3IJ8A

Directed 'in situ' elongation as a strategy to characterize the covalent glycosyl-enzyme catalytic intermediate of human pancreatic a-amylase
Total Genus 180
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
180
sequence length
496
structure length
496
Chain Sequence
EYSPNTQQGRTSIVHLFEWRWVDIALECERYLAPKGFGGVQVSPPNENVAIYNPFRPWWERYQPVSYKLCTRSGNEDEFRNMVTRCNNVGVRIYVDAVINHMCGNAVSAGTSSTCGSYFNPGSRDFPAVPYSGWDFNDGKCKTGSGDIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Directed "in situ" inhibitor elongation as a strategy to structurally characterize the covalent glycosyl-enzyme intermediate of human pancreatic alpha-amylase
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
molecule keywords Pancreatic alpha-amylase
total genus 180
structure length 496
sequence length 496
ec nomenclature ec 3.2.1.1: Alpha-amylase.
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00128 Alpha-amylase Alpha amylase, catalytic domain
A PF02806 Alpha-amylase_C Alpha amylase, C-terminal all-beta domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1180 Mainly Beta Sandwich Immunoglobulin-like Golgi alpha-mannosidase II 3ij8A02
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 3ij8A01
3K4AA 4HZ7A 2BHZA 4UFIA 4CCDA 2YDQA 4AD5A 2DT3A 3L2MA 3CHEA 3FHQA 4J3UA 1AVAA 1GQIA 1JZ3A 4OIFA 3PZVA 4OZOA 4CN6A 1Q6GA 2XM1A 1CIUA 1QOXA 3II1A 2X09A 3VDAA 5A8NA 2D2OA 3N18A 2DEPA 5FCZA 4M24A 5M3WA 5HPCA 4PMVA 5LA2A 2V5CA 3BLKA 3WFZA 4QCFA 1N82A 1DWJM 5LYRA 2Z1KA 3WF3A 1G01A 3H54A 2HVMA 3EMQA 4NF7A 4EE9A 1JG9A 1C91A 4AZCB 1EO7A 3M6DA 1JZ6A 2X2JA 5A6LA 3CHFA 4NSBA 3BUIA 1H11A 2UY2A 4ZE4A 2NT1A 1XCWA 4BQ4A 2G3MA 4TOQA 1WAWA 2PWDA 3AMCA 1KCKA 1GQKA 1NWSA 1E0XA 4AMCA 4H2CA 5D9NA 3M46A 2J25A 2C8NA 5JIPA 1K9EA 2E9MA 2ZUTA 3VIKA 3WMBA 2W62A 5DF0A 1VFFA 2ALWA 4Q7NA 2GVYA 4NRRA 1W1PA 3SCNA 4QLJA 3SEPA 1DWAM 4PMUA 2X2IA 2PI6A 2A3BA 2WW5A 1TQSA 1BVZA 1UZ4A 3QOKA 3ARSA 3EDDA 1LLOA 3D3AA 2EJ1A 3PTKA 4PBGA 4Z2KA 3VD5A 1U33A 2XSAA 1GOMA 3LRKA 3KE0A 2WSKA 5BRPA 2O9RA 4V28A 1DWFM 5AY7A 4OUEA 2FGZA 3VGDA 1GHSA 1G94A 3AXHA 4EANA 1GQLA 3WH9A 5TD4A 3ZR6A 1C7SA 5GNYA 2WMFA 2VR5A 5D4YA 4MNMA 2CBVA 4U2YA 5A2AA 3WF4A 1R7AA 4WSJA 2XN0A 3A22A 4B3KA 2J7CA 3SUUA 5CJ5A 1WZMA 4AIOA 4JCLA 5HNNA 2CBUA 4B9YA 3UR8A 5D9MA 2WZHA 2OWXA 3CLWA 2JEPA 3EJRA 1E15A 1GW1A 4JZ5A 3RDKA 4CKQA 2J8FA 2XGBA 3K46A 3AFBA 1QX1A 3AXIA 3LMYA 4NX0A 3UERA 2ZUNA 3WH5A 5I5RA 2JEQA 1HWWA 4CD4A 2WHKA 1M01A 3BLPX 3HG2A 3MU7A 2WVVB 2VR4A 1ISVA 1JYWA 3VO0A 5CGMA 5DMYA 2D20A 3H53A 3RILA 3AXXA 4U5KA 1J12A 3N11A 4CD7A 1G9HA 1L0PA 1TQWA 2X2YA 3AMDA 4K68A 3BVUA 1C92A 3KL3A 4FNRA 3GXNA 2CESA 1QHOA 4CU6A 1JF6A 4JFVA 3MMWA 3DHUA 1AQ0A 1O7DC 3WDJA 3AIEA 1K9DA 3WQ8A 1JXKA 3BAKA 2WKGA 1WNOA 1GQJA 1OCQA 2JE8A 3VUPA 1EHAA 3M07A 2WCAA 3WQ4A 1UG6A 3WIJA 4AD0A 5C71A 4IPLA 1JXJA 4CVUA 1GVIA 2F18A 4PCTA 4U3AA 3D52A 1J0KA 1GOQA 4D6JA 4JFUA 3S5ZA 3QGVA 1GOWA 3AS2A 3F5KA 1LL7A 3UG3A 1FP9A 1B3WA 1HJVA 1SMDA 1VEOA 2IUZA 1NWUA 2O9OA 1OWQA 3U5UA 2XN1A 1J18A 3WELA 1TQTA 1HF6A 2J75A 3VINA 2DDXA 4MB3A 1UQZA 4PSPA 3MS8A 2ZXQA 3BC9A 5JBDA 3RJXA 4KRUA 4Z2JA 4WKFA 1F4HA 3LXAA 2J8GA 2J4GA 5CXPA 4MAVA 3GXFA 4D1JA 4CN1A 4AMWA 1J0JA 1Q6CA 3KZSA 1JD7A 2OYMA 1R8LA 2VZVA 3SUSA 3L4XA 3BUPA 3DDFA 4AZ6A 1E4NA 1CBGA 1E4MM 4AY1A 2V3DA 1E9LA 1BQCA 4JHZA 5CLTA 4J3WA 5AYBA 1TUXA 4ZEPA 5A6KA 1VEPA 4C7DA 3APGA 3BXWA 2VJXA 1FP8A 1BTCA 4JIEA 2WHMA 3VSTA 1E6SM 3EMZA 4CVWA 1E71M 1IV8A 1PBGA 2WCSA 3WH7A 3AHZA 3I3BA 2J47A 5CLWA 2W63A 3AYSA 4AD1A 4HZ6A 1UWRA 4PTWA 5DO8A 2EPNA 1OB0A 3WN6A 3AMKA 1NOFA 2GJRA 1C7TA 3QR3A 1MWOA 1R87A 3VIOA 2G8ZA 3BAXA 2O9TA 1JDDA 5BROA 3AZSA 3WENA 4HZ8A 2ZUMA 1ZU8A 3VKKA 3TOPA 3ZJ7A 1FHDA 4H41A 2XVNA 3CGTA 3KEHA 2CBJA 4IM4A 1UHVA 1CTNA 4EKJA 1KGUA 2A3AA 1MVYA 4HTYA 2BFGA 1UH2A 4MDOA 1FHLA 5A69A 2DSUA 4GO9A 1WZAA 3S2CA 3MI6A 2F7RA 1WDSA 1NQ6A 3B9EA 3LPFA 3N17A 1MW3A 3QHNA 3CTTA 3S5YA 1R86A 4ZXOA 3ARUA 4AISA 3B9DA 5I3DA 5D9OA 4NZJA 2VRJA 2WBGA 3WD2A 3GTNA 3GXPA 4NRSA 2ZICA 2VZSA 5I78A 3JUGA 2VURA 2ZOXA 3CZJA 2WC3A 4HMDA 4Z2HA 4HMCA 3T2OA 1PEZA 1W9VA 7CGTA 1KFWA 4H8HA 1CLXA 2ZX9A 3A23A 1UWSA 2PBOA 2EQDA 2YKKA 4TTGA 5A8PA 1E70M 2W5FA 1HL9A 3W81A 1KGXA 1V6YA 2FDMA 2VVSA 3WY3A 2Y4SA 4UQAA 2TAAA 1EDGA 3VGFA 2OSWA 4TXEA 2QV4A 3HN3A 5IFTA 4HOZA 3WEZA 3HMCA 4FNPA 1ESWA 3CHCA 2VX6A 4PYSA 4MNLA 2JFEX 2OYKA 2ZXDA 2B31A 1ISXA 2BXZA 1V6VA 1K6AA 1IT0A 1W32A 3N13A 3OGVA 3ALFA 3A4WA 1BYBA 5A6BA 2XJ7A 2WC4A 4W5UA 4BQ3A 3W6LA 4ACYA 1W9XA 4BF7A 3NJ3A 5BCAA 1V3KA 2ZX6A 1OGBA 1UH3A 1DWGM 2EPOA 2XSBA 3BCFA 1FA2A 1JD9A 2XVGA 5HPOA 4LYQA 2F7PA 4LPCA 1TA3A 4AMXA 4GI9A 3HG3A 1LF1A 4HU8A 4UQEA 2BV9A 1FFRA 4UFJA 5A6SA 4MB1A 4MAZA 1ODZA 4WLCA 3WH8A 1HVQA 5E09A 2YLAA 2YA2A 3LPPA 3WDQA 3WUGA 2AMGA 3N1AA 4AD3A 5DT7A 1V0MA 2BY3A 3VSUA 4D6GA 1UOKA 4FNSA 5HDRA 3GDBA 2D73A 1XYFA 2DSZA 5FL1A 1R75A 4Z2IA 3SCUA 3EJUA 3WBAA 4QCEA 5CGTA 2XTKA 4D72A 4V27A 3BVXA 2DSVA 4JKLA 3VVGA 1TQUA 1VBUA 5FOOA 2Z1SA 1M04A 1AQHA 3VGGA 4GZIA 3WMSA 1XC6A 2J7FA 1TZ7A 1UD4A 4P7LA 4FMVA 4AWEA 3GM8A 5AC4A 1VJSA 4GO8A 5BYWA 2WNWA 2VCBA 4JKMA 5M03A 3DC0A 1W91A 1G0CA 5A1AA 2WVTA 3VDHA 5A6MA 