3IJHA

Structure of s67-27 in complex with ko
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
IVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSNNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Immunoglobulin light chain (IGG3)
total genus 49
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijhA01
2Q8AH 1LGVA 1X5IA 2PW1A 5EU3B 3WFBH 1V05A 3L1OL 1RURH 3C5ZC 4JFDA 5DJDA 1TDQA 2NNAB 4K55A 4NKMA 1MCFA 3TCXA 4KHTL 5KVEH 3W9EA 5DD5L 5EU5A 3PWVB 1GIGL 3TLRA 3V4PL 4ZS7H 1N7MH 2AV1B 3HHRB 3PE9A 3SGEH 2BSTA 4MQTB 4KKLD 4J3UA 1NFKA 3FQXA 4HEPG 1T66C 3JUYA 3FMGL 2QSTA 3ZKMD 4LDOB 2WBJC 1NGWA 1CFVL 1H3TA 5BW7A 4HUKB 5A2KH 5SWZB 1A02N 1T3FA 4E5XA 3ULUE 4YHPA 3MOAL 3PXHA 4X6CA 2VUOA 3ZE0F 1WC7A 4HS8H 4X4YA 1BF2A 4JZJC 4G42A 1IEAA 4OLZH 5KW9H 5FM8A 3DYOA 1GOHA 3GSRA 4JQXC 4Y4KD 4F7TA 2P5WE 1H8SA 3F7VB 4JHBA 1LP9A 1AD0A 1TJHL 4LEOA 3D5OF 4UT6L 1M4KA 5K93A 5AAWA 3ZL4L 1PW3A 3IFPA 4NP4L 3MCKB 1M05B 3OV6A 4U1IA 1UWXH 1DBJH 3V6OE 1YEGL 2HT4D 3TT3H 2ARJQ 5FUCE 4Z76B 3VFSA 1HCVA 5D8JL 4JZOB 4QCIB 3VXME 4WTZG 2D4FA 3OJDA 4XBEL 3WLBA 2R4RL 3RY6A 4PRDB 5DJ6B 3CLEL 1U91B 3M45A 3C6LC 3UPRB 4A2MA 4YDLC 2WAHA 2CDFA 2VLJD 4RMTA 5ICZA 3WXVH 2E7LA 3ZYIA 1AC6A 4DGVL 4G9FB 3QEUA 4P5TB 5IHZB 5DEFA 4P4RA 2H1PL 3GMPB 1HHHB 4EBQH 4RGNB 4NIKB 4L3EB 4IOFC 1R5VA 2WBJB 4L8CB 2DYPA 5B21A 4JJ5B 2R39A 2KH2B 2HP4A 4XC1L 1CXLA 4XXCC 3PL6D 4PJXB 2HLAB 4L4VA 4R4BA 3W2DH 4GXUN 4O2EA 5I76B 3RAJH 4Z7NE 1I85C 3TNNB 1JMZA 1CG9B 4I8DA 3Q5OA 4OB5H 2C5DC 4YHMH 4JN1H 2NMSA 1FFQA 4HX1A 2P5EB 3OKDB 3F12B 4NQED 1P53A 2ERJC 2BC4A 3VG0H 1N64L 3QCUL 1LO4L 2FRGP 1AI1L 2BX5A 2IANE 1MCPL 4OD1H 4MWFA 1A6UH 3TWCL 1UACH 5IBUB 2EC8A 3HI1B 1RQ5A 1AIFB 5ADOL 3I50L 5KAQF 5F8QC 4PD4K 3M8OH 3JWOC 1B2WL 3ZMRA 1CDHA 3TPUB 1QFHA 3OKLB 4IIQA 3JWOH 2KZWA 3PHOA 5JOPD 2CIIA 5HYIA 4PJIE 2AXFA 2VSDA 3DBXB 3VRLF 1X5XA 3D87B 1G6RH 1ZT4B 2RIKA 1MPAH 4JE4B 2R9HC 5TF1L 4QHUA 1AQKL 1ZMYA 1B88A 4WO4A 3MJ6A 1OD9A 3R0MA 4Y5YB 1UADC 2FJFB 4O2CA 5DDHA 5GGVY 3D85B 2C3VA 5FGCE 3U4BL 4M1GL 4QNPF 3GHBH 3OR7B 4RZCA 4Y2DC 4RGOL 1V3JA 4MLSA 1YEDA 2JKXA 3O0RH 2RQ8A 4UBDC 4YNYB 5EO9B 4M9OA 4N1CA 2VNCA 5I0ZA 1MNUL 3GI9H 2XXCB 1CGWA 2XN9A 4FXGB 2P7TB 1LE5B 3SDDC 4FN0A 2UWEF 3GGWB 3WDIA 3C2AL 3D39D 5DQJA 5SWSB 1REIA 3L9RB 1NGPH 5LBSL 1HSBB 4MDJA 2BNRD 2A9ML 4P59L 3GHEH 4HXBH 2P1YA 1OSPL 3MJ8B 4IDJH 2WQRA 3DUUA 1S78C 3FB6A 1QACA 2IWGA 4NCDA 4FTVE 4PGZA 1AFVH 1CGSH 2CRYA 1A6TB 2DQJH 3D25A 5HHOB 3OKKB 5E00A 5ITFB 4LPWA 4HT1L 4M1DH 4NQEB 3TCLB 1MQ8A 5AD0A 2XA3A 3DV4A 4P46A 2AEPH 4X4YB 2IH1A 3T1FA 4Q0XH 4FQJL 2E7LC 2P48B 3BN9D 3GFUA 1WV7T 3HG1B 4RGMB 2NXZC 3NIGE 3SO3C 1RULL 1YNLH 5CUSL 4DKDC 3CSYB 4CNIB 1P4LA 1G9MH 3QI9A 1DCLA 5IJVB 4Z7VE 4PB9L 4ZOAA 2DKMA 4FZ8L 5C7XL 3QRGH 3GJFH 1P4IH 4XC3H 5HVWA 4WFHE 1NCNA 1CLCA 1MRFL 3FN0H 3PNWB 1NCDL 3L3GB 2UVFA 4GO6B 4M48L 3O2VL 3BN3B 2DBLL 1QOKA 3GIZH 2P5EE 3MBEA 5FUOL 2VL4A 3NPSC 1RZGA 3VD7A 1D5MB 2HT2D 3R8BB 3RNKB 4ELMB 1T21A 2DI7A 2NY2C 3DRTB 4MAUH 3EKCA 5C0RL 2QQNL 1NFIA 1E28A 1ZGLB 3F58H 5GXBB 1FC1A 2R1YA 1BX2B 1RZIA 4D2NA 3ZT6A 2DLIA 4XZUA 5GGSB 2FHFA 1CFBA 3A0OA 1JGUH 5GRVK 4GXVH 1QFWH 1DBJL 4G6AC 4YO0B 4D9RE 1I7UB 1QUNA 3P11H 1DL7H 1A3LH 2I27N 3KPSE 1KCRL 2GJ6B 4HXAH 2A9NH 3QI9C 1QFUL 2OJEB 4E5XB 5H8DA 1BJ1J 4FABL 5D1ZC 4P9MH 4XP6H 4PJXA 3L7EA 4YLQT 2BNUA 1NFDB 3LPWA 3ULVF 1IEAB 1P1ZA 3RDTD 5EO0B 2D0HA 2PYFA 5I16A 4O00A 1BMGA 1AGBB 1MHPH 4X6FA 4IM8A 4P3DB 3L3KB 1E4XL 4PV9A 1WF5A 3MC0A 3SBWC 1XR9A 3SE3C 4AZ8A 1MJJB 2XZQH 5BCAA 5ACZB 2Z31B 