3IJ8A

Directed 'in situ' elongation as a strategy to characterize the covalent glycosyl-enzyme catalytic intermediate of human pancreatic a-amylase
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Directed "in situ" inhibitor elongation as a strategy to structurally characterize the covalent glycosyl-enzyme intermediate of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 180
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3ij8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ij8A01
1WKYA 5BRQA 4QLLA 4UFMA 4FLQA 1KGUA 1XCWA 2V5DA 3F4VA 4NRRA 1EH9A 2VZVA 3B9EA 1WDSA 3PHAA 3TA9A 2XVGA 4IISA 1EO5A 1QW8A 5IXEA 2J7GA 4P8VA 3GXMA 1JAEA 1E5NA 2D0GA 3GH7A 3CHFA 4TVCA 3UCQA 2YIHA 2E40A 1B3VA 4ZEPA 2CHNA 3WDJA 4HZ8A 3GXIA 3LX9A 1IV8A 3WNPA 2OYMA 2O9OA 2FHBA 4U3AA 1I75A 2X8RA 4ATWA 2D1ZA 4GQQA 4MB4A 3SCPA 3VIGA 2F7RA 1NWUA 4F9DA 3SCRA 1W1YA 1KFWA 3W81A 4U3CA 4YHGA 3A47A 3VIJA 1EXPA 3BUDA 4XZBA 1HIZA 2ZX7A 3MU7A 4PN2A 4WK9A 2W66A 1JDCA 1V3KA 4ATDA 4PTXA 2WWCA 3CMGA 5JBFA 4NXSA 3KL0A 6A3HA 1QNOA 3WQ4A 3S6TA 2G4FA 3WDQA 2CHOA 4J7RA 4OIFA 3B9DA 1J10A 1UASA 3PZNA 1BVNP 2G8ZA 1WB0A 3KL5A 5HPOA 1V3LA 4KRUA 1UKTA 4J3SA 1HF6A 4RE4A 2OW6A 1UD5A 4P7LA 2BNJA 4BA0A 3PTKA 3AIQA 3D51A 3VIKA 4WKFA 1C8XA 1UD2A 3BMVA 1G1YA 4AMXA 1UR9A 2AOSA 1XSJA 4PSRA 1XV8A 4Z2IA 2G3MA 2X2HA 3K8KA 2E8ZA 3ZJ6A 3RMEA 3IJ8A 3DX3A 3DDGA 1W3LA 2XSAA 4WIWA 1QHZA 5CGTA 3AYRA 3DC0A 3WY2A 1EDTA 1H09A 1PZ3A 1GHSA 2WLZA 5A8PA 2X0YA 1GUVA 2BVTA 3SCSA 2VZSA 4OJYA 2VQUA 2D24A 2WMGA 1JNDA 3AFBA 2UY4A 2XYLA 1S46A 4LQ1A 1OIFA 3WSUA 1W3KA 2GFTA 4UR9A 3UG3A 2O9PA 1C92A 4U5IA 1V08A 1C90A 1HJXA 2YKKA 5FIPA 3WMSA 1R47A 3MMDA 2WBKA 3AHZA 1WE5A 2VZOA 1FH8A 4XUYA 4FNQA 4LX4A 3VD9A 4UFKA 3VSUA 4J3TA 3AMGA 1BHGA 1GJUA 3DECA 2NSXA 2C8NA 3BAYA 3DHPA 2HISA 4GI8A 5A6AA 2WMIA 1MXGA 4AEFA 3OZOA 3PZGA 1OGGA 1Q6DA 2FHCA 1OCQA 2VRQA 4UOZA 4PYSA 4A4AA 1JZ4A 3BAWA 2E9MA 2NW0A 3CIVA 1EQCA 3SCQA 2X05A 3WDHA 1UWIA 1MW1A 2D2OA 4DO6A 3BXWA 5AC5A 4BQ4A 1SYTA 1UZ1A 2A3CA 4JCMA 2F1BA 2YBUA 1K6AA 1B31A 1WDQA 1HP4A 2X2YA 1V3IA 1W9UA 2OWCA 3ZJ7A 4JFUA 2WC7A 2ZX6A 5FL0A 2QMJA 4BS0A 7TAAA 1E4IA 1UH2A 1IT0A 1FOBA 3AMDA 2D0HA 1TCMA 2G3IA 1V6WA 3FHQA 3PZTA 4OBRA 3BUQA 2D22A 2W67A 1VFFA 4AZIA 2JALA 1E1FA 1DHKA 1PIFA 4NI3A 4CD5A 2GK1A 1BVZA 4Z2LA 4XZWA 3N18A 2EPMX 4MJ2A 1N82A 1UZ4A 3RM9A 1BF2A 3VOCA 1UD3A 3WMCA 2VNCA 5FOOA 3PN8A 1C7TA 5D4YA 1VIWA 4P7QA 2DQXA 2WM0A 5I78A 2EBNA 3VINA 1BYCA 2WK2A 1M53A 2X1IA 4S3KA 5A1AA 3OBAA 2EO7A 3WH9A 4F66A 1ODZA 2C0HA 2IXVA 1OGSA 1B3WA 1B0IA 2EAEA 3MUY1 1PBGA 1UR0A 1ISVA 1NWSA 1UKSA 3RIKA 3RM8A 2J7CA 2CYGA 4ML4A 1DTUA 3MUIA 2J8FA 4PMNA 2XFYA 1FFRA 1MQQA 3A24A 2G3JA 4ZE5A 4Z2GA 2XM2A 5EBAA 5A94A 3BLKA 3ARSA 3VIPA 2Y8VA 4GPNA 3SUTA 1SMDA 1XC6A 3POCA 1E6RA 4TOQA 2JEQA 2VQTA 3T2PA 4W93A 3ZIZA 2EPNA 2QPUA 4X0NA 4OKDA 3K8MA 3T09A 3AHTA 4FNSA 5ABHA 4H8UA 1CXLA 1KTBA 1J11A 5A8OA 1GVYA 4MB3A 1UWRA 2WCGA 2YFOA 5CGMA 3OB8A 4HTYA 3PTMA 2W63A 2JFEX 1Q4NX 1XH2A 2F61A 5GPRA 1R8LA 3U7BA 3OLDA 1UR2A 1QWUA 4XX6A 1V0MA 4W5UA 3WF1A 1B3ZA 1GVIA 2GDUA 4P7OA 4URIA 1XYFA 3HG5A 1B1YA 2DT2A 3W82A 5CG0A 3WUGA 3HMCA 1CDGA 4AIEA 3GXFA 3BAXA 2ZUVA 1F4AA 3WEZA 3WBEA 1OT2A 2JF7A 3AMLA 4QFUA 3VGHA 1W1TA 4C7GA 2E3ZA 1JGIA 4GO9A 4J27A 3DDFA 3AZSA 1CIUA 3WF0A 1R46A 2JF6A 3WFZA 4W88A 1WZMA 3J7HA 2PWGA 2J62A 2WCSA 1GQIA 3AOFA 2TAAA 5HXMA 3VO0A 5I2UA 4H8HA 2NT1A 3UG4A 5LA0A 3HZ3A 4MDOA 3IAPA 2D23A 1KXQA 2ZOXA 1E55A 1TG7A 5A8MA 4CD8A 2XGIA 2QMKA 2QLYA 1E6SM 3PZOA 5KEZA 1H2JA 2ZX9A 3TTSA 4PMVA 1BAGA 1EGZA 4JHZA 1BYBA 1J0JA 4PEEA 4TVDA 4M82A 3UEQA 1MW3A 4J3WA 1L8NA 1VBUA 4NXKA 1ZB5A 2EQDA 4DUVA 1QNSA 1CGXA 4W8AA 1UA3A 4N0RA 1TQSA 3NDYA 3A6OA 1B3YA 2VOTA 4QCEA 1H3GA 3CZLA 3VGDA 1HT6A 2DH2A 2XWDA 1TFVA 4JHOA 1HJWA 5CLWA 2WAGA 1TQTA 2YL9A 3S5ZA 3WEMA 3B8SA 2YFNA 4KGLA 1WPCA 3MO4A 2WANA 1UKPA 3A5VA 5M03A 1P6WA 2FH6A 3TONA 2VMFA 1AQ0A 1KGXA 1JNEA 4M1RA 4GKLA 4HMDA 1Z32X 1Q6GA 3BAIA 4MTVA 3VGGA 5BXRA 4PMDA 2J78A 3T0BA 4IUGA 2ZXBA 1GOWA 3OLEA 1GQLA 5A6BD 2GJPA 3N04A 3SUUA 5E6ZA 5CPTA 4JKKA 3BVVA 5E70A 2W92A 1HP5A 1JZ2A 4GXPA 3JUGA 5CPQA 4LPCA 2OYKA 3BC9A 4M8UA 3EDJA 3TTQA 5AC4A 2OSYA 1E72M 2WKGA 4HU0A 1MXDA 1PJ9A 2FGLA 5EFFA 1VRXA 1XD1A 1H0GA 3VSTA 1E56A 2OWXA 4TXEA 4LXFA 4D1IA 3AIWA 1QHPA 4UQDA 1F4HA 3WF3A 4AMCA 1D3CA 3ALGA 2W5FA 4GO8A 3UESA 5CQ1A 1J9YA 5C70A 1NWRA 5I77A 3QHMA 1VENA 1PX3A 1MW2A 3CZGA 1J0ZA 2XN0A 1E1EA 3IANA 1KGWA 1ODUA 3O6AA 3D50A 1OINA 3UR8A 3K4DA 3VGEA 2GVYA 1XHGA 5D9OA 3T08A 3FY1A 3IAQA 3BH4A 1V0LA 1X6NA 5DT5A 1TA3B 3VDAA 3CZKA 1UWSA 3D5HA 4ZENA 3BAKA 4H04A 3EMZA 3EJTA 2YOCA 3VPLA 1X6LA 3FAXA 2WVVB 1QNRA 2HVMA 2YJQA 1V0NA 5I24A 1E4NA 1ISWA 2DSVA 4PMUA 4D72A 1GZJA 4AISA 1E43A 3IJ9A 1GORA 4D6GA 3H54A 3GM8A 3VDCA 3CH9A 3AIRA 2OW7A 4F8XA 4ATLA 4DO4A 1E6NA 5IHRA 3D4YA 2ZUTA 1PIGA 3HJEA 2DEPA 2Z1KA 4CN1A 4V2XA 4DWSA 3VM5A 5A2BA 2WXDM 4AD0A 3N15A 4QDMA 3GTNA 1UH4A 5AY7A 2WVVA 2J4GA 3WDRA 1VAHA 3DX2A 3WL0A 3CUIA 3ZSTA 4FMVA 2ZUSA 4H2CA 2XVPA 3QHOA 1ZBWA 2XHYA 2XJ7A 4NSBA 1VBRA 2B31A 1QI2A 2BXZA 1TVPA 3ZM8A 4JAWA 