3IJ8A

Directed 'in situ' elongation as a strategy to characterize the covalent glycosyl-enzyme catalytic intermediate of human pancreatic a-amylase
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Pancreatic alpha-amylase
publication title Directed "in situ" inhibitor elongation as a strategy to structurally characterize the covalent glycosyl-enzyme intermediate of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 180
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3ij8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ij8A01
1E73M 3ZSTA 4NXSA 4D1JA 3EJQA 2BY2A 5A8MA 4ACZB 1CGUA 3PTKA 4PSRA 9CGTA 4TX6A 3I3DA 1DWGM 1R85A 1W9BM 1XSJA 2NT0A 5GNXA 4U31A 4P7OA 4PBGA 4IPNB 5IHSA 2OW7A 3U57A 4P8VA 1GOMA 4NRSA 1NQ6A 1ISWA 1WE5A 4U5KA 4CD8A 4FLRA 2BVDA 4W89A 1WDRA 2OSYA 4X0NA 1KCKA 4CN1A 2EADA 3D3AA 2BY1A 1HJUA 1V08A 4TTUA 4P7NA 3IANA 4Z2JA 4D6CA 1ODZA 1AQMA 2WB5A 3DDGA 3L4ZA 2QPSA 5EFDA 4LX4A 1XCWA 3DDFA 3BMVA 1LF1A 3BAJA 1F4AA 3CO4A 3SUTA 3MO4A 3L4XA 4AD0A 4C7FA 3CHEA 1BVNP 2EPNA 3RJYA 2J7CA 3WKZA 3ALFA 4H8VA 3AHZA 3N17A 2VR5A 5HOSA 1GORA 4DO4A 1HNYA 3L4UA 1W1VA 1W2VA 2EO7A 5DF0A 5LA1A 4Z2IA 5I2UA 4CD7A 4FNPA 1ZB5A 2GDVA 2VJXA 1GQIA 4DM2A 3PN8A 1CBGA 1OWQA 1EHAA 1LL4A 1WDSA 3ZT5A 1UA7A 1BTCA 3VU2A 3AROA 1H5VA 1FH7A 1TQUA 1FH8A 3WENA 4JIEA 1B90A 2VURA 1I1XA 2WZIA 3DYMA 5CPTA 5A8QA 1W3LA 1C7TA 2IXVA 1A47A 1K9FA 1NWUA 3B8SA 1MXDA 4J3SA 3ZQ9A 3QHOA 4CVWA 1R87A 3AIWA 1GOOA 5KEZA 2EPOA 4AD5A 1JD7A 4AD2A 4GQRA 1VRXA 1JFXA 3UG4A 3N12A 2DT1A 3CBWA 4JKKA 1H49A 4RE3A 3DYOA 4QP0A 3BUIA 3WH6A 3CUGA 2VX4A 3FAWA 1J9YA 1H3GA 2XTKA 1B1YA 4ATDA 3VIOA 3BUBA 4FK9A 4PMXA 2UWFA 4JAWA 1NWTA 2CERA 3BC9A 2YLLA 1B3WA 3WDRA 3M6DA 1JXKA 2YL5A 2OW6A 1GJWA 4JCLA 1S46A 4HOXA 1B3YA 2VNCA 5D9MA 5IDIA 2OLHA 4DO5A 5HNNA 1BG4A 1UR9A 2G3NA 3WNNA 2IXUA 2YL9A 4L4OA 3WQWA 4DWSB 5LYRA 3TP4A 1E0VA 4MB5A 3H54A 1UD2A 1LL7A 2VL4A 1PZ2A 3MUY1 3SURA 2EPKX 5JIPA 3K8MA 3GBEA 4A3HA 1LJYA 1BAGA 3ARVA 1QW9A 3MV11 4DO6A 1W9VA 4KRTA 2XYLA 2VVNA 7TAAA 1C8XA 4OUEA 4CD6A 1GVYA 1E6NA 4J3UA 4UZSA 3AFBA 4KGJA 2JEQA 2CBUA 3A4WA 4JHZA 2BS9A 1CLVA 1LG2A 4CU7A 3CLWA 1E6QM 2WMGA 1HN1A 3GXPA 3THCA 3VPLA 4WLCA 3PZQA 1TE1A 3VIGA 3VGHA 4M80A 3BUQA 4U33A 2F61A 1UH2A 1LL6A 3VIKA 4PRWA 3VIMA 1JYWA 3KE0A 5ECUA 3OG2A 1H1NA 3L4WA 2VQTA 2PWEA 4M81A 3VUPA 4U3CA 3AHXA 1JF5A 2BNJA 4PTWA 3WDPP 3GZAA 1W9DM 5IFPA 6A3HA 3BGAA 2ZWYA 4B9YA 4UQEA 3HG2A 1EDQA 1U30A 4B16A 2XHYA 3EDJA 1W1PA 5CLWA 3TA9A 3VSTA 1H09A 4HPGA 1GQKA 4TVUA 2E4TA 2O9RA 3SCTA 1EDTA 4BZYA 5M03A 2WLZA 4AD3A 3FHAA 2ZE0A 3OLGA 1I1WA 4MAVA 5JBFA 2XVKA 3BUDA 5A6BD 2BHZA 1BF2A 4F8XA 3WQ4A 4AZ7A 2D73A 2WVVA 3BMWA 3CH9A 3W53A 3VILA 4GIAA 2DH3A 3GYCA 4AMWA 4GPNA 1E6SM 2JIEA 2DSVA 1KGUA 4HA1A 1OINA 2OSWA 4V28A 3IGUA 4QLKA 4B3LA 4PMVA 2DPEA 1R34A 5ABFA 1CGYA 2VX6A 4XX6A 1E6RA 1QHZA 2D1ZA 2YDRA 3OZOA 3VNYA 1QNRA 2J77A 2J79A 1TA3A 5KZ6A 1MVYA 1WAWA 3WNKA 4HA4A 4HZ7A 3CZKA 2RGMA 3WD4A 3MUAA 3A22A 2GDUA 1W2PA 1UD6A 1NWRA 3L2LA 4TUFA 3S5ZA 2FE0A 2YA2A 1V0NA 3A47A 1UZ1A 1B2YA 5CGTA 3OGSA 3MV01 1WNOA 3SEPA 5E0CA 4J28A 3A5VA 4HMDA 3NJ3A 1B31A 4DUVA 4HPHA 1MFVA 1EHNA 1VF8A 3B9DA 4PMNA 1BYBA 2VT0A 2WHJA 4MJ2A 3ZT6A 2A3BA 3GBDA 3A21A 1JXJA 1JF6A 3VMNA 4ML4A 3BVTA 3KZSA 1OGSA 1QHPA 2VQUA 4FMVA 2BV9A 2WBKA 2DSKA 3PBGA 3W26A 4MB1A 2X1IA 1E15A 4H8UA 3WL1A 2F2HA 5CQ1A 3VD4A 2GK1B 4AEEA 1OB0A 4K68A 5FOOA 2X8RA 2XFYA 1AMYA 2D24A 3U5YA 3VIHA 1PPIA 1J0JA 2WCAA 3TONA 4W8LA 2E3ZA 2VO5A 3ZM8A 1M01A 4BA0A 1C92A 1TR1A 3CTTA 3IJ9A 3VSUA 5IXEA 3CUHA 5D4YA 1R7OA 4AZIA 4GI8A 3PZGA 5E6ZA 2ZX7A 7CGTA 2BVTA 1QWNA 2WW5A 1O6IA 4AWEA 4JFTA 3N1AA 1XH2A 2XWEA 2ZXQA 3VGDA 4ACYA 4M1RA 5A6JA 1L0PA 3HG4A 3RIKA 1R75A 3ZSSA 1VBRA 3ALGA 1E0XA 3AYRA 3LPGA 1ODUA 3BCDA 2EEXA 1PX4A 6CGTA 1QW8A 1B0IA 5HPOA 1VJZA 2XSAA 3PHAA 4P7RA 1XH0A 3BLBA 2F1AA 2NT1A 3F5JA 1KR1A 3KL0A 3NIYA 1ZJAA 4AZ5A 4AIOA 1NOUA 3WD3A 1V03A 1KCLA 3AIVA 4JL2A 2JEPA 4PUEA 1H0IA 3UEQA 3LPPA 1NP0A 1SYTA 1WZMA 1GVIA 2Y5EA 2DT3A 3PZUA 2WC3A 1N82A 2GSJA 2O92A 4IM4A 4MNJA 1HL8A 1VFUA 1CGTA 2GVYA 4MDOA 3SCWA 1FHDA 4HU8A 1TZ7A 3M46A 1H2JA 1Q4NX 2QF8A 3WF2A 2G8ZA 3VGFA 1CIUA 3SCNA 7A3HA 1CXHA 1W3JA 4CVUA 1V0KA 1VIWA 3AQUA 2WM0A 1WKYA 2Z1SA 4AMXA 1FH9A 2F18A 1UR1A 5EMYA 2JE8A 4X0VA 2W63A 2XWDA 2OWCA 2XVGA 4AEFA 4HU0A 4DUXA 3MI6A 3WBAA 1KTCA 2ZUVA 3D50A 3NDYA 3SCPA 1MQRA 1CXKA 3IAPA 1M7XA 4P8XA 1V3LA 3BXWA 4ZEPA 4OGZA 1JL8A 3W29A 3ARTA 1KGXA 2OYLA 2WBGA 3I3BA 5A8PA 1FA2A 3POHA 2JF6A 4PMQA 1J0HA 1W1YA 1CEOA 4MNMA 3GDBA 3RM8A 4H7VA 1H11A 5A8NA 2V3FA 1DWIM 1GQLA 1HIZA 1KXVA 2VCCA 1CGXA 3BCFA 4XV0A 1UH3A 4AZCB 4D6FA 5CG0A 3IJ8A 5CJ5A 2CCRA 2PBGA 4PUDA 1CDGA 3K46A 1M04A 3WNMA 1HP5A 1SMAA 2GJPA 1UKSA 2D2OA 2E8YA 1C7SA 1BYDA 4RL3A 3J7HA 1TCMA 3B9EA 4HA3A 2J7BA 3F5KA 1HXJA 3EJSA 3JUGA 3HZ3A 4H04A 1BG9A 2G3IA 1WO2A 3WBEA 1BVZA 2WVTA 4CCDA 4QDMA 1B3VA 5E09A 1KXTA 3EDKA 3L4TA 3O9NA 1ISYA 4CD4A 1MQQA 1U2YA 5A69A 1VB9A 4W8BA 3T0DA 3QHMA 1EQPA 1XD1A 4F66A 1TQSA 3T09A 3WL0A 1ZS2A 5BRQA 1FOBA 1RD6A 1BLIA 2E9MA 2XFFA 3ZJKA 2J74A 2WPGA 5ABGA 1IT0A 3T08A 3AYSA 