3IJ8A

Directed 'in situ' elongation as a strategy to characterize the covalent glycosyl-enzyme catalytic intermediate of human pancreatic a-amylase
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Directed "in situ" inhibitor elongation as a strategy to structurally characterize the covalent glycosyl-enzyme intermediate of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 180
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3ij8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ij8A01
4QFUA 2YBTA 2WCGA 3MV11 1W3JA 3DYPA 2ZE0A 4NZCA 3GXNA 2J7BA 1VFFA 3BUIA 4JFWA 1TR1A 1WNOA 5JBFA 3BLBA 4AD4A 4KGLA 4J3TA 3PZUA 1J9YA 4OBRA 3OA5A 1H1NA 4GINA 1UR1A 4MJ2A 1W91A 3L4UA 4AIOA 1MFUA 4GZEA 3AS0A 2CCRA 1QW9A 3VDHA 1J11A 4HOWA 3OGRA 3WD1A 4HOZA 4ZXOA 2A3HA 3CZJA 3SCPA 1JIBA 4BQ2A 2EADA 4PYSA 4AZGA 1H11A 1CGVA 4P7RA 3N9KA 1VBUA 3PZOA 3LRKA 1BFNA 1BVZA 4DUVA 2VCCA 1VEPA 2ZUTA 2ZXQA 3ARRA 1J0YA 2E9LA 2YL5A 1EHAA 2WW5A 5D9MA 7A3HA 1HXKA 3CIVA 5IHRA 1IV8A 1UH3A 2EJ1A 2DT0A 1JD9A 2UWFA 1R75A 5LYRA 3ZT7A 1Q6EA 3II1A 3WDQA 4UFIA 1K6AA 4UFKA 5BRQA 1L8NA 1E4IA 1RPKA 2XIIA 2O9OA 1N82A 4V27A 3OLIA 1GOQA 2WVTA 2WC4A 2VL4A 4U5KA 3CZSA 2PBGA 6TAAA 2XFYA 3OBAA 3EJPA 1PS3A 1JZ8A 2FGLA 4B15A 3CV5A 2ZOXA 3GXPA 1NWSA 3W6LA 3ARQA 3FXYA 4M56A 4U2ZA 3W82A 1PZ3A 1U30A 1QI2A 4W7UA 5JIWA 4UZUA 1E6XM 2NW0A 3D50A 4X0VA 2DH2A 3SUVA 3OB8A 2DEPA 3TTQA 2JIEA 5AYBA 1UD4A 1GW1A 4YPJA 3GBEA 4E8CA 3BVXA 5BXRA 1B9ZA 4FLSA 2MANA 1FOBA 1UKQA 2YDQA 1UD6A 1KR0A 4NSBA 2WMHA 1MW1A 1WDSA 5CXPA 4PMXA 4CN4A 2VTFA 3JUGA 5EB8A 4AZCB 1EO7A 4ACYA 1HL9A 2B31A 2O92A 4QLJA 3RM8A 3GTNA 3BUQA 4UQEA 2YA1A 3EJTA 1NP0A 3DC0A 1FFRA 3ZR6A 5D4YA 1XGZA 3WNPA 3QOKA 2CBUA 1SZNA 1CTNA 4AZHA 1YHTA 1XSKA 3PTQA 2GDUA 4UFHA 2D0GA 1GUVA 3WQ6A 1VJSA 4UQDA 3VIPA 1W9VA 1US3A 5LA0A 1ZB5A 1TQUA 3WH7A 5CSUA 1QI5A 2DH3A 1TCMA 2NT0A 3F5JA 4BQ3A 3SCSA 3W28A 4UQCA 4RE4A 3BVTA 4CCEA 1XHGA 2AAAA 5DEZA 4C7FA 1GVYA 3L4TA 1HKKA 3NIYA 1MQPA 3A6OA 1LJYA 4BQ5A 1O7AA 1NARA 2DIEA 2CETA 3BMWA 4XZWA 3ZO9A 2XIBA 2XWEA 1HNYA 2E8YA 1HVXA 1CECA 1TVPA 3CLWA 4GO8A 1IZJA 4H8VA 2BY2A 1UR8A 1JYVA 3AISA 3WH5A 5FCZA 4U3AA 5DT7A 1ZJBA 3W29A 2J7HA 3WD0A 3VNZA 4AMWA 4MNLA 1CGXA 4B9ZA 4Z2LA 1EGZA 4TUFA 1LL6A 1AQHA 1XV8A 3BUPA 5FIPA 3WUFA 3KLKA 2WHJA 1HJQA 4JKLA 1IT0A 3VD9A 5A6KA 4RE3A 4WSJA 4D6JA 4J3SA 3AIBA 3WNMA 1EA9C 3EYPA 4W8AA 5FD0A 4HU0A 2VOTA 5E6ZA 1JZ4A 5DMYA 2CKRA 3CHDA 4TX6A 1KQZA 1L0PA 2VZOA 1E73M 3CMJA 4QLKA 2WHKA 1JI2A 1PBGA 1V08A 2WXDM 2E4TA 2WMFA 3ZSTA 1EQPA 1W9DM 3F5LA 4LYRA 4XUYA 1HIZA 3OG2A 1DHKA 1EXPA 4ZXLA 1GZJA 2VNCA 3ZQ9A 1OBAA 4MADA 3WDRA 4PBGA 1VEOA 4PUEA 4PMNA 1ISWA 1H4PA 3WDPP 3NDYA 3T09A 4XV0A 1R87A 3POHA 1MFVA 4GKLA 3T0BA 3BLKA 1J0KA 3BMVA 5DFAA 1B0IA 1TQSA 4KRTA 3CHCA 4ATLA 4PMVA 2JEPA 1XCWA 3EJRA 1WPCA 2GK1B 1PJ9A 4IPLA 3GXMA 3N13A 1F4AA 4M8UA 1BG9A 4LGXA 1X1NA 1MW2A 2VR4A 1VFMA 2GJRA 1PPIA 1CGUA 3AMGA 4QDMA 4TOQA 3WDJA 1X6NA 4W7WA 4W93A 1E4MM 4DWSA 2ZUMA 1ZL1A 4QCEA 1FH8A 1FHDA 1R8LA 4B9YA 1FA2A 3RJXA 3HN3A 1CXIA 2Y5EA 4TVUA 1QVBA 2VZUA 2EPMX 5CQ1A 1UD2A 1CYGA 1C8XA 1CEOA 2V3EA 2PWDA 3L2MA 2PWHA 2YOCA 1W1VA 1JDAA 1HJUA 2CKSA 2EPLX 3KLLA 1RP9A 4PRWA 2F2HA 1BQCA 1W3HA 5A8MA 4DWSD 3GDBA 3PTKA 4IISA 1QHPA 2YDRA 1RH9A 3PN8A 4GIAA 2ALWA 3W38A 2A3EA 3OZPA 3T2OA 2XG9A 2DSKA 1W2PA 3UETA 1C7SA 3GXTA 3WEOA 1KGUA 1CPUA 2IGTA 3QHNA 3EDDA 3BVWA 1XYFA 2PC8A 4Z2HA 3K4DA 2D0HA 3GZAA 3N11A 3AIEA 4MNKA 4KGJA 3MV01 1DP0A 3L4WA 2WWCA 2WAGA 1WB0A 1KXHA 2X2JA 1XH1A 1MXGA 2YJQA 1BTCA 1XRVA 2JE8A 2W63A 5GNYA 4GI6A 1H0IA 3WY1A 1G94A 3RCNA 1WCGA 3BUDA 1GQLA 3ARPA 2VQTA 4JL1A 2DGAA 2X0YA 4J27A 1E0XA 1WDRA 3VIJA 3UCQA 1QI0A 3VMNA 1BPLB 5ABFA 5A8OA 1JAKA 3VINA 4MTVA 1JGIA 1E6QM 2J74A 2YA0A 2O9RA 1SYTA 3WMCA 2OW7A 2E8ZA 4UZSA 4HMEA 1TQWA 1PX3A 2J79A 1XD1A 3CTTA 2VC9A 4JKKA 4UFMA 2BS9A 4Q22A 3MKKA 1QNPA 3CZKA 4BS0A 1KXQA 1HL8A 4WKHA 2BFGA 4CD6A 2Y24A 2J77A 4AMCA 4EKJA 1BYBA 3A5VA 5D8WA 3EDEA 1H09A 1BLIA 2J7EA 1MW0A 4W8LA 1UZ4A 4OGZA 1E4NA 3POCA 4U2YA 3BAKA 1E71M 1Q6FA 1UQYA 1CXEA 4JFSA 4EK7A 3RO8A 5FKYA 1KQYA 1A3HA 3QHOA 4D6GA 1PX4A 2WLZA 1CGWA 1FH9A 4ACZA 2D3NA 4A4AA 1JZ3A 1RP8A 1ZU8A 3LMYA 1OGGA 3SCRA 4W86A 3K8MA 1KGXA 4HP5A 1ITXA 1UUQA 4R5EA 1E3XA 3M46A 1QNSA 3WQ5A 4H7VA 2VVNA 2WK2A 1M7XA 2IXUA 3AQUA 1GHSA 2DPEA 1JXJA 3UR7A 3UG4A 4X9YA 4W85A 3ECQA 2WB5A 2G4FA 4BQ4A 2BVDA 4AZIA 3I3BA 1W3LA 3UEQA 3ARSA 4PMZA 1MVYA 2IXVA 4GZIA 1G5AA 4KRUA 1SR0A 3L4ZA 1UR9A 4X0NA 1ESWA 3T0DA 2VURA 1K9DA 4R27A 3AMLA 4OOZA 3U7VA 3BSGA 3ARZA 2DSUA 3EMQA 3WNLA 1KGWA 1LWJA 2QPUA 2QV4A 3A21A 2ZICA 3KZSA 2Y8VA 2X09A 2X2IA 3A4AA 3MO4A 1M53A 1TQTA 3BAYA 5A6SA 7TAAA 5A8PA 4Y7EA 3RMEA 3H53A 4UOJA 3W0KA 4M80A 1P6WA 2BVYA 1UD3A 4H8UA 1MQQA 4JFVA 3GBDA 5KEZA 1QBAA 1BG4A 2V38A 2JALA 1VF8A 2VRJA 1HWWA 2XHYA 1WZLA 4D6EA 2E40A 3RILA 4CU6A 2FDMA 1IZKA 1NP2A 5M3WA 4V28A 1V02E 2VZTA 8A3HA 2YA2A 1R7AA 4HZ7A 2VX6A 2W66A 5AC5A 4NXKA 3N15A 4Z2JA 1V6XA 3ARYA 3M07A 5LA2A 1NQ6A 2F7OA 5BXPA 1VFUA 1OWQA 1OD8A 3M7SA 4B16A 2PF0A 2WZEA 3ALFA 4CD5A 4MB1A 1V3MA 2CHNA 2XGBA 1UWIA 3VDCA 