1FHLA 5ABEA 2G41A 4MNKA 1W1PA 3K1DA 1SR0A 1V6XA 2ZE0A 1HL9A 3ZR5A 1EQPA 1LLOA 2JE8A 1XYZA 1SFSA 2V38A 3MV01 1W9BM 2BHZA 1E4LA 5DF0A 3ARZA 3BVUA 3ARPA 7A3HA 5JIPA 4UFIA 3VDBA 3CV5A 9CGTA 1BGAA 3WUFA 5HPCA 4BF7A 1LF1A 2X09A 2A3AA 5CZKA 2EABA 1FP9A 2CBVA 2PWDA 3FN9A 1E71M 3AMKA 1QI3A 1ISXA 2CITA 2DSZA 4MAVA 3VD7A 4FLRA 4DUXA 1UOKA 3II1A 1ISZA 4UOQA 1E6ZA 3G6LA 5A95A 3QOMA 1TVNA 3VUPA 2DSKA 1WCGA 1MQPA 4KWUA 2F7PA 4DUWA 3RILA 2J7DA 4TX8A 1O7AA 1WZAA 2FYVA 3AIBA 3NSXA 5I0DA 3SCOA 4CD4A 3L2MA 3VIMA 1GOKA 3WNNA 3WNLA 2WCAA 1VEPA 2VUYA 1US2A 1OT1A 4AD4A 2BVYA 1XD0A 1V6VA 3SUWA 1BYAA 3AXIA 4AW7A 4PCSA 3LRLA 1V3JA 4PMZA 4D6EA 1BQCA 2GK1B 5GQBA 5BRPA 3WF4A 3CGTA 3S5YA 5CLTA 3ARXA 5I3DA 3SUSA 3SCVA 3ZMRA 3CZJA 1LG1A 4WLCA 3W37A 4LYRA 2A3HA 1ITCA 1R7OA 3A21A 4CCCA 2XWEA 4ZFMA 3LXCA 3EJPA 1DP0A 2J7FA 2WVUA 2CBIA 3RPMA 5A2AA 4E2OA 4RE3A 5M3WA 2PWFA 5CJ5A 4QLKA 3T2OA 4OGZA 4AZGA 3PZVA 3WQ8A 3D4ZA 1UYQA 3AXHA 2WYSA 1PS3A 3VD4A 3BSGA 1OIMA 2VJXA 3WD2A 2Y24A 3T0AA 2UY2A 1Q6CA 3NYDA 3WQWA 4PMQA 3QGVA 1XCXA 1KR0A 4CN6A 1VEMA 4Y7EA 1JIBA 2GJXB 1JDDA 3M6DA 4P7NA 1K9FA 5A6LA 4U5KA 1BPLB 1CXIA 3CBWA 4JFWA 4JFVA 2VT0A 4W8LA 4W87A 5HDRA 1X1NA 1JZ8A 2RGLA 1H49A 1HJVA 3ZR6A 1WDRA 1A3HA 3VX0A 2WC3A 4Q7NA 5JBDA 5HNNA 2CCRA 3N9KA 3L4VA 3CTTA 3U5UA 4AMWA 1UUQA 2J7HA 5BXTA 4UQEA 3DX1A 3LRMA 4D6FA 3F5JA 1CLXA 3M07A 4MNLA 2BHYA 4HZ7A 4M29A 3NSNA 1C3FA 3GXPA 5BXSA 2AAAA 4JZ5A 3SIMA 4P8WA 2WNWA 2Y4SA 3WDIA 1HKJA 3AZRA 3VMOA 3W4RA 2Z1SA 5IFTA 3A4WA 3TOPA 2BY0A 1GOMA 1JD7A 3IJ7A 3G6MA 3WD4A 2WW5A 4FLOA 1ZBVA 1LG2A 4TX6A 2CBJA 1YQ2A 4PMOA 3M7SA 1UR8A 4GZIA 1OGBA 1GOIA 4MNMA 1KCLA 1JYNA 2EEXA 1JFXA 1CGUA 1J01A 1VJSA 3CLWA 2BHUA 4B3KA 3CMJA 1K9EA 2VZTA 8A3HA 3AIVA 1C93A 3SEPA 2ZICA 3M46A 1GPFA 1E9LA 2X2IA 1M04A 5D9PA 4QP0A 3BUBA 1NOWA 4JL2A 4MB5A 2XN2A 1DWAM 2EPOA 4GI9A 3GXDA 4W5ZA 1EO7A 2XIIA 3RDKA 2QPSA 1C7SA 3IGUA 2PF0A 1BLIA 1QW9A 1OD0A 3GNPA 4R5EA 2WPGA 3BUPA 3BVWA 1KCKA 4W8BA 1LL7A 1E5JA 1E4MM 5C71A 1E6PA 3EDFA 3LPPA 3U7VA 3GXTA 5CSYA 1D2KA 5BROA 3WD3A 4TTGA 5E9AA 3U57A 4JCLA 2PWHA 4ACZB 2F7QA 2FGZA 2BS9A 3WBAA 3WQVA 4EAMA 2F2HA 1E0VA 3RCNA 3SURA 3CUJA 2ZWZA 2WLYA 1KB3A 2PBOA 4PUEA 3DYOA 3AS3A 1M03A 2VI0A 3ZT6A 1HJQA 1QOXA 1V0KA 1CECA 4AD3A 3OGVA 4CVWA 4KH2A 4PMXA 2ZX5A 5JBEA 4BQ2A 2GDVA 5BCAA 4IM4A 3ARVA 1H41A 1R85A 1OBAA 2WMIB 4J28A 4ACZA 1CBGA 4HPGA 3GH4A 4E4PA 4GQRA 1W3JA 5AYIA 5BWFA 4RL3A 4CN4A 3FW6A 1CEOA 3EDEA 1IZKA 2EPKX 3AQUA 1H1NA 2E0PA 2C7FA 4PMYA 1G94A 4TUFA 1OD8A 2FDMA 1H11A 3VX1A 1KQZA 4MADA 1DWGM 3CUHA 2YL5A 2Y5EA 2VRJA 2GSJA 4FNTA 1E40A 1UH3A 1LQ0A 2ZUUA 4HOXA 4U33A 1V6YA 3AHYA 1EDQA 4EANA 1UA7A 3QR3A 1QPKA 3LPFA 4MPKA 1R86A 3THCA 4ZXLA 2CEQA 4UNIA 1E6XM 4UZSA 1JYXA 3ARRA 3MS8A 2WWDA 5I5RA 2E8YA 3TP4A 2UY3A 1LJYA 3AHXA 1BG9A 1KBBA 4BCEA 2FHFA 1UG6A 2YL6A 4HMEA 3KL3A 3VIFA 4DM2A 2WVSA 4KMQA 4F9JA 2CNCA 2A3EA 4NX0A 5JUVA 1CGWA 4MDPA 1EHAA 2DIJA 5CXPA 1WAWA 3TTOA 1R75A 1ZU8A 3KZSA 1LWHA 4J3VA 3GXNA 1XH0A 1HVQA 4B9YA 3AS1A 3W0KA 1HTYA 2DGAA 1EHNA 3WEOA 1W9XA 4IPNB 3UR7A 4OUEA 4HP5A 1OSEA 1SZNA 5D8ZA 4PBGA 4UFHA 2ALWA 4PTMA 1GOOA 4JKLA 4ACYA 4MNJA 3MUZ1 3HG2A 3SCWA 3U5YA 5A8NA 1W1VA 1NARA 2DT0A 2XTKA 1GCYA 1E0WA 3AZTA 4JL1A 1XGZA 1W2VA 2FE0A 1NP0A 5A69A 4FK9A 4UQCA 5E1QA 1HL8A 2CBUA 1HWWA 4UTFA 5C8BB 1XRVA 3WDPP 3ALFA 3CO4A 1ECEA 1UD8A 2VX7A 3EJUA 2EXOA 1JZ6A 4E8DA 2WB5A 2OSXA 4MJ4A 2XGBA 5HBFA 1JXJA 1WDPA 2DSUA 4W85A 1UHVA 3GBDA 3CZ8A 3WY4A 2QF8A 1WZKA 3T0DA 2ZXDA 1BTCA 2XPKA 1HN1A 1ITXA 4RE2A 4V28A 3HG3A 3PTQA 4GIAA 1ESWA 4PCTA 1WZLA 3FXYA 5D9NA 3SCUA 3LXAA 5CSUA 3OGSA 1ZJBA 3OZPA 4CGTA 3KWXA 4H41A 4UQ9A 5CPSA 5DT7A 5I6SA 4MB1A 3NSMA 1VFMA 3NCOA 2BY2A 2G3NA 1KXHA 2O9TA 2XUCA 2WMFA 1Y7VA 1L0PA 5AYBA 5FD0A 5IDIA 3DYPA 4AZBA 2UWFA 3VIIA 1SMAA 2DIEA 4JFTA 3CZEA 1B9ZA 3VIHA 4M80A 2QHAA 3VMNA 2WC4A 4X0VA 2VCBA 5I79A 5HOSA 2OLHA 1BFNA 2VX5A 1LWJA 1CGYA 1W3HA 1RP9A 1UR1A 1V3HA 1VFUA 1FP8A 1H0IA 1ZBCA 1MWOA 1PZ2A 1C8YA 1JF5A 5TD4A 3A3HA 1G01A 3PBGA 4IPLA 3GBEA 2J7BA 5FCZA 1JDAA 1ZL1A 1MQRA 4AXNA 1JXKA 1CYGA 4XB3A 1JD9A 2VRKA 1ZJAA 1W9VA 3FNDA 3POHA 2DT1A 4D71A 1CTNA 3PZMA 1PX4A 3I3EA 4UFJA 1MYRA 4J3UA 5M17A 2YDRA 3KEHA 4HOZA 3QOKA 2EADA 2YA2A 1JYVA 3ARQA 2PWEA 3EJRA 3A23A 1MVYA 1J0KA 1HJSA 1W9DM 4AZ5A 3A4XA 1XSKA 3AS0A 3BUIA 4PSPA 3MKKA 2WMHA 2RGMA 1U2YA 3ZT7A 1V03A 3L4WA 2O92A 3PZ9A 3VILA 1U33A 1MFVA 1E73M 3D3AA 1CGTA 4EKJA 5E09A 2VC9A 1J0HA 3WQ6A 1W32A 1MW0A 4WJXA 2IXUA 4JIEA 3WKZA 1J0IA 3ARYA 3DYMA 1AVAA 3ECQA 5A6MA 3MANA 3AMCA 5LYRA 1B3XA 3EDKA 4NZJA 1Q6FA 1TQVA 1E15A 1EDGA 1OWQA 1TR1A 3SCNA 3F5KA 1CXFA 2V3DA 3WF2A 1HXKA 3KLLA 3MV11 1JL8A 4CU8A 4OZOA 3ZT5A 1K9DA 3VIOA 5A6SA 4FNPA 1R7AA 1E3ZA 2EPLX 1GQKA 2ZUWA 5A2CA 2ZXAA 4Z2HA 3AIEA 2W4XA 4CD6A 3RJXA 3OLGA 3T2QA 5DFAA 3H55A 4YN5A 3K8LA 5A6JA 2MANA 4JKMA 4V27A 4CCEA 5EFDA 1E3XA 4R27A 2XVKA 2JEPA 5KZ6A 1BYDA 2PB1A 3SUVA 1RPKA 3OIHA 4W84A 3AJ7A 1IZJA 4PTWA 4EK7A 3LRKA 2BFGA 1E70M 4BQ5A 1FFQA 4DWSC 2YBTA 4D6CA 3HN3A 4OBSA 1QVBA 2VVNA 4M24A 3UETA 4X9YA 1I1XA 2V3GA 3N13A 3A4AA 4FF5A 3WH6A 3EJQA 3OLIA 3AROA 1CXEA 