3IJ8A

Directed 'in situ' elongation as a strategy to characterize the covalent glycosyl-enzyme catalytic intermediate of human pancreatic a-amylase
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
496
structure length
496
Chain Sequence
b'EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Directed "in situ" inhibitor elongation as a strategy to structurally characterize the covalent glycosyl-enzyme intermediate of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 180
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3ij8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ij8A01
3VGEA 3QGVA 1EOKA 2PWDA 3CHFA 3M46A 1D3CA 3D51A 1TQUA 3DHUA 3EDEA 1CECA 1EOMA 3APGA 3BAJA 3I3DA 2XSAA 4F79A 4W93A 2Y8VA 1GQIA 2VX5A 4CN6A 3GZAA 3VU2A 2BNJA 3WL0A 2HISA 2IUZA 4UFJA 2WYSA 4ZE5A 4DUVA 1ITXA 3TTOA 5LA1A 1UR8A 4D1IA 5LA0A 2D22A 1EA9C 4HTYA 1FP9A 4JHOA 1J0JA 4GXPA 1QNQA 2D23A 4BQ2A 1JFHA 1V3IA 3ZOAA 4DUXA 1CGTA 3CV5A 4Z2LA 3WD3A 4UFHA 3MUY1 4N42A 1HJQA 3T0BA 4H8UA 1V6UA 4Z2GA 2WVVB 3N12A 2G41A 3WY3A 4WLCA 1EDTA 1JYXA 4QLKA 2PWHA 2ZUSA 4PCSA 3ARVA 1MFUA 3G6LA 1E72M 4CU6A 3U7VA 1J11A 4HA4A 3MI6A 1BYAA 1MW1A 4Y7EA 1W2PA 1QI4A 4GZJA 4LQ1A 3D3AA 2WMIA 1Z32X 3BSHA 4R5EA 2UY5A 2VZSA 2XYLA 1LL7A 1KXQA 3LRLA 3BVTA 1KFWA 1ZL1A 3QHMA 4RE2A 4A3YA 1W9XA 2VVNA 1MQQA 3WFZA 1QX1A 3CUJA 4AYGA 1UKTA 3RJXA 2F8QA 4UFLA 4WK9A 2BY1A 1OD8A 2F7OA 1OCQA 1LWJA 4H7VA 3BCDA 1KXTA 2W67A 4ACYA 2XVNA 3DYMA 1HN1A 1VB9A 2XIIA 5TD4A 3WUBA 5A2BA 1K9EA 1OIFA 1E73M 1TVPA 2A3EA 3WD2A 4AEFA 3UETA 1TQWA 2VZTA 2FE0A 3AYSA 4GO9A 1X6LA 1WKYA 1E0WA 2QPUA 4ZENA 2UY3A 2BY0A 3II1A 4CU7A 1JZ4A 1G9HA 1DTUA 3N13A 3AIUA 5CZKA 2ZXBA 4UZSA 1HJSA 1UD4A 3D4ZA 1HKJA 3ARSA 5D9OA 2XWDA 4UR9A 2OLHA 3WH9A 4AD5A 2D2OA 1SFSA 2ZX7A 1EO5A 3UERA 1E4LA 3I3EA 1M03A 3DDGA 3AJ7A 2F7RA 5DF0A 4MDOA 1PX3A 3GNPA 5CXPA 3SIMA 2J25A 4DUWA 2ZX5A 3SUSA 1K9TA 5CJ5A 3VX1A 5ABHA 1H0IA 3WL1A 4KWUA 3W6LA 2IXVA 4QP0A 2PI6A 5A8MA 3ARZA 1DHKA 1RP9A 1GOMA 3ZT5A 4JFSA 3OGRA 1KCLA 1E1FA 5GQBA 4D6FA 3IANA 4M81A 2W91A 3D50A 1HP5A 4BA0A 4JFUA 4JKLA 1KXHA 3WNPA 2QV4A 5IFTA 4PTVA 2YDRA 1KGXA 3LMYA 4AY1A 4YHGA 1TE1A 1A3HA 3KL3A 4W5ZA 2O9RA 4HMCA 5DFAA 4AEEA 1Q6CA 1H11A 1PZ2A 5FOOA 1J01A 3WEMA 1I1XA 1V0LA 3E1F1 2WVSA 1GONA 1GUVA 4JFVA 4B9YA 2W61A 1CGWA 4CU8A 2XUCA 1UD3A 2WKGA 3GYCA 1VFOA 1BAGA 2D3NA 2FH6A 4AISA 3DHPA 2VQTA 1DEDA 1W3LA 4QFUA 1OBAA 3FW6A 3WBEA 3WQ6A 2FGZA 3A47A 1QPKA 3L4VA 5CLWA 3CTTA 1UWQA 2X2HA 3CH9A 1EQCA 3DX3A 4W8BA 1JL8A 3SCOA 1RH9A 1V0NA 1GOQA 3VD3A 1QHPA 1N82A 4IPNB 1E6NA 1VRXA 3MS8A 3W29A 3GXDA 3QOMA 4AMXA 4UQCA 1B3ZA 3CUIA 3AIBA 4OOZA 1L0PA 1NP0A 1NP2A 4PMYA 1W91A 2DPEA 1KB3A 3VMNA 3FHAA 2NW0A 2YL9A 1XV8A 1ISWA 4M82A 4HU8A 5E0FA 3WNOA 1MWOA 4GQRA 3EJTA 3ZJ7A 4JFTA 2WXDM 5GNXA 3DDFA 4LX4A 4PBGA 5E70A 2C7FA 1KCKA 2VOTA 3GNRA 1TZ7A 1JGIA 1VJSA 4P7OA 1XGZA 1QI0A 4U2YA 3VIIA 3HG2A 3LPOA 2WMFA 1QI5A 1PBGA 3CZEA 4H8HA 4U5KA 3CMJA 3H53A 1GNXA 3VTRA 3VINA 5CPQA 1C7SA 1ESWA 2DDXA 2J47A 2YL8A 4RL3A 1DWJM 4J3WA 4CN4A 3WF1A 3A24A 3WNLA 2BS9A 1XH1A 4Z2IA 5IHSA 4UQEA 3VIKA 2JIWA 1UOKA 2JF6A 2J4GA 5CLTA 3WNMA 4CVWA 1OINA 1C91A 3OLIA 2GFTA 1VJZA 2Y8KA 3SUUA 1LQ0A 1US2A 4EKJA 3LXCA 2J7DA 1JYWA 1E40A 4OGZA 1AMYA 2FYVA 2O9TA 4QAWA 2WM0A 2G3MA 1E3ZA 2OSXA 4HP5A 2VCBA 3BLKA 4H04A 3SURA 3AISA 1M53A 4PSPA 1W9BM 1JF6A 3EJRA 3SCUA 4UOZA 2WVTA 5BXSA 2PB1A 4NSBA 2VR4A 1LL4A 4HOWA 4YHEA 2DQXA 2W92A 1S46A 2GJXA 1RP8A 2YFNA 3K8KA 3WF4A 3AMCA 5FKYA 5BWFA 4MB4A 2WAGA 3B8SA 1JG9A 1Q6GA 4AZCB 1JFXA 3BAXA 3B9EA 4M8UA 2ZXAA 2FHBA 4ATDA 3MSDA 1MXGA 2X1IA 3GBEA 4JL1A 3ARTA 2YJQA 2CBUA 1GJUA 2ZXDA 1CXIA 3VDCA 2EEXA 4JAWA 3RPMA 1UQZA 2E8ZA 4XZBA 1UKPA 1NM9A 4BCEA 5A8NA 2WLZA 4WSJA 3OZOA 1C3FA 3ZO9A 2Y5EA 3AMGA 4D72A 4U3CA 4MNLA 2YKKA 2O92A 3IGUA 1QHOA 4PCTA 4LYRA 2CKRA 3BAYA 2VZOA 5HNNA 1E5NA 5ECUA 2VNCA 4BS0A 1JD9A 2V3DA 1UZ4A 1B90A 1GOIA 2X2IA 4TTUA 1CXEA 2ZUTA 4V2XA 2ZE0A 4PYSA 4X9YA 5E6YA 1GZJA 1V6YA 1NWSA 4AZBA 3W24A 1LG2A 4PMNA 2GVYA 1UYQA 2J7HA 3WH7A 5CG0A 1R34A 3U5YA 2ZOXA 3T2PA 4DWSB 3AMDA 3WELA 2CNCA 3AHVA 3DX4A 2JIEA 2DSWA 4A3HA 2CHOA 2O9PA 2O9OA 3T08A 3WH8A 1JI2A 1WPCA 2WSKA 3IJ9A 1C8YA 4U33A 4AD0A 3EYPA 3BUPA 3BAKA 1OSEA 2WKLA 1JAKA 1UH4A 2DSKA 2VCAA 1E4NA 1CGXA 4P7QA 4X0NA 1XCWA 2WWDA 1CNVA 4PMDA 4V27A 4HOXA 1W32A 4FNUA 4WKAA 4ML4A 1ZJBA 3VOCA 4UOJA 4P8VA 3WH6A 4XB3A 3NDZA 3CUHA 1TMQA 4KMQA 2ZWZA 2VC9A 3A6OA 3BGAA 2ZUNA 4AC1X 1UWTA 4DWSC 2VX4A 3CZSA 5HOSA 2F18A 4HZ6A 4ZXOA 1FA2A 3TTSA 3SEPA 1HX0A 1E1EA 4P8XA 1QBAA 3PBGA 3VSVA 5BXTA 2QPSA 3HZ3A 4PMUA 2VR5A 1SMAA 1E6PA 3NSNA 2UY4A 1DWFM 4D6EA 1BSIA 1W1PA 3W37A 2GDUA 3N18A 3TONA 3GH4A 1PZ3A 5ABFB 1CXHA 4ACZB 5F7UA 3BUIA 1FH7A 4P7RA 2X8RA 2PBOA 1NWTA 1WE5A 3VM5A 2ALWA 3A23A 1PIGA 4J3VA 4HMDA 1W9PA 5I5RA 1LLOA 7TAAA 1AVAA 4CD7A 2GUYA 4XUYA 1HL8A 3AOFA 4ZXLA 2VTFA 1Q6EA 2NT0A 1IV8A 4UOQA 5FL1A 2DT1A 4GIAA 2WHMA 2WWCA 1WO2A 5CSYA 1W9UA 1V3HA 2HVMA 1NH6A 2PBGA 4OBRA 2VRJA 3WF0A 5A6LA 3WQWA 5ABGA 1E9LA 4D71A 4CCDA 3EMZA 4CD5A 1UR2A 4P7LA 5CGTA 3WNNA 4BZYA 2E3ZA 4JCMA 5E1QA 1V3MA 3SCSA 3K46A 2ZX8A 