3W53A 4H04A 1JDCA 1E6ZA 3N04A 1F4HA 4PSRA 2VX4A 1QX1A 2WLYA 4S3KA 3BUBA 3T2PA 3RIKA 1GCYA 4AXNA 2WVSA 1I1WA 2VRKA 3GM8A 3OIHA 3WNOA 3OGVA 4FNPA 2D24A 4XB3A 4DWSC 3FNDA 2ZWZA 2YLLA 1E40A 3MI6A 3WELA 3KL5A 4OZOA 5D9PA 2BV9A 3VTRA 3WEZA 3AIUA 2VX5A 1EQCA 3T2QA 3NYDA 3AIWA 3HU7A 3A24A 4AD5A 5AC4A 4C7DA 3DX0A 5FL0A 4JFUA 4YN5A 2FHCA 1ISVA 3ARTA 4PTMA 3W6MA 1ISYA 3K4AA 3EDKA 1V6UA 3ZJ6A 1KTCA 1CXHA 1J18A 3AROA 1HKJA 3WF1A 5A6LA 2CBVA 2OWWA 2GFTA 2ZX9A 2XN1A 1D3CA 1HN1A 5I23A 4PCTA 3PZVA 1ZBKA 3OGSA 3MANA 4LXFA 5IDIA 4ML4A 4GPNA 1J0HA 1DWIM 4MAVA 5KZ6A 3D3AA 1B31A 1E3ZA 1V6VA 5CPSA 1K9EA 3MUAA 2WZIA 2W91A 3SUSA 1E15A 3A23A 1ISZA 2J4GA 3WIJA 4PTVA 2C0HA 3MUIA 3BVVA 1WE5A 5A2AA 4WSKA 3CMGA 2RGMA 4AZ7A 4JZ5A 2GSJA 1XSIA 1BYDA 1W3KA 1WDPA 1E1FA 5A6BD 4AYGA 1UKSA 3CZNA 1GQJA 3IJ9A 5IFTA 2ZWYA 1GJWA 1H3GA 2V5DA 4Z2IA 3K8LA 2E3ZA 2G3NA 5I77A 3QR3A 2OYKA 5EMYA 3VO0A 3VPLA 3VM5A 2YL6A 2C7FA 3VGDA 3VGHA 3LPPA 3SCQA 4AD1A 1V3LA 1KBBA 4OJYA 4ATWA 1NOUA 3AS1A 4PCSA 1B3WA 3NSXA 4NF7A 3NJ3A 3GXIA 2BY1A 3FHAA 4HU8A 1UHVA 1J01A 4JFTA 3WMBA 1MYRA 3SCTA 4GO9A 4CD7A 4A3HA 2WPGA 4PMRA 1YQ2A 3WF0A 1M04A 3VIHA 1WZKA 1X6LA 4AWEA 1M01A 4P8WA 2FE0A 1B3VA 2W5FA 4TX8A 4WIWA 4AMXA 3CUGA 4ZFMA 1T0OA 2XN2A 5M5DA 4IPNB 1J0IA 3MMWA 2DDXA 3BSHA 2E0PA 2ZUSA 1FP8A 4E8DA 1K9FA 3MU7A 1GVIA 6CGTA 3VSVA 2J75A 1E4LA 3SURA 4AZBA 1VRXA 3AMDA 3BGAA 2WSPA 1E43A 3KL3A 3S6TA 3SCNA 2WBKA 4HA1A 3AXHA 3AHYA 4WJXA 2J25A 4MB3A 4XZBA 2W92A 5F7UA 3SUUA 2D1ZA 1VAHA 2G3IA 4W87A 4C7GA 4U31A 5AYIA 1EDGA 4J28A 1UWRA 4KWUA 1PEZA 3CZEA 1CXLA 2ZXDA 1R34A 2QF8A 4FLOA 2CPUA 2GDVA 1OT2A 2EABA 1KB3A 2G3JA 1G01A 4PTWA 3U5UA 4GQRA 3MSGA 1B1YA 4TXEA 5JBDA 3MUY1 1XC6A 5ABEA 1C7TA 2XM1A 2OLHA 2VZVA 2ZIDA 3VGFA 4B3LA 4D1JA 1V3JA 5A69A 2F7RA 1OIFA 2DSWA 4MJ4A 1UWQA 1V0LA 4AW7A 1GNXA 4QAWA 3RPMA 1BAGA 1E5NA 4IUGA 2QHAA 4J3VA 4MDOA 6A3HA 2Y8KA 1UZ1A 1TVNA 2WSKA 4F79A 4JHZA 4W8BA 2G41A 3VOCA 4HMDA 2CITA 2JIWA 3A4XA 3VIGA 2PB1A 2A3AA 3DYOA 4TTUA 1DWJM 2YL8A 4NRSA 5BROA 5ECUA 4KMQA 1H2JA 1UA3A 3I3DA 2QMJA 3TTOA 1W1TA 5I24A 4J3UA 3WH8A 1NWRA 2EQDA 4NZFA 3SCUA 4W88A 2V5CA 2XFRA 4MPKA 3B9EA 5I5RA 1EH9A 2VCBA 4HA3A 3PZQA 4ATDA 2W4XA 3VD3A 2WYSA 4WK9A 3K8KA 3IJ7A 1JF6A 3ZT6A 3WQ8A 1TQVA 5I78A 3AIRA 1XH0A 4AEEA 3ZT5A 4U5IA 4L4OA 4P8UA 3TOPA 1CENA 4AD2A 2OSXA 5CJ5A 3KL0A 1ZBCA 5BCAA 2NT1A 4URIA 1US2A 2EACA 5I0DA 3B8SA 2V3DA 1NM9A 3GXFA 5TD4A 3AHXA 2YFOA 2XGIA 2CNCA 3WD3A 1CXKA 3GXDA 5HXMA 4KH2A 3G6MA 1JZ7A 3VIMA 4AZ5A 4WLCA 1HX0A 1Q4NX 2GVYA 1NH6A 4RE2A 3NSMA 4LPCA 4MNMA 1W9UA 3K46A 1E56A 3VILA 1JYWA 4LQ1A 1XYZA 3CPUA 3ZM8A 3AHTA 1GONA 4ZEPA 1UR4A 3WN6A 2VI0A 2XVNA 2FHFA 1QI4A 4FLQA 1GPFA 4E4PA 2WMJA 2A3BA 1C92A 1UKPA 1GOIA 1E5JA 4F66A 1HT6A 1NWUA 3HMCA 2PWFA 3IJ8A 3VGBA 1ZJAA 1GORA 5FL1A 1FP9A 4UFJA 4F8XA 3CHFA 1VIWA 5E70A 2ZUWA 1CXFA 1GOOA 3CHEA 3D51A 1DWGM 4FNTA 2CEQA 3UESA 1HVQA 3VVGA 4TTGA 2XVPA 1BGAA 2O9PA 3MUZ1 2OYLA 1GHRA 4DO6A 2WANA 1QNQA 1HF6A 1OT1A 4CVWA 1TA3A 4HPGA 3TTYA 3D52A 4D6IA 3ZR5A 3CUJA 2YKKA 4H8HA 2WC7A 2EPOA 3VDBA 1K9TA 3W24A 2WMKA 1QWNA 3WL0A 4JKMA 1UASA 1DWFM 4CU8A 3HZ3A 1DWAM 3AI0A 3DX2A 3T0AA 1OIMA 5CLTA 4HMCA 3AZSA 4F9DA 4OIFA 3AS2A 4L4PA 3FAWA 4FLRA 1EOKA 4J7RA 1C8YA 3WL1A 2O9TA 5JUVA 3SCOA 1EOMA 4OOUA 3WY3A 3WF2A 3W4RA 5D9NA 2G3MA 1C8QA 3A47A 3AMKA 1HXJA 3FY1A 2Y4SA 2OWCA 1HP4A 2WCAA 3ZSSA 3ZJ8A 2J7GA 2CYGA 3ZOAA 2UY3A 2OWXA 2VRQA 2GK1A 4PMQA 1E70M 3CBWA 2J7CA 3BAIA 4UCFA 3W37A 1OSEA 3OLGA 4LYPA 1KCLA 3DYMA 2WWDA 5CGTA 1UQZA 3CO4A 1ITCA 1G0CA 2ZXAA 4NRRA 1KWGA 3WD4A 3OZOA 2ZXBA 2GJXB 2F7PA 4D6DA 4DM1A 3MMDA 3CUHA 4HZ8A 1G1YA 5CG0A 1UD8A 2F7QA 1UG6A 3HG3A 4UFLA 5JBEA 3BH4A 1R7OA 2Q8XA 3AOFA 3SUTA 4AIEA 1JZ5A 3DHUA 1VFOA 1WZMA 1O6IA 1VEMA 2BVTA 2W62A 1EDQA 2VX7A 2RGLA 5I3DA 1JFHA 2AMGA 4XX6A 1AQ0A 4AD0A 2ZX5A 4PMUA 4CCCA 3GNOA 3J7HA 1J10A 5GNZA 2W67A 3VIOA 1NOFA 1TFVA 4N0RA 1QW8A 1V0NA 2VQUA 4UOZA 4FNRA 4P7LA 1HJXA 1C93A 4P7OA 1NOWA 2JFEX 3WKZA 1ODZA 4ACZB 1FH7A 1WZAA 1OINA 4LYQA 2XTKA 3EDJA 4J3XA 1W9XA 2ZUVA 1TG7A 4V2XA 2XSAA 2XFFA 3LX9A 2D3LA 1CLXA 2FHBA 1LQ0A 2VVSA 5EFFA 3NDZA 8CGTA 5EBAA 3BCFA 1JNDA 1BSIA 2Z1KA 1UR0A 2CHOA 2FH8A 1HKMA 1O7DC 2FH6A 2QMKA 3AS3A 4PMYA 1GQIA 1QPKA 2ZX8A 2F18A 3EJSA 2G8ZA 1B90A 2EBNA 1VB9A 3B9AA 1G9HA 3F5KA 4CKQA 5BYWA 1H5VA 1OCQA 1HJWA 2BXZA 1V0KA 1I1XA 1B3ZA 2Y2WA 2UY5A 1R86A 1KXTA 2V3FA 3UG3A 2VMFA 3LXBA 2D73A 1JD7A 4UNIA 4UTFA 5A6MA 2PWGA 4ZE5A 3VMOA 3WNKA 2DIJA 1EO5A 3CGTA 3IAPA 2CXGA 5D8ZA 1HTYA 1OGSA 3FW6A 3LXAA 2XJ7A 4CN6A 4FNSA 2W61A 1M03A 1OB0A 2BHUA 3BVUA 2WM0A 2WZHA 1VBRA 1KFWA 5CPQA 3THCA 1V03A 5E0CA 2QPSA 4AZCA 1V3HA 4BF7A 1KCKA 1HP5A 2ZUNA 3AXIA 1D2KA 1ZS2A 4TVDA 1VENA 4IM4A 1KR1A 1J0ZA 2EO7A 3KEHA 1TZ7A 3SIMA 3LRMA 1E55A 2OYMA 1V6WA 2WVUA 4HPHA 1JYNA 2GUYA 2CESA 4GI8A 1GOMA 4YHEA 2ESCA 1XSJA 4CU7A 4DUXA 1JXKA 5A6AA 3VMPA 3WSUA 1W1PA 4FK9A 1BF2A 5E0FA 2QLYA 4WF7A 3A22A 3SUWA 3VD4A 3CUIA 1JNEA 2EXOA 2WMIA 4DWSB 2CBIA 1GJUA 3VSUA 1WO2A 4TVCA 4M24A 1RD6A 1W1YA 5E1QA 4UOQA 3THDA 2CBJA 1GQKA 2DSZA 5FOOA 2WCSA 2J8GA 4E2OA 4HZ6A 4JCLA 3KWXA 1E6RA 1E6NA 