1EOKA 4DWSB 2DT3A 3AICA 3BSHA 1UKQA 3AHVA 1CGVA 3CUGA 1R87A 3L4ZA 2VVSA 2WBGA 2WMJA 4CD7A 2F1AA 1O6IA 4AD1A 2J77A 1EOMA 2XFFA 5DO8A 3LPGA 2E4TA 4D6HA 3CPUA 1WNOA 3CHEA 1PPIA 3EMQA 2E9BA 3ARUA 5A6BA 3N1AA 4C7FA 4BQ3A 5IHSA 3DX4A 1PAMA 3VTRA 2YLLA 1NOUA 3WNKA 2PI6A 3AISA 3W29A 3L4TA 5D9MA 4AZHA 2J74A 2EACA 1E0XA 1JFHA 1KR1A 2IUZA 3WENA 3GDBA 4XV0A 5JIWA 3ZQ9A 3MMUA 4M81A 2XVNA 4B16A 3EMCA 1GJWA 2GJRA 3VNYA 3H53A 1GOQA 1G5AA 4P7RA 2BV9A 1B90A 3ARTA 1W9PA 1M01A 1FH7A 1QNPA 3VGFA 2VTFA 2EJ1A 3OG2A 1KWKA 3WQ5A 2XSBA 3WELA 1KWGA 4B3LA 1G9HA 1V02E 3VKKA 3WNMA 2D73A 3ZSSA 3L4UA 3VDHA 8CGTA 2ZUNA 2YL8A 3RO8A 3RJYA 3MI6A 3S2CA 4DM1A 2JIEA 3CHCA 4PRWA 1QI0A 3L4YA 2OWWA 2CIPA 2XVLA 2VR4A 4AYSA 2VCCA 2V3EA 1JAKA 3K46A 1H4PA 6TAAA 5GNZA 3HU7A 2CETA 1M7XA 3D52A 1I1WA 3L4XA 4B15A 2ESCA 1CXKA 3ARWA 5LA1A 4U2ZA 4ZXOA 3BLPX 2XFRA 3W6MA 4W7WA 3W38A 3MUAA 2F18A 5E6YA 3BLBA 3NJ3A 2OYLA 1ISYA 4A3HA 2ZIDA 4UFLA 1GQJA 1HKMA 1CLVA 1E6QM 1D7FA 1J12A 4W86A 4AY1A 1LL4A 3GNRA 3ZJKA 4CUCA 3ZJ8A 1BSIA 1DWIM 4AWEA 4OOZA 1CNVA 3FHAA 3APGA 4DWSD 3VU2A 2D3LA 2F8QA 5A3HA 3OGRA 1U30A 4YPJA 2J25A 4OOUA 1JZ5A 4LGXA 4HA3A 4QLJA 2WHLA 2D20A 3BAJA 2Y8KA 1UD4A 3WD1A 1KBKA 3VSVA 1TZ7A 1UD6A 7CGTA 2WSPA 3MSDA 4GI6A 1B2YA 3TTYA 4N42A 1JZ7A 1CENA 3EDDA 4FNUA 4L4PA 4CCDA 2FH8A 1CZ1A 3WUEA 1A47A 2GJXA 2BVDA 1HJUA 2W91A 3UERA 3MSGA 4CU7A 2CXGA 2X2JA 1NM9A 1ZBKA 2GUYA 3AS2A 1HXJA 2AMGA 1XSIA 3WD0A 3N11A 1TQWA 3OA5A 2DPEA 4P8XA 4J3XA 4AC1X 5DMYA 2J8GA 1WO2A 2PC8A 3BCDA 1HNYA 1KTCA 2BY1A 4FNRA 5F7UA 4NZFA 1FA2A 2OSWA 1NP2A 3AIUA 3N17A 3WL1A 1TQUA 1HX0A 2IGTA 5BXPA 3HG4A 3GYCA 4HOWA 4WSJA 4HU8A 2PBGA 1PX8A 4WKAA 3CHDA 4HA4A 4JFSA 1LL6A 3WY3A 2WMKA 3WH8A 2XN1A 4WF7A 3I3DA 3W26A 1V02A 1UKOA 1KXVA 2O9RA 1EA9C 2J7EA 1QX1A 4D6DA 4W7UA 4QAWA 3DHUA 4AZ6A 1GHRA 4B9ZA 4HPHA 1O7DC 1UWTA 5BYWA 4D1JA 2WHJA 2WHMA 4WSKA 3A22A 3AYSA 2XIBA 5FKYA 4DO5A 1TE1A 1OB0A 2A3BA 1GW1A 4GZJA 4Z2KA 4NF7A 3VNZA 3GH5A 2WKLA 4WKHA 1CXHA 5DEZA 1UR4A 3BGAA 3UG5A 4PUDA 3F5LA 4PMRA 3AXXA 4LYPA 2DDXA 3VD3A 4UCFA 2CKRA 1OM0A 4H8VA 2W62A 2WHKA 3WNOA 2JIWA 1HKIA 3SCTA 2CESA 2UY5A 4W7VA 3KLKA 4E8CA 1HVXA 3B9AA 1RP8A 3N12A 1AQHA 5ECUA 2ZX8A 3NIYA 2J79A 2J47A 1NOFA 4UQBA 5ABFB 3CZNA 3O2LA 1JI1A 2V3FA 1QBAA 5E0FA 3WUBA 1TA3A 2VZUA 2ZXQA 3VGBA 4LYQA 1DWHM 2WVTA 2X0HA 3WIJA 4AYGA 5LA2A 2BXYA 4UZUA 3DX0A 1H5VA 4CVUA 2ZWYA 3WH5A 1J0YA 1GONA 1Q6EA 3W25A 1T0OA 1QWNA 5ABFA 4AIOA 1JZ3A 3TV8A 4QCFA 4HA1A 4NZCA 1RD6A 1QNQA 5I23A 3BVXA 3W6LA 4UQAA 3WN6A 1UQYA 4H7VA 4ZE4A 1MFUA 5GNXA 1TUXA 1B30A 3CUFA 3CC1A 4HMCA 2VO5A 1V6UA 1CWYA 2VCAA 3BVTA 3LXBA 1QHOA 4MAZA 5A6KA 1R33A 2QV4A 1UQZA 4GINA 2VL4A 1ZS2A 1QI4A 2WZIA 3KE0A 3PZIA 1C8QA 2VX6A 1KQYA 4L4OA 1JG9A 3ZO9A 3LPOA 1JF6A 2DH3A 1BGGA 1AQMA 4W89A 5D8WA 4AZCA 2D3NA 4TTUA 4AD5A 4K68A 4EE9A 5ABGA 4C7DA 2W61A 2CKSA 3O9NA 3WFLA 3CZSA 3W24A 3EBVA 2CERA 5GNYA 2VX4A 1YHTA 2E9LA 1EIBA 1J18A 1HKKA 2Y2WA 3IK2A 4U2YA 2VURA 2DSWA 3GNOA 1CPUA 1NH6A 1VEOA 4HZ6A 5EMYA 2YA0A 3VM7A 1QBBA 1TMQA 3THDA 4U31A 1VFOA 4CKQA 4D6JA 2NT0A 1BG4A 4UOJA 4AZCB 2ZUMA 4CU6A 4GZEA 3L2LA 4D6IA 4P8UA 1JYWA 2J75A 3EJSA 4NRSA 1QI5A 3FAWA 4M56A 3WMBA 3VMPA 3BMWA 4FLSA 2D0FA 3GZAA 3W27A 3LMYA 4AEEA 3RM4A 2VR5A 1AMYA 1VJZA 3QHNA 2YDSA 5FL1A 3BCFA 3K4AA 3W28A 1JI2A 5EB8A 4AZ7A 1NWTA 2WZEA 2BY3A 1K9TA 3I3BA 4PTVA 5IFPA 2WSKA 1VB9A 1G0CA 4S3JA 1W2PA 1V3MA 1VF8A 3E1F1 1RH9A 4TVUA 1FH9A 4Q22A 1DEDA 2XG9A 4AD2A 1DWFM 3WH7A 3EYPA 3MMWA 5E0CA 3W53A 4KGJA 1C91A 2YDQA 3NDZA 3VD5A 1FHDA 4BZYA 1DWJM 3AI0A 2F7OA 5M5DA 1UWQA 4F79A 1UWUA 1US3A 2WZHA 4A3YA 1KXTA 4AIUA 3PZUA 3PZQA 1PEZA 3VVGA 5A8QA 2XM1A 1R34A 3WY1A 1NQ6A 1WP6A 3NUKA 1W91A 1XH1A 4Z2JA 2YLAA 4KRTA 2Q8XA 2CPUA 2V5CA 4YHEA 1GNXA 3ZOAA 2YA1A 6CGTA
chains in the Genus database with same CATH superfamily
2GSMB 2NX1A 2X9YA 2HT2D 2F54E 1U95A 3VA8A 3O41A 3SJVB 3ILEA 4OLZH 3QXWA 4GT0A 5T5FH 4QRUA 4ZA0A 4NRRA 2JKAA 5HYEA 1RL1A 3UGRA 4P2QE 1WDSA 1I1AB 5DS8A 4MTMA 4L4MA 3T3ME 1BQRA 1U8OA 3GXMA 5EZLA 3RHWF 2VLJA 1A5UA 1MEHA 1X5IA 1TZ9A 1E5NA 3QEQB 3QUYC 3GH7A 4TVCA 4QHLA 1L6ZA 4U1LA 2I07A 1INEL 1B3VA 4Y7OC 4LBAA 2AGJL 1WOAA 1UM4L 2IQ9H 1OHQA 4MMXA 2FWOB 3PHSA 5J8OA 1ZGLB 2NV2A 1NPJA 2R1WB 4JM2F 3ZTCC 1E3FA 1I75A 3FQWA 3O6FA 2O5ZL 4ATWA 4HK0B 5K9JL 2PU1A 2VEFA 1VPOH 3LIUA 3SCPA 4WU7A 1DVFB 3GIVA 2JXMA 5E2WH 2F7RA 1NWUA 5FFGA 2GWGA 1HDMA 3UBPC 2C9QA 2BSLA 4OLWH 1KYUA 2YSSB 4U3CA 3W81A 3QJFA 5HVHB 2GGIA 2F6UA 3OPUA 2IWEA 4YHGA 3C8KB 1EXPA 4C1LA 1YNTA 1HL2A 4XZBA 1OP3K 2NW3A 1BFTA 4D7BA 2VHLA 2WD0A 1NCDH 1W5NA 3KOYA 3T3PE 3DIPA 1X9RA 4Q7DA 1FWFC 4FTVB 2WWCA 2DN7A 3I6RA 3CMGA 3QIBD 3L3HA 4IW4C 2DWEA 5JDJA 1KIUB 1PCKA 2KLSA 4PHXA 1NZRA 3C12A 1YDPA 1RJLA 3QSRA 4QJ5B 3G6DH 4FEMA 3UZZA 3GTHA 3TYUA 1BIHA 5LIXX 4XZUB 3UBXB 2MHAB 1UJPA 1IEAA 3EYFB 1QA9A 3ZZSA 5IBXC 1AY1L 2Y3NA 4JTEA 3FGCA 2CHOA 2X3BA 1WV2A 3GDLA 2PDKA 1J10A 1DBMH 4NNYB 3KM8A 4OUOA 4KCVA 1AP2B 4H0GA 1IT7A 1X5KA 1TJGL 2R2BB 5IBLC 3QQ9D 1XW8A 1KV7A 3QNZB 4F4RA 4YBQD 3M1OA 5HPOA 4RISH 3HURA 3HLAA 4KXZI 4DLMA 3R0DA 5LDSA 4FPSA 4U6VH 1UKTA 