3F5LA 5A8PA 2EQDA 1ZBWA 3A3HA 3TOPA 1E6ZA 1OGSA 1ZBVA 2EPLX 3B9DA 4E8CA 4GI9A 1GJWA 1JZ5A 1HKMA 1V6VA 3GNOA 3AHYA 2EPOA 2WW5A 5E6ZA 1J0ZA 1C93A 1C7TA 5IFPA 3PTQA 2V3GA 1O6IA 4CUCA 3PZUA 1R7OA 2VI0A 3WD4A 3WMBA 1JYVA 3OG2A 1C8XA 2WZEA 3CZ8A 1ZB5A 2VX7A 1NWRA 4W7VA 3WY4A 2DIEA 3VIJA 1TQTA 4MDPA 5AY7A 1GQJA 5JBEA 2EACA 4MB1A 5I2UA 3WDQA 4HPGA 1PAMA 4KGLA 4D6JA 1G1YA 3F4VA 1KWKA 3EBVA 1J0IA 3AS2A 4FNSA 3SCTA 3AIEA 1UD2A 4TX8A 1UWSA 4UQ9A 3UEQA 3SCRA 1VFFA 3DYPA 4W86A 2XN0A 1J0KA 4Z2JA 1CLVA 1XRVA 3VD9A 4W85A 7A3HA 3AHZA 1K9DA 1WAWA 5FL0A 5DO8A 1P6WA 4AWEA 4HZ8A 1B31A 3S5ZA 2DEPA 3FAXA 1M01A 3L2MA 3WFLA 2IXUA 2F7PA 3EMQA 3QR3A 1JIBA 2XN1A 3BLPX 1ISXA 4M80A 3W38A 2ZUMA 3AHXA 3VNYA 2D1ZA 1BLIA 3LXBA 5JBFA 3VKKA 2D0FA 4W88A 2EXOA 1JD7A 1E70M 4UFMA 2VT0A 1WDSA 1B2YA 4AD3A 1ZU8A 2Q8XA 4RE4A 3VD4A 3SCNA 3AIVA 1UR0A 4YN5A 4AD1A 3VGGA 1UH2A 3EDKA 4JZ5A 3VVGA 1QNPA 2J79A 1JXJA 3GXNA 3DC0A 5BRQA 4ATWA 1X6NA 1PJ9A 1KGUA 1HJWA 2Z1SA 3UG4A 2YIHA 4PMXA 3EJSA 2E40A 2FHCA 2EBNA 2XJ7A 4MNJA 1BVZA 1HVQA 3M6DA 1HXKA 3BMVA 2RGMA 3PZOA 3AS3A 1XCXA 2Y2WA 5A3HA 4H8VA 5I79A 4Z2KA 3DX0A 1KTCA 1E5JA 4LGXA 2G3NA 3NDYA 4L4PA 3F5JA 3VD5A 1W1YA 2OYLA 2ZUWA 5LA2A 1X1NA 3UR8A 1LG1A 4MAZA 3CMGA 1CXLA 4UFKA 1UWIA 1FP8A 1TA3B 3HJEA 1J10A 1FFQA 3ZSTA 3WY2A 1O7AA 3MV01 1KQZA 1RPKA 1FOBA 1KBKA 1ZJAA 5A8QA 4NF7A 4RE3A 3POHA 1HNYA 1UD5A 3CPUA 4NXSA 5D9PA 1Q6FA 1TVNA 1HT6A 2W63A 2XGIA 4K68A 5D9NA 5BXPA 4B9ZA 4UZUA 1KXVA 4HU0A 1CLXA 2WHKA 3T09A 1BPLB 3SCPA 2EABA 1EXPA 4LXFA 4XZWA 1H4PA 1H49A 3IJ8A 4Z2HA 1W2VA 3GH5A 4JL2A 4BQ5A 1ITCA 4AZCA 3RM8A 2EO7A 1ISVA 2YA1A 4PMVA 2YBTA 4V28A 1OGGA 4MTVA 3BUBA 2QF8A 1TQSA 2DSUA 4PMRA 2XSBA 1LL6A 1W9DM 2F7QA 1ODUA 2GSJA 1E71M 3SCWA 3VPLA 1BF2A 1M7XA 4GI8A 5AYIA 4CN1A 3D5HA 3N04A 4AZGA 4NRRA 2XPKA 4R27A 1JZ7A 1WZKA 5KEZA 2ZIDA 1B3WA 4EK7A 2VMFA 5CQ1A 1W9VA 1SMDA 3EDJA 2WMIB 4UTFA 3OLDA 2QHAA 3BC9A 3NYDA 4HA1A 3HN3A 3WQ8A 3NIYA 3LX9A 1WZAA 5I0DA 1ZBKA 3UG3A 8CGTA 2BFGA 5CPSA 1JNEA 5EFDA 4FNPA 4PUDA 4J3XA 4TVCA 4W7UA 1C90A 4PRWA 5BRPA 1U30A 4WJXA 3WQVA 3GXTA 4N0RA 4IISA 1OT2A 1B9ZA 1JZ8A 1PS3A 3T0AA 1QW9A 4KRUA 4GZIA 5FIPA 1QOXA 1J0HA 1HXJA 1EH9A 2B31A 2YDSA 1WB0A 3WENA 5E9AA 5GNYA 2XWEA 4AD4A 3HG3A 3LPPA 3L4XA 3KE0A 1QI3A 3KEHA 5I77A 3L4UA 3WDIA 3AI0A 1E6SM 1KGWA 1VEMA 3BAWA 3WDJA 1E56A 1JZ3A 4TTGA 3GXMA 1DWGM 4M29A 2UY2A 1VEOA 4QDMA 2VRQA 3JUGA 1XD0A 4A4AA 4F8XA 2OSWA 3HG5A 1H5VA 1VAHA 3BUQA 2DGAA 2J78A 3BLBA 4AZHA 2CESA 3ZJ8A 4XV0A 4PSRA 4BQ3A 4B3KA 2XVLA 1GQKA 2EPKX 3RIKA 1V3KA 4CD4A 3N17A 2YA0A 1E6QM 2CBIA 3LPGA 2OW6A 5ABFA 4ACZA 4GQQA 3F5KA 4UNIA 3N9KA 2X0YA 3T2QA 3S5YA 3DECA 1PEZA 3KZSA 3OGSA 2VZUA 3AHTA 1QHZA 3ZSSA 3NCOA 2X2JA 4AW7A 3ZJKA 3WUGA 3HU7A 5GNZA 3RM4A 1UQYA 3T2OA 5HPOA 3CC1A 1E0XA 3POCA 4QCEA 5AC4A 3W53A 3AXHA 2VQUA 4OOUA 3AYRA 3UG5A 2BXYA 3LRMA 1BG4A 2Y4SA 4MB5A 4FK9A 3TTYA 1I1WA 3SCVA 4OJYA 3NSMA 1UKSA 4IM4A 1TCMA 2JALA 4JHZA 2WC7A 4PTMA 2XFRA 1Q6DA 3WEZA 3A5VA 2EPMX 1E15A 1LWHA 4EAMA 2BVYA 4AZIA 2E0PA 1GVYA 3TTQA 3RILA 1TUXA 4TVUA 1CENA 3ZT7A 4MPKA 1WNOA 2IGTA 5A6BD 7CGTA 2A3CA 1QWNA 1LJYA 1CPUA 2XGBA 3OB8A 2J8GA 2CBJA 3N11A 2XHYA 2BVDA 3WF3A 1NOFA 3WMCA 1TQVA 3L4WA 3NSXA 2WVVA 2J7BA 1V03A 2WANA 5JIPA 2PF0A 3MANA 1E4MM 2EAEA 2YLAA 5DT7A 3AZTA 1XSIA 5BCAA 3VIHA 2VURA 1UA3A 2XIBA 2QMJA 1H0GA 4PEEA 3K4DA 1GCYA 2CHNA 4DWSD 3FY1A 1GVIA 3ALGA 2VJXA 3VGHA 2QLYA 2NT1A 4CCCA 4AIOA 1OB0A 4FMVA 2CITA 3ZMRA 5AC5A 2CETA 2C0HA 3VDHA 1JZ6A 2WC3A 1DP0A 2ZWYA 2G3IA 3A22A 4W84A 1PPIA 1V3JA 4LYQA 4PTXA 1PX4A 4C7GA 1EHAA 2WC4A 1Q4NX 1XC6A 4JKMA 3L2LA 3PHAA 3EDDA 2VRKA 1ZS2A 1VENA 1R86A 1KBBA 1UR1A 2FHFA 3AMKA 4GZEA 1W1VA 2E9BA 1NARA 3ARYA 1WZMA 3W27A 3GDBA 1RD6A 4FLOA 2A3AA 1U33A 4D1JA 8A3HA 3QOKA 2YA2A 5A6KA 1IZJA 1CBGA 4JKKA 2PWGA 1E3XA 3WF2A 1TFVA 3S2CA 1CXFA 2XM1A 1MW0A 1XHGA 1EDGA 1EIBA 3VX0A 2VX6A 2XG9A 2CCRA 3U5UA 4CD8A 1UR4A 3MMUA 2WK2A 4M56A 2CXGA 2GK1B 1CWYA 2BV9A 4KH2A 2OYMA 5I23A 4HZ7A 1R8LA 5D4YA 2ZUUA 2WHJA 3W28A 2D3LA 3RCNA 1AQ0A 1XH2A 4E2OA 1EGZA 1D7FA 3GH7A 5M03A 4NX0A 5HDRA 2GJXB 5JUVA 3VUPA 1W3KA 1ISZA 3I3BA 3CZLA 1JYNA 3MO4A 4LPCA 1U2YA 3ZQ9A 1CYGA 2OW7A 4WIWA 1VF8A 3NJ3A 1H2JA 3BCFA 1BG9A 1XYFA 3IAPA 4AZ7A 1B0IA 4B16A 5M17A 3IJ7A 3GBDA 4ZEPA 4B15A 1CGVA 5CGMA 2CERA 4WKHA 5LYRA 3MKKA 3KLKA 1JDCA 4U3AA 3U57A 2X09A 4U5IA 1UASA 1XSKA 3OLEA 1CGUA 2G3JA 4CD6A 3OA5A 3WNKA 4OKDA 1VBRA 1JAEA 2CBVA 2WZHA 2PWFA 4P8UA 1W3JA 3WDPP 5I78A 4JCLA 3VDAA 2DT2A 3J7HA 3ARRA 1F4AA 2WMKA 1UR9A 1UKOA 5BXRA 4OZOA 1OM0A 1V0KA 3DX2A 1R87A 4E8DA 2WCSA 1WDRA 4FNTA 1G94A 3OLGA 4HA3A 2ESCA 2YL5A 2YFOA 2A3BA 1GHSA 4OBSA 2YBUA 4W89A 2W4XA 3WH5A 4W8LA 4U2ZA 2CKSA 3CBWA 4F9JA 5D8ZA 2E8YA 5ABEA 3H55A 3WD1A 2BHYA 5M5DA 1E6RA 1CTNA 3IAQA 3OGVA 2WVUA 1R33A 3FXYA 4WSKA 1XH0A 4TXEA 4DO6A 3GM8A 1GOKA 1TR1A 1VIWA 1KR1A 1K9FA 4AIEA 2WMHA 3CHEA 2J7GA 2XVPA 1B30A 1HJUA 2W66A 2DT3A 4WF7A 2WBGA 4GINA 2OWXA 3QHNA 5DMYA 3ZR5A 1NOUA 3AS0A 3M07A 3WSUA 2FDMA 4M1RA 2E4TA 3BAIA 2V38A 1WP6A 4U31A 2PC8A 4ATLA 2YOCA 1HJXA 2DH2A 3T0DA 3LXAA 5IDIA 1EHNA 1NOWA 3BVWA 4E4PA 1FHDA 1GPFA 2BVTA 