3N15A 3VD3A 3WF1A 4J3TA 1UWUA 1LL4A 1BGGA 3BAWA 3WL1A 4XV0A 4W87A 3AIRA 2X1IA 4UR9A 2VOTA 5LA0A 4W8AA 3BVWA 1EDQA 2PF0A 1GVYA 2GSJA 3RPMA 2BS9A 3AHVA 5I0DA 4PN2A 1SFSA 4CD8A 2XYLA 1VB9A 4DWSA 1EGZA 3CH9A 2HISA 1Z32X 1CGWA 2EACA 3PZOA 4WF7A 1JZ2A 4GZEA 1U30A 1KCLA 3WQVA 2X0YA 3W53A 3BGAA 3IK2A 2W61A 4J3SA 1UD3A 1QI2A 3AZTA 1HP5A 4LXFA 1C93A 1Q6EA 3K4DA 2F7QA 1NOWA 4HA4A 1UWTA 2QHAA 1NWRA 1H0GA 4FF5A 1QWUA 3AROA 4MB5A 1XH0A 3PZGA 1NP2A 1OGGA 1WKYA 4P8VA 3IGUA 3KWXA 1BHGA 3AMGA 1B0IA 4AXNA 2YIHA 3MUIA 3WQWA 1VFOA 1QNPA 2V3GA 3H55A 1W9BM 4BCEA 3WD4A 3SCQA 1KBKA 1QI5A 5KZ6A 5ABGA 3ALGA 1NH6A 2UWFA 1XCXA 1RPKA 2G41A 3CZSA 3NDYA 4F9DA 3AICA 5DT5A 1E56A 3VGEA 1A3HA 1EOKA 1R34A 3FW6A 3WY2A 2GDVA 2X2HA 2J62A 4IPNB 3PTMA 1MW0A 4DUXA 3HU7A 3OLIA 3ARQA 4IISA 1MQPA 1I75A 2VZUA 1ISWA 3MUY1 2J7HA 4BS0A 1V6WA 1UKTA 3VIIA 3CC1A 4AZIA 3VM5A 4L4PA 1UYQA 4D1IA 3PTQA 2DT2A 3EDFA 4PMDA 4PTMA 4NZCA 1JAKA 2WHJA 2GK1B 3WBEA 2OWWA 1ZJBA 1B1YA 3NSXA 1XHGA 3BMWA 3GXDA 5I24A 3PZIA 3VNYA 3AIQA 2W66A 3N12A 1OIFA 2Y8VA 3FNDA 4D71A 4DWSD 1HJSA 5CSUA 2XIBA 3SUWA 3W25A 2WWDA 4W8LA 2VRQA 1B3ZA 2EBNA 4ACZA 3VX1A 2XM2A 1SYTA 2WKLA 2WC7A 1VIWA 3WY1A 4OOZA 1QW8A 4S3JA 4LX4A 4AZGA 3W4RA 2WB5A 3ARWA 1J0YA 1WP6A 1JAEA 3LPOA 4OOUA 4PUEA 3F5JA 5EBAA 3MSGA 3AOFA 1IZJA 1EH9A 5M5DA 4UOZA 1JYXA 3HZ3A 4CGTA 1VFUA 3U5YA 1KTBA 1E3XA 1E4IA 4E2OA 1RH9A 3A4XA 4HMEA 4U31A 3DX2A 1E4LA 3DX0A 3ZT6A 4DM1A 3U7VA 3SCVA 2ZWYA 1OD8A 3CZ8A 3UG4A 3DX3A 1C8QA 3BH4A 3A21A 4M1RA 2CITA 3CUGA 3ZOAA 2W92A 4UZSA 4YHGA 4JKKA 4CU8A 1H3GA 4DO5A 3T2QA 5GPRA 2X05A 4QP0A 3AIUA 1CDGA 2XFRA 3DX4A 2W4XA 1AMYA 2ZX8A 1E0WA 4CN4A 2X0HA 4KGLA 3WEOA 1JDCA 4BQ5A 5AC5A 2XWEA 4PMXA 2F2HA 4AZ7A 2GUYA 4Z2LA 3SCWA 1OT2A 1V3JA 1E3ZA 2WK2A 3DHPA 1I1XA 2D3LA 2PC8A 4BQ2A 3K8MA 1WDQA 1DWHM 5D8ZA 2J7EA 3TTOA 1LL6A 4PUDA 4B3LA 1V3MA 1E72M 4ACZB 2E4TA 3EDEA 2CYGA 3SCRA 4M82A 4JCMA 3LX9A 2CNCA 3L4ZA 1TG7A 4PRWA 3T09A 2FHFA 4JAWA 2BVYA 1QPKA 2W67A 4JFWA 3L2LA 3TTQA 2ZE0A 3BVVA 4GI8A 1P6WA 3VIHA 4JFTA 3L4VA 4BZYA 3SIMA 3BUBA 1ISYA 5ABFB 2VTFA 2CKRA 1JZ5A 3RIKA 4Q22A 2WLYA 1DHKA 2BXYA 2VMFA 3BAIA 2C0HA 1TVPA 2DT0A 4XUYA 4FLRA 3LRLA 2E0PA 3AI0A 2AOSA 4U3CA 5EB8A 1CXHA 5BXPA 2XFYA 5FL0A 5ECUA 4ATDA 4EAMA 3A3HA 5E9AA 1B9ZA 3SCOA 1JFHA 2VT0A 4M56A 2V38A 2GFTA 3VDBA 1VFMA 2BHYA 3VX0A 1EQPA 2CIPA 5FD0A 2J7DA 3GXIA 3QHOA 3F5LA 2V5DA 1DWIM 4L4OA 4F8XA 3CMJA 3HJEA 2YDSA 4BA0A 2XHYA 3ARXA 1UR0A 4W7UA 3ZSTA 4X0NA 2EABA 1HJXA 3OLGA 3AS0A 3MV01 4PSRA 4GIAA 3MMDA 1WDRA 3VMOA 2ZX5A 2ZXBA 3RO8A 4TTUA 3MSDA 1XSKA 2D0HA 3PZMA 3EJQA 1KXTA 5E6YA 3T2PA 2EAEA 3CO4A 4XX6A 3OIHA 3AIBA 3FHAA 4YHEA 4UOJA 4UFMA 2G3NA 1H41A 3EDJA 1BG4A 3U57A 2ZUSA 3BMVA 1HTYA 3QOMA 2G4FA 1NM9A 1B2YA 4ZENA 2J78A 1V6UA 3O2LA 3PBGA 2DH2A 3L4WA 4QLLA 1R46A 1CXFA 3W24A 3W26A 3NCOA 3WNKA 4DM2A 3PZNA 1OINA 2F1AA 1XD0A 1WO2A 1ZJAA 1PJ9A 1CXIA 2F1BA 5A94A 5CG0A 1CYGA 6TAAA 3KLLA 3AQUA 4FNQA 2XWDA 2F7OA 4W8BA 3GXMA 1H09A 3VD9A 3VM7A 3OLDA 3RCNA 3VIGA 1W3LA 4N0RA 3SUTA 3OBAA 1BLIA 4LYPA 2E40A 3GH5A 2WSPA 5IXEA 1CZ1A 3D51A 5AYIA 1UR9A 1YQ2A 9CGTA 1ZB5A 4W86A 3DDGA 4W7WA 4R27A 3WDHA 1KXHA 3FAWA 2IXVA 1MXDA 1PPIA 3PZ9A 2XG9A 5E6ZA 4P7QA 1EOMA 2QMJA 5D8WA 4OKDA 1QW9A 5EFDA 4KWUA 4W7VA 3L4YA 3A47A 1SZNA 1CXKA 4PMYA 1YHTA 1Q6FA 3NUKA 3OLEA 3PZUA 1U2YA 5I79A 1V6XA 2YL8A 1GZJA 1UKSA 3POCA 3A6OA 4YN5A 2YL9A 1ZBVA 4HOXA 1VJZA 3WD3A 1JGIA 1V3HA 1KWKA 1HX0A 3OGRA 4H8UA 1ECEA 2E9LA 5EFFA 3OA5A 2E8ZA 1MFUA 3IJ7A 1E6RA 5A2BA 2PWEA 2VO5A 1E1EA 1WDPA 1PZ2A 1HN1A 1W3JA 4AZCA 3TTSA 4RL3A 3CV5A 1CXLA 3VD4A 3LPGA 2WVVA 4MTVA 2J7GA 2QLYA 2RGLA 5A6AA 3AIWA 1ZL1A 2E3ZA 2CHOA 3OG2A 4B9ZA 1V02A 4LYRA 3WUBA 3WD1A 1JYNA 1J0ZA 4WKHA 4UQCA 3D50A 3WMCA 2BY1A 4KRTA 1OM0A 2YLLA 1F4AA 4AW7A 1UWIA 1HJWA 2GK1A 1XRVA 4TVUA 3ARRA 1X1NA 4CCCA 1CECA 3VNZA 3BUQA 3CIVA 1O6IA 1WZLA 1CGYA 4WIWA 1QHZA 2V3EA 1CEOA 3BCDA 2IXUA 1VENA 2WMJA 4UCFA 3ARYA 4PMRA 4ZE5A 2BHUA 2CEQA 2YBTA 2JF7A 4P8WA 3J7HA 2WAGA 2A3EA 5A2CA 4D6EA 1XYZA 4M80A 1UASA 6CGTA 3AYRA 3WD0A 2Q8XA 3VOCA 3WUFA 1CGVA 2G3IA 2CPUA 1GJUA 2WVSA 2VI0A 1V02E 3W37A 1KBBA 5BXRA 4NI3A 2F61A 4HOWA 1KXQA 3CPUA 2DH3A 5C70A 1ODUA 5HBFA 2WWCA 4WKAA 3DYPA 1RP8A 5ABFA 5BWFA 1W2VA 2PB1A 1UR1A 2D23A 4HPHA 3GXTA 3I3DA 3LXCA 3W27A 2Y5EA 4QLKA 1BF2A 4JL2A 1R85A 2FGLA 1US2A 1JYVA 4QDMA 2XVKA 4WJXA 2YFOA 2G3JA 4AZBA 4DWSB 5GNZA 3WNNA 3T0BA 2J79A 4AEFA 3LRMA 3WNLA 2YOCA 1BAGA 1QI4A 4TVDA 5E70A 1E6XM 1KR0A 4WK9A 3W0KA 1KTCA 1WE5A 1RD6A 2ZXAA 1H49A 4UFKA 3THCA 1PAMA 3K8KA 2YFNA 1NARA 1KQYA 1JNDA 4MPKA 5BXSA 4MADA 4AYSA 1PX3A 1HL8A 3WF0A 4HA3A 3ZJ8A 1OBAA 4JHOA 3GYCA 4M29A 1XSJA 3BLBA 2JIEA 4P7NA 1ITCA 4QAWA 1BFNA 3OZPA 3CUJA 4OGZA 3NSNA 4U2ZA 4P7OA 1PIFA 3CHDA 1DEDA 1B3XA 4OBRA 1OT1A 6A3HA 5BRQA 5FIPA 1UR8A 1M7XA 4H8VA 4PMNA 3VGBA 3THDA 3UG5A 4PMOA 3T0DA 2VNCA 1PIGA 1KR1A 4UFLA 2WYSA 5A3HA 3A4AA 2FYVA 2UY4A 1B3YA 4KGJA 4UQ9A 3RJYA 5GNXA 2DGAA 2WMIB 1LWJA 2ZIDA 3MMUA 1LG2A 3ARTA 1H4PA 3WNMA 1X6NA 1J9YA 4PMQA 2XPKA 1BSIA 3ZIZA 1D7FA 1TMQA 1EQCA 1CWYA 4E4PA 3VU2A 1T0OA 1W9PA 4A3HA 1UD2A 2WBKA 3I3EA 2WM0A 2WHLA 4FK9A 4AYGA 2ZX7A 1C8YA 4R5EA 3GBEA 3AHYA 2BY0A 1JIBA 2MANA 1B30A 4RE4A 1GORA 