3WENA 5M17A 3O9NA 1H41A 3DDGA 4UQBA 3OLDA 2EPNA 3SCVA 1QWUA 2X2YA 4Z2GA 1LG2A 5DO8A 4CUCA 5C70A 5BWFA 1Z32X 3WF3A 4D6CA 1CDGA 3WD2A 4AYSA 3TTSA 9CGTA 3NUKA 3IK2A 1BHGA 2F8QA 5A6JA 2WHLA 3DX4A 4GXPA 4P7QA 3WY2A 5A8NA 2D2OA 1MQRA 5A8QA 4AD3A 1BVNP 2X1IA 2HVMA 2VR5A 3VIIA 2AOSA 4QP0A 3ZIZA 4HTYA 1AMYA 4P7NA 3BAXA 5DT5A 4D6FA 3VD7A 3BC9A 3AFBA 5BXTA 4CN1A 2VZSA 4J3WA 2WBGA 4MB4A 3PZMA 7CGTA 2DT2A 1JZ2A 4BZYA 1MWOA 1VJZA 3O2LA 4M81A 2D23A 5ABHA 4WKAA 1HJSA 3ARWA 2J62A 3FHQA 5DF0A 3DX3A 5AY7A 4OUEA 3VGEA 2Z1SA 1SFSA 1D7FA 1R46A 3RJYA 3ZMRA 5CPTA 4A3YA 5C71A 1PIGA 3VGGA 1W9PA 2JEQA 3VD5A 1UR2A 5GPRA 5ABGA 3MS8A 4PTXA 1UWUA 2WNWA 4CD8A 3WDHA 3L4XA 2J47A 4EE9A 2XN0A 3VDAA 1CNVA 1AVAA 4JAWA 5A94A 5E09A 1MXDA 4FMVA 3WUEA 3U5YA 4H41A 4P8VA 2J8FA 3LPGA 3E1F1 1E0WA 1PX8A 1W2VA 1OGBA 2FGZA 1QHZA 3AHZA 4D1IA 3LRLA 4M1RA 5A95A 2ZUUA 3PZGA 4W84A 1PAMA 1UWTA 4EAMA 4DO4A 4DUWA 2DQXA 2D20A 1ODUA 3PHAA 2BY0A 5CZKA 3TONA 3VU2A 1W9BM 2PBOA 2YIHA 2WMGA 3HG5A 3AXXA 4PMOA 3EMCA 1AQMA 1E9LA 3SCWA 4AY1A 1Q6CA 1MW3A 1R85A 3G6LA 1XH2A 3EJQA 2XM2A 3CZ8A 2XVLA 2BHYA 1QBBA 3LPFA 1B30A 3TP4A 3ARVA 2ZX6A 4PEEA 1E0VA 1SMDA 3AZRA 4OKDA 2IUZA 1CWYA 1JFXA 3UR8A 1A47A 1PIFA 2OW6A 3K1DA 3RM4A 1I75A 1B3YA 5LA1A 3NSNA 2E9MA 2VCAA 2UY4A 3WUBA 4AISA 3CH9A 4GI9A 3D5HA 3PTMA 4N42A 5HNNA 5E6YA 3ALGA 3FAXA 3EDFA 1R33A 4DO5A 1KBKA 4D6HA 3AMCA 2DT3A 3MSDA 1XCXA 3QGVA 4PUDA 3BCDA 3CZLA 3CUFA 1LF1A 1WDQA 4B3KA 2J7FA 3U7BA 1UH4A 2ZX7A 1JYXA 1E6PA 3QHMA 3W27A 3EJUA 3AZTA 3GYCA 5I2UA 2HISA 1R47A 3TA9A 5D9OA 1V3KA 3ARXA 3PZ9A 3D4YA 1Y7VA 2YL9A 2PI6A 1W32A 3WF4A 4MNJA 1DWHM 3N17A 2E9BA 4OBSA 4S3JA 4W5UA 3N1AA 1E1EA 2J7DA 4Q7NA 3BLPX 5IFPA 2YDSA 4HA4A 1UA7A 4CVUA 1BYCA 1E6SM 4MB5A 1TUXA 1TE1A 1FHLA 4YHGA 1FFQA 1ISXA 1XD0A 2F61A 2J78A 4AZ6A 5CGMA 3M6DA 1QI3A 3EMZA 2X0HA 4BCEA 4AC1X 5C8BB 3WBEA 3UERA 2DSVA 4QCFA 4MAZA 3VUPA 5GNXA 3S2CA 2C8NA 3WUGA 3A3HA 1ECEA 1BGGA 3HJEA 1UOKA 3BAJA 4AEFA 1HKIA 3B9DA 4P8XA 3WH6A 2A3CA 4JCMA 3W26A 2GJXA 1CGYA 5IHSA 4BA0A 5EFDA 4RL3A 2OSWA 2XVKA 5CLWA 5HPCA 3F4VA 4FNUA 1LG1A 1QNRA 3WQVA 4DM2A 4WKFA 2BXYA 2X8RA 1B2YA 1CLVA 4GQQA 1EDTA 5HOSA 1HJVA 3H54A 2CERA 4FF5A 3AHVA 1BYAA 2XVGA 3DECA 3O6AA 1NWTA 1Q6GA 4LX4A 2PWEA 1J0JA 2YLAA 1JAEA 5A6BA 1LWHA 3L4VA 4PMDA 3UG5A 4NI3A 2X2HA 5ABFB 4FNQA 3WQWA 2WMIB 1WKYA 4NX0A 2DT1A 3L4YA 2WC3A 4W89A 4AIUA 4ZE4A 2WKGA 1ZBVA 3GNRA 1Q6DA 3AIQA 3U57A 3D4ZA 3IAQA 2CIPA 3N12A 3WFZA 2EPKX 4EANA 3VM7A 3WBAA 4D71A 2YBUA 4JL2A 3H55A 5A2CA 1JI1A 2XYLA 1ZBWA 1UWSA 2X05A 2EEXA 2XPKA 3WMSA 3WH9A 2WHMA 3WQ4A 2GJPA 4K68A 4W7VA 2XSBA 2XWDA 3WNNA 2WVVB 4Z2KA 3DX1A 4NXSA 1UH2A 3VIKA 3W81A 1U33A 3BXWA 3PBGA 3DDFA 1CIUA 1C91A 4JHOA 1TMQA 1V3IA 5BXSA 3HG4A 3MMUA 4F9JA 3ZJ7A 2WVVA 5I79A 3ARUA 2BNJA 1JDDA 2OSYA 4UQAA 3LPOA 2VJXA 3RM9A 2BY3A 1JG9A 3RDKA 1CZ1A 3WY4A 2JF7A 4UQ9A 1LL7A 1GOWA 5HPOA 4CGTA 1LLOA 3T08A 1GOKA 3AYSA 5BRPA 3BAWA 1H0GA 2D22A 3WFLA 2XUCA 4NZJA 3VNYA 4CD4A 3IANA 1C90A 1OD0A 1V02A 1UD5A 3LXCA 1LL4A 1JZ6A 1PZ2A 1U2YA 5A1AA 3AIVA 1QNOA 1CBGA 1TA3B 2VO5A 1WAWA 2BHZA 4HOXA 3QOMA 3APGA 4W5ZA 4U33A 3AICA 3PZTA 2D0FA 3VSTA 3N18A 3VX1A 3IGUA 3VKKA 4PSPA 4U3CA 2WKLA 1QOXA 1SMAA 3PZIA 4D72A 3OLEA 3L2LA 3VIFA 3A4WA 2JF6A 1DTUA 1JL8A 3AYRA 2YFNA 3GH4A 5GQBA 5JIPA 3KE0A 3TV8A 3GH7A 2FYVA 1H49A 2V3GA 1EHNA 1B3XA 3PZNA 1EIBA 3EBVA 5HBFA 3I3EA 1KTBA 4PN2A 3VX0A 3CZGA 1UKOA 3HG2A 1OM0A 4H2CA 4QLLA 5A2BA 4UR9A 3WEMA 2F1AA 1QHOA 1KXVA 3W25A 1C3FA 5I6SA 2VUYA 1DEDA 2UY2A 3GNPA 4M29A 3GH5A 2VT0A 4ZENA 1UYQA 3S5ZA 2NSXA 3FN9A 3AJ7A 5CSYA 2TAAA 1UKTA 1V0MA 3CC1A 1KWKA 4MDPA 1J12A 5M03A 1WP6A 2F1BA 5HDRA 5E9AA 1E72M 3ZJKA 4JIEA 2EAEA 4M82A 3DHPA 1V6YA 5A3HA 1S46A 4CCDA 3S5YA 3WDIA 1CGTA 3SEPA 1JF5A 3NCOA 4GZJA 5IXEA
chains in the Genus database with same CATH superfamily
4HXAL 1VFBB 3O6DA 1UJ3B 1RZGA 1FN4B 2OK0L 3BVJA 3WUZA 5I66B 2H6RA 2PLTA 3INOA 1TRDA 2Z7UA 3TYZA 3HBZA 3ATEA 3Q8BA 2B15A 3DYPA 3HR5B 3BQ6A 1HOCA 5HHOD 4F57H 4KJWD 1TV4A 3SRKA 2J7BA 4L80A 2VLRA 2H0PA 4QT5B 5HBBA 3VQ1C 1LQAA 1OX5A 1TR1A 4JG5A 1PHQA 1WNOA 2CKBB 1UMYA 2A2IA 3JZUA 1BOYA 3QGKC 3EFDH 2HP4A 3I9GL 4QRPE 3UGXA 3KVQA 4JFED 1ME7A 2PGEA 2KBGA 4HNTA 3EGDB 1ZT4B 3V0GA 3N6JA 3PWJB 5DK2A 5MI0B 5IT2L 4MJ2A 1UR1A 1UPPA 5C6TL 1E4XH 1PKLA 5CJNA 3GJEA 2CKBL 2ZYIA 2G5RA 3G8RA 1IKNC 3FRPB 1ZT7B 3SPHA 4LPUA 1GG1A 5I5JA 3NBNA 4GT0A 4X6CE 5F6IC 2VDMB 3X11B 3FQWB 1NGYB 4BSVB 4D0DA 1PLAA 3K72B 4Q33A 4L8BB 4A63A 1FL3A 2Z91A 3M45A 5B1CA 5AENA 1TENA 2ZA1A 3K2GA 1WT5A 3ISWA 5DJAB 3F2DA 1U21A 2EADA 2J44A 3DPBA 3HB3B 3RPIA 5HD8D 4XMTA 3D12B 1PIIA 3Q48A 3U3HA 4MMXC 1T21A 2OMXB 1M2VB 4X3ZA 1YN6B 4LSQL 1UA6H 1Y18A 4HC1L 4XVTH 2AK4B 1VBUA 3AT0A 1ALDA 4DBWA 4DJDD 1MAJA 5ETUA 2D31B 1PUDA 4PCPA 3EYVA 2DLHA 2J6EA 5D5ME 3NA8A 4MZ1A 5DMIH 3GMQB 4A3QA 4F0MA 5BZDB 5EIIA 5FX3A 4I0CC 3GS6A 1Z5LA 2OMUA 2ADGA 2XWCA 4HIIB 2ZXQA 2X6BA 3N40P 1KB9K 3LRSB 3QDJB 2V5TA 4M6PA 3VB9A 4QJ3B 5HDQL 5JNYB 1HS6A 3M0VA 3IFOA 3NK4A 3NJLA 4X8JB 1EHAA 3VD2A 2WW5A 2A9MH 4A6YB 3P77B 4JQXC 1HXKA 4P4KB 7A3HA 3K80A 4QX4A 1IV8A 1QLEH 4WHDA 