3AZTA 3N04A 4Z2LA 3LRKA 3EBVA 2WC7A 3G6MA 3RM9A 3IAQA 1E1EA 2XM1A 1DEDA 2NSXA 2VZUA 1HX0A 2ZUTA 4CCEA 3PZTA 2D0GA 3GNPA 1C90A 2XSBA 2HISA 1QI0A 4FF5A 1VEPA 1OT1A 1G9HA 1TQVA 3W81A 3OLEA 2ZIDA 3DX2A 2G3JA 1CGWA 3PZ9A 4D1IA 2ZWZA 2WZEA 4F9JA 2UY3A 1B3ZA 3N13A 1HKMA 2Y8VA 3WMCA 3MMUA 4AZBA 4GO8A 4PTXA 1HJVA 1JZ8A 2PB1A 4NF7A 1JI2A 1JAKA 4UOJA 3PZVA 3K8KA 3T0AA 2IUZA 4E8DA 3BAIA 2WAGA 2OSXA 3RMEA 4TXEA 3SCRA 4GZJA 1GW1A 3BAXA 1TVNA 4DUWA 4QLLA 3CHFA 1LWHA 1Z32X 3W4RA 5HPCA 1NH6A 4D71A 1HJQA 2V3DA 3WQ5A 1D2KA 1G1YA 3SUWA 1EQCA 2D3LA 1JG9A 1W9PA 4D6JA 3VTRA 4AZGA 2C8NA 1WZLA 1TUXA 3DHPA 2ZICA 4W5ZA 2J25A 5D9OA 1JNDA 3HMCA 1E5JA 2EJ1A 3A3HA 2OYKA 2CETA 4V27A 3MUZ1 3VDBA 1QI2A 3AISA 2XN1A 1WZAA 1LG1A 1J0IA 2JALA 1TG7A 1EOKA 3LRMA 4CU6A 2J47A 3VIPA 1CXLA 3RILA 4PMZA 2XUCA 3CZSA 5A8OA 5EBAA 4KMQA 4NSBA 2J7DA 4LYQA 4D6EA 5DO8A 3KEHA 1UWTA 4UNIA 1GHSA 3AXIA 5I78A 3BSGA 1XH1A 3WDQA 2YBTA 2V3EA 1J11A 4URIA 3LMYA 3AS3A 1J18A 3ZR5A 2CBJA 3RPMA 4PMYA 2F7RA 2VZVA 5BYWA 2AAAA 2V5DA 5D9PA 3GH4A 4CN4A 3W6LA 4WKFA 3NDZA 3DX3A 2GFTA 3QOKA 5LA0A 4AD1A 1B30A 2VTFA 3ARSA 1UASA 3WIJA 1UG6A 4J3XA 4A3YA 2GJRA 5A95A 4NZJA 3CHCA 4CUCA 3WDHA 4RE4A 1NOWA 3UR8A 5ABHA 4TVDA 2EACA 4ZE5A 3T2OA 3LRLA 3A4AA 3VGEA 3APGA 5A1AA 1TVPA 1UR8A 4LPCA 1NARA 5BXTA 2D22A 1C8YA 2DSUA 1RP9A 2YDSA 2ZX5A 3WF4A 4PN2A 5F7UA 4BF7A 1FFQA 1ITXA 1BPLB 1UUQA 3DX0A 4H41A 1Y7VA 3WN6A 2NW0A 2UY5A 4AD4A 1ISZA 1AQHA 2E9BA 1QNOA 3NCOA 1PS3A 3PZOA 3WY3A 4LGXA 4FLSA 1KGWA 2BHUA 4AC1X 1VAHA 5A6LA 3CZGA 2AMGA 3DYPA 1Q6DA 3U7BA 5GNYA 3VD5A 1E4MM 1E3ZA 5JBEA 3MU7A 4ZFMA 4AIEA 1GPFA 2J7EA 1GONA 2XIIA 5A6MA 3CIVA 1LQ0A 5CSYA 1OD0A 1CGVA 2EAEA 3O6AA 3OLIA 2DSZA 3VNZA 3WH5A 3AIUA 3WD2A 1UR4A 1HKIA 3BSHA 3CV5A 4W87A 3O2LA 5I6SA 5CXPA 5BXRA 2Y2WA 1W3KA 3GNRA 3NUKA 3WH9A 3WMSA 1LWJA 2CXGA 4WKHA 1HTYA 3A24A 1ZJBA 3W27A 2WANA 2YFOA 5A2AA 3MSGA 1WDQA 3PTQA 3WY4A 5BROA 5ABEA 3ZR6A 2EBNA 4UQCA 1BGAA 4MB3A 3K1DA 1GQJA 3PTMA 4HTYA 4U2YA 1CXIA 4AYGA 1E4IA 1UWRA 3WQ8A 4PMDA 4AW7A 3WY1A 1E0WA 4H2CA 1JIBA 5TD4A 1DWFM 2WVVB 4GXPA 1V3KA 1WDPA 1EO5A 3QGVA 1JYNA 1KBKA 3UETA 3GXTA 4JCMA 1Q6CA 2ZUMA 2WKGA 1M53A 1MXGA 3S2CA 3EDEA 5ABFB 5FL1A 2O9TA 2ZX8A 5I0DA 1R7AA 3MMWA 4WSKA 3VGBA 1VEMA 2IGTA 2WHLA 1TA3B 5I77A 1QWUA 2CNCA 2D23A 3AS0A 2XFRA 2YA0A 2X2JA 5AC4A 1NWSA 2W92A 1EA9C 3WEMA 4J27A 1NP2A 2EQDA 2CBVA 2ZUSA 3EMQA 3D51A 1V6VA 4QCEA 1ECEA 1VFOA 4JKLA 3SIMA 1E4LA 1KQZA 3WQ6A 3T2PA 4PMOA 1KXQA 2BVYA 1F4HA 3WDIA 1HP4A 4J3VA 4JHOA 4GI9A 3W38A 3EDDA 5E0FA 3NSNA 3WDJA 1UKQA 2FH6A 4UQDA 1XC6A 5LA2A 2O9PA 3WNLA 5I24A 1UWSA 3WF3A 1XGZA 4J7RA 1E6PA 5C70A 4YPJA 1RPKA 1JZ2A 4QCFA 1UR2A 4E8CA 2CITA 1V02A 1FP8A 3NSXA 1K6AA 2WK2A 1GOIA 2XVNA 1VBUA 3GXMA 4WJXA 2BHYA 3WMBA 2E8ZA 1ZL1A 2CKRA 3NYDA 1ISVA 2EPLX 2Y8KA 2Y24A 3EMCA 3OGRA 2VUYA 5DT5A 1J01A 1XCXA 1UYQA 4MAZA 2X0YA 1FP9A 3CMJA 1G94A 4XZWA 3TTQA 3OGVA 2VMFA 3VO0A 3LXAA 1AVAA 1DTUA 1BYCA 5BWFA 2UY2A 2WMIB 4GI6A 2Y4SA 4BQ5A 2FHBA 2WSKA 3L2MA 3T0BA 1QPKA 3OBAA 3BAKA 1UKPA 1UD3A 5BCAA 4UQBA 2WVUA 1JDCA 3CZ8A 4W7UA 4QFUA 2WMIA 3WNPA 1JD9A 1CXEA 3U7VA 8CGTA 3D5HA 1DWJM 1PZ3A 2X2IA 4D72A 5DMYA 2O9OA 2F1BA 2VX5A 3SCUA 1JGIA 1UQYA 3CPUA 1KWKA 5E9AA 1DP0A 5C71A 1B9ZA 2G4FA 2GJXA 1J10A 2EXOA 2XJ7A 2FHCA 4UFMA 1UOKA 4UFKA 2G41A 2VZSA 1RH9A 1EH9A 4C7GA 3ECQA 2BXYA 1W9XA 2J78A 2CYGA 4MJ4A 1C91A 2JF7A 1X6LA 3OA5A 3D4ZA 3AOFA 2C0HA 3CZJA 5M17A 1R33A 4XB3A 1OT2A 2XVLA 3LXCA 4HMCA 3W0KA 3M7SA 3AHYA 2JFEX 4NZCA 2ZXDA 1GUVA 2DIJA 3VVGA 5AYIA 3RJXA 3KL3A 1GNXA 4ZXOA 1ZBVA 3AS2A 2EPMX 2CHOA 1CTNA 4CKQA 1C3FA 1M03A 3N11A 5EFFA 1GCYA 4KRUA 1CYGA 3K8LA 2VZTA 1FHLA 1BYAA 5A6AA 1QX1A 1HXKA 1CLXA 3B9AA 3GNOA 3GXIA 1HKJA 3CZEA 3KLLA 3WNOA 1VFFA 3FNDA 2W67A 4PYSA 5I5RA 3WUFA 3SCVA 3FAXA 1KR0A 1W91A 1W9UA 2CESA 4ZE4A 5E70A 2J62A 1XRVA 5D8WA 1VFMA 1C93A 1UWQA 4OKDA 2WSPA 1QI3A 1XSKA 3TV8A 5A6KA 1T0OA 3VIJA 3IJ7A 1V3MA 1J0YA 3ARZA 3EMZA 1QVBA 3S5YA 1XHGA 4YHEA 4Z2KA 1W32A 3VIIA 3WH7A 2CHNA 3WF0A 1HJWA 3CC1A 1MFUA 4E2OA 5M5DA 1G0CA 2XPKA 1J0KA 1YHTA 1ZBWA 3WFZA 3CZLA 1BHGA 4ATLA 4OOUA 2F8QA 4DWSC 3NSMA 1SZNA 3II1A 1QHOA 4U5IA 3IK2A 4LYPA 4V2XA 1PAMA 3CGTA 1YQ2A 1UWUA 4BS0A 1E72M 1OM0A 1H0GA 2XM2A 4P8WA 3ZJ6A 1E1FA 1MYRA 4GZIA 3ARWA 1R47A 5CLTA 4TVCA 4EANA 4F79A 1GJUA 1OIMA 4HOZA 2VC9A 2QMKA 3CUJA 2J7HA 3POCA 1ZU8A 1KXHA 2E9LA 2XGBA 1UR0A 2FGZA 1V3IA 4PMUA 3I3EA 2D0HA 2V3GA 2DH2A 3HJEA 3BVWA 4B9ZA 1V6YA 1AQ0A 2VCBA 1BQCA 5GNZA 1Q6GA 2QHAA 1SFSA 3ARRA 1BFNA 3K4DA 5FKYA 3HG5A 1PIGA 2VVSA 4IPLA 1HJSA 1TQWA 2CEQA 3AMDA 4UR9A 4BQ4A 4AXNA 4P7QA 1PBGA 1XV8A 5CGMA 1KQYA 4AZHA 4KH2A 4W84A 2ALWA 3H53A 3VD9A 1J12A 2YFNA 1UKTA 3GXNA 3W25A 3MUIA 3S6TA 4HP5A 1US3A 4ACZA 2OWXA 1W3HA 5CPQA 3TOPA 1B3XA 1US2A 1HWWA 2X2YA 1O7AA 4Z2GA 3AMKA 4S3JA 1HF6A 1UHVA 1W1TA 3GXDA 1PX8A 2F7PA 1EDGA 2YKKA 3QOMA 4AY1A 2XVPA 3SCSA 2PI6A 2WZHA 1R46A 2JIWA 4NZFA 2YJQA 4JZ5A 1QI5A 2DSWA 4JFSA 4B15A 2A3CA 5A3HA 3KWXA 2QLYA 2F7QA 1UZ4A 4IUGA 1E43A 1GHRA 1QNPA 4FNQA 1HVQA 2Q8XA 3ARQA 1MQPA 4N42A 1OBAA 2WWDA 4M82A 4WF7A 5HDRA 2G3MA 3W28A 1CXFA 5M3WA 3PZMA 