4FQLL 1CFQB 2WNKA 5TDOB 3WIAA 4Y1TA 4LP4A 3MV8A 4JQIA 1SHXA 2OW6A 4G42B 4Q9BA 3EX3A 3TBSA 4FOMA 4BFJA 2A73B 1UD5A 1DLFH 4O2FA 4IWWA 3WE6B 3PWPE 3B0YA 4BA0A 2B5IC 1ADQL 5B38B 2CBTA 4G6ML 1WC7B 2R27A 2WXKA 1DXEA 2VFHA 3QBUA 4WKFA 1QPPA 4IRSA 1UD2A 2ZSWA 1U91B 1G1YA 3BMVA 5ERWB 3UZQA 1N67A 1PHWA 2HCZX 1YNTF 2CLZA 2F53B 4U1JB 2FIQA 4WNJA 4AMXA 4FULA 3GZQA 1A9EA 3Q45A 4ES9A 3WYZA 4U28A 1LORA 2R2HA 2X1XR 4PTDA 1FWJC 3HS0A 2L0DA 4H83A 3VQMA 3ZRCC 5B3JE 4K0OA 3DX3A 3UPWA 1KB9J 3DJTA 5IZ7A 2QCEA 1DOSA 1TB3A 4CILA 5ANHA 1F8MA 2WKJA 2XSAA 4WIWA 3ME3A 3VFSA 5CGTA 1ENUA 4X4MA 4KZDL 1U4FA 4O4WA 3W9EA 2UY6A 1EDTA 1PZ3A 1H09A 5CGBA 2QCLA 5FSEC 2WLZA 4NHUB 1T6VN 1DQVA 1QHQA 4RMTA 4UTCA 5T5NG 2Y7QB 5K9KB 1G6CA 1AG6A 5MEOA 2BVTA 4Y9PA 4XP5L 3PFMA 3QZPA 3G04A 3DGBA 2VZSA 4A7GA 4Z0XB 2WXIA 5SWQB 4GG6F 2D24A 2WMGA 2F7FA 5E8EB 1U1UA 3RPIB 1LP9B 1TQCB 3MNWA 3ZFHA 4H8NA 2X4QB 4FMKA 2UY4A 2XYLA 5D1ZB 3OODA 1S46A 3KOWA 1LD9B 1OPOA 4ROPA 4LQ1A 2UZ9A 4TUJB 4TNVK 1BD2B 5SV4A 2JKWA 4K94H 2R0LL 3WSUA 4L9DA 2FUTA 3SJVD 1PIIA 1BCIA 3CO8A 5GGSY 3UYCA 1F4WH 1T2QL 5DSCB 1HH9B 3GSOA 4NZRH 5H35A 5CMAA 1XYCA 5EUOB 3J07A 4HU3A 3RGVA 5J4MA 1ED3B 3LS4H 3W11D 2CZ5A 2OZ8A 2IOMA 1Q65A 3WMSA 3KS0J 2K4WA 1R47A 4BFOA 2IGFH 4G6JH 1FCVA 1TDQA 1RPXA 3QEGH 1A7BA 1WE5A 2VZOA 3BFQG 5KOVC 3AHZA 4KKBC 1HEJC 1RXOB 2CLHA 2L4OA 2GQ8A 3A6BL 1RURH 3FU0A 1HKLH 3W02A 3VSUA 3SBRA 4DVRH 5KS9F 4E68A 3AMGA 3PWIA 3WN5B 2ZOLB 4NJHA 1P4LA 1NDWA 3DECA 1GJUA 3AM8A 3Q44A 2AAMA 4KRMB 2EIEA 5H2ZA 3BEWA 3ZE1B 3KLHD 1AHMA 4MNGA 5F7DB 3KPSA 4K23L 4RH4A 3RVVD 1IIGA 3WL9A 1E28B 4FX8A 2GK2A 2WWKO 1E7VA 3DRQA 2HISA 2WMIA 2YR3A 3BI9X 1MUMA 4ZK8A 4L4VE 4TV3A 4AEFA 3CT2A 4C1NB 4E4UA 1MCOL 4DCQB 3PZGA 2EIDA 5KG9B 2IJ0C 3L3OC 3P4NB 1OGGA 4KJYB 1EEUA 2XN9E 3HIZA 4U7MA 4XMPL 1H5BA 5ACMA 1U5HA 4NUJB 4O1DA 4IF2A 4YHNA 4YHIB 4A4AA 3QUYB 4BIKA 1A9VA 2A1YA 4AMKL 3UXFA 3CVIH 2KH2B 4N2FA 4R8WL 4Y5VC 3CLEH 5JPMA 1JZ4A 3ARBB 3S3DB 4KWVA 4XAYA 4CC4C 4OV9A 2VAAB 2AJVH 2XZCL 4N9OB 1BKSA 3GHSA 1XS2A 3CHRA 4DBSA 3MRJB 3OKKA 1MW1A 2D2OA 4DO6A 2DEWX 2CKBL 1UWIA 2AMXA 3BXWA 5AC5A 1U4EA 4PS3A 2Z92B 3QQ0A 3ABGA 1LL1A 3OMNB 1FYTA 2O5XL 4JCMA 3F5WB 4OUUB 1U1JA 1CT5A 2YBUA 2FECL 5IV2B 4HX1B 4Y9EA 1HCFX 1A5NC 3M64A 4P3CL 3MLWL 1HP4A 1NGXA 1SVDA 4QTHA 2GQHA 4MD4B 3RU8L 1Q9LA 1W9UA 1JNHB 1SUJA 2X0WA 3BH9B 1QZ1A 1IT8A 3ZJ7A 2DZEA 5AOIA 3GB7A 5FL0A 5FGCB 1FSKB 3ARGA 7TAAA 4UV7L 4C56A 3DHFA 3EO9L 1S9YA 1FOBA 3MRMA 3AMDA 4UMAA 2Y7OA 3P0XA 2F54A 5F7FA 3EOOA 5G1MA 4LVHB 1VS1A 4MA8L 5C7VA 3LHTA 1R3JB 1W8OA 1IKFH 2EXYD 2OS7A 2Z0BA 3L7FA 4OJFL 2GFBA 1RLWA 2ZCKL 4YHLH 4ZFOB 1Q63A 3B9KA 3NAVA 2H8PB 4WDIA 3WEXB 5J0BA 2OXHA 3FA5A 4QWWD 2JALA 4AZIA 2H8XA 5DJ8B 5JMUA 4N5EC 4KBXA 4AC4A 3V0HA 2OR9L 2E7HA 3TT3L 4CD5A 1BVZA 4PMEA 1Z9MA 1W72L 4PJ8D 5ALCL 3QULA 1RZ7H 3EYSL 2V68A 4ZOEA 4Z2LA 1DUZB 1PZDA 2O5ZH 2QUTA 3MUCA 2HFTA 4KV5E 3NPWA 3N18A 3BT2L 2V7HA 4HFUL 3B3IA 4PJ9A 1JCTA 1TFHA 1JUKA 4Z5RB 1C1EH 2FYYB 1N82A 3B9NA 3RM9A 1PFCA 2AGJH 1IGWA 2A4ZA 1INEH 3VB8A 1AW2A 1J9RA 2FEJA 4REQB 3E2RA 4LRSA 3PN8A 1C7TA 4IKKA 1PB0A 2E25A 1CF1A 4LAKA 1YJDH 2E47A 4LS1A 5D4YA 3GSNH 4ELKA 3NYZA 1XKYA 5JO5B 3RWGA 3QIUA 3YPIA 4WI3A 5KBDA 3KBPA 5KYUA 2DTMH 3TZVC 2BB0A 2W9MA 4CQAA 1RA0A 5I78A 2FUQA 3N9SA 3VINA 1ZVSB 3VXPA 2WK2A 1BYCA 1W8NA 2WXLA 4HWEH 2IPWA 2VYOA 4Z7OE 4QG6A 1H7NA 2H9GB 1UZ8B 4WJKB 1OHZA 4XVUD 2WQAA 4DKEH 5A1AA 4KUCD 3QS2A 1Z69A 2VDLL 2BGSA 2PDXA 2R82A 2O6PA 5KSWA 5IBUG 3UWQA 5BRZE 4F66A 3KYNB 4ENEC 4OIIH 5KS9E 1KCUL 1ODZA 1OGSA 3MYZA 2PDIA 3MUY1 4EVZA 5LGJA 3NA9H 4AQ1A 1TFPA 3L3JA 3U36A 1UR0A 1ISVA 1P4IH 4UU9B 5FK9B 2R1MA 3MRNA 4RPPA 1UKSA 5AB3A 5KSUA 1FFPA 2QQQA 3FFCB 3CJPA 2CYGA 1DTUA 4TVPL 1UZDA 2DQDL 3S36H 3RZCC 4K8GA 5GISL 4B5SA 2XFYA 4ISVB 4M6QA 3QZWG 5HJ3A 2DWXA 2IH3B 2WQUA 2XRAL 3LZFH 1EHLL 3KCPB 2ERJC 5DRZA 3KWSA 4KXCA 3UJTL 3VXUE 3WFEH 4Z7IA 5DUJA 2OB3A 3P61A 1F4YL 3HAEB 5A94A 2DORA 1FXPA 4OE7A 2OJEB 3H6JA 3UYOD 3LH2L 4GXUN 1YNQA 2BIOA 1SJCA 3POCA 3IJQA 4IHCA 3VABA 4ZTPH 2Q01A 1DIOA 3REQB 1J8VA 4NN5B 3D09A 1EBHA 5FUOH 3W1TA 5TE7L 3PWPA 4NJ9L 1KTDB 4WSGA 3M5XA 4FLHA 1MOEA 3MGTB 1E0TA 3HB9A 4UC5A 1PD6A 1N2VA 5L2KE 1EIXA 3OQEA 4K71C 4Z95H 1QACA 3T09A 4CMHC 1CL7L 2Y6ZA 3SFWA 3BX7C 1CXLA 4RGOL 4PUUA 2J2ZB 1T7XA 1CICC 4F9PA 3PPCA 4UB0H 2MCPL 3CT7A 3SGGA 1GVYA 3AM8C 2HE8A 5KZMA 1OAJA 2YFOA 3ZVVA 5AOLA 5F88B 1RAKA 3HGRA 3PTMA 4N2CA 1YZZA 4RDYA 1YEYA 3U7BA 3OLDA 2HVKB 3JQOB 4GFTB 4YU1A 3C60B 5M95B 3TCSA 4KRPD 4W5UA 1HL5A 1B3ZA 3BW9B 3PCYA 3LBCA 4P7OA 4URIA 2W65A 3WYRA 4Y1AD 1E0UA 1MHHA 3DXAD 4ODVL 5JNYB 1T83C 4OLXH 2DQHH 5DJXB 1B1YA 3ZMEA 1KJMB 2Y7GA 1VF5C 3BG5A 1FBIH 5KYWB 2V9TA 3HMCA 4CSZA 2XPGA 1V77A 3II3A 2DQCL 3MFFA 3D33A 3OMZA 4XNUH 4UF7C 5CJOL 5KWYC 3EA2A 1JJKA 1F4AA 4U6HA 4ZUTB 5EOCJ 2UWEA 2UZYB 3PGCA 1OT2A 3WBEA 2A7BA 3QPZA 4E9RA 1EZUA 5KBNC 3C5ZB 5AVTB 4LLYA 4IT1A 5LJYH 1BQHA 3GLZA 3IRCA 1YBQA 2DJ4A 3W3OA 4JY9A 4QFUA 4LU5L 2JKTM 2RBLA 3VGHA 1W1TA 3FXGA 4L8SA 3R0UA 5C0IA 4N6QA 1ZHBB 3GIVB 1M1XB 4TOYH 4YNGA 3CG8A 5I6NA 3BZDA 2C1IA 2VDNH 3V0FA 4KNTA 1CIUA 