1RUSA 5BZWB 2K3HA 1DVTA 1UH3A 3OR7B 1I9CB 2DT0A 3CIAA 1T1YA 2J2ZA 2ATAA 1QASA 3II1A 1IXQA 1Q6EA 4W68A 2GJNA 3DETC 1I7TA 1JTTA 2VC5A 2OP4H 3WDQA 4UFIA 3RDTD 4P48A 2I57A 4DPCX 4PB5A 3X1EA 2I60L 1SVZA 4XB8A 1N7KA 2G50A 3DURB 4K1WA 5EF3A 2DLEA 3TX9A 1FE8L 1KIUA 1E4IA 2NYKA 1RPKA 2E7CA 4L29B 2V17H 1GOQA 1NFBA 2WVTA 2H9AB 5HNRA 2NMSA 1FWBC 1WFIA 2VL4A 3KLSA 3NEEA 4FTVD 5D1QA 4XP9L 1V55B 2PBGA 3DKLA 6TAAA 2LU4A 3GGWB 5GS0L 1HZYA 1PS3A 2OJ1A 2XPGB 4LVHC 1U3HD 4QTHB 2X4TA 4XOAA 5AKSA 3W7NA 1ZEAL 4KQ3H 1CZ8L 1X5KA 2QV2A 4WJG3 3CV5A 2ZOXA 3ITYA 4ROPA 1PZ5A 4ELKA 1NWSA 2ZOUA 2IPKA 3QJFB 4HFWB 1NBZB 3FXYA 3TWCL 1IGFL 1T2QL 3LKSA 5D70L 4M1DL 3LY6A 4YSSA 3RX2A 1CLZL 1IAIH 4X6BB 1U4EA 3ETTA 1XISA 7ENLA 3E9UA 3SPGA 1BFVL 3FN0H 4O02B 4AYID 1OG6A 1TZZA 2NW0A 3D50A 2VABA 4FEIA 1OE2A 3R18A 2ISFA 3VI4B 3MGTA 1P5VA 2JKTM 4C6KA 3QO0A 4P2RA 4PB9H 3OZKA 4Z7AA 2DEPA 4A7TA 4PTUA 3V4LA 5AYBA 1JV2A 4JFPB 4ES4A 4MJ5A 1KIPB 1Z44A 3GDCA 4LVFA 2DMGA 2P8LB 2WYTA 4XVOA 1Y0EA 3N14A 5I0XA 1WS7A 4LOCA 2NQ3A 5I2IB 5BXRA 1DQVA 3QUYD 4JFXA 4ODUA 4UDTA 3W1ZA 2PDIA 2H9AA 1NAL1 1FOBA 4L3EA 1UKQA 2HVKA 1UD6A 2MMXA 3D8MA 5IQMA 3LB0A 2FSEA 3C09B 5DS1A 1T0MB 4NSBA 3HMXA 4K8RD 2WMHA 5CGYD 1E5BA 2UY7A 4WGVB 4CNNA 1WDSA 5CXPA 3WLOA 1UXSB 3BQUA 4LVEA 1IGFH 3UAJD 5C6PB 4GJTB 1E1CB 1RR2A 1ZCOA 2PP8A 3MUXA 1DQXA 1EX1A 4XH2B 3KM1A 4JFDD 4LCWE 2DM4A 1DJHA 4JR9L 5DDHB 4LOUD 4ZOAA 3ZLQC 4KMLB 1LOSA 2O92A 3DBPA 2ERJC 4QLJA 2ICEA 5GS0H 3RM8A 3GTNA 1UM5H 5DRZA 5FO9B 5G5IA 3HZKA 1W6TA 3V0WL 3W2DH 3O3AA 1P7QA 1JNJA 4TX9A 3CIQA 1TWDA 2DD8H 1G69A 1NP0A 3IXAB 4G8IA 1FFRA 5IB3B 4H9UA 4GXVL 3GHRA 2BNUB 2PTYA 4MQ7A 5D4YA 5G1TA 1KC5H 5DX7A 4GH1A 4JFDE 4F8TA 5DELA 3BT0A 3KBSA 5CSGA 3QZLA 1CTNA 3CVCA 5DZPA 4MJ6A 5HHMD 4MY1A 4Q8NA 4AZHA 1YHTA 1XSKA 4XODA 3FF8A 4X8GA 2QPXA 2XWJB 3NOIA 4M5SA 3PTQA 1FCUA 2PTTA 5C07E 5FECA 3BLOA 4DGYH 3WQ6A 5D1QC 6PCYA 3N25A 4UQDA 3APMA 4AU0A 4KDTC 2NY3C 5J6GB 4LPWA 4QHNB 3R1GL 4PJ8D 4XNYL 4NCC2 3X1NA 3JU2A 2BPBA 4G7VL 1B88A 4URKA 3AZSA 3IPWA 4LVAA 4NC1E 5HGHA 1W5QA 2I9EA 43C9A 4IQHA 4OSUH 4GG8A 4JY4B 3ETBF 3G6JB 1RULH 2NXYD 3G5VA 5KSAC 4X80L 1TJPA 4Z7VF 4PUUA 4FQLL 1YEEL 5FA3B 2ZKMX 4LLVB 2PF6A 5A6IA 3X11A 3TFKD 4BFRA 5F7BA 2XH2A 3CB3A 5F3HB 3RX8A 4J3ZA 1QI5A 2DH3A 1HHIB 2OL3B 3BO9A 1SLWA 1YHPA 3ZZLA 3PV7A 4LSQH 2Y7OA 1FC1A 3GK0A 1L6YA 1WV7T 3WE1A 2ISWA 1UT1A 1Q0XL 3GRIA 1RLDA 4G9DB 3HZVB 4AYMC 3ALWA 4IOSD 3GFUA 3QJTB 4PG9A 5DEZA 2J8UE 3CSGA 4C7FA 1EAPB 4LVHB 4XRCB 2Z1WA 1U8CB 3S8HA 1FCGA 3H0TA 3MJ6A 5KSUA 4MD4A 3SDCD 5E2WH 1F56A 4W5ZA 1VGKB 3TLLA 2OTUA 3QFDB 5FOBA 5BS0E 2IBZX 4BQ5A 4S2SA 4OJFH 3KS5A 3HAEH 3L1GA 3PWVB 5TDPB 2ZG1A 2R0ZH 5CD5C 1OZMA 5K9DA 1MFAL 3IGHX 2DJ4A 1FN4A 1HHJB 2XWEA 3M7FB 3IVKA 3IJHA 2DQHH 1HVXA 4IMEA 3QORC 4E2VA 4PBWD 2RUSA 2D8KA 2WKOA 5JXAH 1IZJA 4XPHH 3L16A 3B8VA 1BGXH 4HT3A 2BY2A 2C9PA 3PWAA 4TQHA 3AISA 1BVNT 4XVSL 2OOFA 3V4VH 2GFBB 3IJQA 3VFRA 4GRLC 1AC0A 1IQDA 1ZJBA 3CZFB 3DROB 4LV9A 2CLZB 1IVLA 3FOLA 4NWTH 1UIOA 5HHQB 3TT1L 4JFXB 3CFCL 2H1PH 2PDUA 2VLME 2CRIA 3UC2A 4JYDA 4Z2LA 3FFCB 1B2WH 5C08D 5EZLB 1PFOA 3RYSA 4TUFA 2JI2A 3ZMEA 4I6KA 3BUPA 3W88A 1JCVA 1A5FL 4G59C 3MV9A 4JKLA 4G1MB 2BNQD 8FABB 1ZTXH 5D6DA 4KO7A 4WSJA 3OZMA 3SN0A 4KO6A 4BFFA 4D6JA 1SYVB 1IWPA 2O55A 4D0BA 1EA9C 4WUUD 2CU0A 1MCWM 4QQ3A 2PXYB 3EYPA 1XEUA 5KOMC 3WUWG 2UX7A 4PG2A 3TYFA 2Z34A 5DMYA 1JZ4A 5IFHL 2F08A 3F2LA 4L4TE 4JO3H 3BKJH 2ERJB 4DP6X 3IS1X 3LKSB 5AW7B 1KQZA 4WU7B 4XCNA 3CHDA 5AHEA 3WLWD 4PJDE 2H2SD 3UWWA 1E73M 3GUWA 4RCXA 2ZAGA 3TCEA 3VU1A 3AACA 1G7LB 1D8WA 1CYWA 3ZSTA 1W9DM 3A4DA 2A0NA 4EIVA 2OR7A 2ZWLT 5K3VA 4OT1L 2PURA 3T05A 2V9TA 3T8XB 5KJRL 1EEPA 1X8CA 2WYIA 1SZGA 4AWSA 2NW2A 1NPJA 1D2PA 1VADB 2JJUA 5FEXA 1ISWA 1OL0A 4GFTB 4CW1B 3NDYA 4CBPA 3KPLA 5BO1H 2CK0L 5BJTB 1G7MB 3HE7A 4PBVC 4R3SA 2E7BA 5ISZE 1T7YA 5KBLA 4H0HB 1LOQA 1TKWB 1KN2L 1J0KA 3FU3A 5DFAA 5IUCA 5JQ6H 1SGKA 2W0PA 5BMWA 1TQSA 3CHCA 2O0TA 4PMVA 3M8OH 1C08B 2ZNWA 3IF1B 1NUGA 2JKRM 3EJRA 2C3ZA 3KFTA 2A79A 3D07A 1DLFH 4IOTA 4Q4QA 2PS2A 1WKEA 4IPLA 1S5VA 1QSEA 4X8JA 3N13A 1RZ7H 5ENWB 1F73A 3UJSA 5DTFB 1YPZE 1ZCCA 5GJMA 4FL4B 4M8UA 3HGRA 2R23A 3T07A 4I3RL 4ZXBB 2XA8H 2DWDA 4F91B 1MQ8A 4PMJA 1KLGB 3RFAA 1X1NA 1TPDA 3AXMA 3T7VA 3H9ZA 3L9BA 2VW4A 2VR4A 3LQAL 8PAZA 4PJXB 4WI6A 5IY5B 1JCNA 2A74C 2VWTA 4APXB 3NTYA 4GJJA 1VFMA 4LCRA 4TV6A 3EFOB 5I73C 2GJRA 1MPAL 1CGUA 1OTTC 3AMGA 4W7WA 2BHFA 4J3OH 1FNGA 3WDJA 1E4MM 2E59A 1HCFX 2NQLA 5J89A 3F7QA 1Q0EA 2BOLA 1I9RH 3CU1A 1FKWA 2ZUMA 3K4WA 5A40E 1JZIA 4M7KH 4QCEA 1FH8A 2OSLA 1FHDA 4CCZA 3EBGA 1M3IA 3RBGA 1N6UA 2HTKC 3IKKA 4HIHA 2GJ6E 3FT4A 4BFIA 1EGJL 1PD1A 1CLYH 5KVDL 3SQOH 3WKMH 2WZAA 3ZHDA 3HN3A 3EZJB 1CXIA 3P4OA 3NGBC 2Y5EA 2P45B 4U1LA 4M6OH 1Z66A 4GW5B 4FDWA 3IJYB 5K9XA 3SJNA 2EPMX 3QORB 3E0GA 2J6XA 2PLKA 3CV7A 1UD2A 1CYGA 4XO9A 3ZE1E 1H7WA 1E50A 5GGUA 1UWIA 4GP8B 3KH3A 3L2MA 1ML0A 2OZ4L 1HJUA 3ZDYB 2X0VA 4HUUA 2C9RA 5T8IA 4FI6A 3TCTA 2EUVA 2BVOA 3FU8A 1MI5D 3GZOA 1I82A 1VACA 3AWEA 2MKLC 3PRZA 2K7PA 4QEGA 2J1KA 1OGAE 5HI3C 3PTKA 1OAUH 1CD8A 1UOVA 1QHPA 1M1BA 