2WWCA 3CMGA 1SR0A 1R86A 2WMKA 4PTMA 4WSJA 2DDXA 1IV8A 1CENA 4M24A 2PC8A 4UZUA 1EXPA 4MADA 3BAYA 3WF1A 4R5EA 2A3EA 3AMGA 4N0RA 3MS8A 2RGLA 3CUFA 5IHRA 1WPCA 1JZ4A 3AI0A 2CBIA 4YHGA 1WP6A 1K9TA 2ZXBA 2B31A 4L4PA 2QMJA 4UCFA 3FXYA 2VR4A 3D52A 5CZKA 3GM8A 4GZEA 1UQZA 3WQVA 3VSVA 3A23A 1E70M 4YN5A 4NRRA 2FH8A 1CECA 3VKKA 2X0HA 5I3DA 4OOZA 5IFTA 1PIFA 2CIPA 3VIFA 2XGIA 4D6IA 2W66A 1WCGA 2WYSA 1QBBA 3UERA 4GQQA 4W93A 5AC5A 1HKKA 2J4GA 2XIBA 3ZMRA 2Z1KA 3A4XA 1IZJA 3DX1A 1OGBA 2J7FA 3RO8A 4JFUA 2VZOA 1CWYA 3AHTA 1OIFA 1DWAM 5HXMA 4U2ZA 1U33A 4TX8A 3TTOA 5JBDA 4B3KA 4D6HA 1PEZA 3WH8A 1R8LA 2BXZA 4WK9A 1NOFA 4D6DA 1O7DC 5HBFA 2D0FA 2DT0A 5GQBA 1JZ7A 1E3XA 2WVSA 5CPSA 3AJ7A 4CGTA 1D3CA 3BVUA 2X09A 3LXBA 1HT6A 3EJUA 4UTFA 5BRPA 4DWSA 4U3AA 1Q6FA 3L4YA 2PBOA 1ISXA 3ARUA 1H41A 2QV4A 4Q22A 4PCSA 3VDHA 1VEOA 4RE2A 1UD5A 4MPKA 4Q7NA 3ZIZA 1FFRA 4XZBA 3N15A 3D4YA 3SUUA 3VMOA 1UA3A 2YDQA 1LLOA 1TQTA 4Y7EA 4ZENA 3F4VA 3W6MA 4MTVA 2XN0A 2FGLA 5FIPA 3AZSA 4HMEA 4FNUA 4JFWA 3WUGA 1UD8A 4J3TA 4S3KA 4X9YA 3W37A 2V38A 4IISA 4CCCA 1KBBA 1JFHA 3TTSA 2YL6A 2WCSA 2A3HA 2WLYA 5I79A 1EO7A 1HJXA 3N9KA 4P8UA 1V0MA 1X6NA 1QOXA 4OBSA 4TOQA 4UQAA 2GUYA 1MW2A 5AYBA 4P7LA 2WCGA 4EAMA 1CNVA 1UH4A 1ZBCA 2CKSA 4CD5A 2ZUNA 3SUVA 3BLKA 2V5CA 3L4VA 4BQ3A 1E71M 1BSIA 4UFJA 4ATWA 4QLJA 3EYPA 5JIWA 4KWUA 2F7OA 3G6LA 3VM7A 3UESA 2J8FA 2WNWA 2YA1A 3W24A 3UG5A 1E56A 3VDAA 1TMQA 4M8UA 2C7FA 1NM9A 4M56A 4H8HA 3FY1A 3WD1A 4NXKA 1KTBA 1VJSA 3VM5A 3SCOA 5CSUA 1GOKA 3VX1A 4C7DA 3E1F1 2AOSA 3H55A 3OZPA 4KGLA 3ARXA 1UWIA 4UQ9A 2PWFA 3BH4A 2DT2A 3SCQA 3WUEA 5FL0A 3ZT7A 2D20A 2J7GA 2FHFA 3ARYA 3A6OA 3ARPA 2OYMA 2J8GA 2WMHA 4BQ2A 3VOCA 5AY7A 3AIQA 1H4PA 2DGAA 3N18A 2W91A 3FN9A 1WZKA 3EJTA 1C8QA 3BVVA 1OD8A 4QAWA 2YIHA 4EE9A 3AMLA 1KFWA 1KB3A 2E0PA 1BGGA 4FLQA 3WD0A 6TAAA 1QI4A 2HVMA 3AIEA 3K4AA 4A4AA 1XYFA 4MNLA 1OSEA 4GO9A 1V6WA 1G5AA 1TFVA 3MANA 3UCQA 4DM1A 5A6SA 3GTNA 1V6UA 1XSIA 1V3HA 1JYXA 1IZKA 1I75A 5EB8A 2OWWA 3THDA 4MDPA 1JDAA 1E6ZA 4W88A 3LPOA 1HL9A 1MW0A 2MANA 1V6XA 5GPRA 3TTYA 4LXFA 3PZIA 2W4XA 2VRQA 5DEZA 5D8ZA 3HG3A 1JZ5A 2GJXB 3MKKA 2D3NA 4OZOA 2ZUWA 3HN3A 3AZRA 2VCAA 4HZ8A 4ZXLA 4CU8A 1E6XM 5FCZA 8A3HA 5DT7A 3DX4A 3CZNA 3U5UA 1OCQA 3WUBA 5E1QA 1DHKA 1PJ9A 2W61A 2XG9A 2X05A 4FNTA 5A94A 5JUVA 2GK1A 1E5NA 2TAAA 1JAEA 4CN6A 1SMDA 2ZUUA 1E9LA 1JZ3A 3SUSA 3QR3A 4UOZA 3M07A 5A2BA 3RCNA 1QBAA 4E4PA 4EK7A 1XD0A 4PMRA 2DQXA 2ZXAA 4AISA 5FD0A 1G01A 4AYSA 2BFGA 4W7VA 3VINA 2VRJA 4W85A 3PZNA 4W5UA 3F5LA 2QPUA 1KWGA 1JNEA 1EIBA 1V0LA 3AICA 3CHDA 1V3JA 3VD7A 2WHMA 3WELA 4HZ6A 3ZJ8A 5I23A 2W62A 2X2HA 3AIBA 3LX9A 3ZO9A 1JDDA 3OLDA 3ZOAA 4WIWA 5DFAA 2J75A 3UR7A 4OBRA 4HOWA 1MW3A 2XN2A 3BAWA 5A2CA 1MW1A 3W82A 4FNSA 3ZJ7A 1Q6EA 2ZOXA 2ZX6A 2YLAA 2YOCA 1L8NA 3GXFA 4NX0A 2PWDA 4EKJA 2VRKA 2BY3A 4AIUA 2PWHA 2ZX9A 2A3AA 2WKLA 3RDKA 3KLKA 2WMFA 4M29A 1P6WA 4JFVA 2BY0A 3VX0A 1UKOA 2ESCA 2EABA 4TTGA 1V02E 3WY2A 1GOWA 3FHQA 3RM4A 2CPUA 1RP8A 4W8AA 4PEEA 1XYZA 4F9DA 4UFHA 1E55A 4PCTA 3VDCA 3MMDA 4AMCA 5BXPA 4FLOA 4NI3A 1JYVA 4Z2HA 2W5FA 3AS1A 1ITCA 4OJYA 1WB0A 3WFLA 1A3HA 3BLPX 4W7WA 2PF0A 3EDFA 4JL1A 4MB4A 4D6GA 3UG3A 4PTVA 4WKAA 3AMCA 1JZ6A 4W86A 4FNRA 2FYVA 1E4NA 4OIFA 1MWOA 3AIRA 5A6BA 3AHVA 3MSDA 3CUIA 1J0ZA 3FW6A 3DECA 1JI1A 4GKLA 3WSUA 4GINA 1PX3A 1DWHM 3BUPA 3VMPA 3KL5A 2FDMA 2E40A 5C8BB 3BVXA 1QNSA 3DC0A 4UOQA 3VD3A 3OIHA 3T2QA 2YL8A 1CPUA 1QNQA 4UFLA 4LYRA 3LPFA 1K9DA 1EGZA 4DWSD 4AZCA 2DIEA 5BXSA 2WHKA 3AXHA 1UD4A 4JKMA 3EJPA 2PWGA 1GOQA 4UFIA 1K9EA 1OGGA 3DHUA 2DEPA 5D9NA 2WMJA 2UY4A 4XUYA 3AXXA 1EOMA 1HVXA 4LQ1A 2YBUA 1ZBKA 4PSPA 3VGGA 3WEZA 3QHNA 3GH7A 4R27A 4J3WA 2WC4A 1E40A 4AZ6A 2WXDM 3OB8A 1VENA 3HU7A 1CZ1A 3EJRA 1GZJA 1ESWA 4MNKA 1D7FA 2VX7A 5E6YA 1X1NA 2VI0A 2VOTA 4BCEA 3WEOA 3GH5A
chains in the Genus database with same CATH superfamily
4GIYA 4NXSA 3RIAK 1YA5A 3BO9A 2BY2A 3IMRA 4JG0H 4O2FA 4FYSA 4ACZB 3PTKA 4PJ7B 2AXWA 2X70A 1GKEA 3QARA 5JA8B 3NDYE 3ELQA 1BM3L 2X2UA 1NCDL 3BICA 2WXKA 1Q66A 1UJTA 4RMBA 3R06B 4TL4A 3W9ZA 2ABAA 3VQ1C 1A4KA 1KCKA 4JZNA 5EBMA 1V08A 1KCZA 2WN2A 1VPQA 2NLJA 2X4OA 4AUBA 3ITVA 3QA3A 3DROA 4Z7OF 5TGBA 5EFDA 1QZNA 3EO0B 3JZYA 3ATFA 4C7FA 2UX6A 3S4TA 1X9LA 4ZMQA 1DJWA 2UXTA 1WUFA 5KYWB 3VKBA 1F3JB 1TX0A 4JFEA 4WDIA 4BK4A 4ZB0A 3O4LB 2E7BA 4B0MM 3LZPA 1XR8B 4L4VB 1WDSA 3GEFA 2O6PA 2EHHA 3VU2A 2VSKB 2EICA 4HIJA 3IARA 5AVRB 4V1XA 3U1SL 1FO0A 4NQXA 5C0DA 2E3VA 4PJBE 3TEZA 3N12A 3WH6A 3KYNA 1MFEL 4J1UB 3GGWB 1A4BA 1AP2A 2BVPB 2I7SA 3UBHA 6FABL 2X7VA 2MH4A 3KGTA 1BRLB 4RISL 2WCPA 1TFHA 4DWSB 2G2NA 5LO7A 1J96A 3OM3B 5C0GA 5E9DB 4A21A 1K6QL 5J13C 3VQ2C 4NAQA 1UZ6F 3CCHA 4OTKA 1XZ0B 5DJ2A 4HDIA 3V0DA 3CLWA 2FLRT 1HN1A 3GXPA 4FLHA 3JV6B 4MMZA 4XCNB 3UGVA 5E5CA 4PTTB 3N43F 2HXUA 2QQLL 4PJIA 1O9VA 3W0WA 2YD1A 1W1IE 3VH8G 1CE1H 3LN9A 5I1KL 1LO0L 1NLDH 5I6XC 5BQDA 1UM5H 2Y3AA 4CNTA 2NUPA 2DD8L 3QJSB 2CLRA 1MIEL 2V7NB 5BXFA 3NT0A 2PLMA 4HZAA 3VG9B 3OKMA 1MHCB 4IOIA 4DZBA 4C4BA 3EB3A 5I19H 4CJ1A 3VILA 2ODHA 7ENLA 2F54B 1HE8A 3DMMA 4OGYH 5DZVA 2JIEA 1FHVA 3M88A 1ZJHA 4BKLB 1QHZA 5IV2B 