOKA 3AZTA 2UY2A 3W37A 4MNMA 4GO9A 1C90A 5I3DA 3WN6A 1Z32X 3ARXA 4J3SA 3VD7A 3CO4A 4TVUA 1OGBA 3EJUA 2JIEA 2A3BA 3F5LA 3WF0A 1NWSA 3CUFA 3U5UA 1L0PA 3AFBA 4UQEA 2WMIB 1JFXA 1XHGA 1GCYA 1W3KA 1GOIA 1H4PA 3BUQA 3T0BA 4EKJA 1JD7A 3BVTA 2D1ZA 1H5VA 5FIPA 3BH4A 1W9BM 4P7RA 5F7UA 3HJEA 2D0HA 5CXPA 2WLYA 3WQ6A 5JBDA 1C3FA 3EDFA 2J7CA 3WD0A 3KL5A 3WF2A 2Q8XA 2ZXQA 1HJSA 4KH2A 2FGZA 2O9TA 1KWGA 1CXKA 2DH3A 3GXDA 4Z2IA 3CUIA 5HNNA 3WFZA 3W0KA 2NT0A 1D2KA 1TVNA 3BAYA 4PMRA 5A8PA 1C7TA 1XSKA 4PN2A 4E8DA 3ALFA 3DC0A 3IK2A 2A3AA 4IPNB 2WBKA 4CD5A 3BUIA 3DX2A 1VRXA 2PF0A 5C71A 1M7XA 2O92A 5M03A 4AZHA 1WCGA 4GZJA 2ZUMA 3LPGA 4F79A 3L4UA 3WY3A 3SUUA 3VDCA 3QHOA 2C7FA 2ZX9A 2YL6A 4KRUA 5HBFA 1B0IA 2V3EA 2ZXAA 3LPFA 1EDQA 3VIMA 3KLLA 2HVMA 1W2PA 3F5JA 1BGAA 4WKFA 2VZOA 3DHUA 4UFKA 4AC1X 4RE2A 3WDPP 1E0WA 3AMLA 4EE9A 1FOBA 3OA5A 2VT0A 2JEQA 1ZBCA 4ATDA 3WNLA 1V6VA 3SCOA 1KXVA 4LGXA 3LPOA 1UKOA 2YDSA 2W66A 3B9EA 3WNMA 4Z2HA 4PMUA 1J18A 1QHOA 2YLLA 5EFDA 2XN2A 3LRKA 4CN1A 4NI3A 5JIWA 1ESWA 1CLXA 1DWHM 1B2YA 3AS2A 3ZM8A 2WC3A 1NARA 3HG3A 2A3EA 5IDIA 3GBEA 1MW1A 2YL5A 4AD4A 2AOSA 3NJ3A 4JKLA 4CU7A 1ISYA 4HOXA 4LXFA 2X2IA 4J3WA 1BTCA 3BC9A 4P7LA 3L2MA 4N0RA 3LPPA 3RIKA 1OM0A 2CEQA 1KGUA 3UG3A 1HN1A 1UYQA 3MUY1 4AZGA 5I2UA 2CHOA 4JFUA 4DUXA 2WHLA 3MANA 1HXKA 4NZCA 4Y7EA 3ZT6A 4GZEA 4MTVA 3L4ZA 2Z1SA 4LYQA 2CBUA 2EXOA 3CZSA 3RPMA 3LRLA 2PBGA 3MMWA 4CKQA 1EDTA 3IJ8A 2QV4A 1H1NA 4PTVA 3WH7A 1Q6CA 4E4PA 2WHMA 2J78A 1CENA 4V28A 1KR1A 4MAZA 1V6UA 5DEZA 2YFOA 1HJWA 1PIGA 1G0CA 5EMYA 1WDQA 3WDHA 1LJYA 3UG5A 3WL1A 2VCCA 2ZWYA 1GZJA 3VIGA 3BCDA 3RM4A
chains in the Genus database with same CATH superfamily
2VABB 2QQQA 4YN5A 3GLEA 2AANA 4Y4FA 1TJ2A 4ZYKB 2ITFA 3ZPDA 4J3BA 3QIBA 4IBVA 4I18B 2Z92A 3BKYH 3UBFA 8XIAA 1F6YA 3LOWA 4K68A 1OZUA 1S4IA 4UNKA 4GINA 1MF2L 3LIZH 4Q32A 3BP4A 2H8XA 3OKDA 2CW6A 2V5TA 3G0UA 4S1DD 3NIFB 3UYCA 1RHFA 1J87A 2PDWA 4IKKA 5CCKH 2DSWA 4JFQA 5GZNC 3IFNL 5A6BA 4ZQOA 5I30L 2K8QA 4R7DB 5JQ9A 1QNRA 3K4ZA 3L4YA 1MRCH 2HRWA 3FSWA 2G75A 1MI5E 4RDWA 3SUVA 5A6AA 1BW8A 1ZT1A 1ZVNA 2B7OA 4GY1A 1DBJH 3BSHA 3FCSB 3R13A 1Z44A 1IZKA 3PDGA 3KM1A 2PCFB 2PUQT 4PBDA 3WBDA 1H49A 1YN7A 1RJPA 2F53D 4KY1H 5AYZA 4GKZA 3MACL 5DC9B 3GH5A 2ZG2A 1XR2A 3ABLB 2MNUA 3QEGL 4WWKB 2QR6A 5M17A 4OT1L 5F2MA 4UTCA 4IMDA 4NKOB 4UV7L 3WO8A 3EWDA 2DW7A 1K7XA 5E5LA 1Y8BA 4U28A 4OV5B 3F6LA 3V6ZA 1G9MH 4DP5X 2QJHA 3L2NA 5KVMC 2YD8A 3RKDC 4PJXF 4X9HA 2R0ZL 4QHKJ 4XP6H 5D72H 3FXYA 3OLGA 4A55A 4S2SB 2FO4B 4KKLC 1S38A 1VPOL 1BVNP 3V7AE 1FXPA 1OGAB 3U6XS 3GYEA 1JFHA 3D8MA 4TU1A 3IWUA 2EHHA 5SWQB 5D2TA 4CNNA 4QHMA 6FABL 5B4MC 2DT3A 4HTYA 2WKLA 5J0BA 4CNUA 1KJMB 5FA3A 2VSMB 4LSUH 4FNSA 2EJAA 5F1VA 2F18A 3HZMA 4G9DB 2X6UA 4N02A 1D5RA 3QUKA 4QUOA 3PAJA 5JHLH 4QQ3A 2VLRA 4JTSA 3ZQ9A 1K8IB 1V77A 3V18A 2F08A 5K39B 1D5XB 4C6EA 1JHTB 4F8QA 3P4OB 4IP5A 1OB0A 3MRQA 3V0GA 4WU7A 1HAUA 1J0JA 1N5YL 2ICEB 1ZA6B 4LLQA 4J3XA 3WQEA 4LARH 1IAOA 1AH3A 4JN7A 4F1SA 3GKZA 4S3GA 3D0AA 3C0SA 5IHUH 2EDFA 3HN5A 4CJ0A 4P3CH 2WKOF 2EEDA 4HC1L 2IDTA 4KK6D 4Y9FA 2EIZB 1QUPA 1NIFA 2IDQA 2K70A 1RUPL 4N8VB 4DAFA 4GBXC 4JY4A 4L8CA 4Y1AD 3TF7C 5DTFB 2DJ4A 3L2IA 5JH1A 4XOBA 1OIMA 2FQEA 4J3UA 3IARA 3VFTA 4DF0A 3EWZA 2PPGA 2VQ1A 4TUKH 1AOHA 2QMJA 1QBML 4WHTB 3TWBA 4X4YA 5TJWK 3V5HB 1IT0A 4FEMA 1AS8A 2OL3A 4L4TE 4HN4A 3ULUC 4MYWB 1E3ZA 3GLCA 5D4QA 1UBSA 2OJZH 3ITXA 2LT9A 4IQLA 3PU7A 4FULA 4A4AA 4XN9A 3HA0A 2PETA 4BFAA 1MFNA 1NGPH 2WB7A 1TVHB 1MUCA 5A6SA 4WU5A 4WUUA 1I1AB 3V0TA 3CFNA 3NFNB 1V93A 3OW1A 