1F4YH 3FT4A 1OAYH 2WUCL 5SWQA 3LIZH 3HI1A 1FYTB 3AY4A 5MERB 4ZAKA 5I1EH 2VAAA 4P4KC 43CAA 4JVPA 2Z8WC 3WCYA 4BELD 1J5OL 3BFOA 1OAXH 3U9UB 3ALWA 5CZXD 4ZMAT 2AEPL 4UOW1 2GITA 4KRPC 4HV8A 3MGTB 5AWNH 3FAXA 5EH1A 3OAYH 4FG6D 5T1KB 1XGQA 4FP8H 4PJ8A 3CFBB 4OCWH 1UCBL 5C07E 4HUWB 5H94B 3RY4A 4FMKA 1E6JH 5I73C 1DLFL 5D8JH 1MLCB 1JNHA 5I30H 1GRWA 1GGBH 4MD4B 5ACMA 2XZAH 4PY7A 3C6LA 4NQEE 5BVJB 3QEUB 4JRYD 1FVCA 4OFIA 3AROA 2QSCH 2RHEA 3RUGA 5TE6H 4B53A 4KROC 3NFNB 2DYPB 4YFDB 1KELL 3UTPD 4YWGL 1AJ7H 2BVPB 3RWCA 2W0FA 4U1NB 2AV7B 4NNPL 3OKNA 5I8OL 4I3GA 2BFVH 3CLFH 1Q72H 1YYML 1XCTB 4XHQA 2ZCLH 1FE8H 1MHEA 4MA3A 3TV3L 2MFNA 1DN0B 3GKWL 2GT9B 4PJCB 3MV9B 4UOJA 3X3FH 3PDOA 1LHZA 3C8KB 5HJ3B 5I1HL 3IXTB 4M8QA 5CCKL 3ULSB 4PYHA 5GS1C 2D3VA 4RMWA 4FQLH 4DW2H 4TUKL 3VXQB 5ISZA 4AMKH 1S7WA 3D2UD 3KPNA 4K23H 4LLQB 1RD6A 3RU8L 3UXFA 4JB9L 1FNLA 1PLGL 4CMMB 1C12B 2NR6C 1S7RA 4TTGA 1FVEB 3DXAD 1RZ7L 1M71A 5GIRA 1KSRA 1IKNC 3G08B 4HDIB 5C0AE 4B5EA 1LD9A 4NPYA 3TJHD 1KJ2H 4M5YL 4GT7A 4LQFH 3VXNA 1YN7A 4KDVA 4FQ1H 2O93L 5C0IB 1NUDA 4ZS7L 3QDJE 4NBYB 4G5ZL 3UBXG 1PBYA 3BKJL 4HUMB 5L9DH 1J86A 4L8SA 1CD0A 1I8IA 2A6DB 4ODSL 3MACH 3UZVB 2AW2A 3H7BA 3MRBB 4P2QD 3GK8H 5HY9A 3E8UL 5IFAL 3RZCB 1D6VH 5LJYH 3D48R 4RGNE 3N1PC 4TNWK 4R9HA 3G5XA 3V0WL 2A73B 3NCJL 3BD5A 2IBZY 3MRRA 3SDXF 4JVWA 4HBCL 4P5TD 2FIRT 1MCIA 4MQXC 3TBSB 3BGMB 4KK5C 4OV5A 3ARUA 5F7FA 4YHOH 3RA7H 1L6XA 2UZIH 4QKXB 4BZYA 1MFEL 5HHQA 2J7LA 2BRQA 2ICEA 3B8SA 3QQ3B 3U4EB 3P4MA 3UTSD 5IQ7L 4NGHL 1FNAA 3RNQA 4JQIH 4QXTA 1AJ7L 3ULVD 2VITA 4PJGF 3DVNA 3A6BH 3HNVL 4NM4L 2QR0A 1EPFA 2AP2A 3G5ZA 3GMLB 1B4RA 4JM2A 5I1LA 4U7SA 3VXSE 1IGFL 2YA0A 3O6KH 3BZFA 4GQPH 3HG1A 3FO9A 4LCWD 1PLGH 1ZVSB 5K59E 4X6FB 1WGOA 1DQML 2YS4A 2OTUA 1OARL 2AJZA 4I5BB 2VISB 2FEDC 1M7DA 3O11B 4BH8A 3MBXL 3VGHA 4OM0H 3ZKSD 2F9BT 3VFGH 4ODXB 4JFPA 4QRPB 3N1GC 4NUJB 5AWNL 1IQWL 2XG5A 3O8XC 3D0LA 1NCWH 3EYSH 3N06B 2J3SA 3SKMB 3TNMA 2VQUA 3FO2B 4K94C 4LIQH 5IEHB 4U0QB 4XHJC 2GJJA 4X7FC 5KSBF 3AU1A 4KFZC 5DK3A 4Q58C 5EIIB 1IM3B 4JM4L 1IE5A 2K3TA 3BPLC 4X5WA 4CMHC 2BVOA 4MD0B 1J1OH 3F8UB 4PJ5E 4I1NB 2BVTA 4XMKH 1AXIB 1GYAA 4F15B 1BX2A 4K3HA 4QRSB 4WTWA 4DWHA 5C2UB 2R1WB 3FOLA 1HEZA 3CU7A 4M43H 1YN6B 1ZANH 4EI6B 2ITCA 2YEZA 5FCUH 2QADB 3P77B 3M17A 4GKSA 4LSSH 5D9SB 3D3VE 1CZ8L 5JUEH 4NRYB 5SWSE 1G7IA 2UZIL 4YHYC 5LAXA 1U3HA 3CK0L 1P4IL 4XC3L 2WV3A 2W0FB 5HGDA 1MWAH 4U1JA 5HDQL 1RVFL 4UTAL 4MDIB 3ARBD 2F8VA 1NC2B 3DROA 4PJDF 4RBPK 3RGHA 1P1ZB 1JBJA 1JGEB 1OHQA 4GAJH 3NIFE 5HPOA 5IB5B 3OKOA 2VDML 15C8H 4PV9B 1NAKH 2R2HB 4KZEL 4PTUB 3GBML 4PGCB 3BIAX 2J4WL 2HMIC 2B39A 3UYRH 4Q9QL 1RJYA 4N90D 1E0OB 3KPLB 4LHUD 2ITDA 5H35A 4UNUA 3L3IB 3CFKA 3MR9B 3EDDA 1NCBH 2R56H 4RDQG 4C59B 4XWGL 5L7XH 3NABH 2ZCLL 3RWGB 4HFWA 1ZT7B 2X1QA 4HV8B 3HUJE 4Z7VA 5CJQH 4N1EA 2Y6SD 4N0FA 4XH2B 4KMTL 4YIQA 3MMEA 4YFLF 4RGMC 3FT3B 3O6MH 4H25A 1BAFH 1D6EA 3UMTA 5C3TA 4HLZG 4K3EH 1IAIH 1F4XH 4HK3N 4F58H 4JY4B 3QT2A 4FQPA 1OOAA 3AUVA 4BQ6A 2FATH 2APBA 2GSIA 2H41A 2CK0L 1S7QA 4ZTOH 5KS9E 1PD6A 2HKFH 1LNUA 3FTGB 3BPOC 1HH6B 4PLKD 2JJVA 1W0VB 1P6AB 3ULVH 2CLRB 1K8IB 1HDMB 1K85A 3LDBC 3LS4L 1R24A 1W2KT 3QXDB 2GHWB 5EUOE 1FNFA 3QO0B 4MCZA 4F80A 4K3GA 1S5HA 2VO5A 3FB5A 3EJZC 1G7QB 5MI0C 3VXSD 5ANMA 4QT5B 2PF6A 4L29B 5D5MA 5GGTA 2IPUK 4NO3B 1B90A 3L6FA 2DL9A 4JAMB 1K5NA 2J8HA 3EJZD 4AJ0A 1KN2L 3HAEA 4FABH 5IM7B 1R3IL 4U05A 1FG2B 4NC0B 1FZOB 4LOUD 1GAFH 3HFML 3C2AH 1SJVA 8CGTA 4XBGA 2YD4A 4P2OB 2PYEE 3LQZA 2W0PA 3G5ZB 3HLAB 3O9WA 5E8NB 1G7MB 