2AOSA 2RGLA 3S6TA 2DSZA 3MSGA 5JBDA 1KWGA 1D2KA 4M24A 3MV11 3L4ZA 2FGLA 3BUDA 1KTBA 4D6DA 3TV8A 4FNRA 3W6MA 2XM2A 2J7EA 4HPHA 3RMEA 5A6AA 2X05A 3W81A 2JEQA 3BXWA 2D0GA 2E9MA 5EBAA 1FH9A 1VFUA 5GPRA 1XD1A 5A2CA 2J75A 1H3GA 3MUAA 1E6XM 2BXZA 1G0CA 1UWUA 2ZX6A 1UD8A 4UQBA 1B3VA 2F1AA 3CZNA 3AQUA 1B1YA 4FLQA 1MYRA 1MVYA 1V3LA 3BH4A 1E43A 1JNDA 1J12A 3AFBA 3NUKA 3KL5A 3VILA 3D4YA 3PZVA 1MFVA 4W87A 1VBUA 4PUEA 2UWFA 2WCGA 3AZRA 1HJVA 2AAAA 2CEQA 5IHRA 2C8NA 2BY3A 2GJPA 3CZJA 1R85A 3GXPA 1ISYA 3ZM8A 2WB5A 1G5AA 2J62A 4D6HA 1UD6A 2VVSA 1PIFA 1AQMA 3ZJ6A 1JDAA 4J7RA 1YQ2A 3VNZA 3BMWA 1EDQA 1QNSA 1JF5A 2J7FA 3L4TA 3AXIA 2WSPA 3UCQA 3WMSA 3RM9A 3WD0A 1R7AA 1MW3A 3MUZ1 3VIOA 3K8MA 3ZT6A 4MJ2A 1R75A 2F61A 1MXDA 2YL6A 2WBKA 2XVGA 4UFIA 4GKLA 2XVKA 1O7DC 4GO8A 3BVVA 3GXFA 3A4WA 4AMWA 4NZFA 1XSJA 2D20A 5I6SA 3MMDA 2D24A 1V02A 1BVNP 2BHUA 3PZGA 3THDA 3W4RA 4EE9A 2GJRA 1WDQA 2WMGA 2FH8A 1M04A 4TOQA 3PZMA 1CDGA 3L4YA 3VMOA 1UUQA 3RO8A 3VIFA 1GW1A 4PMZA 1US3A 1UA7A 4OIFA 2WMJA 2X0HA 4D6IA 2ZUVA 3ARQA 3VDBA 1NWUA 3VSUA 3MMWA 3KWXA 1KQYA 3CIVA 5CSUA 1I75A 1SYTA 2F1BA 2ZXQA 3GXIA 3HG4A 5A6BA 1CIUA 3KLLA 4IUGA 5DT5A 1JZ2A 4MNKA 4GPNA 3BVXA 1T0OA 3WY1A 3VM7A 2WZIA 4P8WA 1UHVA 4AZ5A 4BF7A 3BSGA 3PZTA 2NSXA 3U7BA 3WKZA 1G01A 5EB8A 2VCCA 3O2LA 4NI3A 3N1AA 2YLLA 2W62A 4QCFA 4HMEA 3VGBA 5E09A 1K6AA 1R47A 4DO5A 1FFRA 3WQ5A 1V08A 3AIRA 2TAAA 3VGFA 6A3HA 4DWSA 5A95A 1UZ1A 2Z1KA 5EFFA 1H09A 3RJYA 1SZNA 3EJQA 3AZSA 3LPFA 1H41A 5A2AA 2YDQA 2V5DA 2EJ1A 1QVBA 2WLYA 3AROA 4AMCA 2XFYA 1OD0A 3PTKA 5FCZA 1GHRA 2F2HA 1OIMA 2E9LA 3ARPA 4MB3A 3A4XA 5M3WA 1GQLA 2W5FA 2OWWA 4UQDA 4IPLA 1FH8A 4MAVA 3W0KA 5IXEA 3SUVA 1BYBA 3ZIZA 2DT0A 3UESA 5DEZA 1YHTA 5KZ6A 4J3TA 1MQPA 3CLWA 3PZIA 2J8FA 3EJUA 2DH3A 3EJPA 4J3UA 2XFFA 1C92A 3ECQA 2ZX9A 4D6CA 4F9DA 1UWRA 1BHGA 2VO5A 2D73A 1R46A 3WUFA 1BFNA 1HIZA 4PN2A 4S3KA 3RDKA 1XYZA 4YPJA 3FNDA 1HWWA 3PZNA 1GOOA 3SUTA 3WEOA 4W7WA 4ZFMA 3LRKA 3VSTA 2DIJA 4AD2A 1E4IA 3FN9A 3AIQA 4CCEA 4MADA 1BGGA 1JXKA 3VD7A 4FNQA 1WZLA 1QW8A 3B9AA 3OBAA 4URIA 2X2YA 2J77A 1CXKA 4NXKA 4BQ4A 4TUFA 4F66A 1IZKA 1ZBCA 4MJ4A 5BYWA 1OWQA 1PX8A 3W82A 3VIGA 1VFMA 3PZQA 3CO4A 3VO0A 3SUWA 1IT0A 1JDDA 1BGAA 2ZICA 2GK1A 4TX6A 3VIPA 1HL9A 1QBBA 1V6XA 2JEPA 3WBAA 4KRTA 4CGTA 1GOWA 3TP4A 2D0HA 2XN2A 2Y24A 3AXXA 5A94A 3KL0A 3MUIA 5A1AA 1V6WA 1J18A 3EMCA 4TVDA 1EO7A 3H54A 4GI6A 2V5CA 5AYBA 5A6MA 4FLSA 1MQRA 1OGBA 1UH3A 3M7SA 4AIUA 1V02E 2J7CA 1NQ6A 5I3DA 1FHLA 3BVUA 2JFEX 1AQHA 1GORA 3UR7A 3W26A 4WKFA 2MANA 4UCFA 3GTNA 3MU7A 2BY2A 1WDPA 2J74A 3D52A 3ARWA 3CZGA 3ALFA 4H41A 5D8WA 2BHZA 1Y7VA 9CGTA 5A6JA 3SCQA 5D9MA 1TG7A 5E0CA 3CGTA 2WCAA 4OUEA 5A6SA 2V3EA 2JF7A 4JIEA 3O6AA 3K1DA 2OYKA 3CZKA 3WUEA 3PN8A 2V3FA 3AIWA 3VIMA 1BYDA 5C8BB 1H1NA 1DWHM 3A21A 3FAWA 4XX6A 2OSYA 4EANA 1BYCA 4FF5A 4JFWA 1QI2A 3PTMA 3OIHA 3WN6A 4UQAA 5I24A 4NZJA 2G8ZA 4PMQA 4QLJA 1V0MA 3CHDA 1VEPA 4C7FA 5JIWA 1EQPA 4AYSA 1SR0A 4NZCA 2AMGA 3AMLA 1J9YA 1HVXA 5C70A 2G4FA 3DYOA 3VMPA 1BTCA 4J27A 2XTKA 2JE8A 4QLLA 4Q22A 1DWIM 3IK2A 4W5UA 4ZE4A 1WCGA 3AS1A 4S3JA 1C8QA 3EDFA 1DWAM 2DSVA 1CEOA 1CGYA 2VZVA 1HKKA 1ODZA 4CVUA 1L8NA 4DO4A 5CPTA 3K8LA 4PTWA 4HOZA 4C7DA 4X0VA 3DX1A 2EPNA 3ARUA 1E55A 1HKIA 2WNWA 5A8OA 1HF6A 4DM1A 1HP4A 5C71A 3A4AA 3CUFA 4KGJA 2WHLA 3ZR6A 4D6GA 3G6MA 1J0YA 1OT1A 2EADA 3N15A 4H2CA 5HPCA 3FHQA 4AXNA 1W3HA 3CHCA 2CYGA 1B3YA 3WQ4A 4Q7NA 2A3HA 2OWCA 4CKQA 1A47A 3CUGA 2QMKA 2WPGA 1MW2A 5BROA 4FLRA 3K4AA 6CGTA 2VL4A 1UKQA 4J3SA 3WDHA 5HBFA 3WIJA 3AICA 4AZ6A 3TA9A 1W1TA 4B3LA 3PZ9A 1HTYA 2GDVA 5EMYA 4MNMA 1JI1A 6TAAA 3OZPA 3THCA 1QNRA 4W8AA 4PMOA 1ECEA 1LF1A 1UG6A 2VUYA 2CIPA 5A69A 1E0VA 1BQCA 4DM2A 1KR0A 4LYPA 1TA3A 4J28A 3HMCA 3QHOA 4L4OA 4P7NA 3VGDA 5HXMA 1CZ1A 3WDRA 5FD0A 3W25A 1B3XA 4NRSA 3O9NA 1QNOA 2CPUA 1QWUA 2PWEA 3ARXA 1F4HA
chains in the Genus database with same CATH superfamily
2WQSA 3VGEA 2BH0A 3L7EA 1Q0XH 3ZDYB 3CHFA 1A3LH 2V5SA 1JV5A 1JRHL 3N43B 5E8PA 1MFBH 1OGAE 4GRWB 3US1A 1S2CA 4XCFH 1M9WA 1XYAA 5AQ0A 2L5HA 3DMMB 4KBPA 3RVWD 4UFJA 4XMKH 1BW8A 3TA3D 1YLVA 2HS6A 4D1IA 3MRHB 1AANA 1AQDB 4FQQB 1DE6A 1KBGL 3QNZB 2GT9B 1CQYA 4Z1CA 4LFHD 3AREA 4RIRA 2JKXA 3WD3A 3QQ4A 3H8NA 3DMMD 4H25A 4QLKA 2CRZA 4JHWH 2EG6A 3UDWA 2YB4A 1E72M 1O94A 5CEYB 4DNMA 3H9ZA 2PF8A 4JR9L 4APXB 5T5FH 2ADGB 3X3FL 2NUTB 1OCWH 1Q0YH 3T4AC 2GTWA 1W8NA 3LVTA 2VUNA 4LPTA 4C59B 1MAKA 2AKRB 1LL7A 2GIYA 5GJSH 1TYRA 3CHXA 2P3YA 4LSUL 4MY1A 2N3JA 1OQFA 1ZL1A 3R0MA 4LEOB 1R3LB 5D2NA 3RJXA 5AC7A 1OD8A 2DM7A 3VUAA 3CUXA 2EILB 4RA0C 4WI0A 5AW0B 4OTKA 3ZWSA 4ZTPL 4WWNA 1BZ8A 3CSGA 2V7NB 4KX8A 4D0CB 2B7OA 1IT8A 1ZSDB 2ZRWA 2CLPA 3JTSB 3A4JA 4UTWA 4FG0A 3T3PB 5CEZH 1GC1C 3CU2A 2CBQA 2EE6A 3AIUA 3D4ZA 1HKJA 2PYEB 5D9OA 1TIUA 3RDTD 4B5SA 5ESVA 3I3EA 1HOCA 4CC4C 4K71B 4W9DC 2H45A 5AVRB 2WJDA 1V55B 3GNPA 4UTHA 1PG7W 2PO6B 1XINA 1TREA 4DUWA 3D3VB 3G6AA 4MYPA 3VX1A 2PYED 1X5ZA 4YDNA 5I1IL 2YWYA 1OHQA 4JDTL 4U10A 2JFCA 4WW2B 3TCTA 2I9TB 3HE7C 1LBMA 3MACL 1S8DA 2PO6D 3HB3B 2E25A 3DJ9A 3D50A 4S23A 3MKGA 4JFUA 3N25A 2VW6A 5I00A 2W8CA 3L1OL 2VR9A 2QV4A 