2YC1A 3N1PC 4FABL 4PJIE 2B59B 1U8QB 3B9KC 3AADB 5HPCA 3HPLA 2HISA 5DUBB 3W84A 1NOAA 4EQ3A 2BSCA 1K6AA 5C9JB 2LLGA 3AY2A 1OZQA 1YEGL 1H0GA 2IWGA 3Q06A 4GP4B 3QFGA 1T5KA 4POYA 3O0LA 2NZLA 2J4GA 3LKNB 2Y72A 2OELA 4LFHD 1A14H 3RMEA 4G56A 4YHZL 1SUHA 4HWNA 3B4NA 3THQA 5FGSA 2NX5D 1LP9F 3WS6A 2PR4L 2VQUA 4MA3B 3LEVL 3WLBA 2AMGA 4B9YA 3N3MA 2WCAA 3MRNB 1U5HA 3OYXA 5T1DL 2Q7YB 2LVEA 4Y4HC 4IRZL 2WTRA 5LBSL 2QPDB 1U8CB 4JY9A 4M7ZC 2OMTB 2XRAL 3LRMA 5G55A 2WMKA 2NUXA 3QORA 5C2GA 1B0RA 3MLPA 3URAA 3DUUA 2PDUA 3PWLB 1PG7X 3HG0A 3CZFB 1WT5A 5MENE 1E73M 3K91A 1H0DB 2CO1A 4XX5A 5DK0B 5E8DL 3U0TB 2VMEA 3QUXC 2VLMD 2NY3D 4WJKB 2YUVA 5GRWA 1XCQB 1GA2A 3MJ9A 3NVDA 2BINA 4X6DE 2OAAA 3RY5A 4Z7WF 2TRSA 3KW7A 1G69A 3UJSA 1H3GA 2LR4A 3T2LA 3LM7A 4S3FA 3PZNA 4LEFA 1ZWIA 3IDUA 4ZFQA 2V63A 5CKAA 1S46A 3SKNA 5IMOB 3ELQA 1JDDA 3GTHA 1AQKL 4MMZA 4HUKB 3HE6D 2AQNA 3DGBA 4YTUA 5SWSE 3UZZA 1S5VA 1DWJM 1D5IL 1PTAA 4PFMA 3SDAA 1UA3A 1CURA 2IMMA 3W1ZA 2WWKO 5FJOA 1G1YA 3RP1A 4N90D 4WFHE 3S37X 3FHAA 4BEQA 5TDOB 1UJQA 3MRBB 5L9DH 5F6IB 5INCA 5C9WA 1G7MB 5F1OB 2I25N 2IPUK 3MRJB 1PDKB 4Z5RA 2LE9A 3S98A 4TNVF 5IVXE 1V3LA 3RI5K 4GKTA 2IKJA 1CVSC 3NQAA 1K85A 2KDYA 4MGGA 3PTKA 2VCOA 5G4MA 1ZCOA 3NZQA 4JFSA 1IBDA 4JRYB 4CNSA 2NSMA 5FEZA 1JVNA 3V4VA 3IBEA 2AITA 3T3MB 1E0TA 4QCIA 3FAWA 3KPTA 2JKAA 3HUJF 3OWRA 1ZZMA 1Q94A 1PSCA 2P80A 2Z7YA 1QOPA 3V4PL 3G6JF 3FPXA 2CO2A 5AAPA 4KVPA 4J1UB 4N4YB 2YRPA 3S0CA 3OAYH 1FWCC 1EEYA 1JQXA 1YPZE 3ARUA 4HEPG 1BVWA 1QR4A 1KGJA 2A83B 1KEMH 3OKLB 5ADPH 1XAUA 4HYWA 3BQUA 4MY8A 2AGJL 3CZ8A 4IICA 3BLIA 3MNMA 3B2VL 3RGVB 3M0IA 5DJ8B 4PP1D 5J6HB 5A2FA 3BZFA 3W3OA 5FYLH 4K8GA 5EOCJ 5KANG 4KK8C 4R5VA 1V4YA 2H1PH 3H7RA 4CC1A 1VFLA 3L4WA 5CBBA 4HWEL 3NCJL 4XNAA 3CFDB 2LLEA 5BRZA 2A6KB 1QABA 3KPQA 4ISVB 2HLAB 3MMDA 1OF0A 1DQML 5E2JA 4EUPH 1JFQH 2XZAL 1KPVA 2Z1XA 3BFOA 1V0LA 1MN4A 4NQEB 1CF8H 5I23A 1XCTB 4HZ6A 1VKFA 4HALA 3GWQA 2FTYA 1VFFA 1N6VA 5IHWA 3TBSA 4NZ8A 1E5AA 3O0RL 2PA6A 2V9TA 3TA6A 4DQWA 1ONEA 2Q8LA 3QIBD 6TAAA 5EBUA 3GNPA 2DWDB 1EWEA 4FYTA 5I73B 5A6TC 1OK0A 5DK2A 3L1GA 5BXRA 1XPYA 7REQB 1G7QB 3QFJD 3AQZA 1HC1A 3I9AA 1W17A 2XTJC 2JJTA 2XG5A 2ZYRA 1TYEB 3DARA 5EBMB 1AQ0A 1XX9C 3L81A 3F7KA 5FIEA 3K8KA 4BFNA 1B2WL 3QJFA 4C6BA 5AZ0A 1ZSDB 1UROA 2HSIA 1UM6H 2YA2A 5CJBA 3BSZL 4N22A 2OXGA 2VCBA 2KI6A 1V02E 4TUJA 3EZ8A 5CZRA 4ZE5A 3PTDA 5I1HL 1WDRA 3WUBA 1KGIA 5LBGA 4QRRD 4XX6A 1RURH 3E12A 5EF1A 3OJDA 2P8PB 4YVPA 2YQ3A 3F7LA 1T03H 5AFAA 2XN9A 3TNMA 3WI9A 4B4HA 3ZLHA 4PG9B 1C16B 5U4NA 1NUNB 1ULVA 4CJ1A 4P2YA 3SDCB 4DFHA 4MXWH 1FFRA 3ZDYB 5I1JH 4W9ZA 4TNVK 3VSUA 1K1DA 5I7GA 5FYJU 4I7WA 4ZTEA 2NQHA 3IGUA 3T6WA 4IGBA 4OI8A 1G67A 2AKMA 4JTLA 4OCYH 4N0UB 3RUGE 4AXWA 3PWPE 2NZ9D 5TE6H 2J5WA 1U95B 1QDSA 1F8IA 1AE6L 4O52A 3NOYA 4H4IA 4ERIA 1KTRL 4M80A 3V0VB 3ZKXB 3D12B 5DRWA 3FJTA 4N9GB 5EU7E 4L4VE 5HGDB 3EEGA 1OLLA 2YD0A 1Z0NA 2MIZA 1OAUL 1Y18B 1EJSC 2QUTA 4YXHH 1OZTG 3S36H 3F7VA 1L6GA 1BZ9B 3CFEA 1U3ZA 3ITCA 1IAII 1XPGA 2Z7ZA 3ZE0E 2BNRB 1VBJA 4B9GA 2HPMA 2XBDA 4AEEA 4XD4A 3QK0A 3V0AC 4LO9A 1R0AH 1CD8A 3S34L 3G1YA 1VH7A 2BSSA 4ACZB 2VDPH 4PJ7F 4Y7MA 3VI2A 3QEQA 3VOGA 1FORH 2XNAA 4IIDA 1MHHA 5KMYA 1KXTB 5EO0B 3FQWA 4OZIA 4LLMA 2WMIA 4GUCA 2EECA 2EZ0D 3BO8B 2JKXA 4Q9QH 3FQTB 3BZJA 1PFCA 5F7BA 1RQEA 3QS2A 5HJ3B 3CN1A 3EH1A 1M2VB 2OS7A 4E5XB 3IJ7A 3B83A 2R56L 1ZAIA 5C2CA 4XWGH 4PMDA 1V6YA 3FUDA 5D2YA 4Y8AA 3QBTB 1B4JH 1HJVA 4I77H 4A3QA 4R27A 2RACA 1BXAA 4ZMNA 5DFVD 4JFDB 1G6RH 2XWRA 5KITA 3U2SA 2IALA 3Q2CA 2BP5M 5AHEA 4R2GD 3CT2A 