2ZPKH 3GMRA 3WNPA 2ILLA 3O0RL 5L88H 3ARFC 5DQDL 4MA7L 1GZQA 5J1SC 1BOGA 2E6PA 4PB0H 1HYRC 3K2MC 1MJ8L 3EO1A 4LEOB 3RIAF 3T4AB 5HYQA 1L0QA 2X9WA 1RSFA 4UOW0 4XI5C 1GSMA 1NFDF 1I8MA 1OAKL 1CDUA 4K3DL 3C9NB 4PGEA 4UILH 3LSOB 2C26A 3FO2A 2Q6WA 2ATKA 2DL2A 3IKKA 4GLRH 4JM2D 1JWUA 2I5YL 1AGEA 5E8EB 2GK2A 4RIRB 4UB0L 4QHLB 2VH5L 4QHMB 3IB4A 4Y2DA 5FOBA 3WFCL 2AJ3A 3T4YA 3QUZA 2B8OT 3DVGA 4TVSa 5EN2B 4FZ8H 3L5WA 2NNAA 4ZUWA 3RTQA 5D7IB 2XOTA 5CIPB 4PRHE 1UEYA 2WBKA 3PQYE 4MB5A 2ENYA 1ZLSL 3ZE1F 5E7BA 2Q76B 4HFUL 4LKXB 5E7FA 2AV1A 3EYUH 2ITCB 5GSVA 5FYKU 2ICEB 3U4EA 2NTFB 5FV1L 3IDIB 1MQKL 1DBBL 4P5TA 4ZQKA 4CAGA 3VFPA 1ZLUK 5IJKC 1DQLH 5BV7H 5ERWB 2ZKHH 4ISVB 2E5EA 4X8XA 4JREB 4X6CB 3NIFF 2FD6L 1F3JA 4WI4A 3B83A 2BVQA 2IFGA 5ECJE 5F1KC 1CXIA 2XKNA 2AABH 3GSRB 4N0UA 4GW4B 5D5MF 4KRNA 4V2BA 2I07B 2YD5A 5DJ8B 5IBLC 2VDKH 1MPAL 3KJ6H 3TJEL 3I6GA 4V1DA 2RAMA 4NQTA 5F7DA 1IGFH 4P23D 3DNKA 2R2EA 5I1CH 4NQVB 4JPIA 2ZNXA 4PJEF 4Z76A 4XRCB 1F90H 1QVOB 3TPUA 4HLZH 2KBGA 1F3DJ 1X9QA 5ALCL 2CMRH 1QEWA 1N6VA 4DKAA 5J11C 3B9DA 4EOWH 2QJDA 1CL7H 4G8GA 5IHLB 4QRSA 4CU7A 5TQ2H 4I13B 4LLMB 4MJID 2I60H 1TPXC 5F6IB 1JFQL 4HUXA 5ICZB 1B0GB 3QDMB 4OF5A 5C6WH 5DJDB 4XC1H 4KKNA 5DUML 3TYFA 2Y5TB 5AZEH 3GHEL 5CHNB 4U6HA 1U58B 1N6QH 3X12B 4MSWB 5IWLC 2VLLA 1VPOH 5HYJE 2X44D 1VGEH 4G43B 1JZ2A 1GL4B 2A6IA 4L4VB 3P9MA 2R2BA 2QQQA 1SVZA 4GG6E 3IVKA 4X9FA 1CLOH 4OD1L 3SJVE 2YPVH 1TCMA 3P73A 1CI5A 4KMQA 4NNYB 3KYNA 3M8OL 1LVEA 4M6AA 4QXUH 5FO8B 2FATL 1TTGA 3STLB 3OJVC 4XCEB 4PLJD 5D2LE 1DUYB 4MWFB 3KPRB 1CDGA 4N1HB 1YEEH 4WY7H 5IW6A 3STBA 1E4WL 3SKNB 4EZMA 4ZXBB 4ZO7A 5DZNA 5DGQA 3ZO0A 4ODHH 5GGRY 1WWWX 3TGXA 3O2WL 3C08L 5C0JA 1I1FA 4NO0D 3MRGA 1A6VL 5BZWA 5EBGA 1JV5B 5CINL 5CD5C 4U1IB 3QIBD 2XA8L 1I3GL 2CDGB 3QUZD 3ROOB 4Q7DA 3RP1A 1I1AD 3V5HB 3IJHA 3OHXB 3HS0B 3F5WA 3VWJC 3K8MA 4JLRB 2FECL 1ZS8A 1C08B 1FPTH 5ADPL 2VZTA 4ORGB 1MJUL 1FCCA 4MQ7B 3T4AA 3SGKA 1T7WA 4JM2F 2QQKL 1KLUA 1D5ZB 1T5XB 3FRPA 1KJ3H 1QHPA 1NMCC 2X42A 3PNWA 1TPXB 5F6IC 4HUVA 4WW2A 5K33A 4PREA 1J1OL 3HPJA 4XNQA 4NKIL 3FFCA 1ZLWK 4MAYC 4LQFL 4WFED 2VQ1B 3MLUH 1A47A 1J1PL 3MOBL 4QRTB 4PJIF 1IC4L 2BK8A 5IHZA 1ORQA 4JHAL 3SDDB 4YDLB 4GBXB 1JNLL 3BZ4A 3T4YB 4ZUTA 2VL5B 3ARTA 3RTQB 1K4DA 1TCRB 1P7QD 3O9WD 4YHIA 4ONGL 5DLMH 2BNQB 2WINB 2DWDB 3B9KB 3PWLB 1JGLL 4EI5B 5JUEL 5C8JA 4X4MA 3T09A 4HIJA 5JW4R 5I76A 4LPTA 3JV4B 3U46B 2EDYA 3MOBH 4WUUB 2YPKB 5A1AA 1KEML 5C0BB 5HHOA 5E9DE 3TA3C 5DJAA 2K9UA 4LLWB 4YZFE 3TZVD 4D0BB 5FV2A 3T0EE 1N0LA 2DM3A 3VXPA 5KZCB 2Y1VA 1EUUA 3EFDH 3BKJH 3L7EB 3GMRB 3SE8L 1QPPA 2F5BH 5F1NA 4F7EB 4NZDA 1FZJA 3MV7A 1QQDA 1NDMB 4CNIA 1MRCH 4IIQB 5EOQL 1IZJA 3BAEH 5ENWB 1UWGL 1FIGL 5B8CA 2PW2A 1BD2B 5LWYL 1ONQA 1ERNA 3QHTC 5JA9A 1YEEL 1YNTA 3RVUC 1OAUL 3QQ9D 1NCAL 1ZE3C 5E4EC 4DVBA 1Q38A 1A4KA 1EHLH 3FQRA 5IW3A 4UDTB 2IAMC 1A2YA 1QBML 4O2CB 1FN4B 5DDHB 1AGEB 2JCCE 5E8EA 1E4KA 5IB1B 4QOKE 1F4HA 1AQDA 3TEUA 1MCBA 5IMMB 4HKBB 4EQ3A 4J23A 1KIQB 5DTFB 4GXVL 3QFJD 3IFLH 1I85A 3RL1A 5DD6B 4F8TA 1IC1A 5A16A 1RUKH 1X5YA 2VSCA 3M1BB 4JQVA 1EO8L 1BVLA 3V8CA 2UVEA 4KK8D 4NQXB 4Y89A 3NPZB 4LU5L 3AVEA 5TJWK 3Q6FA 4HCRH 2NTFA 1INEH 1UXWA 4I18C 1CT8A 1OTSD 2CKBL 4HWZB 2F58L 4YXKH 3RWFB 3MRJB 5HVFB 3R8QA 4CW1B 4FFYH 1GC1H 3TFKD 3CX5K 1RZJC 2D9QB 4WI7A 3C09C 1YC8A 3N9GL 5FM5O 1PG7H 3X12A 1G9NH 1NCDH 2EDHA 1EAJA 3DWTA 4S1DD 4ZDHB 3TA3B 5JHDE 1H3WM 4D9RD 2BVQB 4DGIL 1J0IA 3BN9C 3S96B 2Q8BH 5F9WB 3LN9A 2VR4A 4NBZB 1JWSB 3IRZA 1T7XA 1WFUA 5JHDD 1UM6L 5FYJH 2B1AL 1OAXL 3QH3B 