4R96B 4BBWA 2X4PA 2QHLA 1JCJA 3W7CA 3QZBA 3L7FA 2YXXA 4IQLA 3QFGA 5C0RH 3OHXA 2D2JA 4XC3L 1OW0A 2P47B 3DFQA 4AC7C 3G1RA 3JT2A 2QELA 5JW4M 4XBMA 4YYFA 5I16B 4GW4B 3T4YB 1YNTF 3UZVB 4A6YL 1RPQA 1A4JB 2R9RA 4H0GA 5EO0B 3V9CA 2LHAA 2QL1A 4PR4A 4GP5B 2WZPA 2DI9A 1EYEA 5LG1A 4M6AA 2EXWC 3OF6D 4JTTA 1TVBB 5DCBA 4LLAA 3G5EA 3QHNA 2ZG3A 3OAZK 4U6XB 1UOWA 3S96A 3GMMA 5EU3A 5IKCB 4TUOA 3JWOC 4KFMA 3CFEB 5EU6B 3WSQH 5L0QC 1YTEA 2EG6A 2QUVA 3LENA 1AD0B 3V0JA 3N11A 4HPJA 4DW2L 4LAQH 3UVAA 2ZKHL 4K3GA 2BW5A 1IILE 5BNXD 3UTZB 1L2UA 1EWHA 1JPKA 3MV01 1DP0A 1PKNA 3L4WA 3EXRA 3ROLA 1DDHA 3C5XA 3CPLB 2NX3A 2WTRA 3QE5A 5J9PA 5JXED 2FT6A 1MI5B 3BDYL 1C8VA 1XRVA 4B90A 2DDQL 3IN0A 3C5SB 6TIMA 5L2JB 3QUMH 4I7VA 1RJZB 4GI6A 1EJSC 2HWZL 1IJNA 5HTSA 1GG0A 1G94A 1UWGH 1T6MA 4ODWB 4ZPTB 3LV3B 3L66A 4XC1H 3MLVL 2CDFB 2ENSA 3NAAH 3QWRD 3VXTA 1A4JA 3K6NA 4EI0A 1TV3A 3W84A 4RETB 4GRWE 2VQTA 1UADC 3EHBC 2NNAA 2CSPA 2GIYA 1ZE3H 2DTML 3FT9A 2IANB 4I0PD 2Y61A 4J3OF 2VE6B 3VIJA 4UB9A 3UCQA 3AVEA 2EDFA 3MV7A 4LU0A 1YQVL 3RFZA 4ZZFA 4KKCD 4L64A 1JGIA 4LP4A 2D4FA 2NZLA 1SOQA 2APXA 2J74A 4MUZA 2VMJA 4RFOL 4K3JL 3KPRB 3TF4A 2YA0A 4ZTEA 3HC0B 3UTTA 5HUPA 4OI7A 4QGCA 1TSHA 5DC0A 5DVNA 1P6CA 2QUMA 4YTRA 2OW7A 1D7CA 4XC1L 3DG7A 3FB8A 5D93C 3P54A 3I4KA 5LHEA 5I1JL 2NLJB 1LOLA 4GQGA 2J79A 2PPGA 4GIRA 3MHGA 2HZHA 4MXQC 5KYUB 3SGZA 3V4VB 2VGIA 2ZXEB 3MGOB 1FL5B 1QNPA 2WNNA 4MY9A 2Z6IA 4YGVB 4BS0A 4PUWA 4WKHA 4AVHA 5IWLC 1OYCA 2N59A 1CWVA 4I6VA 1CGSL 5IMMA 4EKJA 4CD6A 4OFKA 4PJBF 1QU4A 4ZB2A 2E4FA 2XT1B 3QORD 3L3JA 3HE6A 5DA4A 4GJIA 4GYPC 3QI9C 4W4OC 3C8KB 4AZ8B 4LRTA 5AVNA 5ESVB 3UYIA 3KLAB 3U4BH 1QNIA 2SEBB 2FZDA 3VXRD 3TN0A 5HYJE 3QY8A 2FTPA 3B7YA 1KIRA 1E4NA 4H88H 2PU0A 4JG1L 4HVXA 1T66C 3DV4A 3V55A 1Q6FA 1IEHA 3LCWA 4KEUA 5FI8A 3IGKA 4LW7A 3DMMB 5HYQB 1A4KA 4PWHA 2BNRE 1PG7W 5E5MA 5TE4H 2GVGA 3UPRA 3ZTNH 5FKYA 3BUYA 1XQKA 4ZTPL 4ZXBA 2OS7A 2WBWB 4WO4B 2WLZA 2PGFA 3QHOA 4A4AA 4D8ZA 3S4SG 5EB9A 1RHHB 3LGEA 3R94A 5SWSA 1RP8A 5D4QA 1W6WA 4IGMA 3NIDE 1ZU8A 4HJUA 4DZIA 4QJ5B 3PNWB 1XR8A 3JQOB 5FJRA 3MCMA 3MZNA 2X0SA 1OO2A 2RDXA 5G2WA 1N0LB 1UUQA 2BVPA 4L9LC 3TLRA 1SY6H 3QYMA 3IUHA 3JTSB 4WDIA 5GGQL 2Q3OA 2X10A 3HAEB 3R11A 4NOFA 3QI9B 3BSZH 3K81A 2WK2A 1Q94A 3G1XA 3IMTA 3MJWA 2LE9A 1TX2A 4IIZA 2NPLX 3ULVC 1TV2A 3MFGB 1GSKA 2FBJH 3PU7A 1TTBA 2VXQH 3OMNB 4FKKA 1KCWA 2DPEA 2VH5H 3HNVL 1NDZA 4GY0A 4W85A 3URNA 5HWMA 2FJHB 4UILL 3N42F 2A3TA 3IDNB 3AQDA 4WSGA 2BVDA 4RFEA 5HWJA 4RRPM 1CLYL 2UY7B 3WTYA 1XPGA 4OF5A 2ZSVB 5E23A 3UEQA 2B7PA 1VD6A 3V6OA 4B2DD 2ZRXA 5AW8B 4FG0A 4WTZA 3TC9A 3NZUA 2IXVA 1QFWL 2PODA 5I1IL 3IV3A 3L4ZA 1UR9A 3EGSB 1LDSA 3Q7JA 1SEBB 4LEOB 1EEYB 1YYAA 3F03K 3MSRA 3FT3B 2X2GA 1ZVNA 3ATBA 1G9MH 4LQFL 1Y1DA 3T4YA 3UZVA 1BMZA 2NTFA 5HDBB 1AH4A 4JAMA 3U7VA 4HWBH 1KSRA 1A5KC 4LF3B 3VUSA 3ARZA 1OLZA 3WO8A 4PBEA 1FL6B 1M6JA 1FO0A 4YSRA 2CBTA 3CHOA 5CD3A 3H42L 1CF1A 3B3IA 3NQMA 3U36B 2EC9U 4EZMA 3QIWB 1K4CA 4JDEB 4PRRA 3EXSA 1EZSA 4H9XA 5LB1A 2X2IA 5MENB 2V5JA 1DJWA 3SOTA 1EXBA 1I3UA 3BAYA 4YJ5A 3P0WA 5A6SA 1Z3GH 5C0ND 3WIIL 2CLZA 5IOBA 3UXAA 3P02A 2FGBA 5A8PA 3BPLC 3Q06A 4Y7EA 4EXAA 4FJYA 1A6WH 3CN0A 2Y36H 1B4LA 5JQ6L 1IGYB 2FX7H 5HVHC 4US5D 3NDYE 2VWSA 1WV2A 3YPIA 1JSYA 1CDCA 2VFHA 2HLFD 1MH5B 1KRMA 1KCRH 4H8UA 1MI3A 3GTTA 2PDCA 3CMOL 3SRDA 4JFVA 3GBDA 3QIBB 4JY9A 1RK1A 2GBUA 2YR1A 3FV9A 3M41A 1MWAB 4NY2A 1OWWA 3WJLA 5CC6A 4C6OA 4L8DA 2PPEA 1XTLA 3GF8A 2E40A 2CKNA 3ANYA 5KW9H 1NP2A 3UGUA 4DXKA 4ZSUA 1V02E 5M3WA 3V0VB 3X3FH 4INFA 4LCUB 4N2HA 3SDAB 2X40A 4F0LA 4M1GL 4LFHG 2YA2A 2XCMC 1XDJA 1BQHA 4XWGL 1ECQA 1ZJHA 1TV8A 2YCKX 3QV7A 1NCHA 2YC1A 2WOBA 3SGEH 4NXKA 4R6UA 3TA3A 3ARYA 3FMGL 4A7UA 3U9PL 4D8OA 4XOEA 1H7PA 4HNOA 5IEKB 3RWDA 1I8KA 1RH8A 4UTKA 5DCCA 4RMWA 4AM0Q 2J88A 1RUMH 1WOAA 5E1HB 4CQAA 1FIEA 4N5EC 4YGAB 5J57B 3N0PB 3F05A 3NPVA 1G7JA 2JKWA 2IQ0A 2PN5A 2YCIX 5FDYA 1VPQA 3RMJA 4B16A 3RUGA 3I84A 2NR6A 1MRFH 4CD5A 1ACCA 1ZTXL 1LUCB 5T5FL 4BEIA 1B3IA 1JZEA 4Q32A 4YXGA 4PUKA 3D6NA 2X44D 3SDDA 3HS0A 4NUPA 3VDCA 3WLTA 2B4GA 3RNQB 4F3HA 2GT9B 4XXDB 4LVNC 1JDCA 3FU5A 1TO5A 3CFQA 3N04A 5DQ9B 4M3PA 1F4HA 3MHUA 4ODVL 1YEDB 4G9FE 2VX4A 2WNQA 4WW2F 3WTVA 3HNTL 4O53A 4WVXA 1UXLA 2HK1A 4TMPA 2R56H 1RUQL 3BE1L 2XBZA 5J1SC 5EGRA 2OGJA 2PPCA 1GCYA 1XCQB 4U0RB 3D3VE 4DN3H 1VYSX 3KGTA 2HSIA 4N24A 3FVMA 2OMYB 3NR0A 1Z3NA 2CM6A 1BF8A 3WNOA 4I5BB 4NJAL 4JZNA 4DWSC 3DNKA 3H4GA 1HZHL 5EBWA 4JHAH 2ICWA 4GMSL 4O5LL 5FW8A 4EDXA 2KLRA 5DZVA 3BQVA 1E40A 1N8WA 1A3LL 2IFFL 3MI6A 2X89D 4HETA 2IXQA 3O4OC 3WELA 1GVRA 3KL5A 3EPNA 4RAHA 4ECNA 4OZOA 5JDJA 1IC7H 1S9KC 3AIUA 4LRNL 1OE3A 3CHRA 4KVNL 4NYUA 3AIWA 4KDVA 4AD5A 2Q76B 3AXLB 1U8JB 2PDBA 3MJGX 4BF9A 3MX0A 2CLVA 2MQ3A 3L23A 3V6ZB 4HBKA 4JFUA 5K39A 1ISVA 3ARTA 2ED7A 3ZTJH 4OJCA 3G5YA 1ADDA 2QGCA 1ISYA 3EDKA 2FLIA 3D25B 1V6UA 4HA0A 5EUKB 2E9JA 5HVWA 4NX5A 4XPAL 4H00A 3UQNA 3KLAA 1MCLA 1W0VB 3GHBH 3LS4L 5A6LA 3KH4A 4AL8L 4AMKL 2HMID 1LO3L 1FWSA 1JHKL 2EDRA 2XPZA 2J27A 2OWWA 1PNCA 4XMPL 4BFNA 3RWDB 3EX2A 4XTIA 4WU5A 3HMWH 5DVPA 2FAUA 1RSFA 3LTVA 5FYJH 3RVWD 