3IM1A 1HKLL 1XEUA 5FS5A 1Q13A 4MNKA 3NDYA 4UNUA 3DA0A 3OB0K 2WVVB 4YX2L 4D0BA 4Y96A 3K3QA 4QOKA 1XRVA 3BZ4A 5KTEL 3AHXA 3VXMA 3UGEA 3LKOB 3QUMH 1H2JA 1MHEB 1XO8A 4AL8C 3X13B 4D7BA 4ACPA 3GNML 4DBDA 2A2IA 4RK8A 4HU8A 4HCRL 4FXLA 4N8CL 3WTTA 4QNEA 4Y9EA 2RBLA 1SLWA 3WFHA 2VELA 5AW4B 3DROA 5IV2A 4DP4X 5CIPA 4MXQD 3QC6X 2E9LA 2EDBA 5C0GA 1K02A 4F2EA 3GXUB 5HAOA 2V2TB 4Z3EA 2OMYB 1PX3A 4UIOA 5BOJA 2P5WE 3UXLA 2A0LC 3GB6A 3ALGA 1JI1A 2ZJSL 1R9ZA 3BP7A 4PWGA 3LXBA 1I4NA 2VLKB 5JR1H 4NQCA 1BJMA 3CZLA 3THDA 2DEWX 1P4LA 3I50H 3GBNL 5HGAA 1MCEA 2ZKWA 3GDKA 2IGFL 3QWOB 5E1AA 4FXKC 1MCSA 2IPFA 1PDZA 2POTA 4X80H 1KBKA 1MG3C 1MPAH 1KPRB 2A6NA 2XTKA 3MXWH 1EGZA 4C65A 4K15A 1N6QH 5GGTA 1VEOA 4HZAA 1A7QH 4A1RA 4OJFH 2GUUA 3ARGC 1P6CA 4RJEA 3FB6A 3PR2A 4P0DA 5C5YA 2I27N 3CTTA 2O9OA 3RWHB 3EOBB 3DSFH 4K7PL 2CM5A 1KTKE 5I77A 3TGXA 4XPFL 4PJ6A 5DJ6A 3AYTA 1OC5A 4KOBA 5DR5L 2VRAA 1V8HA 4U7MA 4JGNA 1BYOA 3WEXA 3B9VA 4ZNCD 2QHRL 4JDZA 3MLTA 4Z2JA 2NQJA 4NRYB 3PQYA 4N6RA 4L1WA 3AMDA 1DEDA 3X1FA 2OXNA 3AWGA 1DBAH 3LSOA 3SE3C 4F8PA 5J89A 2YPKB 2DWTA 4ICWA 5D4YA 3HS0B 2ZIDA 3ESOA 3OJ2C 3SKOB 2MQ0A 5EBAA 2MNWA 2DN7A 1BFTA 5EFIA 3FO9B 3UP6A 3GHUA 1XGQA 2ZWZA 4O02L 5EO9B 2NQCA 1JWUB 2V17H 4NO2B 4HLZG 4M19A 4D6CA 3EYPA 3HTLX 3M17A 5IHZB 4D8PA 3HMXA 1R2SA 1XS2A 4IDLA 3TTEA 1E4HA 3VFMB 1OD7A 1JNHB 2MNJB 3T9PA 3LZPA 4YDIL 4F2FA 4LOUC 5GS1B 3D3AA 2WZAA 3VA2C 3EOLA 1FL5B 4LRNH 3L3OC 4DIAA 1FDYA 4ZCWA 3CSFA 1XFCA 5IVZB 2CXKA 2OV0A 1C8VA 2V9RA 1N8WA 4H19A 3PWUB 1DJXA 4A67A 3LIZL 3U2ZA 1MJUH 2Y1AA 3KPNA 3WAJA 1B4KA 5MERB 5IBUB 3BEWA 4TLSA 4Z7QB 5CCKL 4M24A 4JFPB 5D6CB 4JFEA 5GRYA 2MHAB 1JAKA 1MRCL 3UO8B 3UPCA 3NJXA 3EGXA 1SOKA 2BIQA 3MGAA 4F2UA 1Z32X 3IK4A 2AXJA 5B7MA 3V8OA 3QY7A 4U1HB 3IN2A 1SZRA 1DBJL 3C09C 1S2EA 4Y6GA 3S5SA 2QNEA 1ZLWK 1LEKB 2X16A 1FCGA 1XXXA 3ES6A 3GFXA 4IFKB 1N5AA 4G42B 4HKPA 4FPSA 1W9BM 1F4WH 3KL5A 1MJJA 1CXKA 5LGHH 1KLGB 5AYQA 4P05A 3BAYA 4HIXH 4F7EB 4HV8A 4P5TA 2BB0A 2YKLH 1G4EA 2PF0A 1RJYA 2ROXA 5BRZD 1G9ML 1R9XA 1U8HA 1RV8A 1AR1D 2R2EA 2ZX9A 1P9MC 4R0LC 2YZRA 4XP6L 3VXNB 5D72L 2Q8AH 3REQA 3ILQD 3GLDA 2FECI 3F5JA 3F5WA 4NL1A 4L9DA 5ISZD 4P5MB 4M4RA 1O7DE 5DD6B 5D6DA 5GGUA 5EUOF 4R4FH 3NZ8B 3OBKA 4EE9A 4QRTA 1SJHA 1JMZA 4XB7A 1SO6A 4JXCA 2FIQA 3TZVD 3B9EA 3RL1A 3O6CA 4LSUL 5JQ6H 2MOVA 1NAL1 4PMUA 1AKJA 4GUGA 4BWTA 1IM3A 1SJAA 4HJEA 4JLRA 1DWHM 1AZUA 1NARA 2CZEA 3QEUA 2CGYA 5JHLL 5T1KB 5C0IA 5FF2A 4QDPA 4LXFA 2JQXA 4FXSA 3LKQB 1A4JB 1HN1A 3UG3A 1UYQA 2NXYC 4ZTXA 1YMMB 2EXOA 1I1YB 4JN8A 4NQVA 1EVUA 3FO2A 4LARL 2PN5A 4GH3A 3EYOB 4B60A 3SPHA 4JJHA 2GKIA 4QXIA 5IHUL 4PWJA 5E51A 2OMUB 4P3CL 4BINA 5AZEH 3UR2A 3PHAA 3WN5A 4CQBA 1J5OH 2QVKA 1FNSH 3JWOC 2WXFA 2Z00A 4RX4A 3NZGA 3MV8D 1UCTA 1J9CT 3K2UH 2VUKA 2QVHA 3D9AL 1DVSA 5AEAA 2OX5B 5D7LA 2Q09A 5DVMA 1T6VN 1Q65A 4ZPVA 4TUKL 3QZWA 2OOGA 4IMGA 1S7QA 3APMA 3FTGA 3P6LA 2ORBH 3TX4A 3GH7A 4HB7A 4LF1A 1E1EA 4PEKA 2NW0A 5MI0C 2HXTA 3L1OH 1ETZB 4JW3A 2CO7B 5HPOA 2OJZL 4IGBD 1A22B 5D1QA 1TTQA 3HA1A 1RERA 1UA6H 4PGDA 1W32A 1HJCA 3K8LA 2F7PA 2YD9A 1NGPL 4LVEA 4OJAA 3KVDD 3W56A 4G5ZH 3HTWA 2VLJA 2BY3A 2IG2H 1POKA 2X6MA 4KX7A 3RZCB 1ZJAA 3TNNB 1Z5HA 3PGFH 1D2PA 2ADIA 1UQSB 4JGUA 1QD0A 3VKDA 2BXVA 3SADA 3O8XD 1YTEA 3KYMB 1RPUA 2J24A 4UDTB 3DU0A 3O6FC 3UYRH 5J56B 2E8YA 2Z25A 4YZFE 3F8UB 4C1KA 4BD4A 2X7WA 1GY2A 4DZBA 2OQJB 1J96A 2ZUYA 4RZCB 4JREB 3IKCA 3W5NA 4W9DC 4PD4K 2WJ7A 3LQMA 5E0FA 4INFA 2QHAA 1A14L 3BVWA 4H5SA 1RSYA 5E9XA 1Z9SB 2EXYC 3W28A 3ES7A 4IIHA 1Q9LA 4V2XA 4XOAA 2WIIA 1FIEA 