4LC6A 4LPVA 3FO9A 2G60L 2BOLA 3UBXI 4DI9A 3N0PB 5CJXA 4I9WE 1LLZA 1Q6CA 3TBTB 3HB3D 1LK3H 1GONA 3MJGX 1UXSB 4RMWA 3FTVA 4PG2C 4P2OB 5FV2A 5DMKB 4S1RH 3IT8D 3Q6FA 4ERAA 5DD5H 4JO1H 2BVPA 1UWQA 3SYPA 1NAMA 2NY4C 1PIIA 3QNXB 3LLXA 3FH8A 4LL1A 1PYWB 3MS8A 3ZQXA 1CBVH 4P2OD 2OX1A 4J3BA 5EU9A 3SSZA 4NQDB 4I85A 1EF2A 4RCAA 1CI5A 4GKOA 1X5MA 5ISZB 2XHNA 4JQ2A 2VN6A 1AGBB 1CF8H 1MAJA 4TNWF 4E36A 2YC1B 4MNQA 4NQDD 1UZGA 3SGKA 1NCGA 4N3UA 2C5DC 3I6TA 5D96B 4L3EB 5ISZD 3BW9A 1C12A 4JPIA 3OKYA 1WLHA 4F7TA 5MEPA 4KI5C 4IEFA 3G1AA 3TBBA 4U6TA 1I9RL 1DVJA 1FZJB 3MNZB 3FQ4A 5HHNA 4WFED 2ZRXA 4ACTA 3IK4A 1RSYA 4LARL 2D7PA 2GTZA 1OFAA 1LQ0A 3QG7H 1PS9A 1AMYA 5D1XB 2G3MA 2J4WH 5CD3A 5IKCA 5D96C 5IB5A 5I18H 5F3BB 3ZYIA 1QUNB 1AGDB 3SURA 3LBMA 3MKCA 3QXDB 4R90L 4RNRA 5E6UB 3UPWA 3L5JA 4OZHE 3CIWA 3CUPA 1HQTA 4F5CA 3CWHA 4K3JH 3K6SB 1W6LA 3JZYA 4GZ7A 4DCQB 4Q6XA 3RPMA 2E8ZA 2WQAA 5D1XC 4L1LA 3NIGE 2BMBA 4Z0BL 4DERA 2WLZA 4Z77B 5D09A 3R1GL 5CP3H 2VYRE 4D72A 3EOTL 2C4FU 1S5IL 2QJJA 2NXZD 4KO6A 1XH3A 4XMPL 3I9IA 1P4LA 3RFZC 5GS0D 1A7RH 2G3XA 4IOSA 4V2XA 5E6YA 1GVEA 4DUOA 4H2AA 4UTBL 3FB5B 5AWNL 2DSWA 2PSNA 1W72H 1TQBC 3D46A 4Q6KA 4Z7VF 1RAMA 2VLKA 4O51B 1OSEA 1JAKA 1XIFA 1E4NA 5I8EB 4P7QA 3BKJH 2H90A 1Z5YD 2A74C 3S35X 2BSRB 4F8TA 1MCPL 5D5MB 4ML4A 5IB2A 3CUHA 1QU4A 1OV8A 3DETC 4GQ0A 3T8LA 5FWRA 2A7RA 4HHPA 3ZHKA 2F53E 3BHBB 4PI0A 3N85H 2WSDA 2IEPA 3WUWG 2VR5A 3C9NB 2XA8H 5FYJL 2Q09A 2VDPB 1SMAA 1F18A 4LLMA 2A6JB 4P46A 5BJTB 3RKDD 2KL6A 5KYXB 2GPZA 4P7RA 2OMUB 1KFEA 4L4MA 1I9IL 2ALWA 2G37A 3ARFA 1T04A 3WL9B 1JN6B 2D03H 3R7MA 5GRYA 3W56A 2QGDA 2RHEA 5CZSA 4Z0JA 3TVMA 4ZJ9A 3LS5L 3MSPA 5FO9A 4WV1A 1PG7H 2VIRB 2OJPA 1U21A 5IVZB 2C9XA 3U0WH 1J8VA 6XIMA 5T3ZH 2VZ1A 1XPGA 3HB9A 1ZIBA 2PYFB 4JMXA 3K46A 3QPKA 3GZOA 1EFZA 1HKMA 4WK0B 2WWKT 4BDVA 5I8OL 1RCQA 2SEBA 3EYSH 1C93A 1F1GA 2XV2A 2HKHL 3G1SA 2Y22A 4WGHA 1BVKB 3L1FA 1QRQA 3EH5B 3M7FB 5DVKA 2R0WL 1U95A 2EACA 4MB1A 3LY6A 3WDQA 4KGLA 3RIFF 4D6JA 1KCSH 3B0XA 5EBMA 1XGQB 4U4BA 3SCTA 1BRLB 2PC4A 4K7PL 5EMJA 5ITBL 1BZ7B 5K93A 4PCFA 2ITCB 5EWIL 1YXCA 1FHVA 5AZ2L 3VXPA 1E8WA 3UMNA 3NP3A 3BQVA 4W9TA 1J6PA 3ARGD 3LLFA 1J6OA 1FZMA 3MLWH 4U6XB 3S4SG 1ISXA 1I7TA 2D1ZA 4IBYA 1FC2D 1OAXH 3LXBA 1BIIA 4WDIA 1JD7A 5G55A 4H9MA 2ZOTA 3BRFA 1VFBA 4X8JB 3VTMA 4MNGE 3K71B 5E8OA 4EI6B 4F1SA 2ADFH 3H56A 4KFZC 1UJ3A 3PCYA 3M44A 4PC8A 2R0KL 2AKMA 4GA8A 3U4EA 1TEFA 4YDVB 5MENA 2AC0A 1ZP3A 3WJZA 1NCTA 5EO0B 4EPEC 1ADQH 5A3HA 4K5MA 3G0SA 1TPWA 4YQXL 1F9CA 3HG1B 4ERSH 1THFD 2Y1ZA 2ZUWA 3L5XL 1CFTA 4MAZA 5FV1L 5EO1A 1HCVA 5EDXA 5INDA 1JCXA 1UT2A 5DRCA 1FWAC 3DG7A 4HK7A 3BP7B 3Q9QA 1QRNB 3W7MA 3HG1D 4UV4L 3EO9H 1QLEH 1WUEA 3W7QA 1KLGA 2WNGA 2BBFA 1CLXA 2CLMA 3S1XA 4CSZA 2ICWJ 3SE9L 2VMCA 4KRZA 4LXFA 1QRND 5DWUL 4X5LA 3NCBB 1ZV2A 2YAQA 2PDIA 4N0UB 3V6ZB 2J9YA 4FFYL 2OO6A 3VKCA 2J8HA 4HWEL 1MI3A 2O55A 4AOFA 1ASOA 5DD0L 4M6NH 3CSPA 2FBJL 1IUZA 4R7VA 1M7XA 5C7XL 4CNOA 1N5AB 3H2MA 5SWZB 2ITDB 4FA8A 2LFEA 5I1HL 4DJDA 2XWCA 5CQ1A 4J6RL 1WXYA 1W9VA 2OI9C 3NJJA 2DRUA 3DFNA 1MXSA 1OM9A 4MD0B 3UCRA 1KPVB 4A6YA 3DV6A 3B7SA 5SWZD 2FATH 4NPKA 5LUMA 5KAQG 1HZHL 1BWKA 4PUBL 1IBDA 1CZ8H 1LO4L 4OJFH 5HGHA 3VTAA 3VWJB 1NCBH 4A7GA 3T0AA 3URAA 3IFNL 3TZVC 4JZJC 4MWFB 3X2QB 4QYOB 3H21A 3FQUB 2YQBA 3MJ7A 4ZUWB 3RGVA 1OC7A 1Z2KA 4BK5A 4GKTA 3L0KA 2ICWB 3FX4A 1REQB 4QDMA 3JUGA 5CPMA 4LO9A 3H7VA 3BLBA 3VWJC 1ITUA 2YZ5A 1SNRA 3F3HA 3URQA 4HQVA 5EPMA 4ELMA 5B1KA 1BZDA 4XCNB 2AJYH 5CSGA 1MG3C 3RIAK 3EWDA 1A4JA 5JHAA 4HV8B 4W9CC 2ADIA 5EOCH 3DX6B 3OTRA 2WZPD 2ZRZA 1OP3H 4P57B 4M7ZB 3ZSSA 3Q9PA 3IJHB 5E08L 5D7LA 1A7BA 4PV1C 4JJ5A 2OZ8A 3E3HA 1E9OB 3CC1A 4I8DA 3CX5K 4GAGH 5EZLA 4QGTA 5RUBA 1ACZA 1G1OA 1VZHA 1V51A 4OJYA 3N0AA 5IW3A 5FW7A 3VCRA 1PCSA 3NFSL 1JPHA 1P7HL 2E0PA 4PRHE 2ROYA 3CZFA 3ZE0E 1F2QA 2Y36L 2GJJA 4TV3A 3KBEA 3QWOA 2PXYD 4Y9GA 1GC1H 5I1DB 3SQSA 3E6HA 1LJMA 3G5XB 4QRQA 5HHME 1BFVL 1Z9SA 1IGIH 1B4LA 4F0RA 1M1BA 3VGHA 4LSVL 2DWEB 3PP7A 3QNYA 4NT6A 3DGCR 4PJCA 5C08B 3VFTB 3ZK0A 4JQAA 5JQHC 4AQ8C 1Z44A 1FZOA 3NCXA 4TQEH 2JXMB 2V5RA 3KXFD 2B2XL 2ISSA 4GZEA 3ZFHA 5C08D 3L5IA 4MA7L 5C2XA 2Q1EA 2X44D 3Q5OA 3RWJA 5I09A 2BWIA 2CCRA 1Q38A 4CD8A 3C6LA 4HWBH 4ERIA 4NJHA 3RX5A 4GG9A 3IU4L 4CQ8A 4HZ7A 1GIGL 3FQ1A 4FAMA 1SLUA 5HDRA 1K6WA 3CH0A 3EJZD 1XQLA 2EPHA 1DVZA 2FT7A 3MO4A 3QJUB 1AFSA 3CDZA 4Q8WA 4V33A 5GVJA 1B0IA 2V4LA 4X60A 5CC5A 1MLCA 1N18A 5M17A 4GXMA 3GBML 1BOGA 1MDRA 4XMWA 3HPLB 2QEZA 3OA5A 2QR0B 4P8UA 4HGMA 2DQUL 5I78A 5HHXH 4C4KT 3LD8C 3HC0A 4ZX5A 1FFOB 4PJEB 2OPJA 1FDYA 5AB0A 1UWXH 3UP1A 2YFOA 3VYLA 1R5YA 4W89A 4Z0XA 4QRRB 4Y7MA 3IAQA 3EXJA 1M7PA 4KRPB 3FXYA 4Y1AE 1TWWA 3SE3A 1GOKA 1T5KA 3QGAC 3K1KC 3RWEA 4JHAH 1YYLL 5DFVC 1LRTA 4Y9PA 5HUPA 4OUIA 1TZGH 1MFDH 4HUWB 4KRPD 2Z1VA 2K4WA 4P5TA 1IGJA 4JAMA 3AG2B 3I50H 4L1WA 2RMNA 4XWUA 5DUPH 1SVZA 4BH8A 3MV9A 3DIFA 3LHPH 4JZOB 4Y4FA 2OZ4H 2CJUH 2Z65C 1IGCH 2XNAA 5CIPH 2F9BT 4OAWB 2KDYA 2E9MA 1DR9A 1DZ0A 4PIRF 3QQ3B 2FX7L 4M6QA 3AQUA 3UTTB 2V6HA 3QEUA 3GMNB 2Y7QA 5L8JB 1IGSA 1DL7H 3GHSA 3D69A 1MIEH 4MQXC 1BQLL 5CAYB 3VFMA 2UWFA 