3AB0B 3WF0A 3LCGA 4NDMA 5F9OL 1NFIA 1A5CA 4WI0A 3J7HA 3SDCB 4PJAA 1ZGDA 3IYLW 3EGXA 1NGQH 3S3JA 4RV3A 4H6EA 1OVZA 3LKSB 2J56A 2OMYA 3EH3B 2OXNA 2Y69B 4I7ZC 3BP5B 4EIGB 2QPDB 4NQED 1URLA 1QR1B 4QXUL 1PMYA 4Q9CA 5ALBL 2YPLA 5I2UA 4LLDB 3REVA 2NT1A 2Q6WB 3S34H 1NSNH 2R4RL 4O4YH 5DUBA 1IEVA 3FLUA 4ZVJA 3P11L 5HI3D 43CAB 5F96L 1OP9A 4OHQA 1FJ1A 1KXQA 3G5XB 1Z42A 2D23A 3B5GA 5ID0B 2HBXA 4Z76B 4ZZFA 2ZOXA 3UWZA 1DHPA 5A5WA 1BRLB 1KKRA 2QMKA 3CXDL 3P0GB 4GLEA 1XKJA 1BQLL 4WU5B 5CAHA 3D39D 4AE1A 2BBFA 1AP2A 4YHOH 1BAGA 5D72H 1GL4B 1Z9SB 3B4UA 3NN8B 1UZ6F 2Y36H 2AJZA 2YAEA 2WZMA 4UTIA 4FG6D 1NAKL 2F19L 3QPEA 3HBLA 2Q3XA 4P04A 1ORQA 3RX8A 3EWUA 3F2DA 2OPCA 4DPCX 3ALWA 1II4E 5FW8A 1EJUC 3C5SA 1L8NA 4JFED 1OFRA 1RJRA 1J9CT 1M6UA 1DN0B 1VBUA 4MF4A 4LBRA 5F9AC 1AC6A 4RDQG 2VW6A 4YHOL 1E2ZA 1A1OB 4Y7MA 3ULVD 1TPWA 5AW3B 1IR1A 1YNLL 1G0DA 2IOOA 3N42B 2OGJA 3RVXD 1TQSA 1B3YA 1CE1L 4PJ7A 4PFEA 1MUJB 1AGBB 4Y2WA 5FAGA 5I6KA 2E1DA 4PWIA 1SXAA 1GT8A 2W95A 1SPDA 2KERA 3F6JA 2C1OB 5KYNA 1K5WA 3GO2A 4HCDA 2VXSL 1S2TA 1UXSB 4JHOA 3TK7A 4PUWA 4MNQD 3RN6A 5KYXB 2GGHA 3ERPA 4YDVA 1GGCL 3WEMA 5IRPA 1BX2B 1INQA 4OF3A 5AN7A 2YFNA 3FQUB 4FG2A 4KGLA 1CFVH 1BOYA 3QHFH 1WPCA 2XWCA 4PV8A 4DWHA 4Z7NB 1S7QA 2WANA 5G4NA 5C7XL 5JA8B 3MO4A 1BLNB 3RFAA 4LAJH 5ITBH 1IBYA 3X11B 2ALAA 1VPYA 2VMFA 4J8QA 4A6YL 3UROR 3WHXA 4TOYL 1WLHA 5GZOC 2ED9A 1H60A 3QFWA 2FAUA 4ZW5A 2QVNA 5EFIB 4YHYB 2NDGA 3BGFC 3PZTA 3CCHB 1Z32X 1YEHH 3CH1A 4JY5H 4B3EA 1SU5A 4UAOB 5E7BA 3FT1A 2BRRL 3HZYB 4DGVL 2J78A 1E4JA 3B06A 3MWCA 1E2VA 1JMXA 1LD9A 1VGKB 2C1PB 3TTEA 5FOBA 1JYNA 1ACYH 1ZSHA 1GPWA 5KVFL 1SXSA 4D8OA 15C8H 5A6BD 1L2UA 2VSDA 3N04A 5IHUH 4HH8A 1WJ3A 2WNGA 5EF3A 5EUOA 2X4TB 5E6ZA 2FZ3B 4A7SA 4ODVH 1W3NA 4JKKA 3TROA 3TZFA 3SQRA 4C91A 4YLQT 3FTZA 1I1AA 4IQHA 3CVHA 1ADQA 4JB9L 1LRTA 4GXPA 5ICUA 5D1QB 1ZVNA 2Y5QA 4B5NA 2D4DA 2Z0UA 3BC9A 3MV7A 4M8UA 1SVCP 3GI8L 4JDEA 1SY6A 3WKPA 4R7WA 1KXQE 3GVRA 2WIIB 2XX1A 3L16A 3B4YA 5AC4A 1BIIB 2WKGA 4HWUA 2WXRA 4OQTA 1JUEA 1AOHA 1T1ZA 1W80A 1ASOA 1BXBA 3BXNB 4Y4KD 2N7BA 3N41B 5CEZL 1JCYA 5IJDC 4DWDA 3RVWD 2C34A 5IB1A 2MFNA 2R1WA 3UBHA 3W6YA 2WQVA 2IBZX 1H0GA 1N8WA 3WL9B 1IYXA 2OWXA 3G18A 4FNLH 4DNLA 3ETSA 5F7AA 1SLUA 3DBXB 3CPRA 4RNFA 3H4GA 5LB1A 3S1XA 4JRYD 4LF3B 1T80A 2QADC 1ACZA 3CHVA 4D9RE 4LL4A 4QGCA 5HYQB 4XD4A 4ZMNA 3WI9A 1F18A 1ZVHA 4LSQH 1SOXA 3FB6A 3UTQB 3SDYH 1L5GA 1P4CA 4HT1H 1FVCA 2R0WH 2QADD 3CUXA 3IKCB 4TQIA 1MW2A 4GCXA 1J0ZA 1JCLA 4DNHA 2DZWA 3S9ZA 3FSWA 4XKYB 2EDEA 3BG9A 4GUPB 1IQWH 3TBYA 4KI5C 3L23A 3IANA 1WDAA 2PDQA 1I1YB 4IQLA 3HB3C 1ODUA 4PUNA 2Y0FA 1R3LB 5IROA 3KD4A 3D50A 1EGVA 4IFOA 1TO5A 3ZHLA 2C7UB 3W7PA 4ALAC 2YBVA 4WAFA 3MTXA 3FGCB 1D5BB 1RZGB 2JKLA 3T08A 3RIAK 1XHGA 4ZMGA 3W2LA 4XP4H 3IAQA 2OQHA 1V0LA 1X6NA 1NGXB 1P4IL 5DT5A 1TA3B 4FZ8H 4NN7B 5E9DD 2BWDA 4XH2B 2ZAIA 2VISB 1JNHA 4N8CL 4H04A 3EJTA 1I60A 1CBJA 4UMSA 3B8DA 5DBTA 4GYFA 5GGRY 3FAXA 1I9JL 5D09A 1JVLA 1FNHA 1S9YB 2A73A 1B88A 4C6CA 1OT4A 4EXAA 4NWTL 2DKMA 4RGNE 5K59F 4UAOC 1E4NA 1YPIA 2DSVA 2WSQA 1A14H 3VNIA 2QSVA 3OKDA 4Y5YA 4LQFL 1GZJA 1S5NA 1I8IB 3IFNH 3W7HA 4AISA 5C07A 1U91A 5ERWA 2AVFA 1LQBC 4F2EA 3F4WA 1CT8A 4TUUA 4GH1A 2ATPA 3CDGA 3QVQA 3IJ9A 3S3SA 1YVLA 2YC1B 1SN2A 3QEUA 1YAIA 4L4TD 3T0EE 1Q94B 3CAFA 5CD3A 1GORA 3DC8A 4UQ3A 4I90A 4D6GA 3IXAB 4YIWA 1C1EL 4Y9MA 3IVUA 1MMFA 3CQ0A 3O3DA 1RZJH 2HVJA 3EYOA 1P7KA 3H9SE 3QPKA 1Z9NA 2VYRE 1ADWA 4OZFH 4RNRA 3TIDB 1GSKA 4DO4A 5DY2A 4ATLA 5IHRA 1WS7A 1P7QB 4UQ2A 1JV5B 1HWHB 4PULA 1MKFA 1J4EA 1ZJHA 4UTJA 1M7IA 1U22A 3HB3D 3QQNA 2D2GA 3RWGB 5JO5A 2WXDM 3E0VA 3TEXA 3MBED 4QDMA 1IVLA 1I82A 1TJIH 3LQMA 4MA1C 4NWTH 3UAEA 2V2TA 1NGYB 4IDLA 4MA8H 5B1AB 1AJ2A 2IBZY 3NZUA 2HYMA 5EC2B 2J4GA 1EXUB 1BM7A 2OLDA 3DX2A 4NO0B 5CD5D 3EO9H 1SQ7A 3CUIA 3MLXL 1OD9A 4KF1A 4S23A 4C6EA 4FMVA 4H2CA 5CZJA 1KUMA 5ESAB 1ZGLP 3Q3GA 2HG5B 2O56A 4JPVH 5D1ZA 2GTZA 3RNQA 2XHYA 1U8HA 3K6FA 4HJJH 2XJ7A 4X6DE 1MWAH 4E2DA 1I1CA 2BXZA 3OF6D 3PU7A 2VEPA 4H9YA 3QZBA 3ZM8A 4JAWA 4LS2A 3U4KA 5CMAB 3H2AA 1JV2A 1IFHL 4KKAD 2B77A 4YS4A 2I9TB 1DIKA 4F8OA 2A83A 2MQCA 1I9EA 4W6WB 3SCMC 3NM1A 3GDTA 3TBVB 1TETL 4LCQA 4MNKA 5EMLA 2P48B 5F1NB 3I9GL 2P3EA 4KFNA 1GYCA 3BW4A 5BOFA 1SR0A 1WITA 1V6XA 2YYTA 3C2AH 3BVJA 3WS6A 3PWNA 4KFZC 4NRYB 1EQPA 5GRYA 3H21A 1CW2A 5E9DE 3GZPA 2O30A 1R3KB 1TZ8A 1Q9OB 5IHBA 3NBNA 1TQXA 1S8DA 4NP4L 1J05B 3SBPA 4NC2B 4CBPA 4F1ZA 3U7YL 3OAUH 2OM5A 3C09C 3MBXH 1W56A 4WHYG 3CMOL 3HC0B 1ZA3B 3RKDD 4US5A 5K7JA 4F3FB 1WFUA 1SJDA 4TQPA 4AXKA 4JYDA 3H70A 3ARDC 2NUYA 1SEBA 2ZCGA 3VZXA 1HINL 3QWOB 3SFKA 1MCOH 3PTDA 1T3FB 4LEQA 3ZDYB 2A3AA 5CZKA 3PY2A 2FLRT 4BQ9A 4Z0SA 4ZMAT 1FGVH 3G3MA 2ALDA 3VXSE 2DJXA 1D9KD 4YZFF 1PNCA 2OMTA 2I60L 4OVXA 3VD7A 4YHIA 5TE4L 3HTLX 2JB6B 3ASNB 3OVUB 4I89A 4FLRA 4L1HA 1TXKA 4YSTA 4JO2H 5FYLH 4DPRA 4EI5B 3C6LA 4DUXA 5JPMB 3RZCD 1KN4H 3WKMH 4XKYA 4H19A 3VAEA 2P5EA 3TYFB 1ISZA 4XO4A 4G70B 1NFDE 5DS2A 3I4KA 3GI8H 3RL2B 4FTDA 4HVBA 1RJQA 1QRND 2P80A 2HVKA 1KJ3L 4JIRA 1M2OA 1AH4A 1MCEA 3CHPA 4QRRD 3PJSA 3RG6A 1NC4A 2RB8A 2IANB 3LS4L 5CLZA 