2QPUA 2VQUA 4FLSA 1GOKA 1SMAA 4H7VA 3D4ZA 2EPKX 1E6ZA 1GHRA 1ISZA 4U5IA 3EDKA 3K1DA 3VIPA 1FH9A 2BVTA 1NOUA 1GJWA 3IJ9A 4HU0A 1QI3A 2ZUVA 3NYDA 4URIA 3SURA 4DO4A 4GPNA 2AAAA 1PZ3A 1BGAA 1CLVA 3DECA 2A3CA 4J3XA 3CUIA 3WKZA 1NWTA 4F9JA 4MJ4A 5M17A 1XV8A 3TP4A 1UKOA 1XH2A 1E55A 3VIJA 2D22A 3PN8A 4W93A 1UWQA 3TV8A 4OBSA 3ZQ9A 4DUVA 1XGZA 2PWFA 4FLQA 2WANA 3FN9A 4GQRA 4AEEA 4HA1A 1D2KA 3WH6A 1NP0A 4ATLA 3ECQA 3KL5A 2CHNA 2PWGA 3WQ6A 3WNOA 4TUFA 3VGHA 1KQZA 2VX5A 2D0GA 1LJYA 1QBAA 3PHAA 1GNXA 5JBEA 1V0NA 3OGSA 3L4TA 5CZKA 1MXGA 1E5JA 2UY3A 1UD5A 2C7FA 1H5VA 3LXBA 5CPTA 1AQMA 3RM9A 1CXEA 3B9AA 1JI1A 1E5NA 4F79A 2JF6A 1UD8A 4P7RA 1HIZA 3O9NA 3K8LA 1KB3A 1QNQA 1WB0A 1UKPA 2E9BA 5ABHA 1EDTA 3CUHA 3BAJA 3WY4A 3BAYA 1HJUA 5E0CA 2OW7A 2NW0A 1WPCA 4HP5A 2DPEA 5I6SA 2VCAA 4D6HA 2W91A 3WNPA 1QWNA 3ZMRA 3ZJ6A 3G6MA 4GXPA 4PEEA 3UR7A 4CD6A 3WDIA 3AHXA 2JIWA 4TX6A 2VZTA 3ARVA 4YPJA 3W82A 3GH4A 3W28A 4AIEA 3WF2A 4M8UA 4PTXA 2PWHA 1H1NA 3SCTA 2F8QA 1JI2A 1CPUA 1HKIA 2VZOA 3MV11 1JF5A 1W9UA 1H2JA 3VDCA 4AIUA 2E8YA 3HG5A 2XVLA 3S6TA 2FE0A 4W5ZA 3QHMA 3NSMA 1MW2A 2CCRA 4C7FA 3NDZA 3KLKA 2WVUA 4RE3A 5HOSA 2WZEA 1J0HA 2DT1A 2ZUUA 4J3VA 3FXYA 1XD1A 3T0AA 3UETA 4MNKA 1HVXA 2YDRA 1EHNA 3UESA 2O9PA 2VCCA 3MUZ1 4Z2GA 1FH8A 3GZAA 4AD2A 2XFFA 3CUFA 2BNJA 1UH4A 2CKSA 1HXKA 3DYMA 4XB3A 5FKYA 3CZKA 7A3HA 3VMPA 1MYRA 2VUYA 2XUCA 1O7AA 5IDIA 5HXMA 3VD7A 3FAXA 1X6LA 4TVCA 4PTVA 1C90A 4D6FA 2OSXA 1LWHA 4UTFA 4JFSA 1HJQA 3WEMA 3SCSA 4AC1X 3WDRA 1UD6A 4NXKA 3VMNA 5A8QA 4U33A 2DSKA 3UEQA 1Q6DA 3GBDA 2NSXA 2WMKA 4ZFMA 1UA3A 3EMCA 2ZWZA 4M81A 4UNIA 1XSIA 3OB8A 3ZT5A 3F4VA 4B16A 1ZBWA 4DWSC 2CETA 4XZWA 4ATWA 2WZIA 1VAHA 2DIEA 1E6NA 3AZRA 5A6JA 2JALA 3N04A 1HP4A 1BG9A 2EEXA 1TFVA 2PBGA 2OWCA 1W2PA 4PMZA 1D3CA 5A95A 1UKQA 1VEMA 5GQBA 1HKJA 7TAAA 2CBIA 4HPGA 1BYCA 3CMGA 1HXJA 1DTUA 1V08A 3EJPA 3WQ5A 1M03A 3L4UA 3SUVA 4X0VA 1JL8A 3M7SA 3FY1A 3ZJKA 4GQQA 2EO7A 5A8MA 1MFVA 1W1YA 1UA7A 1BPLB 2NT0A 2CERA 4MDPA 3WL0A 1K9TA 1BVNP 3CZNA 4IUGA 1R7OA 1TE1A 1QVBA 5JUVA 2WMIA 4RE2A 5A8OA 3GNRA 2V3FA 3ZSSA 3VIMA 5IFPA 1V3IA 5CSYA 3UCQA 1FH7A 1QNOA 1E0VA 4UFHA 2FHCA 1JDAA 3BUDA 3PZTA 3AS1A 3WSUA 1UUQA 5E1QA 4NZFA 1GPFA 5IHSA 1EXPA 1EO5A 1FOBA 2EADA 1L8NA 1I1WA 3BSHA 4LQ1A 2UY5A 3BSGA 4CUCA 2OYLA 1A47A 3IAQA 1V03A 2WMHA 4NXSA 3POHA 2O92A 2Y8KA 3CZEA 4AZHA 3B8SA 1JZ7A 1E73M 2A3HA 2OLHA 3BVTA 2QMKA 3EBVA 4CU7A 4EK7A 1W3KA 1PS3A 2ESCA 3CZLA 1VF8A 1V3LA 1HKKA 3VILA 1E40A 1DP0A 4GI6A 1TA3B 3MO4A 4W89A 3WFLA 2OW6A 1W3HA 2WLZA 4PCSA 3ZM8A 3HG4A 1J11A 1SR0A 2EXOA 1CGXA 1C3FA 1ZS2A 2FHBA 1QNSA 1KWGA 1RP9A 2D1ZA 4DUWA 2VRKA 4X9YA 3ARPA 5A6BD 2XVPA 1FFQA 1JZ8A 3IJ8A 3AS3A 3NIYA 4QFUA 5I2UA 2WPGA 4MNJA 1TQVA 1TVNA 3A5VA 1B90A 3ZR5A 4GZJA 3CZGA 1LQ0A 3O6AA 1G1YA 2VC9A 5I77A 3N9KA 2WMGA 2EPLX 1GUVA 1J0IA 5KEZA 3GNOA 1GONA 8CGTA 3TTYA 3OZOA 4MJ2A 5JBFA 1J10A 3AIVA 4KH2A 5C8BB 3ARZA 3CBWA 2X8RA 4CD5A 2FH6A 4FNUA 1JFXA 3W6MA 1E1FA 2CXGA 2VL4A 1US3A 2YA0A 3SCPA 1OD0A 3MANA 5D9PA 2ZUWA 2YL5A 3DX1A 5E0FA 3KL0A 1UR4A 3MUAA 2OSYA 1BYAA 1Q4NX 3D4YA 1E43A 1EA9C 1HT6A 1J01A 4D6IA 1OGSA 3TA9A 3E1F1 3WDPP 2BY2A 1Y7VA 5EMYA 4JL1A 2J74A 2XN2A 2YBUA 1PX8A 1TR1A 4P8UA 4J28A 1QBBA 1CENA 4ML4A 2Y24A 4AZ5A 3T08A 1PX4A 1TCMA 1UR2A 2DIJA 1CNVA 3W29A 4A4AA 2XIIA 2YA1A 4WSKA 1MW1A 1HKMA 2GJXA 1IZKA 4W85A 5BXTA 1E6QM 3AJ7A 2YL6A 1MQRA 1W1VA 4F66A 3U7BA 4E8DA 1S46A 3IANA 3EJTA 4UOQA 5DFAA 3W38A 4S3KA 3AISA 4W84A 3G6LA 1B31A 4DO6A 5LA1A 1K9FA 3VSVA 1UZ1A 5CPSA 4J7RA 2DQXA 2EPMX 4P8XA 1C8XA 3DYOA 1M53A 4XZBA 1QHPA 2VX4A 3GNPA 5CQ1A 3RMEA 5ABEA 2VX7A 4LGXA 2J77A 3VPLA 1W9DM 1OIMA 2RGMA 4AD4A 3ZT7A 4FLOA 1MQQA 2FH8A 5DEZA 5F7UA 1W1TA 3EYPA 3WUEA 3MKKA 2DSWA 4D6DA 1VBRA 4GKLA 4C7GA 2VQTA 1XH1A 5I23A 4A3YA 3VIFA 2GDUA 2GJPA 4N42A 1KXVA 1R47A 1H0IA 3AHTA 4UQDA 4H04A 4GINA 3TONA 3D5HA 1HNYA 4CCEA 1BYDA 1EIBA 5JIWA 1ZBCA 4MB4A 4UZUA 1B3VA 1ITXA 1JNEA 4E8CA 1CGTA 1V0LA 1GCYA 2WXDM 1UQYA 1GOOA 1ZBKA 2WCGA 1V0KA 2D3NA 4OJYA 1QNRA 1LG1A 2D24A 3GH7A 4V2XA 2QPSA 2VVNA 4Y7EA 2QF8A 3RM4A 3A24A 1E6PA 4D6CA 3IAPA 1OSEA 3AMLA 1R33A 4KMQA 2YJQA 4J27A 3PZQA 2XGIA 8A3HA 2D0FA 4UQBA 1WZKA 1GOIA 1JZ4A 3RM8A 1VRXA 4W88A 4FNTA 4B15A 1QI0A 1WCGA 2Y2WA 5IHRA 2IGTA 1CGUA 1KGWA 5CPQA 3EJSA 1G5AA 3VTRA 4TX8A 3ZO9A 2GJXB 2J7BA 2BVDA 4ZXLA
chains in the Genus database with same CATH superfamily
2IBZX 1S7WB 3ELAT 3RKDD 1M1XA 2G4EA 5T5FA 2ZRYA 2BHZA 4IJRA 3UP1A 1GC1L 1DSWA 2OR9H 1NCWL 2E46A 3CE1A 4KHXL 3MUUA 2O6FA 2IBGA 2YQGA 5DUBA 4YN3A 5I1GL 4PQXA 2DT3A 1T6BX 1MJ8L 3RN6A 4JPWH 2HWZH 3EXSA 3L48A 3W1PA 1AVAA 3B2VL 1KM6A 1CVRA 3MJWA 4NUMA 8FABA 1E4XH 2YKLL 2W1NA 4PG2C 4J35A 1P1ZA 4OIFA 5SWSB 3Q43A 2HA1A 4F2MB 3CH0A 3KCPB 3MSRA 3V5KA 1FCCA 3ARFB 3V4VL 3GNNA 1F4WL 1A0QH 4NU7A 4QE1A 2QSCL 2X30A 1UWGH 5I76A 4A8RA 1CIUA 3QEHA 2BOBB 4IF2A 4LIQL 3S37L 3II1A 1U93A 3V0SA 3PUCA 1PB0A 4U1IA 5A8NA 4N2AA 2X6MA 5ECGA 3CYJA 1E27A 4HT3A 5CPSA 4NN5C 3N18A 1JPST 3RTQC 4U1IB 3FU5A 5A6IA 2PTUA 3RU8X 5FCZA 4OIBA 1BFOA 2E7LA 5HPCA 1JHKL 7PCYA 1E2ZA 1BJMA 4XNQB 3L1OL 1AD4A 4YSUA 4PMVA 3OF6D 1MFAH 2DI8A 1GRWA 2VIRB 4OAWB 4QCFA 3VFUB 5CFHA 4TYUA 3AM8A 4EI5A 2ZCLH 3HHSA 2LV4A 