5ACZA 4XCEA 1NBVH 1KXQE 3WL9B 4WGWB 3VXTA 4UV4L 1JTTA 4A6YB 3DJ9A 4R96A 1TVBA 2ESVD 3CNKA 5F9JA 5HDLA 3KWWB 4H26B 1FFNA 2O5XH 3D3VD 3BP6A 4HGKC 3VXUA 1OQOA 2GITB 4M7JL 2ARJB 3PV6A 5BZWB 5CAYB 3WFEH 4IOIA 1F02I 1S9KC 5F88B 2VDQH 4HF5H 2FD6H 1UWEL 2HRPH 5FK9A 5IG7B 1T89A 3AREB 1G9EA 3TBTB 1DUZA 3GJFK 3A6OA 4HHAB 3EO9H 4PY7B 5BW7C 1D5MA 3DMMA 1T21B 4D0DA 1IRAY 1FDLL 1ULVA 3F6LA 4LPVA 1FVCB 5AZ2L 3T0EB 4PJXF 4X6DE 3S37X 4JB9H 3QQ9C 3RUGB 2BDNH 4KK5D 4RWHA 5HYJB 5A3IC 4NO5A 2F19H 3VW3H 4QOKA 4HUVB 1KEGL 5KS9A 1A1OB 1S5IH 4NFDA 1T2JA 4QXGL 4EXKA 1CU4H 4HWEL 2HVKA 4APQD 3WKMH 5GZOD 3UTZB 2VLRA 3CC5A 1FAKT 5ICXB 4FQJH 1AE6L 3T77B 2VMFA 4BH7B 1X5KA 3KYNB 1OSPH 1YZZA 4FQQB 4ELKB 3MYJB 3B9AA 2AEQL 2WINA 1ZSDA 4I4WB 3TA3D 3QCVL 2JJTC 1N2RB 3T2NL 3QNYA 1AGBA 1YUHB 35C8H 4GAYA 3RIAK 2V5RA 2VR9A 4K3DH 2QSCL 1NGWB 3VGEA 1J18A 4ZXBA 2EICA 3LRSB 4JHAH 1QHOA 4Q0XL 4N9OB 2XYCA 3V95A 5HHOD 3SKUD 1NFDE 1XAUA 2BXYA 1YNLL 5CUSH 5ESAB 3GHBL 2NY6B 3U0TA 4ZAKB 1MCPH 5H37H 3BZFB 4ETYA 4OFYD 3S4SB 4Z95H 1X5AA 3RVXD 4GRLA 5IEKA 2F54E 1EERB 3CCHA 2IEPA 1NBQA 2DJUA 4I77L 4LHUB 5SX5K 1M7DB 3U0WL 3JZ7A 5B39B 3DI2B 4M6MH 2R0ZH 1UENA 1BM3H 2X89A 3GI8H 3ZYJA 3F7PC 3TVMC 2FNBA 5D1XB 2DLFH 2WM0A 1G6RL 4XTRC 1QFWI 4LCWE 1MCCA 5EC2B 1DVFC 3QIWB 4AEHH 3FFCE 2PN5A 2EC9T 2KQNA 1C5DB 3C6LB 1AQKH 5E6ID 5BVJA 1I75A 2EZ0D 5AG8A 4JHWH 3PIQB 1IAMA 3U0WH 1AFVL 1CGSL 2BRRH 4J3VA 4LGRB 3NFNA 4LL9A 1VADB 4KVCH 5FA4A 2QHLA 1S7TA 3M1BA 5I1DB 1KPUA 1AGCA 4EUPG 4JPVH 4WENB 5L6YH 1CXEA 2BXZA 1BFVH 2X2YA 3U46A 4XVTL 4XNUH 3QDHA 1T0NA 3RZCD 2PTTB 4P2RB 1DQDH 1Z3GH 5SWZA 2LVEA 1I9RL 4OF6A 1MVFA 3DVNB 5DZLA 5EB9A 4UU9B 1EFXB 4W6XB 2X4TA 1D9KC 4MDIA 4WW1A 4XAWH 7FABL 2WWKO 3KPNB 2A83B 4WDIA 5KSAD 1I9IL 2R69H 2YPLE 1NDMA 4HJJL 1UJ3C 3RUGE 4BSWB 2VXVL 4OJFL 4KRLB 3QDGE 2LQRA 1CZ8H 2IMMA 4NFCA 1AI1H 3GNMH 4MA1C 3RWHB 4FFVD 2B2XL 3IFPB 3VWJD 4I77H 4KUCF 1JP5A 2XZCH 4G80B 4ZFGH 3DPBA 3EGSA 4E9LA 2V7HA 3IAPA 4R96B 1MCKA 2HH0H 4PJGE 3DXAE 3CFKB 4Q9CA 4O9HH 1YYLL 4PS4H 1MI5B 5DJ6A 1G0DA 3DETD 5D7SL 5HYSG 3AS0A 1KIPB 4L8SB 2X1WL 3BP5A 3TVMD 2A6DA 4NCC2 1F11A 1MCJA 5D70L 5C70A 5J0BA 5F9OH 2BDNL 5C07D 3WNOA 4X7DC 2YZ1A 4DN3L 4GRMB 1J1XH 4UT6H 1T0MB 3BKML 2AQ1A 3LRHA 3HC3L 3MXVL 3Q6FB 4KKBD 5E03A 3AGVA 5H2BB 4Y5VA 1RURL 3GIVB 2DKUA 5CEYB 4NRYA 3TP4A 3THML 4IS6A 1KV3A 2X4SB 1R6VA 3LKPA 3GSOB 4L3EA 5ID1B 5IT2L 3NABL 2NYYD 4L8CA 3OPZL 4NKDA 1HHKB 4CVZA 5IWLA 4BUGA 4HLJA 3RGVB 1T1XA 1CFNA 3OAZK 1BQHA 1KPVA 5DK2B 2IF7A 4NHCL 3MRIA 3T8XA 1V3MA 3EOAB 5FYLE 3CDFA 5HDBF 3MOAH 1G7QA 1CD1B 2OBGA 3GSQA 2B0SL 4Z7UE 4Z7QE 3LQAC 2FH8A 4XGZB 2BC4B 2R2HA 1P7HL 1KCVH 4PGCA 3CVHB 1KEMH 1NGYB 3RY6C 2ADIB 1PYWB 1K5NB 3VW3L 1QR1B 5GGTL 4MJ5B 1A6TA 3OXRA 1D5BA 4H88L 1HXMB 5DQ9A 4GRLD 3O11A 4Z7OE 5E08H 5L2JA 2P5WD 3ROLB 5K9JL 4NQUA 2WP3O 3E6HA 5IGXL 3DYPA 3RWGA 2HVJA 5DT1L 1FP5A 5C0AA 1V8HA 1IGJB 2HT3C 4YXLL 4XPGH 3BZEB 2GTWB 4UNTA 4TQEL 2LU4A 4Y1AA 4BQBA 3DHMA 4Y2OA 3S8WA 1P2CB 5I17A 4G5ZH 3GMOB 3QUML 5F7YC 3OXSB 5GGVL 5IBUG 5EPMB 1WTGT 1HILB 4IHOA 4X6EA 1UM6H 3RVVD 3LS4H 3N50A 2DICA 2R1WA 3DETC 4OLYL 3MLRL 1U93B 3PABB 1XF3B 3IKCA 4Y4FD 3VFVA 1LNUB 3I6LE 3LH2L 4NP4H 4X4XB 1QRKA 1IGML 2CKBA 3DX7B 5LVEA 3CFDA 3FO1B 3NCBB 3ZDYE 5KSBA 3QIBC 5LAXB 3QEHB 4RNRB 4IMLA 5ACLA 9CGTA 3E0GA 1N7ML 3O2WH 3NN8A 5D5MB 2EKJA 2EIZB 4NO3A 1UWEH 4P46D 2X10A 3ARZA 5F70A 1TJIL 2E27L 4E41E 3CDGB 1HOCB 1MCNA 3FB6B 1AHWB 5F7UA 4X6CF 4D94A 5MENB 1NJ9A 1CLYL 1SYVB 4Z77B 1YC7A 2X5PA 4MXWH 4EUPA 5F9WC 4EVNA 4TTDD 1PDKA 4OAWB 