3S47A 2ODOA 1YMHB 2V4LA 3V5KB 1T7ZA 3A67H 1NUDA 1IT9H 4BKTC 4MZYA 4LPYA 4DLFA 5AVXB 1KNOB 3MRFA 4JDVB 5CWSA 4YYFA 3CSGA 1MWAL 1QMUA 2EE2A 1KTRL 3CDZA 3B9DA 1VLIA 2HSAA 1SZFA 1WBXB 2XISA 3W7PA 2X7WA 2J20A 2F38A 1VQTA 3BVTA 4INFA 1D5MB 3ZN6A 3T8XB 2X1IA 1NC2B 2JKPA 5CBIA 1TPWA 4I13B 5ESAA 3HPZA 5D7LB 1YNTF 1U91A 4IFKB 3HAEH 4L7ZA 1M01A 4FAAB 4BZ1A 1GGBL 4XN2A 4NO0D 4LK4A 4PH6A 3WJWA 3P74A 4YBHA 1BSLA 3QPZA 4AWEA 3GQFA 4F27A 3HG4A 3QH3A 1VBRA 5DEFA 3CMFA 1ECYA 2VN4A 4ZUUB 5HHOD 5ADPL 5EO9B 4I7UA 2VLJE 1K1DA 2QCFA 1ZV5A 3GRWH 4PUEA 5ICUA 2BVQA 4EXBA 5HHQA 2O92A 2HBXA 5HPMA 3D25B 4NAFA 4FF9A 3UGRA 1UXMA 3CFQA 3MCYA 1IUZA 4NKDB 3BGGA 4XXCA 3UTSD 2F5AH 4NOBA 1MCPH 4LPVA 2YZ5A 4XBSA 4RH4A 5CF3A 2BOCB 4G1EA 4FXGA 3RUBL 4YQXL 3LZ3A 4GG9A 2GGHA 2X40A 1KJ2L 3HCVA 2HAZA 3ETBJ 1JPST 4WW1B 5SX5K 3QB7C 5FW8A 3V4BA 1F42A 4OKVA 1DL3A 5L2KB 5EIIB 4NN6C 5SX5H 1EVUA 3BZ4B 4GYFA 1CEOA 4UMSA 5C0IA 3RM8A 2NX5E 1R24A 5CD3A 4WFHD 5DBUA 2VDOL 1NAKL 1NICA 1UKSA 4HHWA 1J87A 1PDKA 4C58B 3TVMC 4K3JH 1KOAA 3F5KA 3B2MA 1K3UA 3GVWA 4H04A 2Q01A 3H24A 1JWSB 4DESA 5LBSL 3OMAB 3UBFA 1QOPA 5C9XA 3TBSB 5BW7A 4B7IA 4CD4A 4H00A 5K59E 4QRPB 3KJ6L 4HUMB 5JMUA 3K91A 3S37X 4ZAKD 1YPZB 4N28A 1GJPA 1NIFA 4FG6D 1MUMA 3IDXH 4Y4KC 3AZTA 3LRKA 4NWTH 2WLHA 4URKA 3GSXB 3RXZA 2RAMA 3GZPA 2G5BB 2Q76B 4RGOL 1SO6A 5KVGE 4UTTA 5K33A 3GLZA 3SDCB 2ZWZA 2FIKA 2UY3A 4YLBA 4XMTA 2F53B 4U1MB 5FECA 2WBJA 2QVIA 2NXIA 2W60A 5ITFA 2JGQA 1Z9LA 4XNUH 3BAXA 1VGAA 1VKXA 3AGVA 1NH6A 1HJQA 3PBYA 4JRXB 2ZG3A 3LKOB 2EGZA 4RNJA 4B27A 2C8NA 1SQ7A 4LSDA 3DHPA 4DBSA 3ZPDA 4LLYB 5LCVA 4ZTOL 5IJKC 1YEDA 3UMTA 4JGNA 4DFIA 3KJ4B 1AZ1A 3BH8A 2K6WA 4CU6A 2HK1A 4GC4A 4UIMB 1CXLA 4PMZA 1VRDA 5A8OA 3NQDA 1I2OA 3UCRA 4K0OA 4GNKB 4HJJL 4PJDB 3GKWH 4P5TA 3WYZA 3AS3A 4YBLB 2VDRH 1QSFA 3C6EA 1NGZA 5D9PA 4FYQA 2J8UF 1ILUA 4WU7A 3NFUA 2WGNB 2Y6SD 3IFNL 5FYKU 5IP4A 1P5VB 4J3XA 4CUCA 4V2BA 4LLQA 2AKRB 4QRQB 3A4AA 3INOA 4KO5A 4JEJA 2YMXL 3AAZA 4LPCA 1OFPA 4G8AC 1X5IA 5G4MA 4CSZA 3SE9H 5HYJE 4BF7A 1WAEA 8FABB 3ZZLA 4N5EC 5C0CB 3AT8A 3E8VA 1ISZA 1IEXA 1TPUA 4XAWL 1J9RA 1TX2A 1VAHA 4YHIA 5KYYA 1QP1A 1NPJA 3STGA 4IIEA 5JBEA 4FABL 2J7EA 1GONA 3FQ2A 5CCKL 3Q2WA 1BZ8A 3GS0A 3PFRA 1G4MA 1TJXA 5KTEL 5G55A 4RA3A 3K71A 1GAFH 4LE8A 3DC8A 1TYRA 3F84A 4LCYB 5TDPB 3AREA 4GMTL 4GXVL 2OV0A 2R2EB 3BRFA 4OLUH 1OQFA 1ZP4A 1OAUH 3O7UA 4YWGH 1ZHBB 1RA5A 2LVEA 5TD4A 1PZ5A 2NQDA 3NA9H 4G9DA 4FFWC 4FYTA 1G0DA 2PGWA 4XD4A 1RUSA 1KBJA 5KWYC 3ZYZA 3VRIA 2WNXA 3MTRA 4YDJA 3FTSA 5MHBA 2X12A 1J8HB 3I6KA 2V9DA 1XO8A 3CV7A 1TA3B 4FS9A 2CNCA 1THCA 1EA9C 4BFIB 5KN5B 2VDLH 3L17A 3M1BB 3QPKA 3VYLA 3CHQA 5AYQA 4DJDD 2X89A 2AGKA 3HI5H 2HKFH 4YXHL 3W74A 3TBTB 3TIEB 4DF1A 3JW7A 4OCXH 1HHIB 3DTXA 1F7BA 4U4IA 1TVLA 1XC6A 2YX0A 3ZE1B 4PRBB 5B1CA 3VH8B 5D7EA 3S3DB 2WO4A 4ZD3L 5L4JA 2PMQA 2ZDSA 1ROWA 4GI4A 2DQEH 2A1WH 5GRUH 2EINB 4PTUA 1VCGA 1QPXA 2BDNH 4P0DA 5TE7H 1XCXA 3O9WB 2ZCHL 3OD3A 2CZNA 4RESB 3VO0A 5AZEL 5L4IA 1D7BA 3SKJH 4J4KA 1XGPA 1IAIM 3K2IA 1KBIA 3X13A 5JNYB 3H3PH 3SE3C 2XTJE 1QK2A 3ATAA 2H6RA 1U3HB 4JCWA 3DH7A 4I3SL 1IC7H 4N4QA 3VE0A 3RFZC 4AW4A 3F5WA 2VX5A 3QNYA 1S9XA 4LKXA 1GYLA 1T21B 4HT1L 1CQKA 1JRCA 3H9SD 5E2TH 3EYSH 3RTQA 1FHGA 2MOQA 4P4KB 4IIGA 4O11A 3CVCA 4K4KA 4KX8A 3FTXA 1VFSA 3UAAA 5IMKB 1EWHA 3AWOA 1YAZA 1GZQB 3BMXA 1U8OA 4KRUA 1WUNT 5HHME 1E27A 4WUUB 3P7YA 1HXKA 1XW8A 4AHQA 4R4ND 4ODTH 1QSEA 1O94A 1GEHA 5I5RA 4PJEF 2R69A 1W9UA 1MPAL 3IJLA 5JXAH 1EEXA 4WD0A 1UWAA 1XSKA 1S5WA 5CEXB 2ZONA 5D05A 2F19H 1U8LB 3TYBA 1IGYA 2E7HA 3EMZA 1QVBA 5DQDH 3S5YA 1XR9B 2OMZB 3NOYA 4GUFA 3CXHK 4BIKA 3MOBH 4E2OA 4C83A 1NJ9A 4P23B 5MEND 4KXZH 2UWEA 4G7FA 4Y1AD 3GLDA 1AKJD 2CHWA 1ZHLB 2UY6A 3APTA 3JU2A 3GDRA 4DEPC 3MYJA 3L7FA 2A2IA 3B9VA 4Q6IA 3O6YX 4EANA 4M61A 3T4YB 4AVFA 4MLIA 1EXUB 2JI2A 2BFVL 4QRTA 5B1JA 1X7SA 5D02A 1ES0B 4FG4A 4ZXBB 3WNIA 3W1MA 5GGRY 4AUYA 3SFKA 1SFSA 2X53A 4GLEA 3CIXA 1YDNA 4HIHB 3DV4A 1E8XA 1H3TA 5FKYA 15C8H 1F41A 3MT1A 1CG9A 3GXNA 2V2TB 3W25A 3T4AA 1SM3L 2Q8BL 1B3XA 1YYML 2VQ1B 4GSQA 3IRCA 3GSVB 1G6RH 3KRUA 1DJIA 2NR6A 2W38A 3S0PA 5K39B 1OCCB 5D32A 1DVFC 4BRJA 2WZHA 3MNZA 4JFSA 4KKBD 1GKRA 3DIVA 1I2PA 5I1IL 1L7TH 3FFDA 2WWDA 1UGKA 4JFDD 5DURD 1A5FH 1DIOA 4ORMA 1SR0A 3RLVA 4WSJA 1CENA 1I3UA 4WRHA 1FY6A 3LIZA 4TUKL 2EO9A 3ZDZB 4ZTXA 1R5VB 4Y9MA 4WFEE 1ZCCA 4YE4L 3MACL 1IAIH 2DORA 2QQNH 3PGDA 4HHAA 3W84A 5IFTA 1PIFA 3Q45A 2CIPA 5MP6L 3R7MA 3R7RA 2WYSA 1P0SE 2RIKA 5I30H 4GO6B 1KFLA 2ZAIA 3MRBB 3RLUA 4Q4KA 5JBDA 3MBEC 4AYDC 4LCCC 2WNQA 3WLSA 1IM3A 2PCYA 3CAFA 3CWHA 1I7RA 1QLRA 2DTML 4GYPA 5EPMB 3TCXA 2RDWA 1MJ7L 1H41A 1SGJA 3PFUA 3BVJA 2JFCA 4U0RC 2FX9H 1A4AA 2J7LA 5JW4R 3GHEL 1CCZA 3SO5A 1XIBA 3GG8A 4EBQH 4JN2B 1B0GB 1UA3A 4ODHH 2YKLL 4WWID 5F21B 4ZW5A 2X16A 3W6MA 3IBEA 3K5RA 4M6PA 4RSVA 1DCEA 3TA6A 1RUQL 5H94A 4XPGH 2F74A 1VPXA 3GHRA 1IAKA 5D72H 1OTTC 3ZKXC 4F2MB 3GVQA 5GGRA 2Q86A 5I74B 5AYBA 4XPFH 3H7RA 3WLTA 3V7MA 3FCSA 5I9QC 3SUVA 3KPRE 3B37A 1UWEL 1XFPA 2E1DA 5FF6A 3VZXA 2HTKD 2IH8A 4IIQC 3FO0H 2W0UA 3ALXA 2W9MA 1E56A 4G9PA 3GWJA 5I15H 1B2WL 3O6FB 