5KSAC 1YDOA 2ONEA 2QGCA 2J7DA 4TX8A 1IBHA 1WZAA 3NSXA 1RQBA 3V6BR 4JTDA 3MROB 3WS3B 3ZGIA 4EMZA 2EE6A 3K5SA 5EKYA 4K94L 4OZGB 4NM8H 1QFHA 3WNNA 1TU2B 4W9LC 1AQ0A 2I56A 3MDWA 1OQXA 2AMUA 2VUYA 4I87A 4NQEE 4RNHA 1XGRA 1JGDA 3PV7A 5CIPB 3VI4F 4OU1A 1BBJB 4AG0A 5G5DB 4PUJA 3ARGB 3VRIA 4AD4A 3KDMA 4QRSB 3BLFA 5EEVA 2VZ1A 5CEYB 4I1PA 4QOKA 3MUJA 5I1CH 5IKCA 1KULA 1W0WB 1AHKA 3UTZB 1R5WA 3VOJA 4AW7A 4JE0A 4S1RL 2DLIA 2IOIA 5DGQA 4GYPA 2NYKA 1XIWB 4QIRA 2EZ0D 3WMPA 1ZT1A 3PHOB 2ZA3A 3VZZA 4IIHA 1W16A 4NKOB 2FPVA 2F8OA 5I26A 5D05A 1NANH 3L3OA 4OT1H 3LKOA 4KVPA 5I1IH 1A4BA 1YEJH 5GJTL 5JOFA 3T7VA 2X9WA 1JFQL 1KN4L 3WKML 5IW1A 1WXYA 5EMMA 2WZ6A 4GW4B 4JO2L 5FYLL 4FKHA 1M71A 3TJHC 3KCLA 1RCYA 3LIZH 1R2RA 1PL9A 3GJFA 4MVBC 4N8UA 3SCVA 2VN4A 4LDEB 5D1QC 2BNQB 2BP0A 1FWBC 1LG1A 3R4IA 3BEVB 2Q6WA 3P9LA 4APQD 4NPJA 3STFA 1XFPA 3W37A 3PBWA 2Y72A 1A6PA 3KHQA 4LYRA 1MJ7L 2A3HA 3GW0A 43CAA 1ITCA 1VLWA 5BZDB 2FBRA 3SSGA 3HC4L 3A21A 2BZ7A 1VGAA 2NX9A 2XWEA 4YFEA 1AZ1A 5AVQB 2R56L 3PUDA 3L08A 3ELQA 5D2YA 4D9QD 4WU5A 1SJXA 1UENA 2AP2A 2WSDA 2WVUA 1ADQH 1KLFA 1C8PA 5HYJD 4HK5A 4XN4A 4EIUA 3BAEH 1DO6A 1RHFA 1YPFA 3N73A 4BEQA 4QD2E 4DQWA 4B7LA 2FD6L 4Z7WA 3U48A 4J3OG 4P2RB 3LEPA 2DYPD 2EDKA 2FX8L 3NQBA 4XG1A 5I3JA 1EKOA 2YX0A 3CSYA 4ZS6D 1S39A 2V2WB 4GFXA 4IBYA 4AZGA 1Y5VA 3PZVA 4KESA 2VUKA 2OSLA 1AGCB 2XA8H 5EIIA 3QLDA 2VDML 3VNLA 2WYSA 1PS3A 3JTSA 5TE6H 5BMFL 3BSGA 3CWHA 5F1IB 3GMRA 3FFCA 2WV8A 3IF1B 4LOFA 4P46A 3QRGL 3WD2A 2Y24A 3QIWD 4MJ6B 5F96H 5FWQA 3T0AA 1Q6CA 3NYDA 3O8XD 3QGVA 4PMQA 4DPQA 2Q76B 2XCMC 4CN6A 1S3HA 4JFEE 3WD5H 2V5TA 3SIZA 1GC1L 2I9LB 1OL0A 5ALBH 1JIBA 4KKQA 4AGOA 1QEXA 1I0BA 5HI4D 1UXSA 5A6LA 1E9QA 2EDTA 3D07A 1JRHH 3FB8B 4JFWA 1QPRA 3ZYJA 3DFSA 1FVEB 4WJ8A 1JTPA 2E1WA 4IMGA 1MJ8H 4X6FB 5JHDB 2XIJA 3JZUA 3FQUA 4PV8B 5AOUA 2F8XC 1EERB 4HWBA 3I6LE 1F05A 5ITFB 3V4LA 1LE9B 3JV0A 5EY5A 3QUXC 3VX0A 3MWAA 2R0ZL 3CX5J 5F70A 3ZYIA 1FHNA 1MCBA 2VFFA 3RQ3A 1FAIH 3Q2VA 2VLKD 3L4VA 4HUMB 3WHXB 1RK1A 4JQAA 4G8GE 1ZEAL 1EXGA 2BODX 2IG2L 2J7HA 2JFEX 1FGNL 4PS4L 1GW0A 3FH8A 4D6FA 3ULVC 4PJIA 4I3RL 3M07A 4MNLA 4DBEA 3CH1B 4HZ7A 1PLGH 1MREL 4WU7B 4DYKA 1ELSA 4ZNEE 3W01A 2VDKB 4Z3EA 1DJXA 4OZHE 4QTGA 2L7EA 4XMLL 4BINA 1W1ZA 2W38A 4LO9A 3MV8E 1EJOH 3KJ4B 1OAQL 2AQPA 4ZT1A 1G4MA 3WDIA 3CLMA 3IFNL 3SBQA 5I16A 4MHBA 3A4WA 3DGCR 4DP8X 1AQFA 1R38A 2ITDA 2BY0A 1P6AB 4XBGB 4DPBX 3N9GL 4JO8A 5C09D 3E80A 5D2NB 1E51A 1LBMA 3NIDB 3HGJA 2X53A 3QWQB 3P6LA 4LASL 2NY5H 2DQTL 1QFWI 3IJ7A 1GPOH 4HHGA 1I9JH 4QTFA 4AEHL 5T5FL 3WD4A 1G0YR 4PLJD 3GSWB 3W5MA 3T55A 2NX5D 3Q94A 4FLOA 2WBWB 1JR1A 4S3FA 3FUEA 2W0UA 2CRMA 2J8HA 4U6HB 3EYFA 4TX6A 4M02A 3BXNA 1NFDA 3EHBD 1LYQA 4H4NA 1KJVA 4LSRL 3UACA 3L1OH 5IMMB 3M7SA 1OGBA 4GZIA 4XBSA 4C65A 4MNMA 3GNXA 5CFAA 2F6KA 1KCLA 3O05A 3WMLA 3QNZA 1JFXA 4C6OA 1AS7A 1IGSA 3NQ8A 1ZHBA 1YMHA 1YYAA 1VJSA 3EFDH 3G1DA 4Z23A 1YEFL 1NIFA 2REQA 4B3KA 4G42A 4L4VD 3AIVA 4GUQA 5DD0H 2D7PA 3GMMB 1C93A 4F7PA 3SEPA 1X6UA 2DQJL 1R3WA 3D2UB 3F7VA 1W31A 2ZICA 4WGWB 4DK6A 3DURB 1GPFA 1FVCB 3I4EA 2JVUA 5D9PA 1ACCA 2FRGP 1L7IH 4QP0A 3AAMA 4U1NA 3WFDL 4WEMB 3BP5A 3WFEL 1DWAM 1QK0A 1QTWA 2EPOA 3FDGA 1FN4B 1YEFH 1X8CA 5FJPA 4YHZH 3U8GA 5CC3A 1AR1C 1XCTA 2YBRB 3FQYA 4N24A 3K5RA 5EBWB 4LDOB 3HM7A 1OCJA 3LB0A 4L4LA 5EA0H 5PCYA 3EWYA 1ZHNB 2KBGA 1QW9A 4S11A 4WKXA 5LCVL 2EUVA 1AKJD 4Z76A 4ZMWA 3L1OL 1S9WB 3BUPA 3V0VA 2C9VA 2Y5SA 4W8BA 4R7VA 3QK0A 4Y9GA 1LL7A 1E4MM 2HKHL 3NDZE 2WCPA 3SGEH 5DC2A 2E6AA 3EDFA 4CVZA 1K2DA 4YSUA 1Z9SA 3LPPA 5LO7A 1VBJA 2VRJA 3P7YA 4BSVB 4LC8A 5HNTA 1D3GA 4IX2A 1MG2C 1OG6A 3LNIA 3QO1A 1XYAA 3DG7A 4Q7IA 2F0CA 1OFAA 1GPOL 2HFGL 5E0QA 4S3AA 3LN5A 2YGPA 1FZMA 3IMTA 1OK6A 4AQ8C 4PR4A 3W2KA 3RL1A 1PZSA 1A4CA 4HWEL 3M41A 4N1EA 1T1XA 4BCZA 3IV3A 5I6XB 4Z0XA 2OJ1A 5IK3A 2C3GA 1ILSA 4OGAC 7ODCA 4QG9A 5KZ6A 2FGZA 2BS9A 2X4QA 1IBDA 4MWAC 1T0MB 5KSBA 3GUFA 3BWUC 1TWDA 1KY7A 4TUJA 2TSYA 5F9JA 3DGGA 2ESVE 2PYFB 4MLIA 1EZWA 3RCNA 4HJFA 3SURA 4HPOL 1BVLB 2C1OA 2RMNA 3BT2H 4PCKA 2ZWZA 4MWAD 2WQXA 3AFLA 2K9UA 3GRWH 1KB3A 4JHUA 1P7KB 3RGVB 3ZHNA 5FDWB 5ES4B 5KYXA 2O0TA 2BWIA 2FK9A 4YO0B 5D5MA 5FESA 4Q6KA 1JV5A 1OYCA 2W5PA 3MJ8B 3TWYA 2QQ6A 3S5LB 1V0KA 2GHWB 3L3KB 4YDIH 3QCVL 2PO6B 3HTWA 4B53A 1K70A 2DJLA 4FP8L 3SADA 3BWSA 4LUYA 3OGVA 4KH2A 2R1YB 3RYMA 3VCLB 1AQ8A 3GWQA 5JBEA 5DLCA 5EC2A 5BCAA 2GDVA 4MNGB 1VYPX 3TN0D 4UV7H 4I5BA 4P2VA 2H32A 4M03A 2YAHA 3Q6GH 4HV8B 1HHKA 2WMIB 4MAUH 3NFNB 4JFDA 1CBGA 4C6DA 1OX6A 3OG6B 1DN2A 1QVOB 5EEWA 3LEVL 3M5YA 1Z89A 2IDSA 3SDCC 3UG8A 5AYIA 5HAOA 1I7TA 3BVDB 5AD0B 1FUYA 4NUJA 1CEOA 1YDVA 3JWOL 4OQTH 1EJSC 2EPKX 2NY3B 2ZBTA 4K7PX 4TSBH 1EX0A 3WFBL 2O5XH 2AEOA 2NZ1A 3O4LA 2I1OA 3CK0L 3ZK0A 2A83B 1U8PB 2DD8L 3H9ZA 3U9WA 2XIOA 2Z1XA 4NP7A 2N7SA 4YPGB 4JZJA 1AJ0A 2ZYFA 4MZYA 3PRZA 4KZCA 4A66A 3KCOA 1GWJA 4BZ2L 1KGYE 3NCXA 4JDEB 2ADAA 3CUHA 3C5ZC 3HE6C 5ECGA 4F7TA 5C92A 3L21A 2Y5EA 4Y9NA 1NUGA 3BAEL 2Y36L 4Z08A 4ADUA 1E40A 4OF6A 3QUZA 4FX7A 3U83A 5CSSA 2OV0A 2DOCA 4Y8EA 2JWYA 3FQXA 3HPLB 2R56H 4JFFE 1DJGA 3TA4D 1JXFA 1LQ0A 3CXDH 3NO3A 