5FECB 3RPIB 3LQZB 1A14L 2BNRE 4OCXH 3RZCC 3G6JE 4KH2A 4XPBH 1IAKA 4HWEH 1N0XH 2EO9A 3O6FB 5FO7B 1S7VA 4K71B 2B1HL 1WZ1H 1RJZB 1R3HB 2Y07H 1IC7L 2I07A 1G1CA 4RAUB 4KK8C 2DD8H 3QI9B 1OAZH 1BD2D 5HYSA 2GTZA 1XGRA 3ORJA 4N0FB 4N0CD 3MRKB 4YIQB 1GZPA 4H25B 1UFUA 3TH3T 2ZJSL 3C9NA 4PGEB 4Y4FA 4U1HB 4LGPB 3CMOL 3MV9E 2F53D 1C5DA 5LGKA 1XH3A 2BSSB 1RPQA 2CR3A 3QNZB 3VXRD 2ATPA 5HHOE 2XQYG 3P9WB 3CZFB 4S10A 1IGMH 1Y6KR 4S11A 1ZGLA 5MEOA 5C09E 1DBML 3PQYA 4WEMB 1NL0L 2YPLD 1WSST 4L9LC 1Q1JH 2ED9A 4UZGA 5IROA 5H2BA 3CH1B 4YEFA 2PTTA 1JTPA 2WQ8A 1U8MA 1GGIH 5T5FL 5CHNA 4U1LA 4HKJB 3X14B 4ISVA 1EHXA 3ELAT 3SO3B 1QRNA 1FJ1A 2IAND 5LQBH 3RWJA 4G43A 1FO0H 5DC4B 5J57B 3VG9B 4GXUM 3WFHB 2BNUB 2YKLH 4U1SB 1VKXA 3RA7L 4QWWD 4M1CC 5DHYB 2JK5B 5ID0A 4OCRH 3O3AA 4K3JL 1U36A 3SCMC 1YDPB 4AL8L 2HN7B 3INUL 4M8QB 4Y4HB 2D7QA 4OLWH 3T2PA 1U8PA 1WZ1L 4BFIB 1FGNL 2AJSL 3V0AC 4KDTC 1ITBB 2CRIA 1QR1A 1U6AL 5IBTH 1BOGB 3CU1A 5I1GH 3ZKXC 2JJWA 2G60H 3C60D 3BJLA 1QBLH 4XNXL 5L9DL 4PJAF 1DQQA 4RMSA 2OMNA 2ZSVA 3OSKA 2P42B 3IYLW 2V5YA 4P9HC 3CXDH 4H5SB 5DRXB 5I1JH 2IG2H 4MHHI 1IQWH 1T89C 2L4OA 3BISA 3VXNB 5E1HB 3PF2A 2X6MA 4Y2DB 5FOBB 5JW4Q 1HQRB 2HRLA 2VOTA 3ZLQC 1RZ8B 3QBTB 4PJFA 5J4MA 1I8LC 5ICYA 3PGDA 4ZAKC 1QSED 12E8L 2MOVA 2PETA 1E6OH 4XPAH 2XXMB 4IS6B 3A67H 2BNRB 3MV8A 2HJFB 4U6HB 1A7RH 1GVIA 5JPNA 1NANI 2YPVL 3DARA 3EYUL 3X3FL 3T3PF 4KDTA 3OKNB 3UJTL 4GS7B 3IS0X 3PV7A 4HULB 4Z7UB 5IIEA 3CFDB 1GGYA 4MXQC 4PS4L 2OK0L 4RFOH 3MA7B 4QRQB 4FRWA 4TRPL 2VLRE 3QUMH 5AAMA 3NN8B 3FL7A 3PDDA 4GQ9L 4LCUB 3ILPB 4MA8H 1IGCH 4RQQB 1XGYH 3X13B 5F71A 1JN6A 4OI9A 3O4LA 3VE0B 1OAQL 5GS0L 3KNBB 3HPLB 5T1DL 2UWEB 5D7JA 4LKCB 5EU4A 1I3GH 4UMGA 1JIBA 4BYHA 4HPYH 2EYTB 1F42A 5E56A 2A9NL 2Y06L 4RMUA 5E2UH 1T66D 3UTSA 3OKEA 3G5YB 5EG6C 4JPIB 1LEGA 3LKQB 4EN3D 1VFAB 2VAAB 1H15B 1XGUA 5D7JD 3I75B 4WRLA 4YDKH 5KSBE 5CCKH 5CP3A 2WIIB 3WUWB 1ZHKA 2Q20A 5FHAL 1FNSH 4JVUA 3UBXA 3KYOB 3MRQB 1DQTA 3QHFH 3ALPA 4IHOB 4X6EB 4OF7A 2DWEB 3Q1SH 3MRCB 1YYLH 5GSRB 2XZQL 2DMKA 1MCSA 3WHXA 1YY8A 3X3GH 5ILTH 1I1YA 4I3SL 4MD4A 3T0DA 2W9EH 1YQ2A 4EDWH 5E2WL 4PRID 4MAUL 1A7PL 3MXWH 1ZV5A 4XXDB 3MFFB 4S1QH 2BVOB 2FYYB 4MD0A 3VD5A 1JHKL 1TITA 1KIQA 5DTFA 2V5TA 4EDXA 5AYUH 3MRLA 2CGRL 3O41A 3TO4D 1X5ZA 1MFCL 1FC2D 2DLFL 3B9KA 5FKPA 1CBVL 5D96C 1MQKH 3PWPA 3CDGA 2OP4L 2EYSB 3PL6C 1N5YL 3EYOA 4KJQD 1JF1B 1S9WA 3NOIA 4OGAC 1T6VN 3PP4H 2GT9A 5E6ZA 4G7VL 4BFGA 4QXTB 3LS5H 4IJ3C 5IVXE 1A7NH 4X5LA 1CDJA 3JVGC 5GJTH 3C09B 1HWHB 2QSQA 4LF3B 5GHWH 1BQSA 1FSKC 4UT9L 4K2UH 4IRZL 1A22B 1CD9B 1MWAA 3ARDB 3MREB 4HPYL 5C07B 4YXHH 1NC2A 4O2EB 4XT1C 4OLEA 1QPXA 1OB1B 3IETA 1R3HA 2HT3D 3QPXH 1JPST 4XP9L 3OG6B 2PW2B 4H1LA 1GGUA 1IGCL 4J3XA 1SBSH 2P24A 2A0LC 4KI1A 1FVEA 2QTEA 3H6JA 4HH9A 5CSZA 5DS8B 5IB4A 5J06A 2R29H 3MRKA 3DIFA 3W5MA 4X8JA 1KC5H 1P9MA 2NY2B 4OIBA 3WSQH 1BGXL 5D2LF 5KG9B 1UM5L 2Y36L 2E8YA 1CL7L 5J56B 5D7LE 2Z8RA 4XNZC 2X7LA 1OD7A 4PB9H 2EIBA 3LN4B 2D03H 3CSGA 3H7BB 3MRBA 5GRJH 1D6EB 2YN5A 1CDBA 4PG9B 1S9YB 1EHNA 3G5VA 5EZJA 3M17B 4KJYA 5FGBA 4YHNA 4WIQA 1BIIB 1CBVH 5I74C 2YN3A 3KPSB 3QUXD 1U8MB 1G7IB 2DQFA 3QA3A 2HJFA 2FJHB 4R4FH 3TBSA 3ZKMC 4Y1AE 2QSVA 3SJVD 3AM8A 2SEBB 4APQB 3RBSA 4KGJA 5EUOA 3U36A 4K8RL 4RMRA 5L0QB 3HR6A 1Z2KA 4KZEH 2BRRL 4UT9H 1KLGB 1NPUA 3ZE1E 3O3AB 4H20H 1Y18B 4JPWH 3H2WA 5FCUL 2JB6A 4RWYL 4YGAB 5JR1H 1GCFA 2LABA 2N4IA 12E8H 1HI6A 4HG4K 1ZSDB 2XKSA 1AO7D 1U8PB 3NMEA 5C92A 3MJ8A 3VXTB 5GISL 3U82B 2B5IB 3CK0H 1XIWA 5DWUL 4YBLB 5IROC 3QIUA 1NC4B 3KHQA 2V9RA 