2D9CA 1KTBA 1GOKA 2IH1A 3GK0A 3GBML 3L1EA 1FHUA 4AQZA 4PTDA 1ED3A 2J7GA 1F18A 2QEZA 2SEBB 4NQSA 3AUWB 5FS5A 2OZ3A 2ZRWA 4HK0A 1MFAL 3DVGB 3HB3D 3MRJA 3UY7A 4LQFL 1KFWA 2PCFA 3W1ZA 4QBXA 3KBWA 4HS3A 4IPJA 2DKUA 5JORA 1I7TB 1ETZB 2MTAA 5L0QC 1XEDA 4KO9A 3ULVE 3DGRA 4I4WA 4N87A 3BQUA 4XP4L 3RU8H 1V3HA 2QDGA 1Q9KA 3VFTA 2Q09A 3MV8E 4BINA 1ME8A 2DLTA 1JDAA 1HL9A 4NCC2 5GJMA 1V6XA 3QNZA 3ZVHA 2AJVL 1U92A 1QFEA 1GOFA 2Y6TE 4EXKA 3ZFHA 1QFUH 5F1KC 3LS9A 4GKOA 2A77L 1R3TA 2OTUB 1YUHA 3QHZL 5A94A 2WKOF 4HKJB 3VXUD 4CMHB 4Y4FD 3P30H 1Z44A 4P2QB 4PB9H 3PSWA 1EJUC 2Y85A 2Y7GA 2XKUA 2R56H 1C08A 1KRCC 5C0JB 3U9UB 1QFPA 3AWGA 3P0WA 3FRPB 2HXTA 2LLEA 2ZX6A 2VR7A 1AHKA 3L9RA 2YHGA 4AIUA 2G75A 1K5WA 6XIAA 3KLKA 2ZPKL 2VD9A 4JFVA 5EUOE 2I07A 3P02A 2V7HA 4GH3A 4PJXA 5BWAA 4JRFA 2C7UB 4G3YL 3P11H 3BLPX 1LQBC 1ASOA 2OK0L 3VUSA 4GKNA 1CFVH 3F4CA 5FYLD 3ZHDA 4RLIA 1QASA 1T20A 5FLVA 3ARBD 4H0IA 4U1IB 2DW7A 4QCIA 4JFFE 5JR1L 1OAXL 1JI1A 1AGFB 3WSUA 4XWGL 4PJ5E 4IP7A 3SYPA 1DQKA 3RZCD 3KL5A 5KSAB 4P2RA 2FYYA 2W9DL 3A6BH 3FUDA 3TZVA 3ZGIA 3TVMD 2C13A 1K9DA 3BVDB 3L3KA 1PE1A 2K6YA 3PWJB 5BXSA 3ITYA 1T5AA 1CLZH 3CUXA 2KUTA 1G5GA 2PWGA 2P53A 4N24A 4P46A 3MDUA 1S1PA 3P3BA 4KHTH 2WMJA 1RHFA 3V4VL 1XC4A 1FWNA 2N4IA 4RX4A 3RDTC 1LE5B 5DDHB 3NFPA 3HU7A 1R3RA 1OF2B 4LLDA 3W1NA 2Y7OA 1E73M 3BZ5A 2FJGA 1SHWA 5LIWX 3ZS4A 43C9B 1A25A 1T0MA 1R85A 3IV8A 1BQRA 1NBYA 4LVHC 3G77A 2VWEE 1CFNB 4H6QA 1ZCRA 2JKTM 2A9NH 2J9YA 2BVDA 2VLRE 1VFHA 3SN1A 4PGCB 2DJUA 2WQUA 4TSBL 3T1FA 3PAVA 4ZQNA 3CQKA 5EEVA 3SPVB 1XIEA 3BAJA 5D1QB 3NRFA 1RFDL 5FW7A 1FRGL 2VB5A 2HJKB 3H9HA 1XLKA 5LSMA 3AC0A 3MNDA 1F61A 4M5PA 2PABA 1XLBA 5KYXB 3OAUH 5AW4B 4BR1A 4P3DB 3C56A 3HB9A 3SSZA 1CBGA 2OMYB 2DQFB 4LW7A 1H5VA 1TQUA 3CHOA 3GFYA 4S38A 4CVWA 1JD7A 3AG4B 4TX9A 2G9HA 4QP0A 1PY0A 2V37A 4HG4J 2XTKA 5L6YL 3QEQD 1DVQA 4IEFB 4PMXA 2VUOA 3VWKC 1JPSH 4K94H 5HYQB 5FXCH 3K74B 1SVBA 2HXAA 1AH3A 4FCAA 3NSFA 4DP5X 1AOZA 4KRMB 1KTLA 3RWDB 2VL4A 2ICWB 4XVSL 4A3HA 2DZBA 3TFXA 5I6KA 4KRTA 1NL0L 4WK2B 4HWZA 4DP4X 3U4FA 1PEWA 1YTKA 1P48A 4X4XA 1RK5A 4UTAH 2ZKWA 1LOLA 2WJEA 3KDOA 4LOCA 3KCPB 2OGJA 3UGEA 2EYTB 1LL6A 3CK0H 5LHFA 4ZMYA 4K8EA 3KE0A 3IIVA 1I7ZB 1HO4A 4O0QA 2X38A 3T0EC 4MD4B 4PJ9B 4EX4A 3UIZA 4OGAC 4FFWD 3BLOA 1E1CA 4IBUA 2UY7A 2E7CA 3RVVD 4FHKA 3QZNA 3KBHE 1N70A 4K7YA 5I3IA 4WENB 3DX6A 4HS6B 3DX7A 3RWFB 2WVVA 3BMWA 1D9KB 1UA6L 1M9HA 3QRHA 1WA3A 3GHPA 3JVFC 4OLXL 2FNWA 1T5KA 3PV7A 2BW4A 3CQQA 1W8SA 5ERWA 1TWZA 3DI1A 5C0BA 1BZ9B 2YLKA 4MMXC 2O56A 3L6FB 4LSSL 2XPYA 4LT7A 1PKQA 4Y5XB 4YAQA 2X1WL 4G42A 4ONHB 4HNUA 4KEVA 4IBLT 4JY5H 4C6KA 1MFVA 4ODUA 4PMNA 3QIBA 3CFDB 5ALCL 1WKDA 1MRDL 3OHXA 3STZB 4P5SA 3RX4A 2XXGA 1QYGL 2L7QA 3PBGA 2NY7L 1ZHKB 1O6VA 2VC2L 3WL1A 2ALAA 3T55A 2GK1B 3FSOA 5EZOH 4TULH 1AD0A 4ZODA 3NJFA 2E3ZA 2VO5A 2ICEB 2WLNA 2Y06H 3VSUA 4MJID 4HK7A 5B7ZA 4AZIA 2PDYA 2ZX7A 1TCRB 2YQGA 4MKMA 3N1AA 4PGJA 4ERGA 5JPMC 4RDQF 4DHLA 4GAFB 3D34A 1DSWA 4BFBD 2ISFA 3BLBA 2F1AA 2CUAA 5F9DC 3RX2A 4MFDA 4HNCA 2HCVA 3KL0A 3M1ZA 3V5HB 2GVLA 1QO5A 1NP0A 4XNDA 2XPZA 4EKXA 4HBCH 3RPIB 1XIIA 3PZUA 5LIKX 4ZX3A 2WC3A 4L8DB 1N82A 2D31B 1AD1A 1BV8A 3QQNA 4G7VL 4APQA 3KHOA 3IKCB 3WF2A 3FGCB 5EMMA 1Q72H 5DT1L 5I6LA 2Z1SA 2VCOA 3QULB 3B8UA 1A0QH 2XX1A 5F6IC 5CAHA 1JPTL 1KCRH 1DLHB 4HU0A 1TEGA 1IGTA 2AEQL 2CO4A 4P8XA 3ABSA 3ENEA 3QC6X 4JPIB 2VWTA 1KGXA 2JF6A 2Z31A 43CAA 1R3LB 4FXSA 3GK8H 5D1ZI 4XHQA 3BCFA 4XV0A 2DM4A 4OI8A 4F24A 4N0YH 2D03L 5I3KA 1ONQB 3K46A 2P45B 2C79A 1U8CB 4NHUA 4FL4B 1J05A 1ZLSL 5D1ZA 4HA3A 3HZ3A 1XF2A 5DYFA 5SWZE 2X9WA 1BVZA 1B3VA 3JS3A 3NZUA 3EGDB 4OD2B 1I9IH 3BISA 4JN6A 1NCAL 1NFDF 4YXKL 3UTZB 1TQSA 3QVQA 3WL0A 2JB6A 5IBTH 4QWWD 2Y8UA 3BWAA 4EI6A 2HLAB 4Y5YC 3G6MA 3IGAB 1I9CB 3P62A 1DEDA 2NSXA 3SBPA 2VD8A 5BV7L 4DJED 5AUMA 3G3MA 2JTDA 2IKHA 1J5DA 5HJDA 4IIZA 5A40E 3WXWL 2ZKHL 4XCEB 4FQIL 1A49A 1QI0A 4FF5A 4PGBB 1N6QL 4N9GB 2WINA 5ALBL 1T41A 1IU1A 3VFPB 4GUIA 2R1KA 3N13A 4ELKB 3MODH 3NABL 1OSPH 3I50H 3O45A 3GW3A 5SWQB 1AH0A 4MCYB 2AMXA 2DZVA 3SCRA 2X30A 3CFNA 1FGVH 4WVXA 2ZCLL 1DVFD 4IK7A 4B3ZA 5FESA 4MJZA 4GKZB 2ZICA 4W5ZA 1NGQL 4U1GB 4WFFE 1QI2A 4C56B 4RZKA 3CPRA 3EGXB 3BVNA 1K8ZA 4KMQA 3GSWA 1CF1A 4LF3B 3GB6A 1G7IA 2VDPL 2UXVA 4KPHL 5BVPL 2QDHA 3MC0A 1TZIA 2CC0A 5F7AA 3PXHA 1JRHH 4I0PB 2ZG2A 3OKEA 5H35B 3IDYC 2GJZB 3KOXA 1I3GH 1FKXA 1P6BA 4ODBD 2P5WD 4DH2A 1U1JA 2VIRB 4H1LB 3ARSA 1F8TH 3WI9A 5IGXH 1N2RA 5CZVH 2G0LA 2OZNA 4PP1C 2GJRA 2GITB 2SFPA 4ODSH 1MHEB 3S1UA 4OGQC 2GFBB 4LPUA 2I16A 1DO5A 5F88B 1NARA 5BXTA 3ZDYF 1CK0H 3WF4A 3QDME 3MBED 5BMFH 2HVNA 5F7UA 2QGCA 4DZ8B 2NW3A 5FC9A 4HW6A 5D03A 4D7BA 2NVCA 3Q48A 4I6KA 2FBJH 1VFLA 1UXWB 3PU7A 2OX4A 1KPRA 5BJTB 4AD4A 1IGJB 4JPWL 1DXEA 4JZJC 4S1QL 3ZE0E 3HE7C 3XISA 3KLSA 5MHSE 4KETA 2IBZX 2OFJA 2ZOLA 3UJTL 3AU6A 1Q6DA 5EOCL 2QJGA 4UT9A 3H2CA 2GW5A 1FH5L 3QZAA 1QLFA 3O2LA 2NXYB 3VACA 4A6YB 4DQAA 3E9AA 4XGZB 2Y70A 1OAZH 1UATA 3AY4C 5A2AA 4D9QE 5IOPA 5HGHB 2LR4A 3H56A 1AQFA 4XO6A 2P76A 3SDDB 3C6LC 4L8SA 2PYEE 4PRNB 2GVGA 2XXMB 4C1NB 2A9CA 3QGVA 5LAPA 3PWLB 2ZUMA 