4HOXA 1ZA3A 5FUCE 3MLVL 2HZGA 3AHYA 4B9FA 4MD4A 2VITA 3MRRA 3NZSA 3UZEC 1SO3A 5LXVA 3JZYA 1MRFL 2QHLA 3UCCA 3QR3A 4PD4J 3LPWA 3WTWA 4LNYA 1Z1WA 2C4XA 3LPFA 1CWVA 1R86A 3IEBA 3AU6A 4X5QA 1E9PB 1MEIA 4ZXLA 5H1WA 3IFLH 4BELD 2CEQA 3FONB 3T8XA 4EN3D 3HEIB 5I73C 1AODA 1B4KA 1RCQA 4H1LA 3M43A 4IDJL 3QF0A 4WFFE 1RURL 1ZAIA 3D3VB 3IUDA 3MS8A 3ZL4H 3RDJA 4OCYH 4YSPA 3IXTA 5I5RA 3JRKA 2GY7B 3ITLA 3SAZA 1IO4C 1Y0LA 2UY3A 3N9RA 2Y7DA 1EEZA 1U8NB 4FQXC 4Y0GA 3EX2A 1FWTA 1EAJA 4XIMA 3T05A 2HZHA 3PF2A 3ZZLA 1TTCA 4LU5H 5CEXB 4IMEA 4Y9FA 2HMIC 4N4YB 1LWRA 4XBEL 2FYYA 2D31B 4NEHB 3WS3A 4HMEA 5TDNB 1SDDA 4B9GA 3O15A 3KL3A 1JK9A 4YN3A 4RMSA 4F9JA 2J6EA 2J55A 2CNCA 3T42A 2A3EA 1AS6A 2KZBA 5BS0D 4ZDHA 3HRPA 1EHAA 2YD8A 5FR3A 5I18H 5JZ7C 2GJ6B 4AW4A 5I6OA 1ZSDA 4JUSA 4BXVA 5KVFE 3RWJA 4KBPA 1XH0A 1LQ2A 5LHFA 4KQ0A 1TOXA 1K77A 2C13A 4XAGA 4PFMA 5I02A 2JCCF 2A77L 3IFOA 1A80A 3W0KA 3KPLB 3TIEB 3L3OB 4KNUA 2LTQB 3C75A 4Y4FC 5JIMA 5LGJB 3SN0A 4L8BA 3TW9A 4DP9X 2R0KH 4HS3A 3LCWA 1JPST 1AI1L 3EYQC 3K0YA 1R2SA 2HTKD 2PDCA 4WWOA 2J1WA 5EO9B 1A49A 2I69A 4UFHA 2ALWA 2BNQA 2BP0B 3B34A 4ISVA 4AKOA 3FS9A 3GBNL 5C9UA 2W0FB 1DVTA 3HG2A 3DFHA 4JFFD 3VB9A 1H1ZA 3SCWA 4S3DA 3GD1C 5ENWA 1RK6A 5JW3H 2YMTA 4HCGA 1W1VA 2OZ3A 1NARA 3ABOA 3S9YA 1MXSA 1TMHA 4PB4A 2CO6B 2VERN 4G6MH 4M7KH 3EXLA 3C0LA 2P5WB 3QBTB 3OG3A 3R8GA 2OULB 1IAKB 2CZNA 2ISDA 3VTMA 3TN4A 1PXGA 3BPWA 4S1DC 1DQLL 3ABRA 4POCA 4G7VH 3W1QA 4N85A 4KTEL 1NP0A 4HS8L 2WQDA 4N8VB 4AYSA 5GGTL 3VXMD 1G7UA 4UQCA 2PCXA 2OA9A 4KKXA 1TETH 1EHLH 5FWRA 5E1QA 5IHWA 2XRAH 5E93A 2ZC8A 3D3VD 3WOVA 2JKRM 2J1KA 3E2VA 4RW3A 2QVTA 3PWUA 3FQNA 2EIBA 3MI2A 3S36L 3EXRA 3WDPP 1CFSA 2H0FA 1ZHLA 2GIMA 3MRBB 5HDLA 3X12A 4NENA 4MQSB 2RHEA 3PQYB 1KTNA 5EWIL 1SJHA 1UOZA 5DJZB 4UIMA 3RG1C 4OTXL 3LTSA 3GO1L 3KPPB 4XVTH 3F62A 3SE9L 1AXTH 1QASA 3BURA 3EJUA 2J66A 3FOKA 3ULAB 1EUNA 4FQXA 2QQKH 1TPDA 2WB5A 4GAGL 4F2ME 1OEZW 1WAAA 3FFDA 3QDGB 4QISA 1GS7A 3R94A 4P61A 3CSFA 4X4YB 1M7DB 1WT5A 2VXQA 3NGFA 3GD6A 4AAJA 2DZSA 3WBXA 5C6MA 2H0PA 3DENA 2J43A 2AFNA 4PTTB 4ZD3H 3FCSA 2DSUA 4YS1A 4TN9A 1T5WB 1LEIB 1TWIA 4FFWD 2WMJA 4WDUA 3L9RA 5AB1A 4ADGA 4XOAA 2PRLA 4UNLA 4RE2A 3LKNB 4GYBA 4PJDF 3ORWA 3FMGL 3IU4L 1SVZA 4H9UA 2CGZA 2ACSA 1I9IH 4GIAA 4ALAH 2PUZA 4WY7L 1GMEA 1REIA 1UOLA 3EXSA 3KDNA 4QHMB 4AT6A 5L0QC 1EBAA 3FUMA 3P73A 1Q13A 3H42H 1L3NA 1OAXL 5DZPA 3GR4A 4HEPG 3JUYA 1U93A 1W72H 5EF0A 1NDGA 4XXDA 4QLWA 3OGSA 1ZJBA 3F2LA 3LNEA 4GY0A 2SEBA 4DXVA 1XVSA 5I76B 2NYZA 1AYOA 3SKUD 2I5YL 4G8GD 5DI8A 1CGSH 2F5AL 5EUOF 4IOSA 3GRGA 1F1GA 1N6QL 2OU4A 4AENA 2W3ZA 4PJAB 4WO4C 4DLFA 5I6SA 4AI7A 3NSMA 1IT9H 4FQHA 3LDBB 4DFHA 1GOGA 3EA3A 2ZSVA 2FBJH 1OK4A 1S1PA 4AV0A 4LLDA 2O9TA 4PFHA 3RRXA 4FZEH 1TSRA 4MJID 4JTQA 4KW2A 4JKPH 2HROA 1WBXA 3BHBA 3QDGE 3QWRD 2FQGA 3D48R 3NJHA 4GH7B 2DKUA 4WFED 4F2MB 4AZBA 4MA1B 1SMAA 3B8WA 3CZEA 5T33L 4JS3A 1BV8A 2CD0A 1T1WA 3RO6A 3FIGA 3VMNA 2WXHA 1BZ7B 1EL3A 2VCBA 1IM9D 1DBJL 2ZA1A 4O54A 1V54B 2WLHA 4PBWD 2YSTA 1BFNA 3I68A 4JR5A 2BSEA 1EGJL 5HWJA 4ZO8A 3MA7B 3D6GA 1W3HA 1L9MA 1UR1A 4IL2A 4Z42C 3DIDA 4AV5A 1V3HA 4YDNA 1H0IA 2EXYC 5GGTH 4IYKA 1MWOA 1ZBCA 3BJTA 1GTFA 1UP0A 3W7RA 4LLVA 1E50A 1Q6QA 3APNA 4F2FA 2QZ5A 4HT1L 1PYFA 4Y4HA 2Q71A 3A3HA 4RCXA 5KVGE 2PABA 3QI9A 1DJIA 3CD4A 4O51A 5I03A 1TJHH 2EEFA 1G7JB 4K8RL 2ZD0A 5HI3C 1PU0A 4IPPA 2X0VA 5DDHA 1HIML 4BCYA 3TS8A 2R9HD 4TSAL 2G4GA 5IJCC 1MZHA 1TMLA 3GBNH 4KAQL 5IVOA 3PK7A 3GM0A 1U3ZA 3HNSL 2D7TL 3QIWB 2DT1A 3FNDA 3T44A 3GB6A 3BDKA 2CA4A 3PZMA 2JNZA 2KC0A 4Q58C 3RVXC 3V6OA 4MJMA 2V4LA 3RTQC 3R7MA 2BZNA 7PCYA 5KSAA 2XYCA 3CV7A 2JKSA 4L18A 3N43F 1GYUA 1P1ZA 5GSVB 4QNPF 2OT0A 2I26N 3CL7A 3KRUA 1AQDB 4PLOB 3IGXA 4OCWH 2XNAB 4AZUA 3QW3A 3D34A 3KEHA 5I66B 1B3IA 2EADA 3NCBB 1INDH 2YA2A 3BWZA 3JWDH 1P7QD 4IKJA 3D30A 4HH9B 4Z7WB 1XR8B 1C08B 5E9NA 2YAMA 3BH8A 3OWRA 1SW0A 4KROC 1JGLL 2IGFL 2JFCA 1M3IA 4G6JL 5AECA 3HI1A 5K3VA 5IBXA 3Q8FA 2Z35B 3BIKA 5EIIB 2R6OA 4JBSA 4HHLA 4ZFCA 4JZJC 2DUZA 3AS0A 2W9DL 2Y1YA 1WWAX 1A7QH 1PFOA 4R97C 4X0KB 4G7YL 4JO4H 5E94B 5F7WC 3TFKC 1CVSC 3CDZB 4ZX3A 1GTNA 3ZT7A 2HVOA 1S7WB 1AD0A 1V03A 4PL2A 1UWGH 5EO1A 4Y16A 5A2KH 4AY8A 3PZ9A 2LE9A 4GSDL 4GXMA 3PL6C 1ETZA 3B3BA 4XBEH 4JANA 3GU1A 5CBEB 4C6NA 5TQ0L 1WBYB 3NCWA 1E73M 5DRNA 4WQOA 1YXYA 3D1MC 3B2UC 4XZWA 2BW5A 4BI7A 1SDAB 3CVHB 4AHPA 4HVXA 4HYTB 4Z7UE 3CEUA 3KVLA 2ARJQ 2ZYSA 4RKAA 5FJRA 3DETC 4Q4RA 1GW9A 5HNRA 4EPKA 3ES8A 4B9JA 3S35L 3ZL1A 4KI5F 5I8EB 4IICA 1ZT4B 4NC1C 2B0SL 1MW0A 4KTYA 3ZXAC 2AV1A 4FKEA 3UPRA 3QFJB 2EKSA 1T1ZB 4MAYD 5K4ZA 1J0IA 3ARYA 1KLYA 1Z5LB 2Y7SA 4G6FB 4N6RB 5HHPB 4WGHA 1JBJA 2XXMB 5LYRA 2Y06H 4XHJC 4FFZH 2CRIA 2ICES 1HHKB 3QJRB 4P48A 3IDJB 3PPGA 4FMFA 4IRJC 4RNIA 1FH5H 1EDGA 1DUYB 4IG2B 5KVDL 4LCUB 3DHMA 3QYCA 4XNXH 1NMBH 2WXNA 4U6XB 3PHQA 1SLVA 5DFWH 4AJVA 2V3DA 4BHUI 2KZHA 3F5KA 3KOFA 3Q65A 3G6JE 3UTQA 4DETA 2VLKE 4M8VA 2QUNA 2APXA 3UTSE 3R2GA 5HD8C 4TQTA 3GSMA 3WF2A 4O1FA 3IKCA 4FR1A 4G59C 1O5QA 3MRGA 3QYMA 1ZPUA 3RJDA 1RALA 2I5GA 2A0NA 3D6NA 2NXHA 3N2BA 3NJLA 4LW7A 3D85D 4IP5A 5HGDB 1IC7L 