1U8IA 2WMPA 4HT1H 2DTSA 1JNNL 3WXWH 4PBWD 4Z7VB 3HUJA 4R0LC 4Q9BA 4DKEL 5D7KD 4NO0B 4DGVH 3MMEB 2H2PC 5KSUA 2ORBL 2IQAA 4ETQB 4OZIF 5A2JH 3VI3E 4JHWL 3KS0J 3LV3A 4XP1H 2HT2C 3NFPB 2YD3A 3OJDB 4PRBB 4JFYB 4OLZL 2J4WH 5IVXB 1DQMH 35C8L 4NSKA 2VXSH 2FWOA 3RWIA 3L5IA 1IGIH 2NY7L 4Y8DC 3HI5L 4Z8FH 3I6KB 5GSRA 1QTYT 2VIRA 4QOKB 2Q6WB 2RCSH 3PXJA 4JFOA 3GSVB 4RDQF 4ZUSA 2LAGB 3MBEB 4GUPB 2VLRB 3SDYH 5GS3A 4GMTH 3TFKC 1N5YH 1Q0XL 3BRGC 4M03A 1A7RL 1CTNA 1CFTB 1NSNL 4PJHB 3ALXA 2WLYA 4YHOL 1RZIB 4L9LB 5IB3B 4Z7WA 3MYJA 1JE6A 1EGJL 1XF1A 3BVNB 1T4KA 1X4XA 4B41A 5E1AA 4J3WA 3UTQA 1VB9A 5I8EA 3Q5YA 1MREH 1PKOA 2GCYB 3U4AA 5A40E 1TNMA 3DX8A 3KLAB 5MEND 4U7MA 1CN4A 3SE4A 3HAEB 4YDVB 5E2WH 4JKPH 4C56B 3WIHL 1EEQA 2ZUXA 4FHBD 4P2RA 3BSZL 2GUOA 2XPGB 5EZIL 1WEJH 2X4PA 3UEZA 3S97C 1AKJD 3TCLA 2H1PH 5AD0B 2D31B 1K3IA 4RFNB 5C0AD 1AIFA 5ESAA 3U0TB 2XRAL 5ESVB 5TQ0L 4WHDA 3U83A 5E8DH 4Y19B 4AY0A 3QUYB 3MTRA 1PSKH 5EU7E 4WTXA 2OK0H 2G9HB 3WIHH 4LHUA 2FX7L 4P2QB 4OCYL 4KZDL 1E4XI 3VMOA 4ZNEA 2XY2A 4Q9RH 4GRLC 1FSKB 3RWHA 1Y6MR 4MX7B 3OR6A 4MNGA 2AAVA 5EUKB 2YD9A 4MQXD 2ED7A 1DJSA 1UZ8A 2M8XA 5FYLD 1GXEA 2GFBA 3BE1L 3LD8B 3FFDA 1JYWA 1MIMH 4P9HL 1HKLH 4P2OC 2DD8L 2EO1A 4ELMA 5JOFB 1F4WH 4OFVA 1EGJA 2LFGA 5EN2A 2G2RB 4ZYKB 5D7IA 4M43L 5F96L 2B7DT 3G6AA 1U9KA 5GGUA 4XB8A 3QJFB 4OIAA 4U6XA 5GRWA 2JJUA 2V6HA 4DGYH 3FT2B 3G5VB 2R0WL 3LPGA 1BQHG 4NJ9L 3QUYD 3QO0A 1DEEB 3LEYL 1NDGA 3DO3A 4U2YA 3I9GH 5DA0B 1XFPA 5IF0B 4XBPB 1DQJA 3G6DH 3TBVA 2MWCA 5D1ZA 5D7IF 1U58A 2L7UA 5J6HB 4ONGH 5DLML 5FM5M 4UBDD 5E08L 5E99H 1NFDA 3FHAA 5DHXB 2PR4L 2YXMA 3C08H 3GJFB 4MHHG 3U6RA 2XTJC 1S7XB 1X4ZA 2R23B 2Q86A 3NA4A 3S98A 4LCIL 3VRIA 5MEPA 5I71B 4P2OA 1BWWA 1GGIL 2VABA 5KVMC 4WV1B 3G6DL 3ME0A 3CVHA 1IZKA 3P0VH 2R2EB 5JXEC 4F7PB 3QUZC 3MUHL 5MERA 4XMLH 1W0YT 5F1OB 3IS1X 3O6KL 4WWKA 1JHTA 1L7TL 4TUJB 1DVFD 4PP1D 4O2FA 3BHBB 3RJDA 4ELMF 1INDL 1HQ4B 4XP4H 4DTGH 1S7RB 2EYRB 1JYNA 1A7QL 1Q0YH 4U3HA 5F7WC 4UQ3A 3P0VL 3DI3B 3THMH 4MD5A 4HIXL 3V5HA 4DOHB 1I7ZA 1GGTA 3B5HA 1TETL 1RZGB 5D6DA 5DWUH 3MA9H 4OLUL 2EEDA 5GJSH 3O3BA 3ARGA 2ZOLB 1CL7I 4GMTL 1QP1A 1KCKA 3KPPB 2YC1B 4JKWA 3FB8B 4HIHA 2WSKA 3VFWA 4TNWF 2SEBA 1CLZH 1U8HB 2PYEB 3BPNC 4U1NA 4MSWA 1WWBX 1P7KA 3LHPL 4JFOB 1SEQH 1UZ6E 2J6EA 3V6OA 2HFEB 1BD2E 3FAWA 1V7MH 3VDAA 1DN0A 2VXQL 3IDXH 2OQJB 2A73A 3LIZL 4TOYL 4WJ5B 3P0GB 5L2KB 1EK3A 5IB3A 4XGZA 1T2QL 4WW1B 4D9LL 3HI5H 4TPRH 5AZEL 3KPRA 5JQ6L 2GCYA 3JV4A 5M94B 5E9DA 3S3PA 1OY3B 1S7WB 2VWEE 4JQXA 1CE1L 4OFYA 3Q0HA 4TQEH 4OD3L 5C09D 3W11D 4JN2A 4D8PB 1UCBH 1H3GA 3AAZA 4YR6A 4OZIA 3SDYL 1EEUA 2KL6A 3CVIL 1E4KC 2HVJB 2R0KH 3IJSB 5BV7L 3HE7A 4E41D 3FT4B 3HUJB 1AHWC 1Q9KA 4YX2H 1VGKB 3G08A 4HDIA 3LEXA 5I1HH 4PJ5A 2HH0L 2AQ3A 3O3DA 4F7EA 4CKVX 3NFPA 3O8XB 3V7MA 4Z78A 3JWDH 3MQIA 1LO5A 2ICWB 2HMID 4R2GD 4I5BA 5ENWA 3HE6C 3MNVB 4UDUA 1QEWB 3UBXI 3H3PH 2WP3T 5IBLD 3HR5A 1I8IB 2DJSA 4X9GA 1A4KB 5F96H 1R3IH 4BM7A 1HHGB 4NZUH 2CKBB 4L4JA 2R9HD 4X83A 2X4QA 3BDBA 3S35X 5IHUH 4YXHL 5DT1H 1ACYH 2XQBL 4IMLB 2FJGB 5DD6A 3GSXB 5HHXL 1BIHA 5T1KD 2D2OA 4P9ML 1OF2B 4XP6L 4OLXL 5TQ2L 1CGUA 3IFNH 2N7AA 1JPFA 3B5TA 3DX8B 5JLZB 3RDTB 4KGLA 4NWTL 5FUZL 1EA9C 5F1SA 3RNQB 4YDVA 4C56A 5KSVB 3DUHA 3LD8C 1HH9B 4OIIH 4JFEE 4CW1A 2A6JA 4BK5A 3IFOA 1U2CA 2EDOA 3LKOA 5FYKD 1MOEA 1F4YL 1N26A 1OTSC 1KCSL 1HN1A 2NR6D 1A1NA 1AXSA 3VXRB 3MLXH 5FO7A 4M7KL 2GQHA 4OUUB 2QV2A 1QSFD 5CP7B 3TVMB 1VDGA 2JK5A 1DFBL 4NQDD 5C08E 5I1EL 1K4CB 4K71C 3VD4A 4AEEA 3ARED 1RUQH 5IVOA 4PRAA 2AXHA 5C0EA 