5EU4A 4CILA 5H6HA 2I9EA 1GKQA 3UZVA 2DBLH 4DKTA 5L8JB 1ZEAH 5ABFB 3RLHA 3DLQR 4GG6E 5FA3A 1TZ9A 2BSTB 2EDQA 4JTLA 1OB1A 5FYKH 2X2JA 1JGLH 1SYVB 3QYCA 5FM5O 4GQGA 3LTPA 5DN1A 3WEMA 1CLOL 2ZUSA 3R19A 3QUZA 3U4BH 1ZTXE 3HPLA 3WKPA 4F7PA 4X7TA 1P1VA 4AYFA 4YC2C 3N2MA 2ADIA 3CHSA 2RAGA 3ZW3A 1ZT1A 1IRAY 1U2HA 1UWSA 4J7RA 4J2MA 1DJXA 4F57L 3U46B 1UR2A 4PC8A 4XC3L 1LLAA 1E4KC 2WK2A 1OWRM 3RO6A 4E9WA 1P9MA 2HSIA 1BD2D 1U58B 1UJ3B 4MFHA 3EMCA 2PDNA 4G8GB 4CBZA 4AM0A 3BJTA 4HEMA 1X7QB 2E7MA 1ZVNA 1ZIAA 1QHQA 3OGVA 3HA0A 5LJYH 2ADGB 4OJDH 3K6OA 2C9PA 3M0LA 3VD2A 1DCLA 4OCLC 4U1NB 1BQKA 4GKSA 4CQAA 5KW9H 4GG8A 1I3VA 4GX8A 4X4MA 4LJ3A 1PZ3A 3ZIYA 4L64A 5DMYA 5C08E 2O9OA 3NPXA 2YC1A 5C71A 4PJCF 1JGVL 1YNTA 2DJXA 3FONB 5EIIG 4IJTA 4C7GA 1W9XA 4LCWD 2J4WH 1O5DT 1WIPA 1CFTB 3MCKA 4HC1H 4LLWA 2NY5H 1UQSB 1XISA 4ZPTB 2R69L 4RMSA 2ISSA 4JFZL 2KZ1B 1HQRB 1MCRA 1FLRL 1UZGA 1D5IL 4MNQB 3SJVE 5KS9F 2VR9A 1BREA 4CKQA 1M03A 3N11A 4I48B 1D9EA 1XLDA 4AGNA 4B53A 1YEEL 1RY0A 2QPDB 4LIQL 4HIQA 3BQ6A 3FNDA 4FMKA 4PYSA 2WTPA 4KIEA 5E70A 2HFGL 1WAAF 4QKTA 1JGEB 3ZXAC 5JPNB 3TV8A 3ASWA 2GDQA 4FTVD 3HC3H 1T7WA 1RJCA 3IJ7A 5F3BA 2CO6A 1ZLWK 4QTGA 4PS7A 4LDCA 1UFUA 3VKJA 4YHEA 2WNZA 1ZLWH 5IESH 3E0GA 4C8XA 3NL2A 3FYOA 3WF0A 1MLBB 1VJIA 2I5QA 1YNLL 4F8OA 1ZBWA 3TIMA 1BHGA 4BXVA 1H8OA 3CJPA 4ATLA 1N18A 3HUJF 3E9UA 3GSNA 4UTBA 2F8QA 4ZQOA 4DWSC 3EX6A 2AAMA 5U7SA 1RHHA 4V2XA 4XNYL 4EPKA 1S7VB 1EAPB 1MXSA 2NQLA 2JJUA 2DL9A 5TQLA 2MPVA 4TVCA 3I6GB 3RDTD 3P61A 4M5ZL 1NANI 1XAKA 3W1UA 4ZZKA 4L1DA 1OG0A 4AY7A 2MQ0A 1MLCB 3EWXA 2F2KA 1VGEH 1N3NA 4LDEB 4AC2A 2KPWA 3CTLA 2POTA 5LXVA 1A5UA 2VJ0A 3TNBA 3GJEA 3W2LA 3P81A 5CGMA 4L8BB 3ILEA 4LAQH 3MJWA 4MRBA 4GFXA 3NSDA 1DVUA 1F00I 2I17A 3QKZA 5CUSL 1WDWA 3LSOB 3B9KA 3VG9C 3MSRA 2AQTA 4KNQA 2QSTA 4ZW3A 4L1TA 3C2OA 4HCFA 3LTSA 3LIZL 2WZAA 5BUAA 1OVZA 5EO0B 2Y5JA 5ESQA 1AFSA 4JREC 1LDPL 1JMZA 4BEIA 1IGMH 1VPYA 3CMGA 2ZWLT 4PI0A 4HXBL 4LHUA 1UUOA 5FA4A 4TO8A 4AK2A 3SSGA 2ZWNA 4YJ5A 3SDYL 5EMJA 3QZLA 3BAYA 3EFDL 2Q10A 5AB0A 5H8DA 4GBUA 1GTNA 2QDEA 2KZBA 3GIVB 4ANKA 4IRJA 1BXCA 3V5DA 5AZ2H 3DFTA 4UCFA 3UFIA 1NGYB 2HRPH 2GG1A 5J1SC 3B5TA 4D0BA 5GGQH 1QUNB 4PY8J 3CVBA 3MCG1 4H0GA 3VFVA 2YEQA 3VWKD 1CICA 1ZQ5A 4DGYL 4HPNA 1JV5B 2XU9A 2J8UA 2OT1A 3CD4A 4JFXB 5CGQA 3Q4DA 1BWKA 3H2EA 1IZJA 3DX1A 5FACA 1MREH 3OSVA 1TZ8A 2VZOA 1RZFH 1CWYA 3AHTA 4QHNB 3W2DH 4HUCA 4D3CH 3WE6B 2FZMA 4X6FA 4E2BA 1OX4A 2JXMA 4MVBC 5I0WA 2QJDA 35C8H 3MKGA 2WVSA 5DJYA 4P49A 3EJUA 4NBZB 4X6EA 3G9VA 3LN5A 3JWNG 1AG6A 4ISVB 1RLBA 4HXAH 1IGCL 4M1CC 1N6VA 2YPLA 3CSFA 1QFWM 1MJJA 3OGOE 2DMBA 5ISZE 5D4JA 1A9EA 3EOLA 1E4JA 3T0ED 1DJHA 2HNEA 4J3TA 3C5QA 1KLFB 3M1CA 1DBJL 4I2XB 1OCWH 5EIQA 4MA8L 1GW6A 3QJZA 4B95C 3WFEL 3W2JA 5CKSA 5ICXA 3F8UB 3T1GA 5GGVY 1XLFA 2FMNA 3TSMA 1AQKL 1CFQB 2ATKA 2R0LL 5EEWA 3BKJH 2WNWA 1BVLA 4TNVF 4ZUTB 2CLZB 2YGVA 3QXWA 5F2LA 2IKGA 1TJIH 2ORBL 4MA7H 3VX1A 3NBNA 2J73A 4K38A 4CADB 2B5IB 2OX1A 5BS0D 2E6JA 3ARYA 3D18B 3ARPA 1I9RH 5FSDC 2NQHA 2EDYA 1T7LA 4JYFA 2IFFH 5D2YA 3BN3B 4F7MB 4FFVC 4FQHB 4FLQA 3PPEA 3QE5A 1MI5D 1NCWH 2ITDA 1F3WA 2XY1A 4GO9A 2QUMA 3IUHA 5E8EB 1EBHA 4QTIH 4DM1A 3WLQA 2MWCA 4KQ3L 1XSIA 1M2VA 2LQRA 3M5YA 1P2CB 4AH2B 2VRQA 4HD9A 1AJZA 1ROCA 1RZPA 3LVTA 4UMCA 4YEFA 5IVZA 2CW6A 3SDCC 3FX4A 3QFJB 4IICA 1DHKA 5ACMA 4NCC1 4KK5C 1FQ9C 3G6JE 1OCJA 2JLPA 1UOVA 3DXAE 1UT2A 3ESUF 4L1GA 4QE4A 5FCSH 4E4PA 4HIIA 1I4FB 4EK7A 1BXUA 1C5CL 1G7MB 2BIPA 2QSCL 3SGEH 2V67A 3AICA 4ZMXA 1NEZA 3EYUH 2W80C 3MAWA 2E6PA 3VW3L 4OBRA 5KSWA 1EC9A 3WFCH 4ZGYA 1MW3A 5B3JF 3MDWA 3ZJ7A 1RZ8A 3FULA 1IC5H 5MERB 5BMWA 1HQTA 1R19A 3KJ4C 4NC0B 4M29A 3VOHA 4FP8L 5FCUL 1UKOA 4W8AA 3DFSA 2NLYA 1R2TA 4HLEA 4C6IA 1JSYA 5T1LB 2EIKB 3LERA 4O1AA 1VKFA 2AQ2A 2YQBA 3I6LD 1ACXA 1CF8H 3WEXB 2O6EA 4PJEA 4Y8FA 1E4NA 2OO0A 3HTLX 3IJEB 2J27A 4N0CC 5LNUA 4MCZA 1DWHM 3BUPA 3RITA 3K2UL 3KS5A 4G7QB 2YPKB 3LPFA 2XZAL 5C9UA 4P3WA 2LAGB 2W27A 3N0PB 4CDHA 4BWWA 4DK3A 4FIQA 1T1YA 1JOIA 2CIIB 4IPPA 3OZMA 1XX1A 5G2HA 2RFXB 2OMUA 1YEHH 3CH1B 3LVEA 4E8GA 2OS7A 1QFWH 5F97E 2YB4A 1NU5A 3G5YA 2J88H 3KZ8A 4RAUA 3TWAA 4PRHD 1XFBA 2IAND 4MDIB 4WFGD 5L2JB 4M6OL 4HSQA 4O57A 2R2HA 1XGTA 3MNWA 3RHGA 4I9TA 2ZXGA 4M7LL 3PS6A 5I71B 1A1NA 4JLRB 4DP0X 2A0LD 3ULSB 1ME7A 1UC6A 2OSYA 4CN1A 2EADA 3TWYA 4NO0A 3A12A 4X98A 3L23A 4Q6XA 5IROC 2ZADA 1SJVA 3P5YA 4AD0A 3NAAH 5ACLA 4JB9H 2EPNA 3RJYA 3Q65A 4GW5B 3ALFA 2XQYG 5HHOA 4LRTA 5CFHA 1OF6A 2WXHA 3QGKC 4DKEH 1S5MA 1S2WA 1E6OH 3OJMB 4FNPA 4K7PH 5I02A 4LSVL 1FYTD 3DPBB 4MAUH 3URNA 4B9CA 5D9SA 3TBYB 4QXTB 4ACTA 1KUMA 3O3DB 3SD2A 4ZUVA 2VURA 4JM2D 1ZOXA 2Z2UA 1D5ZA 3UTSA 3KUMA 4Q8TA 5KEZA 3LN4B 1Q6LA 3VZZA 3QAZB 1FFNB 4YX2L 4ZMLA 1OW0A 3TF7C 3FAWA 5AVSB 2I5YL 3ISYA 2C1PA 3O9WC 4M43H 5FB8B 1A1MB 2NZIA 4YNGA 1TNNA 5KSBF 3FSVA 2H0PA 5IHUH 4OAWB 1K3IA 1U3HC 2O61B 3DARA 4JO2H 3RN6A 3D08A 1P4CA 3HO8A 5HMSA 4UAHA 3TL5A 3HE7D 2RBLA 4R96B 4MNGB 2CNZA 3I7SA 5AHLA 2WHVA 3OYZA 3O05A 4FQJL 4G6KL 4RSYA 3AFBA 1AZ2A 1XGYL 4MNHA 1XIWD 3LSBA 4D8PB 1A65A 1TE1A 5CEWA 3D3VD 4IWWA 1YEIL 4PV9B 2YGNA 4KFOA 