3AZRA 3KM2A 1G9MC 2GJPA 5DGQA 1W0WA 1JE6A 4CGUB 4PJCF 3SOBL 4CQDA 3BMWA 1A6ZB 3V5CA 4LNYA 1WBHA 4A3UA 8RUCA 4EJ1C 2DLHA 2VL5A 5CCGE 2H0PA 1T4KB 1AXIB 4FHKA 1LUCB 2GABA 4JQVC 3CQFA 2VGLM 2RAGA 4PP1D 1ES0B 5CJBA 4XD6A 4C83A 4MJIB 3IE9A 3I7SA 1KEGH 2WINA 5JH2A 4KK5D 1KQYA 1UUSA 3GXIA 1EZUA 2V2WB 4IUGA 2BXVA 4WTQA 3CSYA 1VKFA 8FABA 2BODX 4MYAA 1SXBA 3ONBA 4FI8A 3WEXB 3T4CA 4KCWA 4IMKC 5EB9A 1YBQA 3W57A 2X4PA 3DKJA 4LAQH 3HPJA 1QABA 5HATA 3TLRA 1KYOK 3P9WB 3V0IA 1J2WA 3EGSB 2QQ6A 4XVUC 1O0VA 2EDJA 1GPOL 4IG2A 2W88A 2CGRH 4D0DB 5M3WA 4DGYH 4IPLA 1HYRC 3B56A 4MAVA 2VDKB 1FHUA 4KCVA 3ZRFC 2EVJA 5D4JA 3EX6A 1GKQA 1DJSA 3I2CH 3MLPA 4ZFMA 3WQFA 2H26B 1JWUB 1GKEA 4GBDA 3WKML 3N2CA 2O5ZH 3WS6A 3ALXA 1UM6L 5REQA 4MJ4A 3TJHD 1IT0A 5K7JA 2APXA 2JJTC 3ES8A 4BF5A 3I9PA 1EJWC 4OJEH 2WNKA 3GS0A 3LRSA 3CPLA 2ENQA 1HOEA 2NX5E 3NTCL 3U7WH 4HIXH 1TTFA 4G7EB 3B9KB 5LQBH 3MLRL 3ALPA 3HPXA 1CT5A 2Y89A 4ACPA 5F7KC 3RZWA 3U1PA 5K9OB 4N2BA 1RSFA 3ARWA 1QSFB 3V5DA 2G5UA 3IXAA 5FJOA 5A6JA 3UPAA 3B9KD 4ZFFB 4LRSA 4Z7QF 4PJDE 2E77A 3NGJA 3NQMA 5AENA 5CILL 1QSFD 1TQCC 3FQ2A 2IKGA 3QY7A 3LKOA 1OD9A 2FEJA 4XC1L 4QEEA 1YYCA 3CQKA 2O26U 5LIXX 2C16A 3B8IA 1XF1A 1QI2A 4LQFL 4OLVH 5JIWA 3NJFA 4FRWA 1ZT7B 5C0ND 2Y6TE 3SSJA 2FVNA 1PKQB 1AFVH 4OZGA 1CEOA 2E3VA 3A4EA 1S3KL 3NCCB 4PWJA 3UJTL 3FONA 1HKIA 2BNQE 4DESA 1HP4A 3PTDA 1BREA 3T1GA 3U9WA 4ALAC 1FL3B 3HR5B 4UR8A 2H2SC 1SJAA 2KPWA 1UOLA 5DCBA 5EYWA 3H2PA 1QD0A 3TA9A 4JDZA 4A2SA 4N24A 3LIUA 4PJBA 3WQPA 1KFJA 1T89C 3FHEA 1L8PA 5HTSA 4M7KL 2VUKA 2YW4A 4RFEB 4Y19E 3CHVA 4IGBB 4JY5H 2X10A 5IQ9B 1F58L 3CCHA 5AW9B 4H4IA 1RQHA 5C0AB 3QQXA 2R7EB 3PL6B 4NHUB 1OTUD 3NFNB 1Y18A 2H32B 4QHUB 3ML8A 1I2QA 1YMME 3ARBA 1K8YA 2XC8A 1B3IA 5C0AD 3ZOAA 3EBHA 4R4FH 3GMOB 4IGBC 3CB8A 1YIXA 3MUY1 3WY3A 3ZQWA 2J43A 5EIIA 3IFOB 5I5JA 1CB4A 2ZUYA 3PL6C 4XPBL 4Y96A 4G2DA 2CD0A 4MVBD 3DVNA 3NEHA 4CU6A 2DEWX 1SFDA 5GS2D 3HFYA 4LCUA 5I17A 4GAYB 4IRJB 1NUFA 1LEKB 1JJUA 3H26A 2BIPA 4EWND 4ZVJA 3FB8B 4R5EA 1AR2A 5F6IB 4UBDC 1YEKL 4YVVA 2PN5A 2Z1PA 3RYMA 4E5TA 1TTGA 3C52A 3KYOA 4DX3A 3FTXA 7PAZA 5E1AB 1OEZW 4G5AA 5IW1A 2MCPH 4IRJC 3MWAA 1QOPA 2VN3A 3QIWA 3HZYA 5FJRA 2Q6ZA 2WWMC 1ID5I 3S35L 4AEFA 1WHOA 2P46B 3BP4B 5F6IC 5KBNC 3Q0HA 1B2WH 5KSAA 1TCRA 2J21A 1RVFL 1CICB 1UENA 12E8H 3C5JB 4JM4L 3BKCL 5LBSH 3SIMA 3AY4A 4KKLD 3LCGA 2CM6A 3NPWA 3ROOB 3UC0L 4PJIE 3GSWA 1BV8A 2IXVA 1CICD 2PI6A 2VKZG 5BMXA 4DK3A 3B5GA 2INEA 3H8AA 3GUGA 4QXTA 5GIRB 2NY2C 5FPIA 1FLRL 2WB7A 2X4SA 3VGAB 3WFHB 3WNPA 2BNRA 3VKDA 3P3YA 3BO8A 3CN4A 3B2VL 3TAKA 3G3DA 5IVOA 4PJBF 2PDJA 3L9YA 3WEMA 5BXFB 3PS6A 3HS8A 1B4KA 3W0WE 2VMEA 4B9YA 3K30A 4CU8A 1A7OH 2GFBB 4BFIA 1DEDA 3FSZA 3ARDB 2IQ9H 4IWWA 4D8OA 4ZW7A 5IMLA 3MSYA 1ASPA 2YMOA 3DX3A 3PQYA 4XBSA 3HIZA 1JUFA 3X14A 1WKEA 4R8WH 4X4XB 3OJDB 5DJ6A 4N2EA 2R1PA 4F92B 3QUMB 2CZFA 4NLHA 3VXMB 5T1DL 2IKHA 1AXTL 3EJTA 3ZJ7A 3N2TA 1SFJA 2WXDM 1I85A 3BG3A 2H1LM 4JNMA 3ARDC 5LNUA 3LTVA 2ZE3A 4PUJA 1WAEA 4H9XA 2APBA 4MPQA 2I7SA 4XPHH 1GNXA 3TLLA 1SOXA 3FQRA 5DQDH 5CR1A 4BH7A 1B4EA 3P0YH 5FJIA 4KJYB 3UYPB 5HHQB 3WF1A 2ZXGA 4ZFGH 2C9SA 4U6HA 2J56A 3ISYA 4X0KB 3VXRE 3CFQA 2OTWA 2VISB 3S8GB 1A65A 1P1ZB 1FNEB 1TEYA 2O9TA 2GUUA 2WM0A 3CX2A 1OF2B 1ZHAA 2P8BA 2FWUA 4WO0A 1IWBA 3HAEH 3F00A 2WVTA 5I19L 2VR4A 3GO2A 3OKMA 4MKMA 1NL0H 3HA1A 3T3MB 3B9EA 1G4TA 2PODA 4KESA 1JCNA 2DKSA 5HP5A 3DO4A 3HS9A 1UKPA 4B9FA 4QS5A 2VLMD 3T71A 2DJMA 1DQJA 1MFEL 5IHBA 5AVVB 2A2QT 5I1CH 1Z7JA 5IOPA 4IIEA 3W7HA 4OF7A 4C56B 1V54B 1EX0A 4OGYH 3DA0A 4K7PX 3EFDL 3CQHA 2V3DA 3O45B 4PGLA 4TTUA 2CR6A 3W24A 5CCJA 4F2UA 1R3KA 3N6YA 4X4MA 1KY7A 5CG0A 4Y0GA 2UX7A 2VDOL 1L7IH 4C56D 4DWSB 1FYTB 4QRUA 1G9MH 1H50A 1IBGH 2RKXA 4NNPH 4L05A 2A4AA 3UWYA 3BDXA 3IJ9A 1ZGLA 3HNVL 2PTWA 2AS5M 2DSKA 2FKPA 2AJXL 4LCWE 5DVOA 1QBLL 2NZ1A 1W32A 1FYTD 1NCDL 2W9EH 3IJIA 3S48A 5JA9A 1RVKA 4EMZA 1ENUA 5JQ9A 3LCWA 4AC1X 3BQUC 1BCIA 3ZKMD 2VR2A 4DWSC 1M3JA 1QSEA 1AA1B 5D7KD 1OAZH 4N87A 1FA2A 4LALA 1E1EA 4P8XA 3IDUA 4Q8MA 4HWUA 2KERA 4PR5B 4YE4L 4NN5B 1E6PA 4NKOA 3GI9H 1ZQ5A 1ZPLA 3A6CL 2OMZA 3W37A 4G7SB 2N0KA 1A7QL 1HSBA 1Z3NA 4C6OA 2PPEA 4HZ1A 1G4RA 4LSTH 1M5WA 5DJ0B 3GKFA 1Z8AA 2ZZ2A 3QW4B 4QDPA 2NT0A 5I02A 3AUJA 5TH2B 1OX4B 2WWCA 1OARL 3ULUC 2AHIA 2XQYA 3AG3B 2PCQA 5C0GB 5CGTA 1I8AA 4LCVA 5AW8B 1EUTA 3MOAL 2ZX8A 3L68A 4D9QE 2KZKA 3B9DA 3AT0A 3JVGC 2F6UA 1CW2A 4B92A 4CUCA 3DX8B 2EXWC 4NRZA 3VIJA 5F89B 2N1KA 4MDPA 4MKNA 4QUOA 1K5NA 3LU2A 3U4FA 1PAMA 4IUOA 5E8EA 3BW2A 4QHLB 2HVKA 2J1WA 4YR6B 1UD2A 2EDOA 2X4NB 1C1EL 4IU3B 4Z42C 2XN0A 2FGWL 4Z7UE 5HD8D 2J2ZA 1B0RA 4JREB 5FL0A 4IOFD 2OQJA 3HV8A 4PY8I 2J27A 5HDOA 2FIRT 1MY7A 3FFOA 3VKKA 5TBOA 3JYCA 3ZYJA 4IMDA 3K5XA 1HKLH 2VERA 4N5ED 4DN3H 1WDSA 2CLVA 1B2YA 4AD3A 3T1FA 1BVLB 4YN5A 5ICZA 3PWJA 4GUPB 3VCNA 1X6NA 4GJJA 4JREC 1CTOA 1YNLH 3ABOA 2YIHA 3ISIX 4WRLA 4KMTL 4JYFA 1EWEA 1X5FA 2XJ7A 4OV5B 2GJNA 4K7PY 1MFAH 3N6QA 1N68A 4AHOA 1KTLB 1KTCA 3GSXB 2ETWA 1U92B 4IBUA 3ZS4A 4XCYA 4M93C 4HKZA 1FQ9C 3MV01 1HYSD 4XVJL 4IS6A 1DVXA 4NZRH 1MPAH 3KMDA 4NXSA 5D9PA 3PNWB 4HIHA 1KJMA 1MNUH 1M68A 