4BH8B 4X9IA 2UY6A 3FZUD 3HZMA 5DRWB 5GIRB 2CDGA 4I2XE 1GZPB 5DK0B 4R8WL 2Q1EA 5TFSL 5CGMA 1K3ZA 3UTTA 1Q9LB 4KKCC 1JHTB 5JW4N 1YJDC 1CGYA 3S3SA 3RIFF 4U0RB 1X3DA 1YPZB 4J4PD 1IM3A 4TVPE 1U95A 5I8KL 4S1RL 1FLRL 4PJBA 4KTYA 1F2QA 4NUGH 5D2LA 3WUWG 1D3CA 4PREB 5FK9B 3PQYB 1MJ7H 3FOMA 1QFWL 2XQBH 3O45A 1JHLL 1I9JL 1QSEB 3WUZA 4GKZA 3PGDB 2CKNA 4J3SA 5CMAA 3ZDZF 1ED3B 3SOBL 3KPTA 1NLDH 1FGVH 3RWFA 3CX5J 5JPMA 5DJ0A 3KPPA 3BPOB 4Y19D 4NO5B 2VERN 4NQCD 4PGBB 3TBVB 2ARWA 1ZA3B 5MEQB 1BFSA 4Z0BL 3GNML 1MCQA 3WXWL 4ZFOL 1PY4A 5HVHC 3C2SA 5A2LH 1OM3H 4NNXB 1CDCA 4Z7UA 1K8DA 5DJZA 1BFOB 2HLFC 5DJAB 4YHML 1DBBH 4NZTH 1WIUA 3KAAA 2W60A 1N64H 4YDKL 3L5JA 3L6FB 4LSPH 4RGND 4L3CB 1KOAA 4WTZA 3PP4L 3RWDA 5FF6B 3VE0A 5D7JC 3MNZB 4F7TB 1D9KB 5I66A 4YHLL 5F9JB 4P2QE 2VISA 2GKIA 5DR5H 2EDQA 5K9KA 4ZOBA 1EZVY 5IFHH 4L4TD 1F5WA 4HZLB 4L4TE 4JGUA 1G1YA 3Q6GL 1IEBB 4XCCH 5CP3H 4RA3A 4Z18A 2I25N 3F6IA 1ADQH 3NH7L 5IESH 3PGFL 3RUGF 3FQRB 1T2QH 2W38A 3D85D 4A6YH 4KY1L 3BI9X 4S1QL 2J6EL 1ETZB 4UAOC 4P2RE 4D0CB 1FG9C 1G7LB 2DQUL 4N68A 4ZSOE 2PTVA 4HK3J 4IEFB 5HHMB 3TIEA 5GS0H 2VE6A 5T1MA 3FN3A 2F15A 2N7BA 2D0GA 1K2DA 2B20A 1C5CL 2IH3B 4M00A 2BNRA 3MV8B 1FGNH 2AI0L 4HIHB 1LK3L 4FNLL 4L5FL 5TPWL 1MUJB 4D9QE 5E2UL 2YEZB 2ATKB 5C0NC 4BUHA 1U3JA 2VDRL 4NQSB 4OZIE 3S88L 1BREA 1QBMH 3HFMH 3QXDA 2IALA 4GW5B 1KJMB 4KK9D 4NQCE 4PGJA 5EOTA 4XAKE 4L29A 1YJDH 4X5XB 3OAYK 5DSCA 3CMGA 4P3WA 4GBXD 4F8QA 3P2TA 1UEMA 1UKQA 2YKLL 3UPCA 3QUKA 5BQ7B 4I48B 4EXPX 3QJHB 3T0WA 2X70B 3QDGA 2FX8H 3FN9A 1TZGH 5CSGA 1YMHA 3MLTB 4Z7QF 2GJ6E 1T1WB 2CDEB 2MHAB 3EFDL 3SE3A 1BAFL 3MUGA 4CUCA 3N1QC 3UJJH 1FNSL 5GRUH 3NCMA 4LRIA 4GAGL 1I1AC 1G7MA 5EOCJ 5IOPA 1SEQL 4X7TB 4HQQH 1S8DB 3RVTD 4LSQH 3TZVB 1EX0A 2GYSA 1M1SA 3CSPA 4Z5RB 4PFEA 5DS8A 1IT9L 4YX2L 3N1MC 3ZE2F 3RQ3A 4F2MA 3CXHJ 3QDAA 4QTIL 1UH3A 3HRZB 4KRPB 3WS6C 1QD0A 4JY4A 1UXSA 5TGBA 4Y0GA 4BFBD 1RIHL 1OGAB 1URLA 3Q2CA 2R4SL 4TUKH 3C5ZD 4X99A 1C1EL 3QQ4A 2GSIB 5EZOL 5KAQG 1EXUA 4LRNH 5ALBL 1A6AA 4JRWA 4G42B 1IMHC 5FO9B 5DYOA 4BJLA 3GZKA 2X9YA 3K74B 2DN7A 4OLYH 2ADFL 4HUXB 3O45B 4OLWL 1ZA6A 3EYOB 4JQIL 5ICXA 5E24E 3SQBA 1C5BL 1BZ9B 2CUMA 3B6SA 3KPSA 4KAQH 5CFHA 5EZOH 3LHPH 4CL7A 3IAGC 4Z7UF 2VLJA 3QHZL 4LCUA 4S1SL 4HKZB 1ZEAL 5FYKL 2MKWA 3AS2A 5GS0C 4OTXH 4KV5E 4K3JH 1YUHA 1H5BB 1FH5L 4DJMA 4OUUA 2IPKB 1FZOA 4Y4KB 3K3QA 5KANI 3FQTA 4RFNC 5C0EB 1LO2H 3LKNA 4HW6A 4QTHA 5LCVH 3S34L 3ZTJG 1NBYB 3C5ZA 4YGVB 5DK0A 3V4VL 1DBMH 4LARH 3S35H 5KJRL 3FO0H 2BMKA 2WIIA 5I0DA 3IRPX 1HHHA 3U7YL 4M5ZH 1H3PH 5B38A 3MV9D 4OBSA 4XRCA 5B39A 5L2JB 4M5YH 2K1MA 5I74B 5B3JF 4MXVE 1A6VH 1LO2L 2AK4B 5C0CA 3V5KA 4MVBC 1GHFL 4XPGL 4RAVB 2VRAA 5K9OB 5KSAA 3BZEA 3B2VH 3U48A 1I1YB 4XVSL 1EEZA 3F7QA 2B4CL 1C1EH 3RX7A 3RY5A 5I30L 1G7LA 1FO0L 2HTKC 4MCYB 1IKFH 1QYGL 3CJJA 4YPGA 3B9VA 4HC1H 3QUZB 4HSQA 5KVFL 1NCCL 1VADA 4QXUL 3QA3B 2Z92B 1ADQA 3NIDF 4QRRA 4WV1C 3DOSA 3PWPB 5D6DC 5ABDE 4PJ9A 1OP5K 5I71C 3UP1A 3U36B 4L1HA 2BP3A 1MFAL 2XTJB 3EOYG 4NNXA 4YH6A 1S7SB 3O4LD 1MCHA 4OD2B 1ZT4A 4MZ3A 2VL5A 2P5ED 3ARPA 4DZ8A 5C6PB 3GSNB 4EKXA 3WN5C 1NMAL 4QYOB 4RX4D 2FSEB 5DXWA 3ZSTA 2VXSL 3D39E 4JZNA 1A64A 3TO4C 4ZPVA 1L9MA 1FL5A 2R0LH 1TQBC 3ES6B 3V5DA 2A83A 2PYFB 4KKAD 1MF2H 5CEZE 4GG8B 1OB1A 3IU3A 3VD9A 2B5IC 4YXLH 4GW4A 2X70A 1AR1D 3RX5A 2NLJB 3DV6A 5JNYB 1YMHB 3QFJE 2NY4D 1NMCB 2W9DL 3E6HB 2ZNWA 5C0JB 3LMJL 5HI4C 5CZXC 4YHZL 1IGJA 3EZ8A 4G80A 2EXWC 4JDVB 5F1NB 3VFUA 2Q7YA 3GSWB 3KPMA 1MH5B 4O9HL 2F54A 2IPTH 4X0KA 2JCCB 3BPCA 2C4FU 4PPTA 1X5JA 1LDPH 