4GQ0A 4P4KC 4KKCD 5ID0A 4UINL 2O93L 4JQIH 4OGXH 5E2JA 3VUPA 1EEZB 5GGTA 3MRIA 3HG2A 3B03A 9RUBA 5HGBB 5A2KH 1GYNA 4QOKD 1W1PA 1J8KA 2R0KL 3FQTA 3PE9A 4B9PA 2GY5A 2V68A 5D2NA 4RWYH 2R8SL 2HT3D 1EEQA 2VN7A 2WWMC 3RA7L 2Z9TA 3TAKA 4S39A 2CRIA 2BG5A 5FO7B 3F12A 1MDAA 4GVGA 4DYEA 5FIEA 5HHNB 3EX1A 4P23C 3NJXA 2J6EL 2UZXA 1JWUA 4ERIA 3MREA 1PQZA 3QCTH 4B92A 5FEBA 4GRMB 4A8IA 4ODXB 3F2LA 4G8FB 4DUVA 1MG3C 3MKVA 3CXFA 2VT0A 2YEZB 3FRPG 1KW1A 4M51A 7PAZA 3VFGL 4IH3A 4MD0B 3UA3A 1KM3A 4EUPG 1QHPA 1CT8B 4JDZA 2DWDB 1LEGB 1FUNA 3W26A 4YHKL 1ZWIA 4ZXBC 2Z93A 4JFPA 4X50A 4LRIA 4IBWA 2D24A 3VDGA 5FEWA 2PD5A 4YIQB 2AVGA 4Y0GA 4PFHA 5LZLA 1P7KB 1C92A 5CSRA 3MV7E 3PZGA 1GC1C 6XIMA 1T83A 4NIYE 5C07B 2FEEI 3C52A 1L0PA 2APVA 2GTWB 4A2FA 3E02A 5CJQL 1XH0A 3ERPA 3HNTH 4ORGA 2LV4A 4Y2DD 5L88L 5EF3A 3NG3A 1ZJAA 3OQRA 4NT0A 5AW1B 5CC6A 2HMID 2Y89A 4IL2A 4JRWA 5JHLA 3WSQL 5BRZE 3ARFB 1NCHA 2GUOB 1E9OB 4ML9A 1DLFL 3IM1A 4I1RA 2GSJA 4X60A 3A9IA 5C8JB 3MCOA 3HRZB 3O4LD 2COVD 1IR2A 1IGWA 2DJSA 1ZDSA 2FX8L 4L4VD 5GISH 3K1GA 1AO7E 3E2HB 5B4MC 2BERA 4MSSA 4MQXD 2DQIL 3W57A 3NQIA 3C6SB 3WTUA 3FJLA 4DUXA 1UYWL 5AVQB 3S3JA 4F9LC 1W2KT 3C60B 3IAPA 1NCIA 3EG9B 4HN8A 3SRKA 3ARTA 1IARB 1UP0A 5CNHA 5DYOB 3QT2A 3KVMA 4HIBA 2GVEA 3UZ5A 4JPKL 4XD6A 3HI1A 5CG0A 3HMWH 4U7MA 5F2IA 3IRZA 2XA3A 3WNMA 4AWJC 3HGOA 3K72B 1I1YA 2GJPA 4K15A 4YDVA 4GLRI 4DJDA 1YEJH 3BWWA 1BJ1H 3OWEA 4B5ZA 4H9YA 2CM6A 2A6DB 1EJ8A 4IIDA 1FG2B 2ISWA 4L3CB 2O5ZH 3H4HA 3VFNB 3FMGL 2RCSH 2Z29A 1COBA 1IKNC 2IBZY 4PWIA 1HL2A 4ZFOA 5GJTH 3CVIL 3VKAA 3PJLA 4F7TB 2JKRM 4US5D 3U6RB 3EBVA 5FKPA 4N22A 4LUJA 1KFBA 1HX0A 2JLLA 4XZHA 4WW2B 3KP1A 1BQHG 5SWSB 2BOFX 1HKFA 2VLKE 2VXTL 1TQVA 4G8EB 3NIFE 3GEWB 1Q6QA 3SKNB 5LIYX 4JG9A 4KMTH 2Y8VA 2CAKA 2AV1A 4H88H 2Y07L 3L5JA 5AW5B 5I74C 3S1WA 1O5KA 1OAQH 3Q8EA 2ZBTA 1JGDA 4N2GA 3VABA 3ZWTA 1XLGA 1D2KA 1HCFX 4PN6A 4U6TA 4JDTH 4PE8A 5FHAH 4KXAA 3O6FC 1TV8A 1OSYA 3QFDB 3WUWG 3VDBA 3H9SA 3OPZH 3K2GA 3LRMA 3CFIC 4GBXB 1SMOA 2GSEA 4LYQA 4IG2B 4H20L 5AL0A 3WDQA 3CPLA 2YBRB 4U0QB 2HTMA 2D7QA 4HULB 3P82A 4I9AA 5D30A 1NGWA 2YB1A 3NA4A 1OCOB 5CPMA 2FPTA 2QKFA 4AXKA 4LALA 3G04A 3G5XB 3MLXL 1CB4A 5AENA 2WTRB 4ZE5A 3F2DA 3TEYA 1T0NA 4UT9L 3UPWA 1OCBA 1RJQA 4HWEL 4PJFA 4B6ZA 3QNFA 4JJ5A 4PN2A 1DQWA 3LKRB 1YUKB 4GP8B 3FQWA 5EIVA 2C9RA 2IGLA 5L4FA 5IM7B 5MENA 5J11B 2F6UA 2CDFA 2QJIA 3L1OH 4CNNA 1LDCA 1PLCA 4CMHC 4Y1AA 1AKJA 3FKUS 2H3BA 8RUCA 1KDIA 4XIMA 1NDWA 4M1CD 2R6OA 2Z00A 1R3IH 1EGJH 2YAHA 1NIUA 1LOQA 3WMSA 1HXMB 1OE3A 3A24A 2YAQA 3I9PA 1WFMA 5EMLA 1E4IA 1UWRA 2WZ0A 2DZXA 4BI6A 4AW7A 4Q7DA 3WUZA 4ODWB 4NJAH 1AGCB 2WKGA 1M53A 4GQPH 3GJFK 3LNGA 4GCXA 3Q8BA 2WWKT 3P77A 1R7AA 3KPOA 4WSKA 5PCYA 5KSVB 3GJFH 2D23A 3AT0A 3NL5A 2R1MA 4KOBA 5ESVB 4K7FB 4DN3H 2L7EA 3NCXA 3GI9L 1KXQA 3D6GA 3NAVA 3T4CA 5KSAC 2F58H 2RALA 4J3ZA 3KM8A 5CSBA 3EDDA 4N90D 4JFDA 4JM2F 4NNYB 4XVTL 1TENA 3MMEB 5G2WA 4GCAA 3O11B 4X7SL 4QCFA 3SGGA 4X6BA 2I60H 2FCBA 2RJMA 4JY6A 4KHXL 1NAMA 4Z3EA 3LCHA 2Q3RA 2E8ZA 1FDZA 3BDYL 1HYSC 2PKDA 3PANA 1ZSDA 2VDQH 3TTQA 4KQNA 4ADTA 1F6AB 2KQMA 1J5CA 4REQA 1QNIA 2QT6A 2H1PL 3VRJB 1CIDA 1CDCA 3TMLA 1TJMA 4GE8A 3IDIA 4M1GL 3DI0A 3HOGA 2MSPA 1HAUA 5EOCJ 4WU5A 4K2SA 1HZHL 3N85H 4P3CL 3TYFB 3HQOA 1YBQA 1SXSA 2HA1A 4OLEA 3JVAA 1ZD6A 4KK5D 3F01A 3QC5X 5GS1A 2UXFA 5G2IA 3VD0A 2F1BA 4ERSL 4B41A 1UOKA 4HTBA 4Y2NA 3ECQA 3N1FC 5B39G 1H1YA 5A16B 2K1MA 3AOFA 4BH8A 1FCCA 4DNLA 5GHWH 3BLDA 4OZHA 1GOHA 4NWUH 1A6AA 3P3YA 3S34H 5D1QC 1XDMA 1GW9A 2B3RA 3EA1A 3DJZA 1Z5LA 3W11C 1YYCA 5F2FA 4EUPB 2YCLA 1IF2A 3S83A 2OM5A 1KJMB 4YGVA 1EJ7L 1AL7A 5F89A 2XWTA 2VDKL 1UM6H 2DYSB 4S2SA 1U3JA 2OOFA 2QJNA 3QO1B 4WNJA 1SQ2N 4ZE4A 6ENLA 4CNOA 1FORH 3GSNL 4UTBL 4DY1A 3LLDA 2C9QA 2PDFA 2Z28A 4FQXA 1KYUA 1TJGL 4R0LB 2E68A 3QDHA 4J5NA 2XSXA 4HS8H 2CLVA 1HJWA 4G82A 8PAZA 4L3ED 3PP4L 4JRYA 2I9TA 1DUYA 1PTDA 1TYGA 4XP9L 4FALA 4FOJA 3PXLA 1PAMA 3QWRD 1H0GA 2H32H 1BQLH 4YR6A 4PJBB 3UZWA 4UTJA 2HN7A 3NQCA 4KZDH 1KXHA 4L48A 1JEZA 3WLKX 3U2SA 3BOXA 4H6KA 1Z9MA 4Y4KD 4IU3A 3UZZA 1NFDA 1GQNA 3TNNB 2OXGB 3IDMB 4NJKA 1BFVH 2Y7QB 5FYJE 3CQFA 4FFYH 2CEQA 4UR9A 4XNMB 2B20A 1AGEA 2TSYA 3CXOA 1DVSA 2FQIA 4PJ9C 1FJ1A 4IL0A 2AJZB 4UTLA 2FJHB 4FGMA 3GPEA 5E51A 3TT1H 4Z3GA 3KPLA 4H1LG 4AC4A 5I1LB 1HU8A 5C0EB 5AZUA 1CO1A 3NVTA 3AZUA 3AMKA 1KB5B 3VXUA 1BAFL 3GXDA 4Y4FA 5HYEA 1OABA 1D9KC 3NIDE 1FPTH 4KVCH 1AIFB 3NFNB 3IGXA 3GFUA 4JZ5A 1QI5A 2CE6A 5HYSG 3LV3A 4ZQCA 1FO0L 2CMRH 3B6SB 1WOBA 4NJGA 1MQPA 2PXYB 3VI3F 3TYEA 3IRDA 3P40A 2G2RB 1J9TA 1YXCA 1BXXA 1KM2A 3IF1B 4UZUA 4AG4L 2BNUA 1BQHB 3U36A 4U3SA 4N0RA 4MHHG 5D4IA 1OZMA 5CSZB 1Z6JT 4Y5XC 3T6WA 4K3ZA 4LY4A 3NYKA 5IUSA 2NV9A 4RFNB 3MRRB 3A23A 4YN5A 3MBDA 5EEZA 3DGBA 1J8SA 4F2FA 5KVFL 2X4QA 4D6IA 2Z1BA 4HF5H 4PBDA 3UERA 3L3HA 3UWZA 2WQPA 3RNKB 3OXRA 1G9EA 1Q0EA 4NY2A 2CU9A 3ARBA 3UYPB 3P9LB 5MEOA 3RO8A 1EJSC 2MPAH 3OKDA 5HXMA 4TX8A 1I1FA 3FBKA 5C9ZA 4YFDB 3MX0A 3RZCA 2AQVA 3N34A 3WH8A 4JIPA 4N5ED 3WUWB 2Q7YA 2X44D 4XPHL 2N01B 2VEKA 5A6TC 4TN9A 5I1JH 2AW2A 3ARUA 3D39E 5I66B 2XV6B 1KF9B 1M41A 3PHQB 4RE2A 