1KXQE 1ME7A 1MWAH 1CT5A 3D08A 3H54A 4HIXL 4KVPA 2HVMA 3RXZA 4PV8A 5FHAH 3Q8BA 4DN3L 4M9PA 4NF7A 3EH2A 3GRWH 3WI9A 5HHOE 4MA3A 4A2GA 1FO0L 2QVKA 5HTSA 4DERA 1C91A 2Q3XA 5JQ6H 5HR7A 1EO7A 4HKJA 4ODSH 3M6DA 5FYKD 5A6LA 3LQAH 1NDYA 4CNSA 4NSBA 2HLAB 4XZ4A 4KERA 4PUMA 4OM1L 3U2ZA 4LCUB 1H11A 4JQ1A 3LM3A 2EIJB 1TJXA 3W9EB 5JYLA 4WDTA 2NT1A 4MD4A 5J4MA 5JMUA 3BD3A 1OAXL 3G1DA 2A2IA 3S8FB 1M68A 1N9PA 1VFAA 2G3MA 5C09E 3V6BR 2XWTA 4CA4A 3IDNA 4Q9CA 4ONGL 4PLKC 1MAJA 1SHWA 1WHOA 3GKFA 4M61B 1R5IB 3HC0A 4YIQA 1RR2A 3HB3B 4PTDA 3UVIA 5RUBA 5KUMA 5MI0B 1TCDA 1PG7L 2DORA 4PJBB 5GGTA 1HI6A 1WUNT 3P30H 4RWYH 4IP5A 1JPSH 1NFAA 2QCNA 3URBA 3E3QE 3K0YA 3M46A 2J25A 3K80A 4AI7A 1LRNA 5D93B 1N7KA 2AV1B 5E6SB 2C8NA 1F76A 3RGVC 5JIPA 1EJ6A 4WWOA 4AL8H 1TO3A 4WUUB 3WMBA 1RZJL 3MRMB 3L68A 1UM6H 5I1CL 2ACUA 1OT4A 1F6PA 2W62A 5LLIC 2ALWA 3QQ3B 3IM1A 3GK0A 3LBMA 1T40A 2XZCL 1VKXB 4MA7H 1R0MA 1JNLL 3HZYA 1H61A 3KS5A 4S1QL 5I30L 3MNZA 3FVDA 4R3SB 1DWAM 3S3PA 4PMUA 2A3BA 2WW5A 32C2B 1I3VA 3ARSA 1I31A 5C54A 2W65B 1P7KA 4AGLA 4NQVB 4X6DB 1PBYA 2GABA 5INCB 1A3RL 5T33H 3WJMA 2DJMA 1I7ZA 1Q45A 1FGNL 3L95B 1SUJA 4YL9A 4INFA 5GVJA 2WZTA 4FFZA 1MNUH 2HT2C 5KBMA 2E7LC 3VD5A 3LZFL 2F53B 3F5WB 4C6BA 2QSTA 5AL0A 5F7DA 3H21A 1GOMA 3W2DL 3U2CA 1U3HD 3FJ6A 3MRJA 1IB5A 3KE0A 4JR9L 5KS9F 1QSFD 2I32A 3PAVA 3QORB 3AT0A 1OE3A 3ZKMC 5IQMA 1YBQA 2O9RA 4GH1A 4V28A 4AG0A 4ORGB 1YEJH 1WICA 2H0EA 1K8IA 1SJMA 3VGDA 4O4YL 3KVQA 4MQTB 1RVKA 4X8GA 3DOPA 4BH7A 3H2EA 4L6OA 5FSEC 4HZ6A 1ZLWK 3NK3A 2WMFA 2VC2H 2EUWA 4JY9A 5GSVA 5D4YA 2EDEA 2Y23A 4JE4B 3AFLA 3ZE0E 4NNCA 1JNHB 1RJYB 5ICZA 1PLCA 1BZEA 3FU7B 3OJVC 1B6UA 4MNQB 3PP7A 4FXGB 4H8WC 2JKWA 2K70A 2CBVA 3UXAA 1QACA 3ELFA 1YJDH 5DUML 3FQNB 2H6PA 4JM2C 4K1WA 3VNJA 3DFYA 5FFOA 4J3OF 3TYDA 4H7CA 4RMWA 1BXVA 3ZBMA 3S2MA 1O6VA 2QADC 3T8QA 4XGZA 3WF4A 1R7AA 4IPJA 4KKLD 2H2SD 3QDGD 1SF3A 3L21A 2DBLL 4Z3FA 2NX5A 5INDA 1EWHA 4EKXA 4Z7WF 3ISYA 5C08E 4X8JA 2IWKA 1GTFA 2P8LA 1U8MB 1DJQA 4KKCD 4RGNB 3L3DA 4ZMPA 2DQHL 4P9ML 3QUZC 1SDAB 4DPPA 2YGNA 5E23A 4YVUA 1S7TA 2F8XC 3VAVA 3LSOA 4LSQL 2KZKA 3DTDA 3C6SA 4EQ2A 4IEFA 5HNNA 1JK9A 1U3JA 4E9TA 1BEYH 3T3PB 5BOJA 5D9MA 3PV7A 2OCZA 4N4QA 4MUPA 2D31B 2GITB 1N8FA 4LB3A 5C7HA 3BX7C 1IM9A 2WGXA 2G0WA 4RDZA 3RDKA 1NFIA 3QQ4B 4ES9A 4CKQA 3K46A 2J8FA 2XGBA 2XZQH 3P69A 4CNOA 1GQNA 3AXIA 1FZKA 4NX0A 3UCRA 5DEGA 3ZK0A 3KGUA 1RZKC 2YUXA 4OF7A 4WEBH 2JEQA 4DEPB 3EA1A 3GK8L 5I0ZA 2EH8H 2DZXA 5HJLA 3ARDC 3FIGA 2ODHA 7FABH 3RJDA 1O66A 4OZHB 1WKEA 1SY6H 2VR6A 4WTXA 2VDKB 5C0CB 1M01A 1S9WA 3HPLB 4QXGH 2C4FT 5IF0A 2WWNA 3PV6B 5AG8A 2QUTA 2Z2BA 4ABQA 3JTSA 5I19H 1ZGLP 1AW1A 3MU7A 4Q4MA 4BFGA 2NSMA 5FA4B 4U6YA 3QDMA 4N0UE 3UGXA 2Z00A 4ROQA 3HTWA 5KINA 4YE4H 4HKPA 4UBPC 5TAOA 4H1LA 5DVOA 5KVDL 1JZEA 2WN3A 4Q7BA 4FABH 1O12A 1R2TA 4HHLA 2X4SB 3FF8A 4PP1D 2C3XA 2HMCA 4Q4KA 4K8RD 3R4IA 3N11A 1NFPA 3T3MF 3BP4A 1G9HA 1L0PA 1TQWA 3MNZB 3PNWA 4B9KC 1YNYA 3KRSA 5EU7E 4IGSA 1PU0A 3ZRCC 3GXNA 1S5TA 3RVVC 4QJ1A 2ENYA 4LZKA 1DFXA 4HXAL 1ZLUK 5DJ8B 3KS6A 3GT6A 4NAFA 3TMLA 1JF6A 4JFVA 5GHWH 3U0WH 3QSTA 4B7IA 1YEEH 3WE1A 1WD9A 1FRBA 5AQ0A 1K9DA 1RZ7H 1X39A 4BCZA 4V33A 3BAKA 3LTVA 5GSRA 1WUZA 3NESA 3QUMA 5AVVB 3RURA 4PG9A 4H25B 4GEIA 5KW9L 3WXVH 4GXUN 2WCAA 4WXYA 4P4RB 4XP1H 4Q8OA 5CR8A 1UG6A 3BPNC 2W0FB 3C9NB 4RAHA 1BIIB 1NUDA 3FUJA 4OH2A 1Q85A 2HEJA 1A2YB 3A4DA 1QBLH 1RI8A 1WQVT 2DQMA 2HWZL 3DVNB 3N44B 2GC4C 4I77L 3UBXG 4M00A 4PLJC 2XQ0A 3VVVA 1LO0L 4F7TA 1YW1A 1U3ZA 4KIEA 3CAWA 1C9DA 4K39A 3HHRB 4ALDA 4L9ZA 3BYTA 2HPIA 3REQA 5H1WA 3B7TA 3F6LA 2IW0A 3QTPA 5HJBA 3WTXA 4HMNA 5BOFA 4QTHA 1GOWA 1WAEA 3MXVH 2PTVA 3F5KA 3Q4DA 2O0TA 4AM0B 4AK2A 3LN5B 3GPSA 5EFIB 1B3WA 4HZMA 1S9VB 5AWNL 1OEPA 3DPDA 4DSYA 3RFZA 4HS3A 3L5LA 3R1GH 1OWQA 3GMRB 4ZUTB 5DQ9A 4IOIA 1FFOA 4JKPL 1CO1A 1HF6A 2J75A 3TFKD 5DJCA 2CLHA 4HTBA 4MB3A 1MCDA 4YZWA 2Q9OA 3A6CH 3ABSA 1DIDA 1L6GA 3BC9A 2X89D 3GPEA 4Z2JA 4KRUA 1PCKA 1J5HA 4JYDA 4AM0Q 5CGYD 5DY2A 4M1BA 4KJWC 1CDHA 4FQHA 4PTTB 4XBEL 5GIRB 3CZFB 2HROA 5H8UA 1T2JA 3D0LB 4MAVA 3R0MA 3T65B 3LH2L 2P80D 1JK9B 4O53A 4XCNB 1OAJA 1IQWH 1UB6A 1DUYB 3NFNA 4WZ9A 1KJ2A 4G5ZL 5CZVH 4IOFC 1JD7A 5DR5H 4QJ3B 3LZRA 1AXTH 4LDCA 4N25A 4CBPA 5JOPD 1SLWA 1QWKA 35C8H 4YHIB 4DKEL 3QDGA 1YDOA 4AZ6A 3OB0K 4IQHA 3RB7A 2NZIA 1E9LA 5IBXC 3MRLB 1A4AA 5CLTA 5KZCB 1A3LH 2JJUA 3G0SA 5J9PA 3UTZA 2GWNA 3OZ9L 3L6FA 4IKJA 1KELH 4IDJL 3ALPA 5CINH 4I90A 3WNIA 4BHUA 3ATDA 2X0SA 3HGRA 1SLUA 2V7HA 2VJXA 2Z4QB 1X96A 4FXJA 2YOAA 3TBWB 1FP8A 1BXXA 1BTCA 3AG2B 3NEOA 1DDTA 2P10A 1CGSH 5E08L 4C90A 2EYTA 5EUKA 4WDIA 4UTTC 3TBVA 3WJZA 1CYXA 4CVWA 1E71M 4UB0H 3PPHA 3WH7A 1NSNL 1A4KA 5JLZA 3AHZA 4PUUA 2JI1A 1GTNA 2J47A 5I1JH 3NMEA 3OJGA 4YHNA 3QKZA 3D25B 3RKPA 1HKLH 5E1AB 4AD1A 1EFXD 1XZWA 5DO8A 4YHNB 2VXUH 1QSZA 3RIAF 5E9DA 4I0PB 3TZVB 4NM4H 2X4NB 1FWIC 4NENA 1NBYB 1C7TA 2GI0A 4DQOL 4I5BB 2QV5A 3NFUA 1ES0B 3IXAA 4HQVA 5DSCB 2Y1VA 1U83A 1NJ9B 2A6NA 1LP6A 2CZDA 4JN7A 1XB3A 2VM4A 1MSPA 3DURA 4MMZB 4UM9D 4XOBA 3WENA 4A63A 4MVBC 4F5CA 1KNWA 1WDDA 1WXZA 4I0PD 3S35H 4MAYD 5F9JA 5HGAA 1ZU8A 3FSUA 3VKKA 4FRWA 2CLOA 1KBWA 5EBWA 1JQVA 5K3VA 1RUSA 4KDWA 1LP9F 3ULVH 5A7EA 