5H37H 1BTMA 4H2AA 1F45A 2R1XA 4XPTL 3VIKA 3SCRA 1EJ8A 1JSYA 3KBEA 3Q4DA 4NBZB 5JDJA 2WQRA 5IB3A 3QI9C 1FVDB 1FVEA 3HC0A 4LPTA 3GSWA 4HPHA 3JU2A 2FZMA 4G7YH 1TX0A 4P2RA 3T77A 3IJ6A 4BZ1H 2FYYB 4HZ8A 2PYED 3G04B 4QQUA 5EBGA 2J27A 3V5KA 4YC2C 4UANA 1XIDA 4L8DB 2DTMH 1R5VA 4LCCB 4UB0H 4OKVB 4ZS6C 4LS1A 2H3NA 4PTWA 3K1KC 2OTWA 2MCG1 3H3PH 2YEQA 2IAAC 2D7PA 3U2IA 4FERA 1CXEA 2OR7A 4KDTC 5K9CA 2CNZA 1OF2B 1GKOA 4BJLA 4X6FA 1BJ1J 2DZEA 1DANU 3VSVA 1ZS2A 4UQ3A 1CECA 4OIIH 2PGWA 3DMMA 1T7ZA 3BN9C 3DYMA 4OLEA 5C0BD 5IB5A 2Y1HA 5C08E 4U1JB 1QBBA 2RH9A 4E2OA 3IJLA 3CZGA 3JUGA 4JTAA 3ORJA 4HIHB 4XNXH 2FSDA 2G60H 5HQLA 1EOKA 1Q66A 2X42A 4JX6A 3DGCR 2JEPA 2F54D 4JKPH 4AYID 2RHEA 2KLTA 1M5WA 5DXXA 1U8JA 5HINA 4XBSA 5IW1B 4KMLB 4PGJA 4MBRA 1P1MA 5L9DL 2HQAA 4M8VA 1K5NB 1OM9A 4Z7OB 1P6BA 1A3LH 4XXCC 2OTUB 5DZOA 2VDQH 3FK4A 3B06A 4UBDD 2VFFA 2NNRA 1ZDSA 2NUPB 1X4XA 3ISRA 1BREA 3QXVA 1QATA 2XUCA 1BFSA 2O61A 3SDXE 4Y90A 1HHKA 4ZD3H 4E41D 2ABBA 2FSEA 2AV1A 4REQA 1RZ8B 3IEAA 3W7OA 5LNWA 3WEZA 4F7MA 3Q2NA 4BFRA 1L0XA 1SBSL 1U8LA 2C16A 5DUMH 4IX2A 1D5MB 3BW9B 4R7NA 2F53A 5FHAL 4MZYA 1MKFA 2B1AH 3TTOA 4MB1A 4N2NA 1VPQA 3ROOA 1WOAA 5ADPL 2HYMA 5IRPA 2GBVA 2ZWSA 1KJ2B 4D7PA 4NSKB 4UUJB 3CFQA 3LDBC 2R24A 5FYLL 4EXKA 2H26B 4J2PA 2X8RA 4LCUA 3QGVA 5IB1B 2JCCB 2H1PL 1GVYA 4PCKA 5AALA 3LBMA 1TJXA 3IF1B 2FHCA 3NGBC 2WUBH 4IQDA 2GW5A 2GHWB 4JR9H 3R8BB 5FESA 3RR4A 1JFQL 2Z6JA 1GGTA 4PMNA 2CERA 3W57A 4MB3A 1YPIA 4U7KA 3EYFA 2NY0D 3RKPA 1CF8L 1UB6A 3IDIB 1BF2A 1WXZA 1NDYA 4WO4D 4YPGB 1E9YB 4EXQA 3SN0A 2ARJA 4H7CA 3KHJA 3RNKA 3I65A 4NFDA 1BFVH 1FN4B 1XR9A 2OODA 2V2XB 3VCLB 2VZUA 2W0FA 4XV0A 3WTXA 4HPGA 2PCEA 5FF4A 3U36A 4XGZB 3O0FA 2Y25A 2GABA 4H83A 5I66B 2VWEC 4ONHB 4JJOA 4FN0A 1K3UA 1O5RA 1Z9OA 1ONQA 3EJTA 1TIMA 3GLAA 4C7FA 2OP4L 2B4CH 5MP6L 5A40E 4A2DA 4LDEB 3B40A 5TIMA 5FW8A 3I6SA 3QJHA 3GSQB 5IK3B 4QNWA 3VXSD 1PZBA 2V5RA 4JTGA 1UM6L 4MWAE 1NCJA 1XGZA 2P3ZA 4MB5A 3WNJA 2DVXA 3TOPA 3HR6A 3O4LE 1IFRA 3F2DA 3MW7A 1RURL 3O3DA 3DXAE 1KQZA 1GMEA 1GZHC 4NO0B 4POZC 5BV7L 4IMKC 3MNDA 3ZE1E 4I5BA 4AF0B 5I26A 4RX0A 1QFUH 1K4CB 4MXWL 1FNEA 5I1JL 2BJMH 2AQSA 4MCYA 3O11A 4WOZA 3WJYA 3VA6A 1NDWA 1EERB 4AQEA 1IVTA 3VKBA 3W1AA 2B3IA 2WM0A 3HQNA 3WFEH 5TE6L 3RWDB 5ERWB 5CZJA 7ODCA 2BNJA 3V4LA 1DDTA 2IAMB 3RMJA 1HU8A 2YKKA 2D20A 1FL3A 4ZQKA 1N8IA 1A0QH 1ZUAX 1HAWA 3Q58A 2BGNE 2CWNA 4EIGB 3SOTA 1Q63A 3B1UA 1AKJD 1A8ZA 2FCBA 4UFIA 3CHPA 5EPMA 3NPXA 4YXHL 4PRAB 5FACA 3MSYA 3W25A 3S36L 4U10A 3OA3A 2YAEA 4YIQB 1F86A 1BLIA 2GLKA 4PRWA 5FOOA 4RNIA 2XICA 3FHQA 3ZZSA 1MY7A 4W8LA 1R24A 4MA1C 4Z18A 1WEJH 1V3IA 1R0AL 4ZZFA 2VDPL 4KRTA 4DYKA 1S2TA 2NX5A 1RJCA 2CM6A 1FORL 2ZG3A 1HP4A 5GSRA 4JR5A 3A3WA 2WJ5A 3RR1A 4OCSH 2Z3FA 3EWCA 2AC0A 3MOAH 1PKQA 1MLBA 3EOYG 1GYAA 2IDFA 4HUCA 1Q1JH 4TLTA 3T7VA 1I4FA 3LGDA 1M71A 4Z1YA 3RWFA 5I3GA 2Z91B 2CWRA 4PH6A 4Q9QL 3WL9A 4QTFA 3LZFH 4F9DA 4RH4A 3SDDC 1WWAX 1FZOA 4TUFA 5EU5A 3WQOA 3MUJA 5KJRH 4XWGL 3NXLA 1TFPA 1B4JL 4I77L 4JY6B 2CUAA 2GTWA 2X88A 3VFNB 1N0XH 1HQ4B 1P7QD 5GISH 3M1BB 4I3RH 5D7JC 1WC7A 1JPDX 3TEXA 2KMWA 3UGRA 1R3KB 3FB5A 4YYFA 4KKAD 4P2OC 4KI5E 3EMQA 1ZMYA 4U1NA 1NWTA 4MRBA 3G2GA 1WQ5A 2GGGA 5AYBA 1MRFL 3NSFA 1PLGH 1W6TA 2MTAA 1E67A 4JNXA 3KWXA 2RAMA 4LRSA 2GVJA 4Q52A 2C71A 3FUNA 3QUML 4GRSA 2J55A 3ATFA 3HMCA 2V30A 4X5WB 3B5TA 3RX5A 4A6GA 5DMJB 2VWSA 4GOSA 4WVXA 3TLRA 2X9XA 1A4CA 4GKNA 5FA4B 2E7BA 1YPXA 4NI8A 4HJ0C 5LIWX 5FF0A 3E9TA 3IRCA 4GI9A 1KFJA 2I16A 4M8RA 3G0SA 5BZZA 2E4FA 1SVCP 4MDJB 1C08A 4S11A 1F5WA 5HHQA 