2CLKA 1XGTB 4H0GA 1BYPA 1BYOA 1JF1A 2QFPA 4X4YB 1JGVH 2XZ7A 5GJTH 2EO7A 5MP6H 5D70H 2EKSA 3ATEA 4PMRA 1W9DM 1FFPA 4G9FA 1ODUA 1YY8B 3IVSA 1TNNA 4OVUA 3FQTB 2WBJD 3ENLA 4R26H 3KUMA 1J1OH 4ALAH 1JZFA 4ZQRA 4R27A 1JZ7A 1WZKA 1KIRA 5KEZA 2V68A 1U8JA 1HINL 2WJ7A 3CT2A 3S96B 3ZTDC 2OMWA 4JDEB 4M1GH 4H9UA 5XIMA 1SJXA 2JCCB 2QELA 3H1ZA 4XPTL 2OEKA 3VH8G 1JPSL 4DW2H 4J3XA 3WO8A 1AS7A 4QS6A 5JYMA 4LF3B 3IIVA 2EIBA 3CBKB 1JZ8A 3XIMA 3ILQC 4MLJA 3NQFA 5I7GA 4MM1A 1H3UA 3R7QA 4CLMA 5TQ0H 4YHIB 2VFGA 5E5RB 5F4XA 3FH5A 1RZJL 1BEXA 3EOBA 4J3OG 1BD2A 5JW4N 2V2CA 4EZKA 1Q9OB 1UGKA 4YFEA 1LLWA 1S7XA 2P5WB 2DGAA 4D8ZA 5I3JA 1KENL 5GHWL 1LWIA 3WIIL 1JZJA 4BQ3A 4C1LA 3NDYE 5IEKA 5L8LB 2DIBA 1ZA6A 1SFHA 3G5VB 2P5WD 1VCBC 3VABA 3D39B 1YECH 1PEZA 4LCIH 4CSTA 2RDTA 2W27A 3JZ7A 3X11B 3R19A 3RQ3A 3W3OA 1CN4A 3K2IA 4JFFA 3J07A 3D39D 3W53A 4TQTA 2Q86A 5FYKE 3SCMA 1N9PA 5CC6A 3CH1B 5C0IA 3QPQD 1UKSA 4YNYB 3HZVA 5HVFB 3BWAB 3UU0A 1K6QL 2ICCA 4AZIA 3SN6N 1W0VB 3GHRA 2X70A 1TUXA 5A6BD 4BI7A 1RZ7H 2X53A 4EN3A 2CDGB 3F05A 1QBMH 4EPSA 4LUSB 1YEIL 1Z3RA 4IIQB 3AZTA 1JPMA 1NDMB 3VIHA 1KB5B 1UXMA 4G72B 5D05A 5FGBA 5LAXB 4DO7A 1IEHA 1GVIA 1CMOA 4PLOB 3MROB 1OB0A 1HIMH 2PCPA 2HTLC 1RK7A 3IPBA 2KZ1B 1QPQA 4KEVA 4JKMA 1ZANH 2V82A 3V5HB 3WIFA 3AMKA 5E8DL 3GDBA 2EH8H 3HC2A 1MI5E 3FYEB 4FLOA 2A3AA 2ZAHA 2YA2A 4JKKA 1E3XA 1F2XK 3NG3A 3LKRA 1XHGA 3TJEL 4ETQB 1PU0A 2DQJH 4D8PA 4PQXA 3T8XA 4M19A 2CO7B 5HQLA 5FUCC 1R24B 1JZDC 3GDCA 3ECBB 1R5WA 3GUTB 2D3LA 1J5TA 1AQ0A 1K8CA 4GP8B 1NGXA 3GH7A 3QBUA 1V7NH 4Q6YA 2QZQA 4E9YA 2ZRYA 1ADSA 2KHAA 1LQSR 1W3KA 3EOYG 3PB0A 1PZ0A 1TPH1 2PD5A 3RWDB 2UZIH 3BCFA 4MFHA 3ANVA 3MODL 1FRBA 2GKIA 5CGMA 1IT9L 3TA3B 5I66B 4U3AA 4UT7L 5L9FA 3WAKA 3CWGA 4P4KC 3U6XS 3KHQA 2XOTA 5AYTA 4NAQA 2EO1A 1YPZE 3OLGA 4GQPH 5BU6A 2Q3OA 5H37A 2CIIA 1AQKH 5BVJB 3RVWC 4HT1L 2WXGA 3TA3C 4QTIH 3TO4B 1A50A 2QADB 3VG0L 1XH0A 1AMKA 1FHNA 1VIWA 1CDCA 4RPQA 3NL6A 3DNKA 5I5MA 3FOLB 5IVXE 2AQVA 1Y5VA 2IDTA 4LT7A 3DMMC 3QFEA 3HKZA 2RUSA 3ZR4A 3SRFA 1W8GA 4NRYB 3TO4D 3L9RA 4F58H 5JIIA 2KYIA 2QADD 1TEGA 2A6KA 1TCDA 5CZ0A 3LVEA 2VW7A 3EYFA 3T0DA 1Q9KA 4K7FA 4FR1A 1JK9A 1YYMH 1BBJA 2BDNL 4LC8A 2ZVIA 1QK0A 1KTBA 3CXHK 5A6AA 5ABAA 1OTSD 4FR6A 4AV4A 2FJFA 3UJIH 3W76A 3MLSL 1AJ7H 3NIFF 1KFBA 3S2NA 3D8MA 3NAAL 3RDTB 4NVTA 4UQBA 4AJVA 4FLQA 1YXDA 1MVYA 1MG2C 4S38A 5DD1H 8XIMA 3WJMA 2KS0A 1UOZA 4OM0H 3GKZA 4PTUB 1BDYA 2NUPB 3RR4A 2J62A 3SGZA 2AP2A 4IMGA 1QNSA 4WX2A 3WD0A 4MJ2A 3HJ0A 3RDTC 1O5XA 1R75A 3EWUA 4A8RA 1TVLA 2KQNA 5AZ1A 2JK5B 2WB1A 3A4WA 4G8EA 1KYUA 1ZPTA 1G9NH 2IANA 2JBMA 4TOQA 1AGEA 4TNVF 4Z7VA 4LAKA 3ERPA 3EUDA 2JKPA 3G22A 3TYDA 4K71C 1SM9A 3UXKA 3BAEL 4YDKH 2PO6C 2CKBA 1QPXA 3BDBA 4R7JA 3OVQA 3GSVB 4I0PD 1TTIA 4WW2C 3WKZA 2RBLA 4ZUUB 4OD2B 1IEIA 3VXUB 3HB3C 2D7NA 2BVQB 2YLLA 1AIFA 1ORSA 4H8WL 4MSWA 2IMMA 1XCFA 2CMRL 1TKKA 4JTSA 3M1OA 4HG4K 1CLZH 1CCZA 3AZSA 1DVFB 5IBUG 3HNSL 3VXUD 2WZAA 3GJEA 5B39B 3VTTA 5FCZA 4FFZA 4V2BA 4G1MA 2F2HA 1QTPA 3TBSA 2E9LA 4P2OC 1BFOB 3TH3T 3W0KA 1Z6KA 5D7IA 3UESA 4J3TA 1DVFD 2FWSA 1Q94B 3VSQA 5TF1H 4MZYA 3RAOA 5F96H 4JN1L 1UPMB 3QRFM 3K72B 3TQVA 1KIQA 3HVNA 1R46A 3WUFA 4KCTA 4I2XB 2VWSA 3FNDA 4HNLA 3MBEA 2O61B 5B7ZA 5I73B 3OBAA 4HGWB 1VP5A 3TWBA 3S5LG 4NXKA 4YBQD 4B4FA 5BYWA 5CN2A 2V2DA 3EBGA 3PV6A 1UYWL 2E4FA 1OAQH 2VDIA 3E7JA 5KSBE 3UY8A 2XFWA 1NGYB 3AXXA 4LSBA 3BQ6A 2EP6A 1XLCA 5JIHA 4YMZA 5AYBA 1IF2A 3TQPA 4QHKJ 3QXBA 1JPTH 1OSZA 2EJAA 5F2GA 4HSOA 3WLBA 3G1RA 4IBSA 1QNZH 4JM2B 2NXZB 2FVKA 1MLBB 3UAAA 1VYRA 3ZE2E 4IXHA 1TJGH 2Q76B 2HE5A 1XG3A 3D52A 2CWXA 2WXPA 4H41A 3WN5B 5TGBB 1QR1B 5E0CA 1K72A 4JM2D 3BJSA 3TVAA 1TU2A 2V3EA 4NFBA 4JIEA 3MUUA 2ALDA 4REQA 3CZKA 2J6XA 2AJVL 4H19A 3AGWA 2I9LB 1BYDA 3KBJA 2NXZC 3DU0A 5GS0C 5AOJA 5ESAA 4WY0B 5I76B 3V0GA 3OIHA 2G8ZA 3V6OE 2O72A 5CWSB 1VEPA 1MJJB 3WN5C 3MAWA 1PTAA 4KBXA 2G4FA 1BTCA 3O0RL 1PCWA 3FXGA 3BI9X 5FJTA 4EP8C 3C5ZB 1C8QA 3F64A 1IM3A 2VGGA 5DEFB 1KIUA 1ODZA 4DO4A 5GISL 3ZIYA 5PCYA 2IC2A 3CE1A 4X5WB 1HF6A 3DENA 3C5ZD 1ALDA 4PZVA 4PJ5E 1OT1A 2BX7A 1LP9A 3L9EA 2AMUA 2A3HA 4CKQA 4TPRL 4GEIA 4J2MA 2WLIA 3SODB 4ZPVB 5GGUA 4URTB 1MH5A 1UCBL 4AH2A 4J4PD 3O6KL 2HFFA 3OAYK 3RKDC 2AV7A 3DROB 2AMXA 2FEEL 3DRTB 5FHAH 1KCVH 3EYVB 5D7IF 2P26A 4UTTA 4DP1X 1CZ1A 4X80L 4JBRA 3S37X 4FGMA 3ARXA 4NJKA 3VFUB 2OPCA 4IJ3B 1GA2A 2E7BA 3BAJA 4MYWB 3KOXA 2QHLA 2VX5A 2BNJA 5K2ZA 3TSDA 3I75B 1CLOH 3PS7A 1VHNA 4Q9QH 2IALA 5HAOA 2W3ZA 4DUXA 1FLTX 1O68A 1KY6A 4HS3B 3RRAA 3V0SA 2H6OA 3DBXB 1XLEA 1SJEA 2UVEA 5MHSD 3R10A 2EXSA 4MA8H 1R19A 4LEXH 3U7VA 2X4OB 4H9VA 5G4WA 3ARGB 1BYAA 1P48A 2B0SL 2EYTA 5C2CA 4MYXA 5DJAB 1ZS8B 3IJ6A 4LQ1A 2BWDA 1Z42A 4LCYB 2OXGA 1D6EA 3T0CA 4JRXE 4XD3A 1F8IA 4DN4L 5GZOD 1T40A 2Y07H 2IV8A 1PKYA 4FDWA 4NN7B 5C2BL 1YEGH 3ARGC 1KXTA 3AITA 3RX3A 1FVPA 4PJHA 3ABQA 4UTAH 2VEIA 5JXAH 2QQKL 1KJ2L 2GTQA 2I5QA 1S7UA 4A05A 4TUOB 2FE0A 2HX8A 1X6LA 1WKYA 3GAYA 2QPUA 3GNNA 3O6LH 5FA4B 1JZ4A 3WHXB 5KVMC 4MAYA 2IFGA 1JTPA 4FE9A 1OADA 4HCRA 1VKXA 5IBLD 2HVJA 3E2HB 5J6GA 2Q7YB 2BOFX 4DVRH 4KRNA 3W1XA 4BM7A 1KLZA 3HG0A 5EEVA 1IEAA 