4U6VL 4URTB 4Y5XA 4BKTC 3S97C 3KZ8A 1OX4B 3S1GA 2ZOOA 4LFHG 3PJXA 3AG4B 5E03A 1UT2A 4H8PA 5KN5A 2PC4A 2KL6A 3CN1A 3G3LA 3WFBH 5L8LB 4PRHA 3G8RA 4XVSH 4YHKH 5KITA 1MI3A 5LKNA 3DTXA 4MFDA 2ZXAA 2CZVA 3PWPD 3F84A 3QH2A 4J35A 2W4XA 4WD0A 5EN3A 5FF3A 4CD6A 1TZIB 2X1PA 4JRXA 1RQHA 2VITB 3MRRB 4PJBF 4NJGA 3RJXA 2GITB 1IAIM 5D04C 3B4NA 5FF2A 3P82A 4GFSA 3SYPA 2ATMA 2VJ0A 3K8LA 2YPKB 4LDLB 5KJ4A 5A2IH 2MANA 1ZV5A 2MMXA 1R24B 1E3XA 1QABA 4EVNA 4JQ1A 2JEPA 4R27A 3DFNA 4F7PB 4EDWH 3FONA 3T8XB 2DIKA 2IO5A 2PB1A 5KVDE 3TEYA 4MLRA 4AF0B 3NQKA 3RVVC 2XY1A 5D1XB 4GA8A 1IZJA 3QCVH 5HHMB 2G5WA 1RK7A 4OW6A 5D7IF 1XF5B 1YN7A 2A6IA 5C07B 2BOGX 3GNMH 2Z7KA 3IXTB 4O2CB 4POZC 1E42A 3TEWA 2XWXA 2OVLA 3AADB 4NQVA 4YIQA 5HJDA 4BE6A 1XF0A 4GIRA 2R23A 1QLFB 2WW8A 1UWXK 1P0NA 3SY1A 3FO1B 1SSDA 1N68A 2OXGA 1E27A 4OBSA 5K9JH 1QVBA 2VVNA 1OIOA 4X9YA 4N42A 5ILTL 4K39A 2HVJB 1WIOA 3EYOB 5FGBA 2R2EB 3D4CA 1KYDA 2KDGA 5DZAA 5B8CA 3UCDA 5MI0C 4BUQA 1MY5A 1RAMA 4DF1A 3WH6A 3DAQA 3EJQA 2NY6B 3AROA 1S3KH 1BREA 5JHBA 2P53A 4XP9H 4JFZH 5D71L 1ZRQA 3C0SA 1MDRA 4DWSB 1AG1O 2OP4L 2R9HC 4E5XG 3GR8A 3OTTA 4K4KA 4OZIE 2AXWA 2DQHL 3GS0A 4ZPTA 4RZ4A 1NGYA 1QSEA 1QCWA 3G1FA 3HOGA 3V5KB 4XP1L 5K9QG 3W72A 1KTRL 1KCZA 3LNGA 4CD7A 2F1AA 3A0OA 4ZQTA 4KITB 2AANA 2VDRB 4KHXL 1OCWH 2ED6A 1RFDL 2GUOA 2QLVB 2W07B 3IDIA 4ESKA 1EOMA 3RNQB 5T1LD 4U3SB 1FDZA 2E4TA 5MP6H 2OPJA 1CX9A 3G9VA 4M3KB 3CPUA 4D6HA 2W60B 3HRZC 4OCLC 2YPIA 4L3CA 2FWUA 4PRID 4HS3B 5HUOA 3FRPB 2NY1D 5ELIA 5KTEL 3NCYS 2I7OA 4GAJH 2VR9A 5J12B 4FAMA 5LZLA 4DYJA 4KRPB 3HMJG 4Z95L 4G3YL 4QUOA 1KIRB 1VFBB 4C7FA 3DX4A 4F0HA 3FDKA 4HWBH 1Q9WB 4LP5A 4ZPVA 4RZ5A 3IPBA 2W0FA 4E9XA 1JEZA 3VTRA 5IVXF 3WNKA 3VCNA 1KENL 1H8NA 3W29A 3I6GA 2PO6A 3QC6X 4NILA 3QJXA 2UX6A 4ZOAA 4ONFL 1L6WA 3NQGA 3QW4B 3W7NA 2EXWC 5JXAL 1H3PL 2LV4A 2YQ3A 4IU2A 1IGTA 5JXAH 1KR1A 2ATAA 3CHXA 4JYFA 5JIWA 4U1MB 1HXMA 2B0MA 4HJ0D 3V0EA 4HIPA 1AH0A 2DUAA 4N8VA 1C16B 1HCVA 2W79A 2YW4A 1P84J 1BQSA 4MMZC 3WJZA 1XIIA 3LZFL 4HLJA 2QYGA 3QXUA 1QFWL 1IAOA 2GJRA 1GOQA 3H53A 4TQEH 3V5DA 2RAMA 1N7ML 4K3DH 3PANA 4UTBH 2PETA 4Y2DA 1O5XA 3MZGB 4P7RA 3V4VL 1XDJA 3E5PA 3G1VA 5T9CE 3P3RA 3B2MA 3ARTA 1W9PA 3KM2A 4NM4L 1M01A 4PC8A 5LBSH 4FABH 5IMLB 1XWVA 4JO1L 3EAKA 4FP1A 5DZVA 4D9PA 5MP6L 1TPUA 1UGNA 1MJUL 5CGYC 5B1BB 4UIMB 3WELA 4AEIL 5C1MB 1KCUH 2EEDA 4BKLB 4Z6AT 3AT0A 1YIXA 3WNMA 4YDKL 2D73A 4F9LA 1U95B 1A6UH 3QJZA 1HJCA 1AOZA 5FLVA 1YEWA 8CGTA 4F7TB 1EUTA 2GTWA 3FFDB 3IWUA 2Q8AH 2IQDA 2YL8A 3DTUB 2AQWA 1KBWA 4NHCH 3QUZB 4FQ2H 3PJLA 1BF6A 3CHCA 4L9XA 5E95B 3L4YA 1T5WA 2QV5A 2OWWA 4PBFA 3PPSA 3TO2A 1UMYA 2VLJB 3L66A 2XVLA 4A04A 3PJUA 3SY0B 3WCYA 4APXA 4U1LB 4NKDB 1XGQA 2D7QA 5DHXB 4F15B 4CEUC 4G8EB 1A0EA 2KAUC 2PTWA 2V33A 1HE8A 1J48A 4OZHB 2O93L 2EH8L 2Z29A 3ROLA 3HU7A 1RZ7L 3UAFA 1W0WA 5ALCH 3BKYL 4Y5YC 3C2VA 3MU3A 4YCPA 1VA9A 1YDNA 1NCUA 1Q0YH 4DAGL 3QKEA 3O2WH 2PLKA 5TIMA 3GMOA 3W2DH 4MXWL 4U2ZA 1ICPA 2YSSA 4G8GB 4ZXOA 4JHAH 3FSZA 2FTAA 4DQOL 1G6VK 4QXTA 4X8CA 4XE5B 4EP8C 1EEZB 1U8NA 4ADTA 1K72A 2VQ1A 3W38A 2NW3B 3DKHA 5E6YA 2V2HA 3NJ3A 3ZIYA 4XNZB 4I48B 1VD6A 2ZIDA 3KWWA 3V6ZA 4I0PD 3UXAA 3C08H 1GZHC 5DUML 1ZPLA 1CLVA 2IKHA 4B91A 4X9FA 2R29H 1J12A 1E6QM 4DJEC 3P9LB 3KW8A 2WQSA 3MW7A 1SY6H 1CB2A 4WEBL 3QRGH 3ZJ8A 3KPTA 1E6OL 4OLUL 1AHWB 2NXYB 3MCKB 3FHAA 3K1GA 3APGA 3HMXA 4IKLA 3ZWTA 4N2NA 3WX7A 1FHUA 4Q3MA 5HYSB 5JYLA 3C09B 5A3HA 2R2BA 3OGRA 3ISYA 3UBXG 3GIYA 2ZWNA 2XJKA 2CKBH 4HJGB 1SM3L 4Y16C 3MA7A 5FGRA 2NWRA 2AJSL 2GI0A 1TNMA 3C3NA 5IVNA 2EE9A 4PRNA 2J25A 4X7SH 3G77A 5FEZA 1DORA 2HFEA 1FH2A 1P1VA 2QQLH 1X44A 1DE5A 1EAPB 5JHMA 4B5UA 1B4JL 2V2WA 1JZ5A 1OTSC 1WAUA 1XG3A 1QFUL 4L8BB 1HFBA 5CC5A 2AKRA 4HA3A 4HKXA 2WHLA 4PRIB 3GSUA 5K33A 5CM1A 5C0AB 1QBMH 2G3ZA 4K94C 1BMGA 4XNYH 2YD9A 3XIMA 3AQXA 1KBKA 3IF1A 3PWJB 3GK0A 2E5BA 1UM5H 2ZSWB 5DDHB 3UZQB 1MHEB 2WSPA 2A6JA 2WBJA 1MJ7H 2F53A 5D7SL 3RXZA 2X1SA 1KDIA 3L1GA 2CM5A 3KAAA 2Y5TB 2I9LA 1RK0B 2J5LC 5IM7A 4B96A 1XBXA 1IZCA 4GGBA 4CCDA 5F1VA 1A47A 4NO5A 1NLBL 1YEEL 2X6VA 3EEZA 1VCAA 4WI7A 1XR2A 1KZYA 4GVHA 1FLRL 2XQBH 5HHXL 2Y1VA 1BXUA 4CU7A 3MSGA 4PIBA 2C9PA 3S37H 1UB6A 1M7JA 2GUYA 1UP3A 3KR3H 1HXJA 2AMGA 2I5IA 2NY1C 5I1IL 4C54A 5DVKA 4R9HA 2BSBA 3PUOA 3JVAA 3LHWA 1S78D 1ZTXL 4GW5A 1HC1A 4NNPL 2LAAA 3BH8B 3Q1EA 4EXKA 3PG8A 4HSCX 1SLWA 1UACH 3TYAA 4IBWA 1JZFA 4CNIA 5DMYA 3ZDZE 5K9XA 3THUA 2PC8A 1HNYA 3IFPA 3AACA 4LHQB 3LZRA 1YNYA 3WBYA 4XBPB 2IW0A 3SDDC 5KVEE 1WKDA 3T0WA 3AGWA 5FA3A 3FHEA 3MKVA 3X12B 1FA2A 3ISRA 1XYBA 2I14A 3SRKA 1J5OL 2FATH 4XAWH 5K69A 3S88H 1HYSC 3N17A 1GYWA 4H4IA 5J04A 4MZRA 3H2OA 4WWKA 3RNDA 4OD2A 3QY6A 2J12B 4IGSA 4ZQRA 1I31A 1YTEA 4QR6A 1HILA 4EZKA 2YXWA 1UATA 1WBYA 4MFEA 5BXPA 5FYJD 5A16A 1EJ7L 2NNXA 3CAKA 1G4PA 4HOWA 4HK6A 1RUML 4HISA 3SB0A 1KYFA 1JHLL 1LEIA 2H2SD 5F1OB 2IANE 4M4RA 4PJ5D 4ZFQA 1W0VA 5LG6A 2N4IA 3E49A 3WY3A 4HA4A 5JBDA 4F9PC 4HJSA 3Q43A 4LLAA 4APQB 5JYMA 2CR3A 3LKNA 1ZE3H 3I3DA 5EIVA 4WF7A 4LVFA 2FGWL 3HQPA 3THQA 4C6FA 1NFDB 1XL4A 2ZOKA 4HXAL 2VEGA 2FWOA 4K07A 1Z5LA 4N6RA 4NKIH 1U2CA 2J27A