5EB9A 2GQHA 5D1ZC 3L9CA 3HMXL 3DSFH 4FJYA 4JDBA 4XZWA 1Q8AA 3B4UA 3FT3B 1OWRM 3CVDA 2GHWB 3PY2A 2YQ3A 4N0YH 3T8XB 4IBLT 3MNWA 2BVUA 4HC1A 2P76A 2QCCA 4MWAC 1RJPA 3G1XA 3SY5A 4XSLA 3XISA 4S1DD 1ONEA 3GE7A 4OCXL 4C47A 3B6SB 2Q3ZA 5F21B 1UXSB 1F3RB 1ZMYA 3RZWA 2ZYFA 3S2CA 4EI6A 1R3QA 4IHCA 4JQXA 1ZV9A 2J71A 2MNWA 1LT8A 2WLNA 2E27L 3HPZA 1CDCA 5FPIA 4GUHA 4JIRA 4R9XA 1RULH 2PETA 2VDPL 2AKRA 4NKIL 3S5YA 1TCRA 1NF7A 2P8MB 1N19A 5HGHA 3MZNA 3NG3A 1THAA 1O9VA 5KYWB 3ULUE 3ORJA 1R86A 3STGA 2WYZA 1DO5A 1EP1A 3ARUA 1BQ5A 4JVUA 1IU1A 2YPKA 2PLCA 5AVRB 3ZUCA 3ERXA 3RU6A 3HBLA 3JSSA 2CDFA 3MJ8B 4QRTA 1MI5E 4HKXA 2WWMC 3C60D 2YPKB 5AW2B 1ZHAA 1UVQA 5F0JB 2WBGA 2C9SA 3QAQA 3UO1L 1CLYL 5F7FA 3FH7A 5D2LE 1G43A 5MEND 4L5ZA 5T1JA 5I78A 3NCYS 1AO7B 3CDZA 4LHUD 4EZMA 3DX7A 3HFFA 3STFA 2OMZB 3UPRB 2KMWA 3CDZB 4JG0H 3Q6GH 3QGKC 3SQMA 1DEEA 5L6YL 1PEZA 1W9VA 2JCCE 3IBEA 4YSTA 6PCYA 4UQIM 7CGTA 3QI9C 5JIIA 3VCCA 1MHCA 4X4YB 2FR4A 3K4WA 3EHBC 1JR1A 2AL2B 4D72A 4HCDA 1EEZA 3K71A 1UWSA 2TPSA 1GOHA 1ASPA 2O61B 2EQDA 4JNXA 1CFTA 5A8PA 4LSTH 1XGRB 1TJHH 1QFWH 5DJ6A 5FW7A 4MCYA 4OTKA 5D70H 3O3DA 1L7TL 2UWEF 2X4RB 5DJAA 3W81A 1EJFA 5B7ZA 4JY5H 2CPCA 2FDMA 2N7SA 2R2CA 3GJFB 2VVSA 2Y4SA 5E2WH 5A8GA 1GAFL 5GRWA 2Y22A 3KYOB 3OXRA 1SY6L 3AACA 1OF2A 2PD9A 2QDDA 2L7JA 4FKEA 4X5XB 3CPLB 3TEVA 3HN3A 1W0WB 2QQLH 4UU9B 2NXYD 3JZYA 1TV3A 3WEZA 2XUWA 2AW2A 3BV4A 5CJOH 1OANA 3RVUD 1FZOA 2VX6A 4JAMA 4JBRA 2BOGX 5L4IA 2Y69B 2JFEX 2ZXDA 1MZHA 1OCZB 1ISXA 3WLOA 1V6VA 2XDFA 3OWRA 3ZQXA 3LZLA 2FL5B 3FFCD 1BYBA 4UR8A 4MSWB 1OC6A 1NBVL 2DI9A 2G37A 1CVSC 4XB8A 5C0JA 4TVPL 4DJMA 5JW4Q 2PP1A 5C8JB 3COTA 3NA8A 4BF7A 2W07B 1HHHA 3OSKA 5HNRA 4NO0B 3WV0A 2ZX6A 4ORZC 1UH3A 5JHAA 2XSBA 3A0OA 4BHYA 1T0NA 3FGCB 1FA2A 3APDA 2FWOA 2XVGA 3BUTA 3WIAA 1P7TA 2Q02A 2YR3A 1CE6A 2VL5A 3GJFH 3N43B 2YEQA 3QT2A 1XMWA 2P24B 1E28A 2QBWA 2R1XB 1I7RA 5F0LB 3UBXB 1LF1A 3O9WD 2K6WA 4HU8A 4UQEA 4IOFD 4Q8MA 3ARGC 4TNEA 2FD6L 1NBZA 3MNWB 3QBTB 4Y2OA 5JHDB 1OX4B 2OX4A 3FC8A 3PWVB 4UFJA 4Z7OF 3W0WA 5A6SA 4L2LA 4QHMB 4M6OL 4N9OB 1IT8A 1ODZA 2Z35A 3H7VA 3HS0C 3B05A 4RR4A 3W0WB 5AW8B 1H6UA 3EYOB 2IJ0C 3X14A 5MI0C 3QRBA 1ONWA 3FHEA 1QFHA 1LNUB 2AMGA 2Y88A 3EX2A 1X97A 4AD3A 1OGAD 4G8FB 2X42A 3O0RH 3DARA 3QAZB 4N0FB 4BZ1A 3BK0A 1BD2D 3GHRA 4MFDA 4KJQC 3CL8A 2XFXA 1UOKA 1YMHB 2FO8A 2LAGB 4FI8A 1X8CA 2Y0SA 4GRSA 5GS0D 2CLMA 3I2CH 3AWFA 4H8PA 3R06A 1HH6A 1MJ8H 5JPNB 3RP1A 5FL1A 2WW8A 5DTFA 3KH3A 3PWNA 2BW4A 2NSQA 4I9WE 1XCFA 4NRXB 4LUSB 4AWJC 4M1GH 3PBVA 3VXTA 1G9NC 2NY4D 4UTWA 3K30A 4HKBA 3WBAA 1IBGL 2N1TE 2B81A 1PQZA 3RTLA 5L8LB 2F7IA 3BP6A 2LLLA 4NDMA 4PR5B 2XTKA 2NY6B 1DJWA 1UYWH 3IKCA 4B0MM 2X0VA 1LCOA 4V27A 3BVXA 5I1KL 2XIJA 3NCJH 4MQ7B 3MA9L 1AMKA 4UTJA 3MRRB 2ZTJA 1PLBA 3ZZ1A 3KJ6H 3ARBC 3JBG7 4NHCL 5DUPL 2Z1SA 4LF3B 2AJUL 1ETZB 1K3IA 4J39A 2OELA 3RWJB 1M04A 1WEJH 1DJSA 3O4LB 4H6EA 2HH0H 5DR5L 1AQHA 5IB5A 3RIAK 5CJXC 4ZMOA 3VGGA 4H44C 5F1KC 1G7MB 4GZIA 4IGNA 3BE1L 1AD0A 4B3VA 5F7HA 3CX5J 4TR9A 1XGRA 5DD3H 1O5RA 3LHAA 3APMA 3WHE1 2X6UA 5CIPA 1XZ0A 3WIHL 1TZ7A 4O12A 4P7LA 4AWEA 1FJ1B 1XGEA 1XIBA 4GSQA 3PWUB 2B1OA 4GW4A 5DYOA 5CU9A 5BYWA 2R7EB 4JKMA 2VCBA 3PHOA 5T5FH 1W91A 4PJEF 5FDWA 4R7DA 4A2EA 1HYSD 4JTRA 4LYKA 2PTDA 2OZ3A 5C0BB 3EUUA 3PUDA 3L7EB 4PFHA 4FQ1L 2A4EA 2OMZA 1YXCA 4H5SA 4JPWL 4CSTA 4IQDA 4J3TA 1UJ3C 1T1ZA 3UZEC 1M5WA 4Z3IA 2IANB 3L67A 4JFHE 5F97E 3T0WA 1HL5A 4ODSL 1OK6A 2J13A 3M4HA 4KCVA 2EUVA 1SYVA 4XV0A 5CP3A 2X12A 5TPWL 4F1ZA 5L9DL 1HHJB 3ARGA 3QIBB 3DSNB 5ELIA 4JLRB 2GDQA 3BVWA 2PF6A 1E5UI 1ET7A 1F4XL 4QYAA 1GVYA 1UURA 2BS9A 4B6ZA 4KUCD 5XIAA 4J40A 1K8CA 3TT3H 2NY3D 3DRTA 3T3ME 2JIXD 4YJZL 2ESVE 3NOYA 1ZS8A 4WGXA 2ONEA 2HJFA 4QRRD 5TJWK 2J6XA 3T6XA 4E2VA 1FIGL 3BJ91 1VB9A 3GBLA 4M02A 1EGZA 3JQOB 3W76A 4EF9A 1M71B 2HISA 3D85A 1CL7L 3NAAH 2CKNA 2MOVA 4OLUL 5AOMA 3NP4A 5AEAA 1KNOB 1Z32X 2I9LA 3FOMB 4XNZC 1OF6A 3E0IA 4BI6A 3M1BA 4OGQC 3RJOA 1G5GA 5IEKB 3FFCA 2XA8H 1P0NA 1UEMA 1WFOA 2YK1H 3QXAB 1XGPB 3AAZA 5HGDA 1KCLA 4OVUA 4A2MA 4QHUA 2UXVA 4Z7VA 3W53A 2GUOA 3GEFA 1BF6A 2DQTH 4KZDL 5KG9A 5CJBA 2JKPA 2NQDA 5I1CH 2ZSWA 1Q6LA 3IFPB 1UD3A 4QYOA 5IB1B 1B4KA 1DQXA 2JI2A 3W71A 1AGBB 3RGTA 3M7OA 4B4HA 4U05A 4O0QA 1KBJA 4NHUA 4Z76B 1KB5B 4LXFA 4O58H 4Y5XA 4M93B 4XAWH 1OGAE 1AC6A 3SY1A 4H88L 3TAOA 3C5SA 1NOWA 2DJLA 5K4ZA 1AD9B 4K3EL 3H2MA 1YMHA 3N40F 1GC1C 4K07A 3PBMA 1H0GA 2QJIA 3HIJA 1QWUA 2QDHA 5D96B 2XG5B 2RQEA 2TRHA 5HGGS 1J5OL 1K4HA 1WCBB 4Y4KA 1XS2A 3H7UA 3PJTA 4K7YA 3O6FA 3P9LA 3QXUA 4NAJA 5EU5A 1NP2A 5BO1H 4RKAA 1FNLA 3IGUA 3RPIA 1REQA 1JHTB 2IQDA 4AQAB 3G2GA 3W1LA 2X2GA 1X5JA 1QRNA 2YRZA 3L9RA 4LPXA 3AMGA 5C2CA 4QEEA 5EA9A 4WW1A 1DCEA 3QXBA 1RUML 4PRHA 2CRZA 1N6QH 3MHZA 1EXGA 1VFOA 3EO1B 2FTAA 1QR1B 3TC7A 3H9ZA 4YFDB 2AEOA 5CLXA 2XISA 4YHOH 1P6BA 4QRSB 1B9KA 4PRHB 5TF0A 4CVZB 2C14A 4Y5VC 1D5IL 1W9BM 5AYQA 2A0LC 4JM4L 1WS7A 3CC5B 4IBSA 4NNXA 3B3IA 1KIQA 3MGTA 4Z7UF 5FKAB 5ABGA 3PHSA 3ALGA 1ZLSH 3VI4E 1RPKA 4DP5X 4Z1DA 2HZGA 3BZEB 3SKNB 1DQLL 2ZOWA 3QPQC 5I71C 2WNXA 3F7VB 4OFIA 2X1XR 5IFJB 2BS8A 4N3UA 1A4LA 2VR2A 1HH6B 3VA6A 1M7IB 3B8TA 3S2JA 1N7ML 3VGEA 2RCSL 4JG1L 2A85A 2CRMA 2GDVA 2A7BA 2BSSA 