4UXDA 1P84J 3FNKA 4P3CL 4BHYA 1LCOA 1WUNT 3DWTA 3OGRA 3HRZA 1E1FA 3CEUA 3FGCA 2R1YA 1XYMA 2GHZA 1S9WB 1LP9F 1MWAA 3V4UL 2B7NA 2EYRB 4PB0L 1MJ8L 1TPFA 3BZJA 2O9RA 2HX7A 5HBBA 2TYSA 2ZP8A 2WQXA 3QUYA 32C2B 1OSPH 4F7PB 5C6TH 1T7VA 1MFMA 4FTVE 3WBEA 3C8NA 2F58H 5DJDA 4AUBA 2X2HA 2NTFB 3OKKB 3C8DA 4PGEB 2B3RA 3TOYA 1CFBA 2DU2A 4LRNL 3FVMA 4DKEH 3W29A 1HJBC 4MFEA 4OLZL 2MOQA 1NP0A 5ADOL 4E3VA 4YZFF 1W91A 1I8UA 1WRFA 5LAPA 1I1AD 4M82A 4HU8A 3QRGL 4X9BA 4QTGA 1KXQE 3P02A 3FU6A 2YLHA 2WNNA 1FDLH 3EWCA 5AOIA 1H3VA 5KBLA 3O4LE 2VXUH 4P7OA 2IPKA 3NK3A 4XISA 3B4UA 4G6AD 3QUXD 2R0ZL 4BFBD 4H8HA 3VINA 1PKNA 3EWYA 1IGYB 4LLAA 3V7PA 2VDNB 2YL8A 2FO4B 2CJSA 4PBEA 2Z24A 3BE1L 2VR7A 1A3ZA 4CVWA 3VI3B 1ZGLP 4Q4MA 1AZBA 3JV6A 3O6MH 3BIKA 1NGQH 1VH7A 3FA4A 3NOIA 3RUGA 3ATAA 4GRWH 3SBRA 4DGUA 2QSQA 4IXXA 3RL1A 1OPGH 4LUIA 3ITCA 5C8JA 5JR1L 4PJHF 1ZSXA 1CGSL 1KT2A 4R33A 4BFGA 3GBEA 3L3OA 3GEWB 1M42A 2F5AL 4BCEA 2NLYA 5C2UB 3OZOA 5KJ7E 2F19L 2PXYB 5G1TA 1JGUH 4BCXA 3EZ8A 2Z25A 2PLMA 3TC3A 4UMAA 5AHLA 2VZOA 3M86A 3EOEA 2ZUTA 4M7ZC 3EG9B 5DWPA 2ZE0A 3UYRH 4BRVA 3JWNC 5AAPA 5E6RB 2INFA 3EYQD 4TSBH 3L7FA 2EEFA 2E5CA 5F9AC 1NBYB 4G8GE 4PE8A 1MFNA 5BO1L 3I02B 3GHTA 2PXYC 3UTPE 3UGUA 1IGTB 1RUAH 1RMFL 3R7RA 1YTKA 4HJUA 4TUJA 3KXFB 5DZOA 5B38B 4JFXA 3BN9D 4HPJA 5I26A 3QO0B 3L12A 3QYSA 4L4TA 2XYCA 2VX4A 2J66A 1PVHA 4AIZA 3GDLA 4XOCA 4Z7WB 4ORIA 1A6AA 3F58H 3U0HA 5CGBA 4PMUA 1PBYA 2AEWA 3W84A 3F03K 4XX5A 2HT2D 3GFXA 1XUUA 5LZLA 1DWFM 3WJXA 4GY4A 1QEXA 4DQAA 3LCHA 2CZNA 2OKTA 3TCSA 2BZCA 3VXTB 2FZ3A 3ZE1F 3G9VA 4FLHA 1HSAA 3CHSA 1TFPA 5B21A 4J3VA 3OKOB 4HWZA 1ACYL 4H6QA 4CD7A 5ES4B 5CSRA 5IRPA 3KPMA 1T21A 3KYAA 2AEPL 1I60A 4KH9A 4FAAB 2EIDA 1WBYB 3A3WA 4MGGA 4MMYA 3TCXA 4KJWD 1DEEA 5E51A 4YSUA 5BRZE 4HALA 1MAML 5HYJD 4ABQA 1E4HA 1E9LA 4JEQA 1CT8A 2C0AA 4ZW8A 4JNZA 4I48B 3EJZC 1F8TH 1YN7B 5KVDE 2E3ZA 3QUGA 1EV2E 1GKPA 5A8PA 3A3HA 3ITYA 1TF4A 1OK8A 1X97A 5IMMB 3TZFA 2P0IA 5CPLA 1K85A 3MRGA 1UFUA 3RUGF 2FB4L 3I68A 2GHWB 4GD0A 4MMXB 2X89A 2QGHA 3BH8B 1BOYA 4HJIA 5E94B 4OD1H 3O3DA 4QF1B 4TL5A 4ZRGA 2HDJA 3S0PA 1EBHA 3NABH 4E8GA 2QJDA 2PMZA 1OCOB 1HE7A 1UWAA 2R2BA 2FJKA 1CDYA 2K70A 5DZJA 4AY7A 4UTKA 2NX3A 3T6VA 4MMXC 1M01A 3WFLA 2F38A 2C1PB 1XLMA 1W8SA 2BP3A 4ZUVB 4U05A 1H6TA 4KRPC 1VD6A 3MNWA 3VC6A 4DBEA 2H6PB 2Q8XA 4FNLH 3GBLA 3FU9A 2J9ZA 5C9JB 1AXSA 4QAIA 1TETL 1QNPA 4N8VG 1KB9J 4NAFB 1NCAH 1WIUA 4PRBA 1PB0A 3CFIC 5KVGH 1OG6A 5HR7A 1YEHL 1I7UA 1M6UA 1RALA 3M6DA 2C34A 2E5DA 4BKLA 1E5BA 1GAFH 4KHTH 2W65A 2DLTA 3DI3B 3IPWA 2Z8VC 4WKZA 5J6SA 1ODAA 1IGFH 3N73A 5DU7A 3V4VA 2C9PA 2HRGA 4YHLH 2AEQH 1JNHA 2DWYA 4H8NA 1WBZB 4KO7A 1M3IA 3G7TA 4K68A 3STCA 2X28A 3LKSB 4MCMA 3CYJA 4UZUA 4NP9A 3V10A 5H6HA 5TAOA 2WHKA 4S11A 1Q0EA 1VRDA 1BM3L 1BXBA 2YA1A 4PMVA 3P9LB 2YBTA 5AUMB 1XF4B 4PP1C 2YEZA 4OTXH 3R5EA 3WGUB 4AM0Q 1UUMA 1L3NA 4KK5C 3QARA 2HRHA 3MO1B 3R0KA 3TBCA 2B1HH 4O50A 2XZCH 3N1MC 2BFGA 3N41B 2YCEA 3P2VA 4H9ZA 4YSAA 4ZQCA 2R29A 4ECLA 2ZCHL 1T0NB 3O0FA 2VDPH 4ES9A 4IISA 2OZNA 3DHFA 4OT7A 4GZIA 4NDMA 1T1WB 4HKBB 5E9AA 1GTEA 5C0CB 1TLMA 2JMRA 3DOSB 3KGSA 3U2ZA 3PABA 4TVSa 4EPBC 4W4OA 4QO1B 2DEXX 3MBFA 2KH2B 3VVVA 1DWGM 4JFEA 3DK0A 3AZUA 2V2HA 3WJLA 5C0CD 5FYKL 4OLXH 4KV5E 4J1OA 2MMXA 2CBIA 3LPGA 5HJLA 2OW6A 1H6FA 3T6ZA 2K1MA 4DF0A 2D3JA 3KOWA 5GGTH 2D7MA 1H5YA 3QZWB 5AW7B 2Z35B 4QIUA 1QHZA 1FDJA 3TJHC 3FB6B 2DYPB 1NDGA 4HJSA 3VUSA 5BVPL 3RM4A 5H1WA 4TLSA 4P06A 1THAA 1R9ZA 2I07B 2EUWA 3AXHA 2P42B 2Y4SA 1AZ1A 4I1PA 2QS8A 3NSMA 2DYPD 5L2KE 2JALA 1NINA 1DLFL 4YUEL 2ZDRA 3HI1B 4JY4B 1RUPH 3TTQA 5A7BA 3WMQA 3KLQA 1FG2A 1IKFL 1X3DA 5F6HJ 3PLYA 4PP2B 3SQOL 2EE0A 4U6VH 3HUJB 3P9MB 5F9JB 4GG8B 3K6OA 2VXTH 1TQVA 2G75B 3KPNA 3NQIA 1W6WA 3B9KC 3RL2A 3OJGA 3ABSA 5H35A 3K7UA 3WUWA 4H01A 2APVA 1XFBA 5D1ZB 4L4VE 3EXSA 3FY1A 3ALGA 2I9UA 2ZOUA 3KDOA 1YEFL 5EF3A 4RVBA 1KG0B 3VDHA 1E4KC 4GKSA 2DLIA 4G7YH 3DVIA 5D1ZD 3PBYA 1NIFA 5ANME 5C0NC 2VRKA 3RZCA 1W1VA 4IL2A 1DANT 4UNUA 3M45A 4US5A 1SN0A 4DJFD 4M6AA 1EFXA 3IDXL 4P9HC 1ZP4A 4G6JL 3IARA 3LRHA 4L9ZA 4NKIL 2GK1B 1BXUA 4M4PA 5D72H 2PDNA 4MDRA 2ZUUA 3W28A 2F7IA 3QXUA 3VE9A 4HHAB 2HSIA 4MKVA 1D7FA 3PWNA 5C07D 3FT1A 1ID2A 4NZTH 1F5ZA 3IAPA 1PSCA 1SYVA 2UUDK 4OUUB 4JS7A 2EIEA 2E59A 5TPWH 5TE7H 1CS6A 4JRLA 4TQIA 5KOVC 3B8TA 1RD5A 3S4TA 1J4EA 3T6CA 2VN4A 1HNFA 3NYZA 3H9HB 3WLIA 5B22A 2NSQA 5G2HA 4Z7OF 2ESCA 1FH2A 5D32A 3S4SA 1OTUC 5B3JE 2W4XA 5DBTA 2X4TB 3BZ4A 2Y06H 3MRCA 3WD1A 1E6RA 5JOPD 5IQMA 2XFXA 2EVGA 3RGTA 3EPOA 3R18A 5F0MB 2OXHB 1PFCA 3EH1A 5LGKA 4QT5B 3HE6A 1H9DA 3MRJA 2ZF9A 4W1TA 5DS8B 2YQ2A 4JFHD 2HVOA 1S9VB 2V67A 5I1LA 3LKPB 5DMYA 3PHQB 2N1TE 4KHXL 4E2BA 2FDMA 1CE1L 1T1ZB 4MVBC 4PWFA 3HFFA 4M8VA 3E6FB 4AQOA 1UADC 1BECA 3KPOA 1FHDA 6FABL 4NHVA 4YDMA 2ARJQ 2AXFA 5IB4B 5JBDA 1D2KA 2VE6A 3N42F 5FKAB 1TTUA 2RDWA 1VFAA 4H7CA 4ZI8A 3I85A 2Y85A 3CAFA 4HSHA 5EBAA 1FH9A 1BQHG 1FWSA 4UWMA 1ZALA 5HVWA 5IHZB 2V9UA 3KL5A 3PZVA 3SDAA 1WVZA 1XIEA 5MHBA 4LDCA 3GI8L 1FWXA 1I7RB 3S8HA 1VZIA 3JWNH 3BJ91 1KCZA 4ODTL 5JORB 4KNSA 5BMFL 1G87A 3CM4A 3NRFA 3GJFK 2FZMA 4RZCB 2WSPA 