2MTPA 3KLHD 1T5XA 5EA0H 1IMHC 2ZC1A 4OVXA 3WEAA 3QIUA 4FD0A 3PZVA 4QLRA 3WJYA 2OMVA 3TBYB 4OUUA 5HVHB 3N3MA 2X4NA 3IDNA 3JV6A 4OUOA 3CVHL 1LP9B 4YHPA 2FJHA 3OMZA 1ZBKA 3CL8A 3FO9B 3RWIB 3TPUA 3QW9A 3R1GH 3T0VA 5F1SA 1CD1A 2ODIA 3PWNA 5D7JD 1G1CA 4JN6A 1HCZA 4ML4A 2DZTA 1BFTA 1LEKB 4Y19E 3US0A 4I18B 1CDYA 4WDXA 3W85A 2O5XL 4GUHA 3U4KA 1K3UA 4TVPL 3C0JA 3MHZA 1RALA 1OY3B 1XF5A 1FVCA 3FRUA 2JKEA 3FCPA 4TU1A 4PY7A 1VIZA 2RKXA 4XN2A 1Q6RA 1XVSA 2R1NA 2WZIA 1FAIH 3MUAA 4KRMB 2X4TB 2H3BA 2V2TA 3ZKNC 3UZEA 1H15B 2GIXA 1RMFL 4BRVA 3WIJA 1SF3A 1PZ0A 1HAWA 3VFNB 1U1HA 4GW4A 3MUIA 1UGNA 3N1FC 2C3VA 5K1JA 2VM9A 1O5QA 4OD3L 1A7NL 1X9LA 2YGQA 2IH9A 2O5NA 3LCXA 1D7BA 3SAZA 1Q72H 5CCJA 5HHOB 2RGMA 2P8LA 1W72A 3L67A 4JD4A 5E8DL 5LBGA 5HI5C 3BKYL 3QDME 2FZ9A 3QUYB 1QVOA 4PJEE 4EN3C 4JZ5A 3H2WA 4QXVA 2P8MB 4I89A 1A9BA 2IAMC 1YUHB 3MOBL 3S8FB 1A3QA 1XEDA 2B3RA 1WDPA 3HS0B 5GGRY 3N43F 3ZVVA 3B9KB 4XP4L 5EEVA 2OG9A 3B5GA 3I9IA 1RIUL 3BWUF 5B38G 1IIHA 4RMQA 3U30B 4AYGA 4BKTC 1VJIA 3CZNA 4KJPD 2HVJB 5EULV 5G5DA 3TS8A 4HJSA 3AYTA 3VE9A 5XIAA 4RZCB 1EKOA 2YZ8A 4N6QA 1GJPA 4KRPD 4FHKA 5E56A 3ULUC 4XBKA 2P46B 4YDMA 1PWLA 1DFBL 1GJWA 1XLJA 5K7JA 4Z2IA 4K8RL 1LO0L 3L17A 3QXVA 3PFRA 2Z2UA 3PP3H 3L5IA 3C2AL 2Y5SA 3ARGB 1OAYL 3C6LB 2ID5A 3VO0A 4GX8A 1NZRA 2L3BA 4JZNB 4EDWH 2C7FA 4HDIB 3LPPA 4OD3H 4MCZA 5GJTL 5FO8B 1FCQA 3P82A 4LBAA 5E4EB 3UPAA 1DQQB 2YD1A 1X5HA 2YRPA 1INDL 2JKXA 1KBBA 2AP2A 3FZUC 4OJYA 5IM7B 3UBXI 4ATWA 4PCSA 3GSQA 4YZFF 3GMLB 4C59B 1B3WA 1TIWA 3QSTA 4NF7A 1T4KA 1Q94B 3TWCH 1CC3A 3HVDA 4NO2B 3NJ3A 5H37A 1FAIL 3BPCB 2Q86A 3PUGA 4HYWA 4P5SA 1NC4B 1OAZL 1R5IB 3DV6A 3MFFA 5DRWB 3LQZA 2CW6A 3HI5L 1WWBX 3BW2A 2PDLA 4GO9A 3VWJB 3WFCL 3GKWH 4XP9H 4EZKA 3UPBA 2EYSB 5L88L 4JQ4A 3PUDA 4WENB 1F11A 4JM2C 1UOLA 1DUYB 3LIZA 2WPGA 3K6FA 2PWVA 2GWGA 3KVJA 1YQ2A 2ATPB 4Z5RB 1M04A 3VIHA 2CCWA 1NGQH 4MD0B 4EI5D 4P9MH 5EPMA 4JR5A 1GGOA 1M01A 3QQDA 4NO3B 4JRXE 3MJ7B 1B3VA 1YE4A 2FL5B 3CUGA 1BWLA 4WEBL 3LGGA 2DY3A 3WGVB 1FNLA 3MACH 5IHWA 1HFUA 1KYOJ 2E0PA 1TWIA 1FP8A 2JIXD 3ZDZB 2ZKYA 2J73A 3CUPA 5D2VA 4E8DA 1A5LC 3W3OA 3VG0H 2Z27A 2GOUA 1S7TB 4QIUA 2CO6B 3MLSL 4H1LB 4Z7WE 4ADJA 3VSVA 5E99L 4A68A 3QXDB 5D7IF 1IBBA 2Y3NA 5BOZG 3S36L 2FZMA 4AZBA 4DSYA 4A7VA 4EAEA 5GRVL 2PR9A 1MCBA 2WSPA 1E43A 3O4LE 4X0KA 4CILA 5MHSE 1KDIA 4G6FD 3VXSE 2XIJA 5AKQA 3S6TA 4RGMC 3QQ3B 3L6FA 2L7JA 3NG5A 4LKCB 3HQ1A 5DT1H 2ZXGA 4X8CA 3OQ3B 3AXHA 3A6BH 4R0LC 3S96B 4IKJA 5F8QC 4E9VA 1D5MB 1K4DB 4WJXA 1UJ3C 4KVNH 1DIEA 4LIQE 4MB3A 1FFTB 2NY0C 3KGSA 3KYMB 4Q7DA 2FJGB 5ENWA 3RUGF 2AGTA 3SUUA 4U31A 4C7GA 2X7VA 1MFBL 1XLIA 4H7ZA 3PSVA 3FONA 3QZAA 3GGWA 1GSMA 3RDTA 5JLZA 2FMOA 1KB9J 3BD5A 4JHAL 1SXCA 1VLXA 1X7TA 2NCEA 3QXDA 3AY2A 4LRIC 5I1DB 1BKHA 2VDGA 3ABRA 2GGJA 3T0XA 1CLOL 1RLCL 1H5BC 3F5WA 5CSZB 2GDVA 3G1AA 2EABA 2NNFA 3L48A 2PTXA 4J5NA 3B2UD 4F58L 4G5DA 3KW3A 4KZDL 4HEPG 5CJBA 1NM4A 1PD0A 4HKPA 3ILQD 4BWLC 2GL5A 3KPSD 1S78C 2H6UA 4HFUL 4PRHE 4R3SB 3S35X 3O06A 2WXPA 3QC3A 1B1YA 3SGEI 5D55A 3QPXL 3SE3C 4BSJA 2HXUA 3MUY1 4K37A 3JT0A 5EBUA 1ICQA 4OZIE 4CSTA 1C7TA 4ZOCA 2XM1A 2OKOA 1ROCA 2ZIDA 3AU1A 5LAXA 4UT9H 5IREA 1IQDB 1A7OL 3CZFA 1AIFA 4L4JA 4I9WD 3BOFA 5DLMH 4QRTB 1SEBA 4LEOA 4QIRA 2F7RA 4RA3A 5CJOL 3ATZA 2YWZA 1RCYA 4O8AA 1UWQA 2HKAA 4FQIH 4MBRA 1V0LA 2BASA 1ADOA 3HFML 5JDSA 4UTHA 4ETQA 4O19A 4QAWA 1KPUB 5I1LB 3OEXA 4BFOA 3QXWA 3N9SA 4C6LA 3RPMA 3S9IA 1DDHB 4P2OD 4WUKL 2CZVA 4UR7A 4J3VA 3TW6A 2FR4A 4GT7A 4B91A 6A3HA 4K7YA 3D69A 5BU9A 3CQIA 3ASWA 2FLMA 2HJLA 3MNVB 5FKAB 5GIRB 3B56A 1TVNA 2WSKA 1OZUA 4CGUB 3VXSA 5K1NA 2UV8G 1NLBL 1VF5C 1ZGLM 2JIWA 1HXYB 2FJFA 5IG7B 1ZA6A 3OA3A 2XZCH 2X4OB 3DYOA 4AG4H 1NL0L 4IBTA 2QZQA 3LHZA 3TO2B 1JVKA 5ABAA 2YL8A 4M7ZB 4G6JH 3DUHA 4LAUA 4XBEL 3TEUA 4RAVB 5TQ2H 2K9UA 3RP1A 4FKEA 3MV8E 5FUOH 1S7SB 3VQLA 1TRIA 1QRKA 1UR3M 3NURA 2CIKA 5A43C 1H2JA 4FHAA 5J6HB 3JZEA 1DR9A 4DPPA 2V5SA 2W65B 3SN6N 1DQDH 3RBSA 2G3FA 5J3HC 1ZKAA 1GYAA 2HVJA 3WH8A 4IMCA 3WLNA 3UXLA 4NZFA 1OTSC 4AEIH 1C08A 3IF1A 4RV3A 3PWJA 1UJTA 2AV1B 4YDLC 4AHOA 5C54A 3I6KB 2FATL 4NB7A 3LSCA 3M0LA 3NIGE 2I5YH 2VDIA 2AXHA 2OQHA 4W9GC 2AXFB 1BZ9A 5IJBC 3SKOA 2OO0A 1XCTA 4J8RB 4P99A 3NJNA 4G8TA 3H3KA 5K9KB 3RWHA 5EEWA 2PDYA 2YCJA 2CIIB 1QPNA 3C2EA 1Q2RA 4MMZB 3VI3B 1NMAH 1AH0A 1X5YA 2IPUG 1KG0A 3ZT5A 1YCSA 5I5MA 5D7JC 4FABH 3C6LD 5IM7A 2G0WA 2QJHA 4L4OA 4DVBA 3MCLL 2EE9A 2J9XA 1IIKA 3TOPA 4CSZA 1I1YA 1P2CA 1NKOA 2B08A 4ODWA 3BFOA 3CZUB 1X5IA 1AW2A 1EPVA 4YTUA 5DC9B 1JCLA 3KL0A 1OY0A 2IAAC 3FEMA 1YRKA 4FQCH 1NQBA 1CDJA 1NFDE 1US2A 5I0DA 3B8SA 5F9DC 2V3DA 4P46A 1QUNB 3Q2NA 5DHYA 3RPDA 3KBVA 4G7EA 2GEQA 1P4LB 3GXFA 25C8H 5DQ9A 4JW3A 5I03A 1LEKA 1G6VK 2XGIA 1XI3A 1FNEB 3QLDA 1VBHA 3G22A 4XD6A 4N4QA 2HJLB 5DA0B 5I0WA 2NY4B 5AFAA 3LI1A 1INQA 1ICPA 1Z2KA 1NSNH 2NUWA 4NILA 1Y5WA 1FO0H 3QUXB 3C2RA 4I48B 2VXQL 4ZTOH 3RY6A 1XG4A 3G6MA 3AUOA 3M0IA 3LKQA 4XMLL 2FSEB 1GKEA 4ZUSA 1OSPL 3EOTH 4AZ5A 4WJ5B 2UZ9A 4DJFA 4WWNA 2CU9A 3CCHB 2GVYA 1MFNA 1OT4A 4PB0H 3W7GA 1AHWA 2DQGL 1A25A 4LPCA 2BP5M 3ZRCC 5DSCB 3QYCA 1KPVB 3QDMA 