5TDOB 1HTIA 5CHNB 2ITDB 1F3XA 1MW0A 3QQXA 4HKZA 3G6JB 2Z1BA 1K8XA 3CLMA 2X10A 4M7ZB 4I1NB 2VIRA 5I74B 5I6PA 1T4KA 3A6BH 2JELL 1DVXA 4QWWD 4L3CB 4PRPA 2VZUA 3MFGB 2EVHA 4WV1C 4Y2NA 4L4VB 3GTFA 4PV9A 3O3AA 1QO2A 1UPPA 3HPSA 1FNGA 2VGLM 1J8SA 2ICEA 5ECVA 4M8QB 3BD5A 1OSZA 5KAQG 2EJAA 3KPMB 4YXLL 1V6WA 2C1PB 4X6FA 4FX7A 4W4OA 5JDSA 4LRIA 4AZIA 2OSLB 5KBDA 4QXTB 4CILA 4JFQA 4DN4H 1MCWW 4DLMA 3NXFA 3HCVB 4K4KA 4XX1E 3KPLB 2GK1B 4F7KA 2HK1A 1XHGA 4KCWA 1ZVSA 4WNJA 5I24A 4LCCB 4IBWA 1YEIL 4UIKL 3QEUB 1W2KT 4P5TD 4YSQA 1ECQA 4Q4OA 7TIMA 1OO2A 1XM3A 1ICPA 3OKMB 2HTLC 1JWSB 4XN8A 4Q8PA 3DBNA 1YEHL 2HUHA 3GJFK 4FULA 2JJTC 4Y19A 1D7KA 1H7RA 3C0QA 3CQ0A 3I85A 4QRRA 5JNYB 3IMVA 3NA4A 4ZQKA 5BS0D 2FB2A 3GC5A 4ZMQA 4I5RA 1INQB 4I1RA 4GXVL 1U3NA 3VQ2C 2BG5A 3UFYA 1HJSA 2FD6H 3OMIB 3F4WA 4IX0A 4WRLA 1E9YB 1Z3NA 3WBXA 4WK4B 2Y6SC 4MNGB 1RY0A 4XD3A 1UB5B 3LKRA 1HEHC 5T3ZD 1NDVA 1RJQA 4S3FA 2HJFB 3HR5A 3IJ6A 1CF1A 2VRQA 5DZ9A 2EBNA 5HINA 3P4NB 3HR5B 2WC7A 1CBJA 3GMNA 3WY1A 3ZTNL 1GIGL 4GRWH 1QW8A 1AZ2A 2IAMD 3BPWA 1CW2A 1N2VA 4S3JA 2PUZA 4AZGA 5DVKA 3S47A 3ARWA 5D2TA 3U4BL 1J0YA 1LP9E 3KCWA 3LPOA 3H6OA 3Q58A 1ZA6B 3HZYB 3MDWA 4NM8L 1JUEA 2X16A 1S3KH 2JK5A 4A37A 1QRNB 3L9RB 3DCPA 3GS7A 1KACB 1X5GA 4KO9A 3O6KL 4JKNA 1SEQL 2OMYA 3MSGA 1MZYA 4NBYB 1P6FA 4EI5D 4GQ0A 3AOFA 1GS6X 1HZHH 2LU5A 2PN5A 1L3WA 4HIIB 2B5IB 3Q05A 3DFQA 4BELD 1JYXA 4FG0A 1TWIA 1KIRA 5GISL 3HNTL 3L3KB 2PS2A 3MJMA 4JVPA 4P2AA 2WIIA 4WV1A 4FYRA 1PKQE 4NP4H 4S10A 1AD9A 4AZUA 4JFXA 4LPWA 2R69A 1FC2D 2VW6A 3KJ6L 4NHCH 5DUPH 4LNVA 3ZE0F 2B2XL 1BVKA 4E2OA 4EDWH 4Z7WB 3LS4L 1LORA 3RUBL 4HMEA 1OAYH 5LGJA 4O02L 2P4AB 3WKML 1BVKB 4Z7WA 2WO4A 2HFFA 3DX0A 2E09A 2PCEA 3T4CA 2ZWYA 4QXVA 4PJDA 1OD8A 3UG4A 2AK1L 4J12A 3PWGA 5EKYA 3PHQB 3EJZC 5KVMC 1TQCB 3A21A 5DRWA 1NDGB 2I5QA 3NQIA 2W92A 4UZSA 3ZOAA 2ZAIA 4LFHD 1H3GA 1UQSA 3WXVL 2WXJA 3AB0B 3LKSB 1QR1A 1GG1A 1M7PA 1UMLA 3HGJA 2DRUA 5GPRA 1BOYA 2CJUL 1BVNT 3QP3A 4X6DE 4ZTEA 4AEHH 1A5KC 1OARL 2NX5B 4AH2B 5INDB 3AIUA 3TNOA 1XCTA 4HPYH 1A5MC 4HIBA 4LVGA 2NQ9A 3DX4A 4LTSA 2UY7A 1VHCA 4PJAB 4O02A 1UWEH 4KWOA 2ZX8A 4M5ZH 5ICUA 5JQHC 5JHBA 1E0WA 2DZTA 3CAFA 3LNEA 2XWXA 4KPHH 4APQA 5DANA 2PU0A 4XAGA 3SJNA 2L0DA 3RB5A 4RLDA 4AD0A 2PRLA 3L81A 4IL0A 1BEXA 2HP4A 2XWEA 1M05A 3GLEA 3TT3L 4PMXA 2KX9A 4Q6JA 4A2RA 3IPEA 1IEIA 4AZ7A 3W85A 3LHZA 3ZWTA 2ABAA 5BW7C 3E2HC 4WWKD 4BRJA 3JV5A 4NGHL 1A6TB 3MC0A 1EFZA 4NOBA 4MJ6B 1MELA 3NAAL 1A9BA 3ZLHA 4DWDA 4TQHA 4LJ3A 1V51A 4KF1A 2Z64C 1HQTA 4RPQA 2GB2A 2YYTA 4ALAC 3T6QC 4YUEL 1A9BB 2XY2A 1G87A 2CHZA 2IO5A 4OIIH 3RYMA 4EJ1C 4ZSOA 4H9VA 4DEWA 4WENB 4HCLA 4ECLA 3IPWA 2HG5A 3MP4A 4E41B 2EEDA 3K8MA 3QIWB 1RJRA 4NN5B 4DVRH 1LL6A 5AW0B 5IF0B 3WCYA 2W94A 3F2CA 2E4TA 3FTGB 4GPVA 4YQXH 2CYGA 4OUOA 1BG1A 4NBZB 1OQOA 2F38A 1TZHB 3M1CA 2V33A 5GJSL 3KWTA 4O58L 3E8UH 4Z9KB 3N2CA 1R2SA 4LT7A 3K13A 5D2LB 3S35L 2OJZH 3KYMB 3L4ZA 1SVDA 2JBMA 2FHFA 2VLME 3M7WA 2EDTA 2AJSL 2VISB 4Z7UA 1QPKA 2SEBB 5D5MF 4ZD3L 2HSAA 4QWWC 4YO0A 5J8OA 4JFWA 2IPTL 5HUOA 3T1GA 3SOBL 3BSZL 1H8SA 1ZCOA 3BVVA 4N1EA 3MTWA 2WSYA 1OAZL 1RIVL 1CGSL 3O9WC 4JFTA 5E08H 1JPMA 4HUKB 4GE8A 1ISYA 5ABFB 4MQXC 1XBRA 1A7OL 2R0LH 1HYRC 4KX9A 4UB0L 2HNEA 1LTXA 3RIKA 1KC5H 1DHKA 3GM0A 2VMFA 2XPZA 4GJIA 3CJJA 1SQ2N 3KRZA 2FATH 3P0YL 5IOKA 4IKLA 2DT0A 3NGFA 4XUYA 1L6XA 4TSAL 5K9DA 4JPKH 3A3XA 2D7MA 3OBEA 1CDJA 3EOTH 4U3CA 3G1YA 4H00A 5JW4N 1P69B 2DLFL 5EB8A 5FL0A 3RJQB 3ZE2E 4JIQA 1PLAA 1MOEA 1D5ZB 1YNTF 5E9AA 1RAMA 4C65A 2WSRA 2PGFA 5CBJA 1A65A 1IGCL 4NFBA 4APQC 1EJUC 5EEUA 1BF8A 3WU1A 3C5QA 5ICZB 1CG9B 1VFMA 2BHYA 2K7QA 2Y5QA 5E5MB 3C60B 3FQXA 1FF5A 1D5BA 3I75B 4GKOA 4GS7B 4NUJA 4P3DB 4PJFA 4ZUTA 2YGPA 4UT9A 4A66A 4HLZG 4Q8QA 3S42A 3HV8A 5FD0A 3FO2B 1ZA3B 2VR7A 3NSFA 3GXIA 4PJEE 3DK0A 3SO3C 4P57B 1AZBA 4R0LB 3H2QA 1ADQA 2D3JA 3DENA 5BZWB 5EL1A 1FWFC 1YPZE 3QHOA 1W16A 3HMXH 1W31A 2QVFB 4ODUB 5E2UH 1GKEA 2BNRE 2V5DA 1DWIM 4GC3A 3BHBB 4BQ8A 1T6VN 3GLZA 1CD8A 1W0VB 2ZCHH 2G3ZA 1KO0A 3B5GA 3HJEA 1OHLA 2VXNA 1F97A 2PW2B 3ZLQC 7ODCA 1XHHA 1K03A 3M5ZA 2K9UA 3L3HB 3RAOA 3CLFL 2VUOA 3NJIA 1S78D 4LHJB 1TJ1A 1VACB 3WHXA 9XIMA 3HRZA 3TIDB 4X0NA 2NYKA 5EU7C 3OLGA 1CICB 4PSRA 3MLWH 1EHXA 3MLPA 3XIMA 5HDBE 3ALXA 5D6DA 5I06A 5E2WL 3VMOA 1V10A 4FFYL 3HZKA 4PJ9A 1JSYA 1XQ4A 1ZLVK 1YMMA 2BZNA 4M19A 5CZTA 1J5IA 4PJ9B 3IGLA 4KK6D 1DORA 1F00I 3OR6A 1IAOB 1W6LA 2EAEA 1YEIH 2PYEE 3SDCC 3AIBA 2D7PA 2H0PA 2DM7A 3FHAA 4YTQA 3BKCL 4JZJB 5K9CA 2FLBT 2A9NL 2ILLA 5IVOA 5AZ1A 1KUMA 3Q8EA 5LG6A 2H47C 4YHEA 1ZT7A 4UFMA 3RLHA 2G3NA 3F7JA 3UADA 2J4WL 2BERA 3EDJA 4E0RA 1BG4A 2WQ8A 4APQB 2ZUSA 3LM7A 2YD3A 4F3FA 1H1YA 1I1AC 2UWEA 1DCLA 5FF2A 1X9LA 3PUOA 4NZ3A 1Z7AA 3D3FA 2PDMA 4FP8L 4IGBC 4PGEA 3MLZH 2G4FA 3FK4A 2YPLA 1OP3K 3SR7A 2APVA 2ESVA 1DE5A 4HJGA 3FU9A 4JUTA 2WAHA 4LCVA 4JTCA 3MAWA 3PCYA 1C5DA 4XNUH 1XIMA 2EXTA 3BN9D 4YHZH 3VGAC 1DQTA 2DH2A 2NY0B 2YD5A 4OLVL 1HHIA 5IVZB 2CRYA 2JF1A 5KVEH 1EX1A 1G7IA 3BG3A 4ELKB 5K4XA 1GC1H 1UT1A 4U1SB 3IJSA 2IDQA 2HJLB 3FYPA 1DL3A 3NCOA 3JYBA 3UD6A 4DM2A 3PZNA 1OINA 2F1AA 2IG2L 4RNRB 3IJEA 1XD0A 1UUOA 4JRXA 5I73C 1FO0A 1WO2A 5C08B 1PJ9A 1CXIA 3GZPA 3VG9B 4LU5H 4MD0B 