4A38A 3RY6A 3ZIZA 4LSQL 3GKAA 4KNTA 3N15A 4LUTA 3KWTA 1A9BB 4TUOB 5EORL 3HFYA 3G1AA 2KLRA 3FO9B 2TYSA 5E8NB 2V38A 4IISA 2ZKYA 5TK2A 3H6JA 1W54A 4ROPA 2YL6A 4XN7A 5IG7B 3V55A 2RUSA 4BSJA 2JI3A 5TF0A 4ABWA 1GVFA 3K4ZA 1E28A 1XPGA 1GTFA 1H6EA 1L5GA 3SPGA 3R8QA 2WWMD 4XXWC 4YHZL 2ZZ3A 2VLJB 4H8WC 3BRDA 3W24A 1XDTT 2E47A 1Z42A 2VDHA 4XPAL 1S78C 3FY1A 1VSCA 3GAKA 3WD1A 5DMLA 3CH8A 1V7NH 4JQ3A 4ECLA 2N7SA 2WYZA 1A0EA 1IC4H 4UQ9A 3HM7A 1E67A 1KGJA 2JJWA 1V10A 4FL4C 3S36X 4TNWF 4JGJA 2P5PA 2VW4A 2DGAA 5T5FH 2Y23A 2QIIA 2CCLA 1C8QA 4XO8A 3MZTA 4KKPA 3AMLA 3L5LA 3VI4E 3Q8AA 4BZ1L 3AIEA 2ED8A 1C5BL 3UCQA 5A6SA 3EO9H 4WGWB 3CNYA 3EUUA 3GTNA 1M7IA 4RNFA 2NX5B 1LO3L 4OY9A 1WBJA 3QC3A 4IQHA 1KDJA 2WLLB 3EYQC 5CR8A 3QEQA 2PDJA 2OKMA 1RJLA 5HI4C 1FNGA 1TO3A 1XJBA 1ECQA 1INQA 3EGSB 5DRXB 4G8TA 1EF2A 1N19A 4CVXA 1REQA 3D1MC 3PB2A 3KP0A 1JAEA 3T77B 1I31A 1OGTA 3OMNB 1AIZA 4N5UA 5FD0A 3TQVA 1KV8A 1I82A 3QJRB 1ZZMA 2WHMA 4PJCA 1HCVA 3LX9A 2DTSA 4LKCA 5CS7A 4HYRA 2WBWB 3RJOA 4NPJA 1KBGL 3MV9D 4RNRA 4U1GC 4HV8A 3KYMB 2ZX9A 2WQXA 4QEGA 2YYUA 2B0SH 4Z7IA 4TRPH 1OD7A 5TJWK 2EABA 2WTOA 1M3IA 3CQPA 2JB5H 1X38A 2AQQA 1INDH 5KS9A 2HPMA 4N0UA 1T6BX 3AXLB 3B7RL 4MD5B 3GS6A 1M57B 4EF8A 4I0PC 1HHJA 3E7JA 4MB4A 1QDSA 2GK0A 3FCTA 2FYVA 5MEQB 1SJEA 4JNZA 1EKOA 1WAAA 5GS3A 5E1AB 5B39B 1D6EB 4DELA 4Y2WA 4DVBB 3I7QA 5C8BB 3NDOA 4I1NB 3CLMA 4XCFL 3BVXA 3MUXA 3P67A 4Y19D 1HO1A 3IJYB 1E9QA 4X8JB 4UV4H 2BK8A 4S1SL 3VFOA 3IDGA 4S3AA 1KIPB 4O58L 2GGIA 4KEZA 4GSXA 5JTWA 2UY4A 1GT8A 4XVEA 1EOMA 3BANA 1YPZF 2FWLB 3C2SA 2G4EA 3QHNA 3FKKA 5BOPA 4Z1YA 5AD0A 4KTYA 2CWXA 3EJRA 1XT5A 1EV2E 4LDLB 4UQIM 1NGPL 3UX9B 4FXRA 2NXYC 5I1DB 2QGYA 3EJQA 1VFBB 1BXNA 1XICA 1MF2H 3C8HA 1B4JL 5HYJB 2QQQA 2D2JA 3MN8A 3SE3A 4QAIA 4IPNB 1XF4B 3SDDC 5LCVL 1ZAJA 3Q8CA 3L4CA 1A3LL 4MJIA 1E5AA 1H3XA 1N10A 3BZEB 4HHPA 1G9ML 4S1FA 2CXKA 2JSFA 1IL1A 2EIDA 3S35H 2WYIA 3GVRA 3W86A 3CO4A 3MO4A 2Y7EA 4JM0A 3CFEB 4XN1A 1P84J 4EIVA 2VR5A 5D2LE 1HOCA 3ULUH 2PETA 3L4UA 5GJSH 4MXVF 4JZOB 2Z91A 4UNTA 4U1HA 4HPYL 3W71A 5KVDL 3O6KL 2B9AA 3D06A 3BEWB 4WVRA 3VYOA 2WZIA 5CPTA 3DBXA 1WAPA 2AXJA 3B8SA 1NWUA 1MXDA 3O2DH 1NQBA 1ZP3A 3VXMD 3PP7A 2OSLA 2VDMH 4XNAA 3LKPB 3AU1A 4B9FA 4P4RA 1UB6B 4Z08A 2P8LA 2HP4A 4GAJH 1UJ3C 4AMKH 1O5QA 5D7KE 5T3ZD 4JHVA 1R2SA 3RLGA 3BSZA 2R15A 3BTNA 1FFOB 4BSVA 2LU3A 1GJWA 3NQAA 5DD3L 4HOXA 4U1JA 5IDIA 1JK9B 4J8RB 4LARH 4OCRH 1BG4A 4WSGA 3ZE2E 3O07A 1MFDH 4MB5A 3RRQA 5HYSB 2HJPA 3SURA 5ACZB 1B0WA 2NW2B 4KI5E 4YFEA 5TE6L 1BAGA 5GGTL 2MQCA 1IEBB 4OLYL 2NUWA 2AGJL 5F8QC 4OV5A 2FR4A 2YGOA 3IAGC 4XP1L 4IOFC 3QV7A 2YUXA 3NO1A 4J3UA 4JHZA 4MJ5B 4NUQA 4CU7A 3UJIH 3L7EB 3U2CA 3THCA 2HFFA 1UCBL 3TJ4A 2QR0A 4A7GF 4JR9H 2XTJB 2PYFB 1HINH 2A9AA 2OPJA 3JSSA 3MJ9H 3MV7B 3QQ0A 4U3CA 1MQ8A 1KN4L 4DJEA 4JY4B 3J8F7 1OTTD 3TA9A 1NCGA 2ZNWA 2E5BA 2ZF9A 4AD3A 1MCNA 5JBFA 1K02A 3PDOB 1OFRA 1IGIL 5JPNC 5D7JB 2DI8A 3ZKSD 2XH4A 4ERAA 1U8HB 1JHKH 2QXWA 1OINA 1HEZA 4HVBA 4PRDB 3HFMH 4PMVA 3DFHA 4KFMA 1DVFA 5DJXB 4IPIA 1E6RA 3BZFA 5DANA 5KSAD 4WGVB 2WM1A 3WNKA 4MFEA 1WZ1L 4QT5B 3CZKA 1AO7B 2X4UA 3NJKA 5HHMB 4YGAB 2G60L 2IC2A 4UM9D 1H61A 2OELA 3U4EB 3QUXB 3TJIA 3U2ZA 3QR0A 1B2YA 1FNSL 3SQLA 1MZYA 4CA4A 4LLUB 5K9JH 3QZEA 4LF2A 2OR7A 4IIHA 4DXKA 4JHWL 3PIQA 1YEFH 4QHLB 4WJ8A 5FLUA 1RJYA 3WQEA 5D6DC 3EZ4A 1E0TA 2P5WA 4WCYH 4A7QA 2WZ6A 2WXOA 2APXA 2AEOA 1Y07A 5J5EA 4GSRA 5AHNA 2EUZA 5EU6E 5INCB 2VEGA 5JH1A 3RGVB 4L2LA 2IEPA 5JHLL 2XDHA 2D8KA 3IJ9A 5HQEA 5DCBA 4JKWA 3NN8B 3LCYA 5HULA 4UTWC 5E6ZA 5TDOB 3GIZH 2AJSL 3U1SH 3VGDA 1C12A 3MBEA 4P5KA 3QWOB 1U8MB 2VXSL 4PMJA 3MUCA 3FNKA 3LPGA 3IJDA 2DN7A 1A7NH 1NSJA 1TPXB 5HPOA 1KIQB 2F84A 3C8NA 4DT2A 4AZ5A 5D1QD 1V03A 4FDWA 1H5BA 5JQ6L 2YAEA 5DC9B 2ESVD 2XSKA 2XIMA 1W72B 4RFOH 1YQVL 5DS1A 5E4AA 3NIFB 4RISH 1P0KA 3CU1A 1HL8A 2RH0A 1WEJL 3NGJA 1KYOJ 3CC5A 3M46A 1GYCA 4ZW7A 5DJCA 5GGUB 4RZCB 2OJPA 2HPOA 1MFBL 3AQUA 4QDPA 4AMXA 2N1TE 4X0VA 2A9ML 4RCAA 3V7AE 4F8PA 1M56B 2XWDA 3SIKA 2QPXA 3WBAA 1SFHA 4Q9RL 3V52H 3DRQB 1W1A1 2Z7WA 3N6HA 4NAJA 3FOKA 2I9LB 4NNXA 3QYNA 1HHGB 4GX9A 3OMZA 4DVOA 4XODA 1GH7A 3CFTA 3FT4A 2QQLH 5HDWA 2QKIA 3RK8A 1ZA6B 4IIQA 3MSPA 5I1KH 4ZFOL 1CDGA 3O2WH 2EP6A 2VC7A 3NEOA 4RL3A 3BAEH 3BLIA 4DRSA 5KG9B 1RIVL 5DQJB 1TU2A 2OZ8A 4CCDA 2ID5A 4HUVA 3GUFA 4ZQMA 1PNCA 1NFPA 3KPSD 1XD1A 2EDXA 3P2BA 5EFIB 3ULVC 2XFWA 5IBLC 1RD6A 3VG0H 1BLIA 4Z0XB 3WFDL 2E9MA 2X4SB 4BY3A 4F9PC 3E6EA 1NFBA 4G7YL 4Z2LA 3U1PA 3QTPA 3R89A 2VZUA 4LP5A 2Z92A 1BD2A 2ZUTA 3HZKA 5DJAA 4CCEA 4TUJA 4R88A 1K8IA 2OZ0A 4UR7A 2YD9A 4Z0SA 1FL6B 2G3JA 1W5QA 4YVVA 4PJ9D 4BZ2A 2DWEB 3EEZA 3MFFB 4AZBA 5K69A 2Q20A 4GO8A 4TQPA 1UPMB 1A3WA 1MWAH 3T0AA 1TOXA 4UTHA 4NUJA 3NZPA 4FZIA 1Z69A 4XMPL 1T1ZB 3W02A 2IV8A 4L9LB 1XP3A 4LVOB 1D9KD 1RVGA 1HHHA 4FS0A 3SUWA 1MCWM 3KBPA 3VTRA 2FVNA 4LCWA 2UZ9A 1J1XL 3C87A 3VGAB 1E8YA 2E27H 3WEBA 4H44C 1KLGB 1J0IA 1U8NB 2QZRA 5D09A 1V7ML 2MHAB 2B5IC 3VXSD 1A14L 4BEUA 4L9XA 3KPNA 2NSOA 3MWAA 5SX4I 3WTVA 1Z89A 4N9EA 3QLDA 2OI9B 3C8KB 3PJSB 3SAZA 2MEJB 2CKBH 3ZDZF 4G59C 3L5WB 3W5MA 2G3ZA 2V5DA 3KPRB