1AIFB 1LRQA 1SRDA 2CWNA 4IQJA 3VILA 4NZ8A 3TNNA 1QLRB 3O3DA 3ITOA 4XKMA 2WB1A 1AUSL 3EH2A 3HLAA 3MLYL 3KHJA 4LQ1A 4ZFZA 5F6IB 3MDUA 2B2XL 4X6FA 5FW6A 1JPTL 1OP4A 6REQB 1GGBL 1IGCH 1ZJIA 1IM9D 3MVTA 1RIVL 3WZ0E 3GS0A 3H2OA 1SDYA 5LIXX 4X98A 2MOQA 4HG4J 1QI4A 3DVGA 1RUAL 3ARDA 3FQRB 4FLQA 5BW7A 5LXGH 5HVFB 5IR1A 3MREA 4IF2A 5IB1B 4X9SA 1H9VA 1XF0A 2A3BA 1C92A 4HHMA 2NW2B 1GOIA 3IU4H 4FPSA 1YO4A 3E02A 1S7QA 3PUOA 4NT6A 4OZ4A 3QJFA 4HFWA 3OPUA 3RDTB 3SSGA 5JHDB 1BMGA 1S9WB 5F7DB 2NY4C 5AZ0A 5TDNA 4DPRA 4IGBC 3PCYA 4KNUA 1OSPH 3EOTL 3NPZB 1TYJA 4MA8H 4F2EA 2HS6A 2J6EH 3QUZB 5DK0A 2GDQA 3LS9A 32C2B 2DY2A 2ZF9A 4AUBA 2YWYA 4LGRB 1CXFA 2BNQA 2I07A 3U0TA 1GOOA 4L9LA 3LKOA 1DWGM 2QGBA 3O6FC 4FNTA 4MZIA 2BRQA 4OZGB 5E7BA 2CEQA 3UESA 1OX6A 4IPJA 1H61A 2OTWA 2O30A 3ATAA 4RPPA 3AWNA 1H3UA 3LLFA 3ZMNA 5EOCJ 4F33A 2IPTH 2OYLA 1SJAA 5DXXA 3IJLA 2YK1H 4JANB 4LF3A 3F7KA 4R83A 5HJDA 3S3GA 3D2TA 4E9QA 3BG5A 3G6JA 1HF6A 4MWAD 2HH0H 4MXVF 2WLIB 4HK3N 5ANHA 1KPRA 4PB0L 4HJIA 2I9LB 1Z9OA 4QRBA 2K6ZA 3VRLF 4A2GA 1CT8B 1R3YA 4MG4A 3Q2LA 2R4SH 3X12A 3T1FA 4F40A 1GW0A 2EH7H 1XIBA 2BOCB 4HN4A 1ZHBA 2RH9A 4DJED 4L2LA 4DJFD 1FDLL 1S7XB 3C08H 1A6ZA 1SJEA 1YYCA 2WC7A 5FGBC 1E9YB 2A6LA 3W1LA 4KO5A 3BZFA 1EHLL 5CUSL 3S6OA 4ODHL 1DYZA 25C8L 4Z95L 4XVDA 1M7UA 2KQMA 1QWNA 3GRWL 4M5ZH 1BWMA 3LM7A 3WL0A 4O0KA 4MX7A 4XE5B 3H7RA 4XMVA 3FXGA 2F9BT 4WCYH 2B39A 5DJ2A 3T2NH 1VGKA 1OIMA 2MFNA 2BFVL 2CDEB 3BV7A 3V6BR 1LO5B 2O72A 4FN0A 4AF0A 2W07A 1ZSDA 3BDYH 1FG2B 4ZSOA 3CDZB 3OKEA 5T1KB 4D7PA 5C0GB 2EVFA 2NQHA 2FEEI 1EOKA 2XFXB 3VFOB 4XO8A 2QCHA 4MLIA 1U8HB 5D2NC 1C8YA 3LEXA 3IETB 5JUVA 2QEJA 1KFBA 1EOMA 4OOUA 1BD0A 3IK4A 1T7WA 4KAQL 1QBLH 2DYPA 2VDNH 3QXAA 3QNXB 4ZMZA 2DWDB 4AG4L 3HI1B 2YKLL 2E46A 3A47A 3EGJA 3AMKA 1FQ9C 1F3WA 3U4AA 5AVHA 2OWCA 1HP4A 2WCAA 4BHUA 3C0QA 2CYGA 1OADA 5E9DE 4X9FA 3VWKD 5E0KA 1IO4C 3M6YA 4PRTA 5IQ7L 3FSWA 2PGWA 2PXYA 1LJMA 3FFCE 4PFEA 1SBBA 3NRQA 5EMMA 1X5ZA 2HPOA 4UCFA 1A5NC 3NGFA 1FL6A 1TZGL 2WWKT 3VXUA 2FPVA 2PZNA 3VI4A 3M0XA 4I3GA 5B39G 4IIEA 4NAJA 3VOIA 5B7ZA 1V7NH 1KCLA 4BRJA 2OFQA 5EO9B 1INEL 1AO7B 4XBEH 4XC3H 4HUVA 3LB6D 5CGTA 4MRBA 1TTAA 2BIQA 1WFMA 4G80A 4ZOEA 1G0CA 3HPLB 3W75A 2ZXAA 1E9PA 2C3VB 1KWGA 4UT9L 2ZXBA 3S3CB 4YXLL 5IJKA 1JK9A 2F7PA 3FYEB 5JMRA 5DUML 3NDZE 1HK6A 3MYPA 4DM1A 1S7UA 5JW3H 4HZ8A 2CCLA 4IKLA 1SM9A 1HKLH 1UD8A 3CXDH 3W0WA 4OQTL 3T6VA 3HG3A 2BGQA 2LABA 4UWQB 3UL4A 1S7VA 3LTSA 1NMBH 3L9YA 2FFCA 1ZZMA 3BH4A 2IQ9H 3UH8A 2Q8XA 4EJ1C 3AOFA 5SX5H 1CLOH 1ZHNB 1BOGA 4L4TA 1XLDA 2ZADA 1PZUB 3A12A 4KFNA 2DZWA 2VX7A 4HJWA 2OA9A 2JKJA 5D7SH 2Q01A 3H7BA 1YEFH 4GBXA 3VFPA 3S35H 1XBRA 3GKAA 5AFDA 1ETB1 3NA4A 2FBRA 1TJHL 3RI5K 4X4YA 1SYVA 4FG6D 2YSWA 1QRND 4YDKH 4B9KC 2TPSA 3GNOA 3F12B 3HG1A 4DKDC 5KSBA 5D1XE 3WHE0 3ZZQA 4ROQA 2X89A 4X9GA 3CN4A 4FRWA 4N0RA 3C5QA 4ATTA 1QW8A 2Q3XA 2Z6FA 4NUJA 1V0NA 1DJSA 4LCQA 4UOZA 2Z24A 1C93A 4ZS7L 3LQAH 4C4KT 4QG6A 3H8NA 4F0KA 4U3HA 1ODZA 1TYGA 3BIKB 4MJJA 1SFJA 4WTQA 1NFDF 3SDDD 4PJ7F 1UWYA 5AYXA 4C8XA 1WZAA 4YMPA 1XBVA 3HTWA 5J12C 1RQEA 1NUNB 1RZ7L 3CQJA 2BP3A 4U1MA 1M57B 1DORA 3SY6A 2ZUVA 5EBLB 2AJXH 4Y4FD 4AV5A 3R8RA 1VA9A 1PLGL 2I16A 3RPBA 1YEHH 4X7TA 2XSAA 4EPKA 1EJ8A 3MA9L 3M8OL 2WZTA 1BW8A 3QARA 1CLXA 1LQ0A 1U5HA 3NDZA 2DQ6A 4OI9A 1MDAA 4P9ML 1MFMA 3RPIB 5AHMA 3WN5B 1BSIA 5C8JB 3HAEA 3QFJD 4WV1A 3G7TA 3NCMA 5KSUB 2CHOA 3FULA 5GZNA 1PV8A 3FA5A 1FF5A 3H3BC 1VFHA 2E6YA 3E5PA 4IJRA 3TU6A 5E00B 4M7LL 2OO6A 3MRPB 4WWID 5BVPL 4KWSA 1DQKA 4LNYA 4WI9A 4U28A 2MNWA 1GCFA 3RKDC 2R4RH 4KCUA 2F18A 3UY7A 4UR8A 3NXFA 4DX3A 1HKVA 3E2SA 2EBNA 1VB9A 3FRPA 3G24A 3KXFE 3TJHD 4DI9A 1ORQB 3B9AA 1PAZA 2R2HA 2P80A 3P30H 5T5NG 3QFJE 4NNYB 3UFIA 4CKQA 2VC2B 4YHMH 3Q94A 5F8RC 1S2VA 3G9AB 1J9RA 3FO2B 2RFXB 4WNSA 1HW6A 4MA3B 5GGSB 3W7KA 2IWKA 2Y2WA 4XCYA 5K9QG 2VFDA 3V75A 1KXTA 3CT2A 4G6KH 1N64L 3BKCH 4UIOA 5FHAH 3TH3T 3LXBA 3S5LG 4FXKA 4UANA 4ZFOL 2JGQA 3S37H 4FAAB 1GYMA 4W4QA 5JBDA 5B38A 5JQIB 3H70A 3MROA 4IRZA 2HUHA 2J21A 4XSLA 4RBPH 3VMOA 3PWPD 5FECB 4HLJA 1HI6A 3CGTA 4GW5A 1DE5A 2QDWA 4H8WL 5D4HA 2ADGB 4HKZB 7FABL 2CZ5A 4IJBA 3L9RB 3KYAA 4YSDA 3WBDA 1OM3L 5D8ZA 3QZ6A 2WLMA 4FTDA 4GWEA 2IBZY 3LS5H 5HHXH 4BYHA 4YX2H 3ROLB 4CN6A 1WBZB 4R90H 3AUWB 1X5MA 3FT2B 4FQPA 1M03A 3QMTA 1REIA 1T5WA 1WHOA 3ARDC 2NV2A 1O6VA 2WM0A 1HE8A 2PDWA 1IQ8A 3CFTA 1A7NH 2WZHA 4F0RA 5K9CA 1OAYH 3H2NA 3HHSB 1KF9B 1TR7A 3KHQA 5DRNB 4FFYH 1KFWA 1XZ0B 4O12A 1LO0H 1MCOH 4HLZH 3N42B 4PIBA 3UTPE 4F7EB 1E28A 1V03A 3GC4A 5FYJD 5T1DL 2QPSA 3KBHE 1IUZA 2BW4A 3BL3A 3TEYA 2EUXA 3FH7A 4HIPA 3ABKB 3C3NA 4JHUA 2BSDA 1ZS2A 5FC9A 5L2KA 3STFA 2GGIA 3GJEB 2VISB 3WL9B 5IDZA 2WJ7A 2QGDA 1LDCA 1URZA 1QWHA 1YYMH 5LBSH 2WIIA 2C4FU 3G04A 3V5DA 3PWGA 2YQ3A 2WV8A 4NAFA 2EO7A 4QR7A 1PJWA 5E8DH 3SOBH 5C7XH 2ZZ1A 2GYSA 3SIMA 1V6WA 3LKPA 3VXPA 1K70A 5L4MA 1A3RL 4HPHA 5E2JA 5DR5L 2GUYA 5G4EA 4OKVB 5DCDA 3S5NA 1GOMA 4YEFA 3ARFA 3T8QA 3OVPA 4V1YA 4FB7A 2APVA 4F4RA 4GAAA 1NBVL 1AD0A 4DXXA 4KKPA 5FYKL 3K4ZA 1TCRB 3ERPA 4GUIA 4QS5A 3LDBB 1G4RA 4WF7A 4G2DA 5EKYA 3R13A 2X6AA 5BRZB 