1Z9NA 3AXIA 2XQ0A 5EZPA 5ECGA 1TJHH 1Z1WA 1NBYA 2HT3D 3W1UA 2CLRA 1EAQA 3K72A 3HKZA 2WD0A 2VVSA 5JR1L 2XGIA 3T8XB 1YUHB 1RA0A 3MC0A 3I50L 1FNAA 4BFIB 3LDVA 3HB9A 2FR4B 3IDGA 3C87A 4P59H 3B2MA 2A74B 5HDBE 4X80L 1UZ1A 1EEQA 1MPAL 3QYCA 1UIPA 3CQJA 3MXWL 4HMEA 3UIYA 3HZKA 1N6QL 3RB5A 4HS8H 4KROB 1JTTA 1A7QL 4OJFL 4YK4C 4B5NA 1QLFA 2J77A 3HBLA 4OLVH 1UZ6E 4JO2L 1J5DA 1LE5A 4BQ3A 2BHUA 1OFEA 5HHOD 1AGBB 4PL1A 4ZK8A 1XBYA 3SEPA 2VM8A 2OG9A 4JGDA 5DGRA 1H6EA 3WNOA 1QHQA 5HYIA 2EE3A 1MDLA 5HDWA 3ULVE 3NZUA 4MJ5B 3FOLB 4U0RC 2BP1A 3NIYA 2X2GA 5C0NC 3HC4H 2IFGA 4H00A 2IADA 1DBAL 3QQWA 2YCEA 3ERXA 5EZOH 3DYPA 8XIMA 2YEZB 4IT1A 1RK1B 3BKML 2B9AA 1D5BA 3SBWC 5E9DD 4AM0A 5DQJB 3O9NA 3MXVH 3H7LA 1OTUD 3F7YB 4LW7A 2V17L 1M42A 3SI9A 1N8FA 1GYCA 3C60A 3C9NB 1AGEB 1JCYA 3CX2A 5EZLB 3Q67A 2J7FA 4EI5B 4JTJA 1VACB 3V5OA 5LHDA 1HF6A 5GS0D 1F97A 4IMAA 5F1UA 1E1CB 3QFJA 2XPZA 4GD0A 3ALPA 5D5ME 1IWPA 4LRNL 4QLWA 4FHBD 4EQ2A 4A2SA 4UOW0 1IC5H 1X6NA 4H8HA 2F8QA 4WHDA 3LEXB 2Y8UA 2NVDA 4X99A 5IF0A 2XJLA 3FT2B 3PAUA 1ETA1 1MJUL 4PVNA 3VRJA 3DOSA 5F1SA 3ZMRA 3QG7H 1VF8A 4DJFC 1VC4A 5AW8B 2K3HA 4YLBA 2XIDA 1BIIA 1EJFA 3BW4A 4PTUA 5KSWA 3GLZA 3VFPA 1TPWA 1XGRB 4NX5A 4QRRA 5KVGE 3K6OA 4ZT1A 3H24A 4CRPA 4YGVB 4RDQG 3NPUA 3C3NA 5AUMA 2Q5BA 2X7VA 1IEBA 3WHXB 2JSFA 5CPOA 3VRLE 3UT0A 1U3NA 3DVNA 4Z77A 1F4WL 5D8WA 2ZT9C 3THUA 5CG0A 2PD5A 3ZTJH 4HIXL 1VENA 4JM2C 5KN5A 3S3PA 3HB3D 4K3JH 5IJVA 3UTSB 1FHUA 4NI6A 2YKLL 4J6IA 1CDUA 2H7WA 1YY9C 4HMCA 4AX7A 1DE5A 2XWJA 1S9WA 4PRBB 3PV6A 1NGXA 2BNQD 3REVB 1NINA 2VDNB 3NMEA 1LL1A 1KB5B 2GQAA 4HPJA 2Q8AL 1E8WA 3VXUE 1P5UA 3FT4B 1X7IA 4H6KA 1I7UB 4R4FL 4W68A 1O7AA 3VFRB 1GS8A 1XLCA 3GI9H 4P46D 3PG9A 1A6UH 2DKSA 4FTVE 2GI0A 5KVEH 4L6DA 3PAYA 5JQ6L 4JKNA 2Y0SA 1LO5B 5E9AA 2X3AA 4I13B 1J12A 4J6RH 1EC9A 5DLLA 4GXWA 1AGFB 5JLZB 3MTWA 2J8UA 4PRHB 1IAKA 4P5KA 1U58A 2DZVA 1TYJA 3PAVA 4HT3A 5A2LH 1H50A 3D69A 2D4DA 2HJFB 3FNKA 1XIWD 1YEDB 2CCVA 1PQZB 1W1IE 3WFCH 3Q7JA 3N0PB 3ZIZA 3SGKA 3IJSB 4PLKC 2DQDH 2CE6A 2X9YA 4U2ZA 4YHPA 2HS8A 1TWZA 1MCQA 4JFHE 2A21A 4AIZA 3DDGA 4BDVB 5AZEL 1K03A 1KFKA 3S3SA 1J5OL 4TM9A 4JD4A 3CC5B 1BYBA 3OWEA 1FNSL 2V0AA 5D2XA 2E9IA 5CCGE 4X9BA 3W2UA 4D1IA 1DQVA 4Y2DB 3K2UL 3KPRB 4B3EA 2PCQA 3GQYA 1JN6B 3RRXA 1JCNA 1AGCB 1RUMH 1VKXA 3QQ4B 3HMJG 2BOLA 4ECLA 2K0RA 2ORBL 2WQAA 3TFKC 1NBZB 1PYFA 4GXVH 2ZCGA 4CBPA 3L1OL 4MAYD 1URIA 2AJZB 4AQ1A 1LOSA 3R89A 1UA6L 1XDTT 2X70A 3QO0B 5A3IC 4G5ZL 4UAOB 4UQEA 2BTMA 2HBVA 2IG2L 4BY3A 1RZFH 1FRGH 2GSGA 3S3JA 1SDDB 3L21A 4FZ8H 3UTPE 4M5TA 3VH8B 3D3VE 1Y07A 3WD0A 3PGFL 4FG6D 1S2CA 1QZ1A 3N2CA 5CG7A 1HESA 1ZP4A 4AIXA 3CUPA 4MHBA 1NGYB 1KMGA 3NWRA 4P2QE 4I5RA 4CD5A 1M7PA 2CA3A 4Y4KD 3UYRL 4GZJA 3L4UA 1MWAB 2AJXH 3WY3A 3FTZA 1VYSX 3W7DA 5PCYA 3N2BA 3DBXB 2C3GA 1AD9B 4ZOAA 4JTHA 2C7UB 4U1KA 4O5LH 3T0WA 4AHQA 5HI5C 3UTOA 5IROD 3M64A 1X8CA 1FWWA 1BGAA 2P7TB 3PWNB 1MFDH 5AW3B 2LGNA 3OA5A 3P8JA 5DHXB 5IM7A 3L23A 3HR5B 1UZ8A 5DI8A 1RBAA 1ONWA 1J18A 2YLLA 5JIWA 4PJXA 4WFFD 1DQDH 1I1AC 3CFBA 5CSBA 3GBEA 1B54A 3R7MA 2QHLA 4G7YL 3LPPA 3MUY1 1AXSA 4BZ1L 1FAIL 1AO7D 1YADA 1BD2B 1PWLA 3CK5A 3CSBA 5AHFA 4DEWA 4YEEA 3DX7B 2EDDA 4CKQA 4C6NA 3VI3E 2B4GA 1Q6CA 3BAEH 4QS6A 2DTML 5DEZA 3TQVA 4RBPH 4UB0L 5EMYA 1JPIA 1GTFA 2GBAA 4GFSA 4RDQF 3SY0B 3H3PL 4JFVA 1KM2A 5IIEB 4L4PA 3B8VA 1KIPB 5KYYA 3VU2A 1C93A 3QJTB 3WQVA 4PYHA 4PJ8B 4D0CB 2XVNA 3L5AA 5I6PA 3BVNB 3U9IA 3IVKA 3LSBA 1WIOA 5KZCD 5T3XL 4Z7AA 4OIIL 1IE7C 5HJGA 4W5ZA 3ZR6A 1PNDA 2XFXB 5L8LB 3PABA 1AI1H 4LUJA 4AEHH 3EG9A 1THFD 