4UT9A 2HMCA 2JCWA 4J6IA 4FQ2L 3RNKB 3AYTA 5K9JL 1UQSB 4K3ZA 3MA9H 3TXZA 1XSJA 3FQXA 2GUOA 1M56B 5HI5D 4FZEL 4X5XA 4KKLC 2VDQH 2HNEA 4JGMA 3GRWA 2JLLA 2AGJH 4CMMB 2XBZA 3VIFA 1Q6OA 4HEME 4PMZA 1CICC 3UTSB 3S37L 3C8KA 4Y16B 3ZGHA 1CIUA 5DT5A 4Y6GA 2AJSL 3UTSD 2CNYA 4L29B 3PZTA 4QROA 4Y16D 3RIAF 2YSSA 5I16B 2CDFB 2FYYA 3ULVD 3RU6A 4WGKA 3VAEA 3VGAC 2V7HB 3RHWK 1XB8A 1FFRA 1JMXA 1E9IA 1HXMB 2Z1KA 4M61B 1UEYA 1GOFA 1S7VB 1YQVL 2FFCA 1CQKA 3JV5A 1JHLH 5TK4A 1FV1B 4UT6L 5DJYB 4MQ7A 2EDLA 4XP6L 2ED7A 3SPJA 1OM3L 3S5NA 4UQDA 2H3NB 4WCYH 2Q7NA 3MV8A 5FB8B 1P1XA 4NHCH 1R30A 3PZIA 1EEZA 1MCJA 5F3HA 1X7IA 2EVIA 2P80A 1WFTA 4TR9A 1DJNA 2QAPA 1E67A 2IO5A 4OZFA 3GS4A 3TN0D 1O6VA 4YPJA 4IBLT 3I10A 4FCAA 3KM1A 1JWSB 4MHHG 3U2JA 1CXKA 1DDHB 4TUKH 4DJEA 3KLAA 4P59H 1NDTA 3NCYS 3WMPA 5GS1A 4BFOA 4Q56A 4DZ8A 4O0ZA 2Y24A 4A37A 2HKFH 5D30A 1CFNB 3P74A 1DQLH 5DHVA 2V17L 1EO7A 3F84A 3TYFB 2NV2A 4S2SB 1XMWA 3S42A 5IJKC 5F7NC 4NO0A 4R4BA 4JPVH 1FHLA 4MJ5A 4K15A 2YAEA 3IDJB 4RXGA 4BKNA 1FG9C 3W9DA 4G7VL 2MANA 3TBVA 1DBBH 4ZFOA 4TU1A 2Y63A 3TJPA 1MHPH 3VQ2C 4A04A 2CCWA 5CLYA 3JVFC 3ATFA 2OYKA 4M8QA 1R2TA 1NCUA 3DX9B 3D12B 3MRLB 1G6RL 3VIMA 2ZF8A 5IJVA 3DBSA 2ARWA 1EZVX 4RNFA 5FWQA 3STPA 3Q58A 2AABH 4Q9CA 1PZ5B 5I24A 3KNBA 3LCLA 1PCXA 1EK3A 1KLUB 2MFNA 2CUIA 2PUZA 3KVKA 1IAOA 1TPB1 3HBQA 3G6JB 2OMVB 5GZNA 3TNNA 2WXQA 5INCB 5H8PA 1L7TL 5KAQF 2VUOA 3BVNA 4NKQB 3SJNA 4EZMA 1TPEA 5GGRY 2YBVA 3MCKA 4JIPA 4FEMA 4OI9A 3S34L 1L8NA 43CAA 5GRUL 1Y0LB 4HCGA 1EXBA 1UTDA 4K6AA 2QKSA 1ZLPA 3A4AA 1LO3H 3GG1A 4WR3A 3R4IA 3ZKMC 2B3IA 3PHSA 3MRQA 5DR5H 3CHCA 3KPPB 4KXAA 1B3YA 2EVHA 2DQDL 1W15A 2VXSL 4ZUTA 1I9EA 5DRWB 2DM2A 4MMZB 2A85A 3OWEA 4H26A 4JCWA 5A40E 2MPVA 1VFSA 1BQCA 1GG1A 6ALDA 1V7AA 2CPUA 1QWUA 1L9SA 5CU9A 4PV8B 1Q8JA 4NN5C 4RRPA 1OW0C 1T5AA 1E4WH 1PLGH 2GITB 4HIEA 2A9ML 1I8LC 1TPXB 1A9EB 4DQOH 4DF9A 3TO2A 3UWWA 5DHDA 1AZRA 3FH7A 4UINH 4BFFA 2PR4L 5ERWB 5DXYA 2HAZA 2P5PA 4GXFA 2I5YL 3JTBA 4PA8A 4CQAA 4YHKL 3LS4H 3GB7A 4AQAB 4MWAD 5JIKA 4GFIA 2V0AA 4U1LA 2DI7A 2OFJA 4TSAH 2YD5A 4ZDHB 1J11A 2MQ0A 2XH2A 1VFHA 1F3EA 4L8BA 4JKNA 2VDKH 4G8TA 4WHCA 3FT2B 3AGVA 2PCEA 3OZYA 1MUJB 2TRHA 3FU5A 3V4PA 3WKNA 5HD8C 4X4ZA 1BQKA 4DT2A 3QUKA 4RV3A 1YNTA 5E5CA 4IOFC 1LO5B 2HN7A 3LQAC 5FSEC 4C6QA 4ZXBB 1D5ZA 1THCA 3BCDA 3DYMA 43C9B 1H1YA 2VQ1A 2OK0H 4JY9A 4W81A 2W9LA 4N5EC 2A3EA 1AGCB 5HQMA 2FCBA 3CJJA 1E0TA 5IM7A 2APFA 1G67A 2X6VA 4N8CL 4ZXBD 3JBG7 5ICYA 2V2XB 4G42A 1G84A 1HJSA 4PGBA 2P8LB 1QFUH 1KC5H 1XAUA 5FKPB 2F7RA 2J6VA 4L80A 2EDYA 1YSOA 1ZA3B 1XGUA 3GR4A 1DBAH 3GHEH 2Y23A 3TT1H 2HPTA 4OLYH 1HYSC 1TZ9A 4D6FA 1L0YA 3IANA 1CR9L 1TMHA 7PTDA 4X7TB 3M0HA 2Z91B 3A6BH 3K2MC 4C6CA 2XTJB 3GR8A 4JHVA 3KR3L 1NDWA 3QZAA 1MJUH 2WBJB 3VCCA 4HBCH 5D7SL 4Q6JA 4CVZB 3OGCB 2WVSA 4GVGA 1GUVA 3MJ9H 2XTJD 3MRIB 3H42L 2IGLA 2G3FA 3MUJA 4QFUA 4DXKA 3RLHA 4HJEA 3A47A 2BCMA 1QO5A 3MPCA 3FV9A 1RH9A 4ZAKA 1V0NA 2OTPA 1KN2L 3QHTC 1FCBA 2WBJC 2X0SA 4WWKB 3QISA 3KPLA 1Z5LB 2HJLA 3OZ9H 3MV7A 3PXLA 4YCOA 1KB3A 1G6CA 2APWA 2J6EL 1XV8A 1USQA 2GWNA 3Q05A 2BMKA 3M1BA 4WWKD 5CAHA 2OAAA 4Z7NE 1QI0A 4U2YA 3HG2A 3UFIA 1SZGA 2IWFA 5J56B 5G5IA 2XICA 1EHLH 3WFCL 3F6LA 3FCSB 5C09A 2DDXA 3H9SB 3OG4B 4X99A 1MDLA 3IRZA 1FF5A 3MLVL 1N8ZB 2VLJE 2Y8KA 4Y5XA 3QFJA 4EKJA 3EA3A 2PDKA 4M43L 3H9SD 4DFHA 3NGFA 1UXWB 1OVDA 1FNLA 1SM3L 3JWDL 4HK0B 2JV6A 2PTYA 1YNTF 2C14A 2Z0UA 4PSPA 1GYVA 2H32H 4BZ1H 3ESOA 3B3IB 2Z1WA 3LJ3A 1F00I 3NZGA 4NWTL 4FQJL 4I4WB 1GJUA 1EJUC 4HNNA 1TX2A 4AYFB 4U28A 3MA7A 3ZWTA 3SKMA 2QJMA 4N68A 2YPKB 3DPDA 3LIZA 4UDTA 3WJJC 4BS0A 3SM0A 4LLUB 4GBUA 3QPQC 5KG9B 1V6YA 1R3SA 1JPDX 1DXEA 4XBGA 2J73A 3QIBB 2CNCA 2XPYA 4LUTB 2NWRA 1F3JA 4JG0H 3KGRA 4LBEA 2BSLA 5I75B 3TBWA 4GUCA 8PAZA 2AK4B 3UVAA 5CHNB 5AKVA 1AE6H 1AO7A 1UIPA 5DJCB 4HOXA 3QIBD 3UTQB 5DZ9A 3WH6A 4HZAA 3S36L 4ZBCA 5AB9A 2AK4D 1NWPA 2EIZA 4EUPB 3DLQR 1HX0A 4AWJC 3PBGA 1UROA 1QJWA 4IIQC 2ZPKH 2UWEE 4EDWH 4XPGL 4S1QH 2XDHA 4N2DA 3UXFA 3NSNA 4XC3H 4AF0B 5E2TH 1PZ3A 3OZMA 2H8PB 3RA7H 4WSHA 2Y7NA 3GTVA 4OFCA 3O06A 3TIDA 1WAUA 4JN2A 3KWWA 4IRZL 3QQ9D 4MCYB 4M1BA 2FEDD 1IC5L 4L6HA 1ZV5A 2WQPA 1IV8A 1T1XB 4UOQA 1IWPA 4R0LB 1OK4A 3MZ2A 3TNOA 4QEHA 3RNQA 3RY5A 4E9WA 2RJGA 4R3SA 2EAWA 2OMYA 1L6YA 3E8UL 4RESB 3VFRB 1GJWA 4G6ML 2DV6A 4GUGA 3F7LA 3TK7A 1EMTL 1YN6B 1C7TA 3NQ2A 4R0LC 1UCTA 3FOMA 5T9CE 4QNWA 5CZXD 4FYQA 4Z18A 1SJHA 1J79A 5DJ2B 2PP3A 3P4NB 5IIEB 4YDJB 2YK1H 4XI5D 4TOYL 1ZOXA 4BZ2L 1RZPA 4TQ8A 3ID7A 3QUMH 1P7TB 3N14A 4BJHA 3U7YL 3UWZA 1J0IA 5LGHH 3DYPA 2ALRA 4TVPD 3AU1B 3LI0A 4XNUH 4I87A 3LZFH 4UILH 4AY8A 4PUKA 4KDTA 4DZ5A 2GSGB 2X4QA 5A2FA 4B53A 1OP5K 3S5ZA 1WJ3A 4FERA 3WBWA 1BLIA 2AXGB 3OXRA 1I1YB 2GJ6E 3REQB 1C9WA 1NVMA 3P77B 2IMNA 1XUZA 3TO4C 2R15A 2QADC 5I3KA 3AIVA 4FP8L 3VRJA 5KSUB 2VP8A 1DSYA 3VVGA 4NCDA 5HHVL 3DC0A 1U0QA 1PJ9A 1GVQA 3UG4A 4PJGB 2UXGA 1HQ4A 4QTFA 4QLWA 3EO1B 3P4OB 2A73B 3M47A 3NO5A 4JO2H 3UEZA 1OTSC 5I79A 4F7EA 3EKZA 5D2YA 4JRYA 4YSOA 1H15A 1AJZA 3T1WA 4F57L 3R4DA 3WLTA 4XCEB 5SV3A 1CXLA 1TA3B 3LXUX 1ME8A 3MCMA 2AANA 2VDMB 2ENSA 4WDTA 2HWGA 1MCKA