4B96A 1D5RA 1RVFL 2AEPH 4S39A 1J7VR 3SE4A 4HIHB 5BMFL 4UV4L 3VD4A 3M0YA 4IX0A 1P4CA 4JMNA 4J2QA 2BK8A 3FU7A 2I27N 5DRXA 2W9LA 3J2PA 3O0LA 1OK8A 2GSEA 4DWSB 3NIDF 1YNKH 4OCSL 3TBBA 1C1EH 2H32A 4RDVA 1BFSA 2ATKA 4GYBA 4M24A 3TWYA 1D9KA 1LQSR 1RD6A 2Y7SA 3UJJL 1W1YA 4S0SD 2LAGB 4XMPH 2A6JA 5E1QA 4BDVB 4E42A 2WJFA 4UOQA 3P0YL 4U1NA 2CBJA 1GQKA 2DSZA 3ULUF 5FOOA 3NRFA 5FESA 1L6PA 2OM5A 3LS4H 3MMEB 4XAKD 5AVWB 4HZ6A 2VZ3A 4IIFA 1AJZA 2XQYK 4M51A 1GC1L 3KPRD 3SDXA 3T3PB 1AQ8A 2XXCB 1N70A 5CU9A 5ADPH 5AECA 3SGGA 3WENA 2CJSA 4C4KO 4CMMA 2DLTA 3ATDA 4UQ3B 3UO8B 1H41A 3O9NA 1PDZA 5C2XA 4YUEL 5CEXA 1TVHB 3HNTH 2EPNA 4WGXA 1QWUA 3E6HB 3U1SL 2YD8A 4RGNC 3WQOA 5IHZB 4KHXH 5C70A 5HGBA 2NV1A 3RG6A 4YYCA 4LRNH 1Z32X 3CVHA 4OM1H 1HILB 4EXPX 4J9JA 4MGGA 3MRFB 1ML1A 2RHGA 4D6CA 3D2UD 2VDPB 1XLCA 1CDGA 1AG1O 5IVOA 3PHSA 1Y0LA 2EKSB 4QRAA 3TTSA 4YNGA 3CQPA 3BP4A 3NUKA 3IK2A 4GMSH 4O5LH 4U1KA 1KIRB 1HZHH 3CFDB 2Z6JA 5EUOA 4LNCA 2C9SA 3H0TB 2WHLA 3R0UA 4HJEA 4P7QA 3EGXB 1B6DA 3DBNA 2XKUA 5A8NA 3R8GA 1YKWA 5C2CA 4ISVA 3EB3A 4BH7A 1IBGH 4G6KL 4PJCB 3EX3A 5A8QA 1NCCL 5TJWK 2EDHA 2VR5A 4XBGB 1ZLVH 4G9FD 3FGCB 4J3OD 1J48A 1Q7ZA 2AOSA 3ZIZA 2V2WA 5LCVA 1R9ZA 4ONFH 4LCWA 4AWUA 4Y8EA 4LLYA 6REQA 2CIKB 3MNZB 1GS7A 2AJYH 1KNOA 3MRCB 3QAQA 1TTGA 5C0JA 3DSFL 5AC7A 2FQGA 4PHXA 4H1LG 1Q66A 1MRFL 3MA7B 3I02B 4HSAC 2VLLA 4BGLA 4ZXBC 1I8JA 3K13A 3NIFB 4LSVL 4NRZA 4CN1A 2RJHA 4O00A 1R9XA 2EVIA 3QZOA 4CLMA 3SURA 2ZAIA 3MV9B 4N0YH 3Q43A 4U7SA 1OCNA 1W72B 7CGTA 3CH0A 3UWVA 2YGPA 4U1KB 1SU5A 1JZ2A 1CU4H 3LCFA 2JKLA 3JV5A 4BZYA 3D34A 4PP1C 1J8KA 1LT8A 2YAFA 4K9EH 3EJJX 4HIJA 5CINH 1AZ1A 1KM1A 1RK6A 2BVQB 1VJZA 1X98A 4B5SA 3A13A 4W4OA 2PWUA 4CADB 1SO5A 2H1XA 3BW9A 3QJQB 2D23A 4WEVX 2NY3B 4PCKA 4Y19B 4KESA 4KY1L 4BE5A 3L1EA 2CO2A 4NQED 5ABHA 3N91A 1WS8A 3FFOA 1JZGA 3MOQA 4ZQCA 4LEXH 5D7EA 5DF0A 2J62A 4HGKC 1HKWA 3NMEA 2A9ML 3EF4A 1P7QB 1JGEB 5F7YC 3VGEA 4ZS7H 4NQUA 2Z1SA 1FNSL 4MTMA 2LTQB 4Q4EA 3FJ6A 4N2NA 1R46A 5FCUH 2J1XA 3IMVA 3V0HA 5EMLA 1OX4A 5JPMA 5C71A 2A85A 5DJDA 1WSST 2QQLL 3RAOA 1I7ZB 2PDNA 3EXTA 1XH3A 3EJYD 2JEQA 2OULB 5C09B 2RDTA 1WDAA 5JA9A 4P07A 3NABH 3NCYS 1Z3GL 3F7YB 2E5CA 5DO2C 4HH8A 1NFGA 4L3CB 2CZFA 2HDJA 1FGVH 1TEFA 4GAFB 3MS8A 5IOPA 4X63A 3WDHA 2OTPA 2X4QB 1Z69A 1PNDA 3CL6A 3WLBA 1CFQB 5LSMA 3LK6A 2GITA 4LALA 3MRMA 1BQLL 3HVNA 3WFEH 3C8NA 2VJ8A 1AVAA 3LAFA 4DNHA 3DPDA 1GAFH 1JV2B 1KV3A 2CALA 3LYRA 4JFPA 4CC0A 5C86A 1MXDA 1S7UB 3QY6A 2XFYA 3VQ2C 1RJCA 4PTTB 4KROD 2ACQA 2J8FA 2GHZA 1G9ML 3U5YA 3E1F1 3O8XA 4BM7A 1L4IA 1PX8A 4K3EL 4X4MA 1QHZA 4JICA 4BI5A 2ZCZA 3I7RA 3DRQB 2FK9A 4WUUB 1JWSB 4NZ4A 2Z0BA 5KN5B 5A95A 4MZRA 1P7QD 2ZUUA 1K1DA 1MZHA 4IIQA 3ZDWA 3QQ4B 2XTJD 4KKAD 2GKIA 4L0YA 1PAMA 4QOKE 3SECA 3CUPB 1BKSA 5KYXA 3SPJA 1BEYH 2QJIA 2VEGA 4U1JB 2O5ZL 3CDCA 1MCSA 1TZGH 4MMXA 4QTHA 3ZL4L 2ENQA 3M1BA 2ALRA 1AY1L 2D20A 4FX6M 2BY0A 2BG5A 4NOBA 3TK7A 4AXWB 4U0QB 3TBVB 3E96A 3DWTA 4LDEB 3VU2A 1W9BM 3P4OB 3TYCA 1UGKA 4G6ML 5CCZA 5IQ7H 2WMGA 4D0CA 1F2JA 4YFDB 1LE9B 5GGQH 4L5FH 1VP5A 4RDWA 3WD5L 3V3WA 1KDJA 1HHIA 3QZWG 3C0SA 2HRHA 5EZIH 5HR7A 2AVFA 2EG8A 3G8EA 4FR1A 4GLRI 1R85A 2XFXA 3VFOA 4F15B 3B8TA 1OW0C 1TJ0A 1QBLL 3MV9D 3TF7C 2XM2A 1E90A 3L08A 5I8EA 3BCJA 3T8LA 2BHYA 3MRGB 1QBML 2ZPKL 3FCTA 3IDXL 4PJFA 1LBFA 3KBJA 1TLKA 3MTWA 1E8XA 2K4AA 4D2JA 5AVRB 4PEEA 5C0FA 3MLUL 3W2KA 2FLBT 3BLLA 2GBTA 2WZ0A 4N0FB 3SM0A 1W8OA 4UDTB 2IUZA 4QCIB 3TH6A 5I1JH 2AEQH 4UNLA 1DLHB 1JRCA 2DJLA 4XSMA 4GY7A 3U9IA 3HN8A 3NZHL 3VC6A 3B5HA 3TYUA 1S7XA 3K1DA 5EORL 1S9VA 1SW7A 4EVZA 4P2VA 1BQHB 4A22A 1FY6A 2GVJA 3S47A 3V10A 1BJ1J 3G6DH 3GRWA 4Y4KB 5M2FX 2YD3A 4Q9RL 1QO3A 1EZ2A 4LJ3A 3DZ1A 5AOLA 2VCAA 4YLWA 3FN3A 5DRZB 3MJ8A 4K94L 3C87A 2G75A 4GSXA 3KJ6L 2NY1C 4FGMA 1ETJA 2A0LD 4N9OB 3T3PE 3D5HA 3HJZA 4ZQPA 2I5IA 2G5WA 3QW4B 4PLJC 2EUZA 5GGSA 3V5FA 4Z3JA 4EI5A 1K6WA 1AFVH 1GYLA 1U4FA 2LFGA 2BC4A 3PV6B 5JO5B 1IFRA 4DO5A 2HQAA 4Z0SA 5TK4A 1QRNA 5HDWA 4HK5A 1KKRA 4ZGYA 1OFPA 1F3DH 4IRJB 3LCYA 2JCWA 1T0MA 4JBSA 2GITB 2DT3A 1D6VL 3MSDA 1XCXA 4MSSA 3URAA 4PUDA 4UQIM 3CZLA 1K8CA 4R33A 4J2MA 4L1TA 1T8XA 1OP9A 4XZUA 1AH1A 1WDQA 4Y8DC 3U6RA 4AH2B 1YQVH 2IC2A 2ZKHH 5DHMC 5KSAB 5FO2A 1P43A 3U7BA 1TV5A 1O68A 3GO2A 1E6PA 3DVNA 2ZCKL 1I6NA 3RY4A 3QHMA 2J4WL 1WIPA 3QNZA 3L5WB 1UB5A 3RI5F 3ZYIA 3AZTA 4JREC 4JX5A 2HLFC 5GHWH 3QXUA 1DJNA 4XUGA 5DRIA 4K23L 3FO0H 3VCRA 1KGIA 5EZLA 2Z25A 5EU9A 1QFWM 4W9ZA 4NUGH 1EZUA 2VLMD 2GUUA 3PZ9A 3JV4A 2XFGB 1CN4A 3SCMD 4U0RC 4LDOB 4XP5L 3O9WA 4RDYA 5LIKX 4B92A 3Q6GH 2INEA 3JWNH 4MNJA 1SLVA 1U2HA 3N17A 5GGTL 5E4EC 2NSQA 2R8WA 1CK0L 3QZWB 4PEKA 3N1AA 4NKIH 1MFCL 4JTGA 2J7DA 4XWOC 3QUHA 3BLPX 3B3BA 4BZ1H 2RFGA 5GVJA 1D5XA 4HA4A 3QH3B 4UT6A 5IOPB 4CVUA 1T83C 3PGCB 4J3OC 4IDJH 4OLVL 2PEVA 2NYZA 1GXEA 1TE1A 1FHLA 2GUBA 4FIRA 2DJSA 3SKMA 4YHGA 1FFQA 3VXUB 2W8CA 1GK8A 1O6TA 3ERXA 1VRDA 1XGYL 2BIOA 2QQQA 3R4DA 3UGEA 3EMZA 1EQWA 3F7RA 4LFHD 5I8EB 1ZPLA 4W9TA 3W7HA 3ZL4H 2PR4L 5I1CH 2D69A 3O9WD 2BJML 4QCFA 4IU2A 4U7KA 1FHVA 2GSHA 1HH9A 4PJ9B 2DEWX 4BSWA 5B1AB 4YHYC 4UMBA 2UZPA 5F9OH