3MHZA 3VXRE 3ME0B 1NC4B 5TDNB 3VSTA 4XNXL 1DJNA 4FO4A 4QSHA 3KLHC 1QWHA 4OLWH 2NXHA 3DTUB 3I4EA 3AHTA 3O2DL 3IDMA 1RQHA 4JKPL 2VRJA 1OX4A 4QHNB 2QR0B 3WSQH 2XACC 5HYSB 2XZCL 3HFMH 4AX3A 5EC1B 4DWSC 4M4PA 2X6BA 4HULB 5D7IF 1A3LL 1XF5B 1OJXA 4G1EB 1JVOA 1V10A 4DXKA 3OSKA 4M7TA 2Y3NA 4S1QH 4LHQB 1HXJA 2JFCA 2MPAH 2DQTH 4LPWA 4KITB 4XZMX 4M1DH 3GSOA 3QDJB 4TX6A 3VXOB 4XXDB 1YNLH 3Q3GB 5AAWC 4PA8A 5HD8D 3LG3A 5CBEA 1ZQ5A 1E6SM 1CR9H 4BCZA 3LTPA 2VUNA 1VS1A 5LA1A 4BXVA 4ORGB 4RIRB 3FDWA 3P40A 4X2RA 4NQSA 2PMZA 4BH8B 4HCFA 1X5IA 2B1AL 5SV4A 4F4RA 3TJXA 1AFVH 5T3XE 4FMKA 4OIAA 1ZEAH 3T2QA 1EZWA 5E1IA 4DUWA 2VH5H 4ERSH 2WMPB 5I1GL 1QASA 2C13A 3PZVA 3WTVA 2E6QA 2Q1EA 3IIXA 4WQ6A 3L3IB 1KZQA 4XBJA 4UTUA 1UD6A 3E96A 4AC2A 3WEAA 3V0HA 3AMGA 5F6IC 1TT6A 2I14A 4HIQA 1IKNC 4BHYA 2CLZA 3SY1A 3EKLA 1WP6A 5FM5M 3QIWD 3NSMA 3F4NA 4Y9MA 2IMRA 2WUBL 5ISZA 5BZWB 3X3FH 4O1DA 4JM4H 5GGSA 3QZMA 5EEXA 3BW2A 4JR9L 3KFTA 5IW6A 1UQYA 3CZKA 5D9OA 3O05A 3GMLA 3C60D 4M5YH 1DBBL 2VDIA 3TZVA 5J5DA 3GJEA 4GH7B 3N5AA 5F0JB 3O45A 2HNEA 2QAFA 4XCCH 5I1KH 3POHA 2ICWB 2GAZA 1CDHA 4P9HH 5DHEA 2PW2B 2F7RA 3BSGA 1F41A 2XZQH 5J9PB 2H3DA 5E6SB 3VE7A 2WWKT 1RZJH 5ID0A 4UAHA 3KX6A 3CHDA 3O06A 1BBDH 3RGVC 2DORA 2H9AA 1MCPH 4DZ8B 3GSVB 4LLDA 3MYJB 1F74A 1N7KA 4B9ZA 5IREA 1N55A 1JF1A 4BK4A 1Q0EA 2L0DA 2FQDA 2B4CL 4O4VA 1S5NA 5H2ZA 4Z7WA 4U6HB 3FCBA 1NWUA 1EEXA 3MV8A 1MEXH 4ATWA 4W8AA 2ITDB 5J4MA 3B2UC 4FQQA 5DZAA 1HYSD 4Y19E 2HVJB 5A8QA 3URNA 4PJFE 1U22A 3AY4A 3R6IA 3NN8A 4FXFA 2X2HA 1NCDH 1CU4H 4LLUA 4GG6F 5EEZA 2DI7A 5FYJH 5GRZA 2FD6L 1AAJA 4DO7A 4PRIA 1BRLB 1AP2A 1TTJA 5BZAA 4R85A 4HMDA 4ZMZA 4E42A 4DPRA 1CFSA 1GVQA 1Q2SA 5I1IH 1DE4A 1QFUL 3U48A 1CG9B 1QU4A 1OYCA 2BJML 2G9HA 4K1GA 5B38B 2J9YA 2QGCA 1Q6FA 1IGIH 1NLBH 5M3WA 3MO4A 2ZOWA 2ZZ3A 4G8GD 5AL8A 4IOIB 3A12A 1OTSC 4ZX4A 3DX8A 2O9PA 5BVJB 4LNVA 3O8XA 4XC3H 2Y61A 4QISA 5BZXA 3SUTA 3OMNB 3TPUA 1A0QL 5AN7A 2IH3B 3FQ4A 3HV9A 3HUJA 4L05A 3PS7A 3DJRA 4G7SB 1X1NA 1AUSL 1NL0H 2XXCB 1RD5A 1BQHB 4L1SA 1KLUA 2F8VA 4OAWA 2FT6A 5FO7A 5FI8A 3G6JA 3CV5A 2E74C 1XGPA 5I16B 3P0XA 3UZJA 2XIOA 2WZIA 1FDZA 4W86A 4MS8C 1JGLH 4JX5A 1IT9H 3HS9A 3F6IA 4ZXLA 1UEYA 1G7VA 5DQDH 4PY8I 1PJ9A 1YBQA 3OG2A 3AAZA 3Q8AA 3SDCC 1QSEA 5KS9E 1DL7L 5FF6A 3FCPA 4BI5A 2MSPA 3NURA 2NWRA 3PXLA 1E5ZA 4QNPF 1S7XA 3KGUA 3B2PA 3FDGA 2DSVA 1F6LL 3MOAL 1HJUA 1Q1JL 5A6KA 4G6KH 3BV7A 3DI1A 3K8MA 2EYRB 4WSKA 4AYMC 3ZKXC 4ZBCA 2PYEA 3LZFL 3S1GA 6XIMA 5CGYC 1R9YA 1GHRA 1MCJA 1UWEH 1MCWW 4LJ3A 3BOVA 1MW0A 1WAWA 3IGKA 5FDYA 1BDYA 1EEZA 4XCEB 3B1TA 3L5JA 5D93B 5B1JC 2XWTA 5FDWA 1N0XL 3NH7L 4OF0A 3EIFA 4MXVF 1BZ7A 4I3RL 2QVFB 3BUPA 2VENA 3M86A 5ENLA 4TSBH 5JXEA 1CYGA 1JV2A 2QKIB 1IF2A 1UR3M 3U6RB 1UWTA 2ZKMX 2VISB 2F58H 2RR3A 1PLGL 2C3VB 3KHQA 1UKSA 1WTGT 4YTSA 5C0BA 1J5IA 2CLVB 1U8KB 1F6AB 1TVDA 2BV9A 3LMJH 3UZEA 1T5WB 1TQVA 3PJSA 1FL6A 4JS7A 1SMAA 2X9WA 3V6FB 5IB4A 3RVUD 4LKCB 4WV1A 3SE4A 3GDTA 4MKTA 4J3OC 3Q13A 2BCKA 3T0XA 2H9GA 4M5PA 2F54A 2E5CA 3ARDB 2DLFH 1KF9B 5FUCC 1EBAA 1S5HA 5DYOB 3EPOA 1TJHL 1TQUA 3W26A 3PBWA 4XN2A 5K69A 4FI7A 5I17B 3MRKB 4JRXB 4PD4J 5L8KB 4IJCA 2QULA 3GK0A 4I7VA 1LWJA 3B04A 2EDYA 1OAQH 1BD0A 2DLHA 3S88H 1DR9A 5EU6B 2EH7H 5FW7A 2Y5TA 4M8QB 5D38A 3IGLA 1KV5A 1FAKT 5INDB 4P59L 1KZYA 3OMIB 2QFRA 3ZW3A 4E41A 1YPFA 4LVNB 3ATDA 4DWHA 1JYNA 1S7UA 4XP9L 4YAQA 7TAAA 4HS8L 1IBHA 2FDMA 2GJPA 3U5YA 2DB8A 2EDXA 5FB8B 2C1GA 3LNGA 3GMOB 4OLVL 1NJ9B 2XIIA 4MVAA 4LEOA 4S2CA 1BFNA 4JX0A 5H94A 1ORSA 3N6JA 1NF0A 1M1SA 1QP1A 3CWHA 2GBUA 3BVXA 