1O6SB 3T55A 4LVOC 3LV6A 5CG0A 1CYGA 5EBUA 3ARDB 4KRPC 3VI3B 5DD1L 3FVMA 5I1LB 1M6JA 1W15A 4FNQA 4TTDC 4O19A 1Z42A 1MJ7H 1OGAA 1GPOH 2F7OA 4E42B 3GXMA 4LSRL 4EI6B 4NQVA 1XL9A 4W8BA 2Q8LA 3V9FA 3VD9A 2JQAA 3ITCA 4PTUB 2C9QA 3LSBA 1I3RB 1RZJC 4JFDD 4CC1A 1L5GA 4ZMAT 3Q2WA 4TU1A 2GGGA 3S5NA 1F73A 1BLIA 4AVIA 4LKXB 4S1RH 4IBVA 5DRNA 1SN0A 1LD9A 5AW1B 3PQYD 2AQ3A 3ZGHA 2BVOB 3RLVA 4DB7A 5IQ7H 1YQ2A 2POTA 4KFOA 5F89B 2ZXEB 3HBGA 4ZT1A 1X7QA 3W7GA 5T8IA 2P53A 4ZTYA 3UR2A 4G6MH 1VZHA 1JV2A 4F9DA 1PL3A 2Y7SA 1E9ZB 3U79A 1KULA 4UOW1 4DN3H 3TC6A 5BNXD 1VPQA 3GMQB 2ARWA 4QGYA 1JCXA 4K5NA 5TGBB 2M26A 1K5NB 5FV2A 3MHFA 2FYYB 1MCOL 3SQSA 4L8SC 3W72A 2K1MA 2XN9E 4MDIA 3HTLX 4FHBD 3VYNA 4PBFA 1Y6KR 3QFJE 2GJ6E 2PW1B 2OCJA 5AVXB 3H2PA 5BS0E 1QPNA 2XG9A 3PZ9A 5ITBL 4P7QA 1I9EA 2QMJA 3QEQD 1EOMA 1YDVA 5T5FL 4NQXB 4OKDA 1A6WL 4KKCC 1F3DH 4HJJL 1HEJC 1ZA3A 1JDEA 3LHWA 1YYLH 2H6OA 1UFGA 3O6ML 2EXWD 3L4YA 2YUZA 2IOMA 3A47A 2ETWA 4EPEC 3EGXA 3NQVA 1KFAH 1Q6FA 5F6HI 2J6EH 1OLZA 5C9XA 5C0FB 4ODHH 3KAOA 2M83A 1U2YA 1IBGH 3FYIB 2Y7GA 4D7PA 4ZQOA 3E9UA 2UZIL 5EO9B 3EWZA 1L9RA 4PTTA 4L5FL 5GIRA 3BPCB 3A6OA 3I50L 4A22A 3ARGD 2YL9A 3N9SA 3PGCA 4NZUL 1EXUB 1F4YL 4HYRA 1NFDE 1OCOB 3WD3A 1JGIA 2CDEA 1NFBA 1XRFA 4IQEA 3M7FB 1UZGA 5IWLA 5CEYB 1CFNB 3IACA 5LIXX 4PJEA 2AABH 1KWKA 2XFWA 1W5PA 1M9WA 3QO0B 4RISH 2NQ3A 4ZMLA 1Z9MA 1AZNA 1VBHA 3VRLF 1LMKA 3ES6A 5C9UA 1RLWA 4MYPA 4RRPA 3D85D 5FOBA 1NGZB 2REQB 3IJ7A 1ZHNB 3D33A 3ZHNA 2DQWA 3N73A 2HKFH 4FQCH 3ZL4L 3LS9A 3EOAA 1ZHNA 1E1EA 2PPEA 1WDPA 1IBHA 5LGYA 3T0EE 3TBVB 4ANWA 1W3JA 2QHRH 4AZCA 2DZBA 1ZTXL 4HK6A 2INZA 4IFKB 2ICWJ 4P23C 4KT2A 4Y9CA 3N9GH 5ENLA 2WVVA 2NYZA 3FQYA 1NPUA 4TQ8A 4YBQD 4HGXA 1OX6A 5IIEA 1A6VL 2QLYA 1JWMB 4LDLB 2R23A 3RAJL 1MCIA 3O3RA 3SPHA 3OF6A 4L29A 4N7QA 3RFRA 4M1DH 4XCYA 1CFSB 2GGHA 1VFAB 2TRSA 5IJVB 3OG2A 4S2CA 3TXVA 2Z92A 4U0RC 5HPMA 2ZG2A 4NENB 1V02A 2QXWA 3GSWA 3SECA 1G4PA 1J5OH 2DWTA 5DD0L 1J0ZA 4UTAH 1JYNA 4WKHA 3O4OC 4X0KA 1SM9A 3QJHA 5D30A 3C5ZA 2NQHA 3WMCA 2F1EA 4AYBA 4I1PA 5FW6A 3HI1B 1T80A 5LBGA 3W3OA 3ANUA 1FP5A 2W0FA 2AXFB 5D9SA 3VFTB 4BFOA 2YLLA 1F4AA 3BZFB 2EDXA 4DBWA 1HJWA 1MF2H 5D6CB 1DBBL 3PYCA 1FBAA 3W1MA 3RWCB 4TVPD 5C7XL 2IQ9L 3O4LD 1TENA 1BRLB 2EE0A 3TA4D 4HHPA 1Z5HA 4JDTH 1I6NA 5IZ7A 1GTHA 2BC4B 3DTXA 3NEEA 5FF0A 4ROPA 3CIVA 1CGYA 2E9JA 4YFLF 4AYFA 4UDTA 2R51A 2V3EA 1QHZA 2FPYA 4KBPA 4JQ2A 2FYYA 1RA5A 4MA8L 1PKQA 2B20A 2ITEA 3D3VE 3O3EB 2WMJA 4LF3A 3WFBH 4QHRA 4UCFA 2XXCB 2PO6A 3RWJA 3L5AA 2WMPB 1ZLDA 5E51A 2NW2B 3UPAA 5AUMB 3S34H 4C6QA 4ZE5A 3RBGA 3S88H 3GNDA 1GKOA 2WWOA 3EO0B 3CHSA 3S37X 2ABBA 2WAGA 1M7OA 1FVDA 5AVQB 3ERPA 3ARFC 5A2CA 4D6EA 1RZPA 3BW9B 1Y07A 1DZ0A 1XYZA 1ENUA 4OCWH 2NQZA 4M80A 1UASA 1I0BA 3QDME 3OO2A 3SRFA 3WTUA 3D09A 3N19B 4X6EB 4XKYA 4PJ7B 4WEBL 3TJIA 1WJ3A 4EBQL 1S5IH 3BQUA 4F5CE 1XLLA 3OJDA 1UVQB 5DX7A 3D0LA 4RW5A 1OY3B 1IGFH 4AQLA 2ENQA 2P48B 2GJZA 2Y89A 3P2DA 2LAAA 1VPYA 4QXGL 4IU3B 2YSWA 3QG6A 3THQA 3ABQA 5GS3A 2VI0A 3KVLA 1X5ZA 4U6VL 1VFSA 4FQXD 1G9NH 3CBJB 3CN2A 3K6FA 5I6KA 3O63A 1I9IL 2QQNL 3GW3A 4TS6A 1HNGA 3QCTH 3SJVD 3T0EC 2CR3A 5JHDD 3RY6A 4BEIA 3EOSA 4QM1A 4HHGA 3QNYA 2DDQL 2F61A 3TN0A 4DN4L 5BXRA 4HOWA 4FFWC 4E4UA 3CHOA 4XBMA 1ML0A 5C70A 3HUJB 1ODUA 2ZONA 3O45A 3IDXH 1GKQA 1XIHA 1DVTA 4WKAA 2FL5A 5C2BH 1RP8A 3B04A 4YDLC 3KFTA 3W2UA 1U3HA 4FP8H 5BWFA 3UY8A 4AJWA 3PWPD 2NNXA 4OFYA 3D47A 3DGGA 3MLZL 4XCEA 5DGRA 4LBEB 4HPHA 1FWTA 4QTFA 3W27A 3Q1SH 2R0KL 3EOAB 4JTKA 3TQPA 1BF2A 3FQTB 4JL2A 1R85A 2FGLA 2F15A 5HJYA 5LNWA 3S0CA 3IV8A 1H3TA 2FGWH 2GQ9A 4RXFA 1P7HL 3NQBA 1C9WA 4U1LB 2P1FA 3WUZA 3V6OA 3T8LA 3FFCB 4A6GA 4AQ8C 1HILA 3TJHD 3V5HB 1H60A 2J8TA 1E90A 1EBAA 1M2VB 2YOCA 3HFML 4AY0A 5T3XL 1O5XA 5TDNB 3KBFA 4KCTA 2DV6A 4N0UB 1A6AB 3B0XA 3HB3C 2CG9X 4TULL 3T40A 4ANUA 5FC9A 2JJTA 4NZTL 1NAL1 4LDEB 1OYCA 1F2QA 3N40P 1Z89A 4WK9A 5DBTA 2I9TA 5CG7A 1WE5A 4NJAL 1FO0H 4NAEB 3H12A 4ZO6A 4L0ZA 3THCA 3VFCA 5C3LD 3P4OB 1MN4A 3K8KA 4OJAA 4P49A 3KPQB 4TLUA 3L16A 3NCWA 1OIOA 2VITB 4KMTH 5DJZB 3WKPA 4AG4L 5J1SC 1PWMA 2PGRA 5K69A 3QXVA 4Y7MA 3K5RA 4GRLC 5CGQA 4O11A 4MADA 5BXSA 2J6VA 2JIXB 3W39A 2OZNA 3DIPA 5AC7A 4PWFA 4HALA 1DBAH 3FQUB 5ABTA 3WF0A 1RY7B 1F58L 2NTFB 1FE8L 2DJ4A 4XPBL 3MJ9L 5M95B 4OV9A 4XIAA 5B7MA 3IDMB 3GYCA 3ZJ8A 4Q8BA 3TEUA 3CFDA 5JOFA 2HBVA 2JIEA 2YC1B 4O54A 4X3ZA 3IDMA 1V7NL 3GXUB 3KXFD 4P7NA 4WY0F 4G8IA 4W1TA 3KCLA 4HNCA 4DGWC 3DDMA 4XBEH 4M5TA 2YS4A 4Z7NF 4NZ5A 5D7JD 3QEGL 1NKRA 1YVLA 3S37H 1VCVA 3CUJA 3OZPA 3OGOE 5H4ZA 1WBZA 4HD5A 4O0KA 4P7OA 1XYCA 1DEDA 3AU1A 4X80L 2NWSA 1OT1A 3MGTB 5FKAA 3T0EA 2F5AH 3O4LA 4LS2A 2ALAA 1MCOH 2R82A 4QRSA 3QORC 4NUGL 1AAJA 2VLRB 2F54D 1SO5A 1AGDA 5EBMB 2QCLA 1Q72L 2Z7WA 1F9CA 5HQLA 2DBJA 4PAZA 2BW5A 1HSBB 3KGTA 5T3XD 5EF2A 3EXJA 1A9VA 1EYEA 3PAOA 4LAQH 3ETBJ 3X11B 3VFVB 2OR9L 4PJ7E 5JPNA 3RCMA 1EPVA 4KXDA 1PIGA 2PR4L 1BVWA 5A3HA 2FYVA 1J8RA 1FBIH 1XBDA 1B3YA 4EEEA 2IH8A 2ZP8A 1T66D 2DGAA 4ZVJA 3BW2A 4L05A 1YPZA 1AP2A 1VGEH 4Z6AT 5IW1A 3KBJA 2ZDSA 4B2DA 1LG2A 1FUNA 5BMFL 3KGRA 4WU5B 5C0EA 1X6NA 3OAUL 3WNMA 4OVVA 3ATZA 2FZBA 1IVTA 2ADGA 4GD0A 4H13C 1KZQA 1CIDA 1JCVA 4WQOA 4REQA 2Q3AA 4ZYKA 