5KBMA 5CZVH 3FB7A 2L4OA 3LNIA 4EK7A 1HL8A 1TF4A 2EQDA 2QEZA 4NRZB 2M1KA 4OZGE 1Q9WA 4WIQA 2BVOB 4LVGA 3NG5A 3HC4L 2GVLA 4PGZA 3P2DA 4UQAA 4QRUB 2Z2UA 3MQTA 2UWEF 2YZ5A 5TK4A 1MUJB 3W7NA 2Y2YA 2WYZA 5JPMB 1DFXA 1T4KB 1EB3A 3R8RA 3MVSA 3L3GA 3U7VA 3MXVL 4WO4A 1HW6A 4BA0A 4O0KA 2D24A 3A4XA 4P7OA 4Y5XB 4XN7A 3N12A 4KUCF 3ZJ7A 1NDGB 4OGZA 3BKYL 5G5DB 2WNWA 3B7RL 3LBOA 2XI9A 2F8OA 2ZYFA 4FNTA 3R94A 2EKGA 1I7TA 1RLBA 3DX9B 4JZOB 1B6UA 3RKDD 2R94A 4GIAA 3HO8A 1RBLA 2W5FA 2IQDA 2W94A 3KOXA 3F12B 1IC5L 4Q4MA 2WXRA 4NNBA 2RGLA 4LNCA 1I8LC 5U7SA 1TWSA 4IEFB 2Y1ZA 2IWFA 3U1SH 5JNYA 3HBGA 3QG7L 3QDGD 2R1NA 1VJZA 3EJQA 3VXSA 1OC6A 3VFOA 4ILSA 5HMSA 3BPCA 4HISA 4MZ3A 5FEPA 4F58H 3L3HA 3WUFA 1KM4A 4JN1H 1VF5C 3WIJA 4F1ZA 4JUSA 4UTIA 2B16A 2W9MA 1HE7A 4H9XA 2PO6C 5DMGC 3MOQA 3PSWA 2Z29A 4PLOB 4V1XA 4GQRA 4HCLA 4KY1L 3UDWC 1FZMB 3O6MH 1TE1A 1CK0H 1QPXA 1QHZA 2XJ7A 3S35X 3MV9E 2YCIX 2QPEB 3LQZB 5IBXC 3PL6D 1FZKA 2D4FA 3OKEA 3CXOA 2DZPA 4YXGA 1I85A 4BSWB 3WKYA 1AHMA 2GVYA 4Y7OC 4K3JL 1YHPA 3RFZB 5KSAB 2ZA2A 1PVNA 1NFDE 4R34A 5H35B 3FUMA 5AW7B 3VRIB 4Y5YA 4HOMA 1UPMB 4DJDD 1OAKH 4QG9A 2GGIA 3KYNA 1U4EA 3DCPA 2DSZA 4XE5B 2VOMA 2BPBA 4UZGA 3AQXA 4F2MA 5D71H 3W76A 2XYBA 1IGYB 5TQ2H 4KERA 3IMRA 3GZOA 2O56A 1F3DJ 1P2CA 1WD8A 3GI9L 1A6UL 2OGJA 1U91A 2H2SD 4XWOC 3U4KA 5KVEL 4Z9KB 3IETA 2YD1A 5DS8B 3SRKA 2GSIB 1JZ6A 3P0GB 4J6RL 3FSVA 1UD5A 2CO6A 2V5KA 4UYQA 4KBPA 4XN5A 1NZRA 1L7IH 1Q38A 4JZJA 3EOUA 3OC8A 5LN8A 4JPIB 1L3WA 3NQVA 4KJYB 3TK7A 4YSSA 4GWEA 3MO1B 1O9WA 1YNTB 1RL1A 1JPSH 3WFCL 2WW5A 3TO2B 2Z93B 2HE8A 1DWAM 3RGBA 2ISVA 4TQTA 3RNDA 2DQDL 2Y7QA 2BSTB 4HIIB 2VERN 5AKRA 1UUMA 5DURD 1KCSH 2LU3A 3BGJA 2NOYA 1FZJA 1AZRA 4O1AA 5E5CA 5C0FB 3RFAA 4L9LC 3KZPA 4PRID 1P7QA 3PUDA 1CFTA 2R27A 5JXAH 5HGBA 1WFNA 3LLFA 1RUML 1TKKA 3T1WA 3CFKA 2V9QA 4NYLA 4UMSA 1EO8H 1W0WB 1XKYA 3HEIB 5ITBH 4U6YB 3P74A 3V0WH 4EANA 5TPWH 2XPKA 5BQ7B 4I3SH 1V05A 3TYFB 4GXVL 4RGND 2FIKA 4XMKH 4PS3A 2O72A 4HAGA 1MEWA 3I84A 1Q8JA 4O2FA 1T0NA 4NZUH 3NJFA 2H6RA 4IQHA 5T1MB 1F4XH 1WGVA 3QFDB 5KVEE 3S2CA 2DV6A 2X1SA 1KLZA 4Y4HD 2BIHA 2WTOA 3A3HA 4KEZA 5D2LF 2Q76B 1KCLA 2D9QB 3EXJA 8RUCA 3D2UB 1KBPA 4GXPA 5F0LB 1RZFL 1FRGL 3WEBA 3PPSA 4FZ8L 5J6GA 1P1VA 3GFUA 2V5MA 2FL5B 5FXCH 3NQBA 1D9KC 5IOKA 1BAFH 2BX5A 4PRDA 1ZT4A 3MJMA 4XP4H 4H41A 2VL5B 2W3ZA 4UTLA 4ZI8A 5I8EA 5DSCB 1K8DB 2AJXL 1CGWA 3KBHE 1ICSA 2WXOA 3VMPA 1GOGA 3TMQA 4O5LL 4AENA 4OZFB 1QSED 4RQQA 1PB0A 4IPPA 4WXYA 5LGJB 5SWZD 1LG2A 4PJHA 1JRHH 1E28A 3CTLA 1MFDL 5C0AE 4XNUH 3OIHA 1WX0A 5C8BB 1FVCA 3KD4A 1AW2A 4RMUA 4G8IA 4MJ6B 1TZ9A 4CD6A 2DSKA 1R5WB 3V6BR 5F2LA 1DQDL 2H8ZA 2RGMA 3RZCC 5HHOA 3M0HA 1A6PA 4KI1A 3GUGA 3KDMA 4KO9A 2DKUA 2ZRZA 5FYKD 4L4TB 5EUOA 4ODHH 3GMNB 3Q6GH 2ZUQC 3FU7A 4P23D 3ZUNC 1NDMB 2VAJA 4R4BA 3PNRB 3BAEL 1X5MA 1V7YA 5JXED 2RGSA 3QQ3B 1RHCA 3NO1A 2P0OA 3FCTA 3ECVA 4WDXA 2V3GA 3DOPA 5DX7A 1X97A 3UTQA 3TZFA 2DLEA 3G6LA 1VCGA 4B9IA 4JREC 3WMBA 5E9DA 1UWFA 2V5SA 4I0PB 2WCPA 4Q58C 3QG6A 4R8WH 4HTBA 2BERA 3N2OA 2BY0A 3SBQA 3HPZA 4X83A 2XKSA 4TUUA 2UX6A 1F2JA 5ITFB 5LKYA 3CU1A 3LB6C 4NO5B 3UTTE 3RJYA 4BFOA 2YPVH 15C8H 1NMAH 4AEHL 2XWZA 2FNWA 4HGKC 4HAKA 4JQAA 1TDQA 5IBTH 4F15B 1FH5H 2OMWB 2GBTA 1OVDA 1NMCC 1I3RA 1T0PB 4HZLA 2HMIC 2PDCA 2PW1A 1B0WA 4GK8A 4OLWL 1BF6A 2CGRH 3EYSH 2ZOOA 3CV2A 1EXUB 3EJUA 2G95A 5DZPA 5IG7B 2PYFA 5J12C 2AJUH 3F5LA 3QVQA 1L5GA 1U5VA 3NVTA 2DTSA 3M0JA 4XO7A 3WSQL 3OMAB 2UZIH 3S6OA 4LCCC 3BT2H 3HFML 3SPVB 2OKTA 4CGUB 3TU6A 4HIJB 4ZXBB 4U1LA 1U8MA 5AYXA 3CCHB 3ESNA 2VKZG 