1BSIA 2APWA 2CLLA 4KW2A 4OWGA 4LLDA 3BH9B 1D7FA 4G42B 1U3HB 2X1QA 4Y16D 3G5YA 5F70A 5IB5B 2GSEA 4RGNC 1OCRB 2ZPKL 5BJTA 3DGGB 4XCEB 6FABH 1LO3L 1U91A 5IHHA 3AGVA 1SJDA 3WKMH 2VEPA 2VGIA 4NGHH 4UAOB 1WFJA 1KLGB 4YHLH 1VF5C 1F02I 2YARA 3GHPA 4FXKB 2H8ZA 1OP4A 4WWKA 3PJNA 3GS6A 6REQB 3HIZA 2WM0A 2R7EA 1EJWC 4FK9A 2ZX7A 4FS9A 4OQTH 4YR6A 4LCCA 2GPZA 3FS2A 3VXNA 2WNKA 2AANA 3QEUA 4PLOB 1EGVA 5HVGB 4LU0A 3FOMA 1TJGL 3OB0H 2FAUA 2V2XA 2WBXA 3KPLA 3M1BB 4F93B 4IMKA 2P3EA 1MWAL 3FFCE 1UA6H 1W1IE 1VS1A 4XAYA 2YCLB 2V2XB 1E6ZA 3SKMA 3COOA 3PR2A 3EDKA 3K7UA 5ID1B 1I1AD 1JEZA 3LA4A 3K1DA 4HPYL 4YWGL 1FH9A 3IWPA 3BZDA 4DW2H 1A7RL 4QYOB 4GG6F 3DVGB 3ZHLA 2Z8SA 3QISA 2R0ZH 4KK5C 1UWEL 4URIA 1G6RB 2B1AL 5EOTB 4A8IA 3VXGA 2CGZA 2AAAA 3KG5A 1PZ3A 2E6YA 3SE9L 2A3CA 2FX9L 2ATAA 2VITA 4F9JA 1NWTA 1OYBA 4GGBA 3IIOA 5BRZD 4B50A 4JIHA 5EO0B 3G04B 1B2WH 1MPAH 2AJXL 4L4TE 3U9IA 4MAUH 4YDNA 1MCFA 1OAZH 1I8KB 2AP2A 3N91A 4E9SA 1KN4L 3OJ2C 4XBGB 4EVNB 3TP4A 2XVBA 5TE7L 5IREA 2D22A 2CCLA 2VLKE 2Z31A 4PH8A 4IMGA 5L8JB 3O6FB 3P9LB 5C7ZA 3EWDA 4HXBL 1XGZA 4G3YL 4Y1AD 2MCPL 2DMCA 3SY0A 2Z24A 4GJ1A 3VFMB 2WANA 2DW6A 5EN3A 4FTVD 4BI5A 2IADA 4JM0A 4HA1A 3F2BA 1D2KA 3WH6A 2IPUK 3V8OA 4CQCA 2IADB 4BWTA 4JY8A 1T04B 3NSYA 4IZGA 4AL8L 1RK7A 1UATA 3QW9A 5G5DA 5GS0C 1Z9OA 5LGKA 3UWVA 1BGXL 3MCKA 4MYXA 3ISIX 3DURB 4GY7A 4JKWA 2NVDA 5KVDH 2FJSA 5LVEA 3EYVA 4QOKD 3PHAA 1QBAA 1F2JA 4KV5F 4YYCA 2XX1A 2AJYL 3LTPA 3OR7A 1EANA 5JBEA 5IBUG 3S9ZA 4P2QA 1O5QA 5L2KD 4ZDHA 2FTWA 5KVGH 1MXGA 2BOBA 4DBSA 4DUOA 2C7FA 2P43B 2WQPA 1T7YA 3JV6A 1H5VA 5KSUB 5EU5B 4JY5L 3LS5L 4OLYH 4DI8A 1AQMA 3TWYA 1TTIA 3RM9A 1CXEA 4K5PA 3B4YA 3EWBX 4ZX6A 4K8HA 2MUCA 3GS4A 1XLCA 2QF7A 3CV2A 5E94A 2R8WA 1JI1A 1MCNA 3C0LA 1ETZA 1IM3A 2JF6A 2OT0A 1W5QA 2QQLL 2EILB 2CWRA 3TWCL 1XF2B 2Q71A 3MLRL 3UW6A 2E56A 4XVOA 4YBLC 3ROLB 2MOQA 1KB3A 1BXAA 5C3IA 1X5FA 2AKRB 3J2PA 1FHGA 1NELA 2E9BA 3Q5YA 2A6LA 2Q7AA 1EDTA 3EOTL 4NX5A 4JFPB 2OX5B 4PJCA 3CHQA 4CAGA 2NW0A 1WPCA 4WOZA 1O9WA 1HIML 4GAJH 3UC2A 1LJMA 3O2DA 2VXTH 2DPEA 4NY2A 4D6HA 3PAUA 1M05B 3MMEA 1MFCL 4MF4A 4MZ2A 4POCA 4ZQTA 3ZJ6A 2V68A 3G6MA 4KJYA 5JU6A 1AO7A 2NY2B 4R7XA 4GXPA 4KDTC 3S8GB 4HJSA 3PFRA 3WDIA 2MNUA 2NRDA 3MNVB 1CDYA 5GGRA 4MGGA 1YN7A 3DI3B 1F5WA 4NIYE 3NPVA 1OCNA 4YPJA 2CLIA 1U2HA 4MTMA 3W28A 5E2JA 1E42A 1DYSA 4M8UA 2BB0A 2DQHH 4J4PC 5HVHB 4HC1H 5DLMH 1KCWA 4M8QA 3C61A 1WGOA 1I8UA 1JI2A 5LQBL 3BKJH 4JFHD 1ORSB 3LH2H 1ILSA 5HJGA 1IARB 1HKIA 1SVZA 1YEEL 3NZ8B 1WS8A 1DVFC 3CVBA 3BI9X 1AXTL 5MENA 2BNRD 3DG7A 4NKMB 3V4UL 4ZFZB 5BQ7B 4LOFA 1NBCA 3P2VA 3AADB 2CLPA 2VJ8A 4LEXL 2FE0A 3QQDB 2EH8L 1L9SA 2O56A 3VH8A 5HHMB 1AL8A 4I6KA 3TROA 3FONA 4E41E 2X9YA 5DZOA 5CEXB 2CCRA 5IEKA 1AQKH 4GKTA 4C7FA 3QY8A 1DBAL 2VYRE 3EWCA 1SJAA 5ID1A 4M1GL 1CD1B 1BMGA 1QFUH 2C79A 2WTPA 3QUXD 5BRZA 3WQCA 1OVZA 5HOSA 1FPTL 4IJ3B 4YK4B 4FQLL 4A2HA 2ED9A 4EF3A 3EBIA 1EP2A 1XF0A 2J4WH 2VXVH 5ESVB 4R90H 3VWJC 4RGND 3VUAA 1HCVA 3GSVA 3T0AA 5HVFB 1FXPA 3OPUA 5AWNH 1Q63A 4LO9A 4MNKA 3S1GA 3UETA 1AIFA 3GY1A 1LVEA 4HK0A 3BV7A 5E9NA 3N5AA 2VCCA 5ADPL 3PREA 3EOBA 4RUBA 4ELMA 1HFBA 5J3HC 3R8HA 12E8L 3KLAB 1D9KB 4JFZH 4JFDA 3GZ3A 4O1FA 3QFDB 5CJ8A 3U0WL 3US9A 1NWOA 1TJIL 3KHOA 3AXMA 1E28B 1L0XA 2EIEA 3UBXA 1FX6A 1JK8A 3DYMA 1CG9A 3QDJB 5F72S 1WA1X 3H7BB 3CSYB 5DHVH 1A66A 2BH0A 3VE0B 5K1VA 2FIRT 4RDVA 2V6HA 2AJZA 3VD7A 4KX7A 4LEEA 3ZRFC 4ZXBD 3RL1B 5KBPA 3TYCA 2PR4H 3ME0A 4AZ8A 4AUBA 1WG3A 2PCFB 4FOJA 1G9EA 5IJCC 1HOCA 4NNXB 3HE7D 4UIMA 3IU4H 3SQBA 2OKTA 3EX1A 5DA4A 1LO0H 3FO2A 4D6FA 35C8L 1F1GA 4YWSA 1LWHA 4RNJA 5CGBA 2P0IA 1NGQH 1P5UC 3RWIA 1MJJA 3C6LD 3OR7B 3SCSA 4AC1X 3TBCA 3CSTA 4RETB 3ABKB 3MP5A 3PF3A 4OJFL 1SFLA 4NXKA 5ILTH 2YRBA 4TV6A 2DSKA 3GZQA 5D7IB 2JKSA 3UEQA 5CKSA 4HF5H 1OJXA 1IM3D 2C1HA 1KPRB 4YPGB 2HFFB 3VKJA 3ROOB 2C18A 5AVHA 3DIDA 2NXYC 2DTML 3AG1B 2YJLA 2WMKA 2J6EL 3W73A 4YDVB 1IC4H 1X3DA 5J7CC 1DQWA 3SCMA 2C9PA 2EUZA 3ESUF 3WE6A 1H3PH 4QJ4B 3HV9A 3TA3B 4M81A 2AC0A 1MAMH 5EOCL 4EI5B 3TN0C 2P8BA 3CB8A 3EOLA 3QHZL 3DXIA 3WE6B 4OZ4A 1JXDA 4IDLA 2XT1B 4B16A 4L9LA 4XWGH 2J21A 1ZBWA 2PYEB 1NKGA 1BD2A 4DWSC 2DU2A 1FNGB 2CETA 1IAOA 3W2LA 2G97A 2BP8A 1H6EA 4P2YA 4WWPA 7REQB 2HX9A 2YW3A 3ZKMD 3P74A 4DRSA 1R3VA 4H3DA 3N04A 2DYPB 3O8XB 4Y2LA 2QTEA 3NZ8A 4MMYB 1KJ3H 2GSIB 5DMIL 1Q94B 3P73A 4DKEH 2ZKHL 1B6DA 2EE2A 4FQ2H 1BG9A 1PKMA 2HTMA 1VP5A 3V1PA 4IRZA 4MMYA 2FX8H 4XNBA 4D7BA 2Q3RA 3QUMH 2AJVH 5ANMA 1W2PA 3QZPA 1IGYB 3TKFA 4PMZA 2HKFL 4FQCL 4OB5L 1I85C 1UKQA 3PUGA 5IBXA 5A95A 3OKMA 5GQBA 1A6WH 5DFWH 1HKJA 1KM1A 2CBIA 4Z0JA 3WLQA 1EP3A 6PAZA 1LM8V 1BYCA 1HXJA 3C8HA 1W72L 1FNAA 3HC2A 3IRPX 3ECVA 3HC0B 3NIDB 4I87A 1MCEA 4J6RL 3ORWA 3UJEA 4Q6IC 4MX7B 3RIFF 2J24A 4I9WD 1HI6B 1N0XL 4LWWA 4QDWA 1J86A 5AVNA 3ASOB 3QN3A 1F0LA 5GSRB 5CBBA 1EZSA 3M7SA 5HULA 4KJQD 5AHNA 4M1DL 4H1LH 2VR3A 3M1ZA 1MXSA 3CQKA 1RLBA 1CI3M 4BK5A 4F8PA 1D5IH 4W68A 4Y5VA 1Q0YL 4CEXC 1A2YA 4FTDA 2AXWA 3UYCA 4U6XB 1UENA 2VJ0A 3CZNA 4BK9A 5DD6A 4IUGA 1KCUL 4YHKH 1R7OA 2WLMA 5C97A 3C5ZD 2QGCA 3BWSA 1QVBA 4LOCA 5JUVA 2R1KA 3V8CA 5AZ0A 3NQEA 1KLUB 4LLWB 4UMAA 3VQMA 2DQIL 4ZI8A 1Z6JT 1CLYH 3CSYA 4KTGA 5I71B 4Q3MA 3MY9A