3WFZA 1YYAA 4S1QL 5HDQH 2AAMA 4A39A 3C6SA 4FCAA 4XBEH 2MPAL 2DQTL 4QGCA 4Z3FA 4GIPD 4IPNB 1OF6A 3SCMB 3FFCE 5C71A 2FJHB 1G7HA 4M1DL 4G9FE 2YL6A 1QWGA 1YNLL 2I9EA 1S7RA 1I9CB 2ATAA 1KEML 5MENB 1ZE3C 3HZVA 1CR9L 4AC1X 2NZIA 2R2CA 4IOSD 4UDUB 1KYOK 1PZ5A 2V81A 4YSRA 4ZFZB 1AFVL 4S1SH 1GYMA 1KB9J 5FECA 2ZOKB 1PJWA 5XIMA 1ZEAL 4X6DB 5I1AA 3ZLQC 1HHJA 2NY7H 4ERSL 1ONXA 4PULA 2WBWB 2Q9OA 3BRDA 1TJIH 3LRKA 4AYDC 1SXZA 5GZOC 3O7UA 2EXWC 4BGDA 4AJVA 1N8OE 1TLMA 3DVFA 2WC3A 2XWBA 2EUXA 1NFGA 3FFDB 1RUSA 2BNQA 4JKLA 4HOXA 1YTDA 2X2IA 4JIRA 1QFEA 5K1NA 1RSCA 2ICWI 4LLYA 5B39B 2CUMA 1EAJA 1JZGA 2B77A 3MANA 4Q6IC 2G9KA 2OLDA 3X3FL 4LYQA 4JM4L 5EBWB 5SWSB 2AKZA 1FGNH 4M5YL 4P46A 1DIOA 3L5HA 2XSXA 1L6XA 2RJGA 1ME8A 4GRWF 5I1KL 3NL5A 3OKOA 2IQ9H 3LZ5A 5KTLA 1KUMA 2NY4D 3D48R 5IVXB 3VW3H 2XZQL 1Q45A 4FP8H 1M2OA 4HJFA 2YBVA 4S3AA 1XIWA 1EHAA 2EKSB 4M61B 4HS3B 4DY1A 4RXGA 1RZJL 4HSOA 1GS6X 1OCRB 5DMKA 2UV8G 3AG1B 1BBDL 1CD1B 1VAHA 3M6YA 1MCPL 4ONVA 4IW4C 3GHPA 5J04A 4OZ4A 2NNXA 4FL4C 4YE4H 1R6WA 2NY1B 3FSOA 4QHLA 2JKEA 4BSJA 4ZZ9A 1IC4H 5FYLE 4XZ4A 2NY6C 4A3HA 3SCWA 4PGCA 2XFWA 1XVSA 1YPZB 3RL2A 1MEXL 2CLHA 4GRMA 1AOZA 4PJAF 3SZKC 2KS0A 3LSCA 1BX2A 1T96A 2PDIA 4ZUWA 1DVJA 4IJTA 5D7KE 5J3HD 1T03L 3OU8A 4OLUH 1A6WH 4R84A 1NCGA 1VERA 5IMLB 1NCDL 3NSNA 1CU4L 4QTHB 4J4PD 4MNQD 2OZ3A 3E2HC 5FYJL 4GQPH 1SMOA 1XT5A 4XQ6A 5I3KA 2DMKA 4EIUA 3AIRA 4MAYA 1V27A 1PLAA 5CR8A 3BH9A 4OCYL 2JIWA 7PAZA 2LU7A 5I1IL 2OSLB 2X10A 3U79A 2CHNA 3UQNA 4WIWA 1IM9B 5T33H 3VI4F 1SQ2N 4LKXA 3JYCA 4FHJA 1T1WA 5IOPA 1NLBL 1QVOB 2BCMA 2QTEA 3GBDA 5I24A 5E6IC 1WKEA 4A7TA 3E3HA 3DETC 3LRSB 1H19A 4G59C 3ZYJA 1M7IA 4R6UA 5FCSH 1KRCC 2GTZA 5LHEA 4ZZKA 3UTZB 4UINH 4Y4KA 1NL0L 4XAGA 4F9PC 3JZ7A 1Z0MA 4Z7NF 4KJQD 3B6SB 1XFBA 3AU6A 2X5PA 5IROA 3H55A 1JGLL 1W3HA 4TIMA 4ZNEE 1IT9L 2L7JA 2B08A 4NF7A 1LL7A 2GJXB 1HE8A 5DQDL 3WG6A 1EDYA 1H8NA 3W24A 3WS3B 3O4OB 4NIKB 2P8MB 1VIWA 3TJEH 3GDRA 3JVFC 4M6PA 2X1PA 2PD9A 3P3SA 2QQNH 3WE1A 1KA9F 4IRJB 2GITB 2HFGH 4S3JA 5SX4H 1K5WA 4F5CA 5AOZA 1NIAA 3QA3B 4NCC1 3MCKB 2VVNA 1TWDA 4IIGA 2MMXA 5K9OB 5E2TH 1S3HA 1CXIA 1AO7A 1K2DB 3CWGA 4IMCA 2CHRA 1DQQA 2BM3A 3WGUB 5ENWA 1G6RL 4PJEA 4LAUA 2DGAA 1UWEL 4KWWA 9RUBA 3A22A 2HG5B 4P4KC 4UOW1 3D06A 1E71M 1LO3H 1USQA 3RUGB 4AJ0A 5F2IA 1S7WA 3PWPB 4KUCD 4I85A 4TSBL 4MJ2A 4D0DB 2F5BH 4APXA 1B4RA 3KXFA 3EOEA 1JUFB 2VXTH 2F58L 1HDMB 3RWIA 3ZJKA 4L4VB 2PLKA 4M1CC 3B3BA 4DUVA 4MLJA 2AL1A 3I9IA 4W6WB 3UF9A 1YDYA 2WANA 4MPQA 3TEZA 3KTSA 2J20A 3OQ8A 3CASA 1WFUA 3LMJL 1G6VK 2NVCA 1L7TH 3ZE0B 4G3YH 1VCFA 1BQSA 3WH8A 4XNZC 4RETB 2XHNA 4IBUA 2A4ZA 1D7BA 3S9ZA 4R7XA 1AGDB 1H7RA 5KUMA 1GGBH 3CIVA 4KKCD 1QG3A 2DLFL 3D30A 3DSNB 1VFAA 1EJTC 2VDKH 3KLQA 4GW4B 1U92A 1MG2C 1TO3A 4R96A 3VFWA 4NCDA 2N0KA 4Z17A 4DIXA 3PUGA 4I48A 1U3HB 1OAQL 3TDFA 3S88L 3P9MB 5EB8A 3ARBB 2EH7L 5FM5O 5C0CD 2Y5JA 2A3TA 3CN2A 4AY8A 1RVFH 5FOBA 5CUSH 1ZENA 4C56D 1LT8A 5IJKA 5DCCA 1QTPA 3ANVA 1GL4B 2PKDA 2QADB 1HZYA 3T0ED 3DSFL 5HDLA 4K7FB 1NP0A 2AQWA 4G5DA 4E36A 3M88A 2F74B 1PZUB 3QJAA 3GRWA 1CI1A 3GNRA 5CLYA 4B16A 3NR0A 1OSZB 4ZUSA 1T5XA 1WO2A 3KGTA 4AXNA 1XH3B 2Q01A 3BAIA 2DY2A 4U4IA 2V5BA 4UQ2A 2GQHA 1UB5B 2ZNWA 4DJMA 1RVGA 1UENA 4V2BA 2PPFA 5CZVL 3ARVA 2GY5A 5F1IB 1CPUA 3VDHA 3FU3A 1IXNA 3O3BA 2A6JA 4ODWB 4HP5A 3BGGA 3UNTA 1YY8B 3MVTA 3N1GC 5AG8A 1KCXA 5H8DA 3BOXA 3TCSA 4AYFB 3QIWA 4FEIA 2VITA 2CZDA 3KL0A 2DMHA 5KBNC 2L3BA 3STPA 3C61A 4BKSC 3MZ2A 2PAJA 4PRNB 2ZDSA 4NCC2 1U8NB 3ABXA 4NUGH 3PJXA 1U8PA 4KROC 1UWIA 3E6HA 5DO2C 4PC8A