2X4RB 1F11B 1CQKA 5E6IC 5H94A 2EE9A 5EUKA 5GPRA 1P69B 5DJ2B 3QDJA 3MROA 4J6RL 4ZUSB 2ADFH 3FN0L 1SBBA 3RVWD 1RUAL 3WNKA 2Y5TA 3GM0A 3VRJA 2X4SA 5TE4H 3TBWB 1NGPL 2H26A 2G75B 2Z9TA 1K4DB 5I1KH 1I4FB 2GK0B 5DSCB 4APQA 1R5WB 4JFXB 1P4LB 1FGVL 1ZKAA 4QO1A 5DK2A 4WUUA 4AIZB 1L9NA 1SYVA 1VFMA 2HLFD 1X4YA 3IXTA 4FQXD 4KV5F 3T3PE 1QRND 3IDNA 1XZ0B 2XY1A 1PSKL 4DAGH 4N8VA 3TYGL 5E5RB 4FQ1L 3RWJB 2VH5H 3MRFA 1I7TB 2FR4B 1VPOL 1MY5A 3SKNA 3QEQE 4HG4J 4C4KT 2VC2H 3I3DA 1N3NA 2OM5A 3ROLA 4K94H 3BMWA 5EFIB 4X7EC 3UJJL 2ESVE 1LP9F 4WV1A 1R3LA 3UTTE 1XGRB 3CGTA 3D69A 3HZYA 4NWUH 5BZDA 1YY9D 1ZXQA 4MX7A 2C7UB 4FXLA 4UILL 4U3XA 3IJHB 1KCSH 4XP1L 4WWKC 4Y4FB 4MMXC 3Q6GH 3OGOE 3TT1H 5KOVC 4UNVA 2GFBB 1IM9A 1SYSA 1A6UL 4ONOA 3TH4T 4FS0A 5FHAH 2AK4A 2FBJH 4JCLA 3LZFH 4NDMA 1Z5LB 1FBIH 4LHUG 4MNHA 3MGOB 3WD5H 2R0ZL 4ZYKA 2V2WA 2RGSA 3IKCB 3HC3H 2J88L 1DANT 3S4SG 4ZFOA 3PWJB 2VWEC 2H2PD 4HK0B 1KTLB 1A3LL 3BDYL 4NQDE 2YD8A 3FQWB 3EOBA 5I6XC 4CGTA 3EJYC 5C6TL 4ZUVB 1GGCH 4M61B 1NMBH 4AH2A 5KS9B 4KVCL 1G7JB 2J8UA 5DUPH 2C1OB 2J1KA 4FQ2L 4XVUC 3MGAA 3RRQA 4LVEA 5HYFA 2MCPH 5DMIH 1S7XA 4EUPB 1J9CT 3TM6A 2VITB 2BSRA 1FZKA 1LE9B 5C6TH 1U92A 5FKAA 1G84A 2D31A 5L2KA 5EA0H 3UPAA 3LN5B 4G9DA 1L7IH 1DSFH 2HFGL 2OTPA 3LKNB 4JO4L 2UUDH 4OLXH 4JZNB 1I9RH 4LMQI 3X13A 3C5ZB 1KXTB 2VXUL 1A0QL 4YGVA 3CFCL 1SEBB 4X6DF 1F90L 1UQSB 5BXFB 3K0WA 3HMXH 4LKCA 5EU4B 4TUJA 1AD0B 1SHMA 2YSSB 3KPOA 4Y8AA 4HWBL 4XXCA 1OPGL 1CR9L 2W0LA 3D0LB 3TZVC 1MHHA 4OFPA 5F88A 1HZHL 4NCC1 1UZ8B 3VFUB 2CK2A 1FN4A 3UAJD 1ZHKB 4MCYA 4LVOC 4U0RC 1RZFL 5KSAC 2YOCA 3HE7D 4D9QD 4E41A 4K7FB 2IMNA 3G9AB 4U6XB 6CGTA 4POZD 5C08D 2FGWH 1QSFE 5FUZH 1IGYB 3GMNA 3ULVL 1DEEA 4P5TC 4NC1C 1KTDA 1NGZA 3LZFL 4FFWD 5IQ7H 4G6JH 1J0ZA 4RRPA 3LOWA 1T5WA 1Z6JT 4PJ7F 1KCLA 4F33A 3WJLC 4EDXB 4X4ME 1SJHA 3H9SE 4FQQA 1A3RL 3BP7B 3BYTA 1AC0A 1UT9A 3QFDB 1TZIB 4JPVL 2NY0C 4XCYA 4JKLA 1MAJA 3MLYH 2BHYA 1JGEA 1JPFB 3IU3B 4GG8A 4Z7VF 2BJMH 2NW3A 3K1KC 5HD8D 4CN1A 1WBYA 2P5EA 4Z7OF 3OKDA 1WWAX 1PKQE 4JN2B 4D8PA 3BPLB 2EDXA 2EH7L 4JZJA 4TVPD 2R0LL 3WL9A 4HIIA 2OJZL 3BOVA 2YMXL 3W9DA 4NYLA 1CLZL 2DLTA 1I1AA 3TJHC 2DQCL 1W8OA 1JWMB 4NQDB 3A6CH 5CP7A 2VDMH 4Q6IA 2O5ZL 3G5XB 3L7FA 3D2UA 3SGEI 4MA7H 1LO5B 1DBAL 5F1IB 1XMWA 2W07A 3E2HC 5MI0B 3W9EB 3WJJA 2M26A 4JREC 4M9PA 3HZYB 4PJDA 4POZC 1CICC 4OQTH 3DIFB 3H9YA 3WKML 3KPQB 4DZBA 4DN4H 4EUPH 3FQXB 1DVFA 3O81A 1ZT1B 1F3RB 1YMME 2V7HB 3HN3A 4U3CA 5KG9A 4JN1L 1JRHL 5CJ8A 5HYEA 5CKAA 1NGQL 2NY3D 3LKRA 3K2UH 4I18A 4CADB 4KI5D 4JR9H 5DHVA 4NDMB 3PWUB 4DFIA 1ND0A 2H26B 5AG9A 4DKFL 3MV11 4GRMA 4FTVD 3PWJA 2KPNA 1BM3L 2EECA 4NKQB 4PG9A 1CS6A 3BQUD 5JW3H 2X9XA 3SN6N 4J3TA 4PR5A 4ZD3H 3RKPA 4ONFL 5CEYA 5I19L 4KJPC 2X4NB 5KZCD 4N90E 3OAZH 4GMSL 4PJHF 4M4RA 4H0GA 4O51A 5SWZD 1ZHBA 3SHSA 4DK3A 3QAZC 3VCLB 1NANH 3INUH 3O6FC 2ESVB 1IEHA 1IAOB 3PWNA 3ARYA 1FIEA 4X80L 2EYTA 3CX2A 1Z9OA 2OS7A 3VXOA 2CDFB 3VFGL 4H1LB 5I1KL 1OGAD 4WHTB 5C9JA 2IH1B 3P9LB 3T1FB 1WISA 5CJQL 2NY6C 1XR8B 1A6WH 2XWTB 1Q1JL 1D5IH 3RGVC 3O4OC 1VEMA 1TFHA 4JFED 4C83A 1XGYL 4XNXH 4XVJH 5AUMA 2R15A 5T1LB 3EO1B 1IM9B 4KU1A 2YUXA 1OQXA 3W11C 3DSFL 4NM4H 3ECBB 4Y16B 3J8F7 1A5FL 4KDWA 1CDYA 1RAMA 4PJBF 5IFJA 1EHAA 1EMTL 4RISH 5FYJU 3QR2A 1D5IL 4C58B 4ZG1A 2Q8BL 3QIWA 3TNNA 3TN0B 4XP5H 3FO0L 4R7DB 3WO4C 1LWRA 5CZVH 3S9DB 4QF1A 4PJCE 2F8OA 4PRBA 4QHLA 1KTLA 2JCCF 4NO2B 5HSFA 2NXYB 1W72H 1MLBA 3OXSA 6FABL 3IT8D 1FFOA 3MV01 1S9VB 1KPUB 4KUZH 3QXTA 4Y4HC 4XB7A 5IB2B 3PQYD 2ZUSA 5E4IA 3RGVA 2ZP0T 5CZVL 1UB6A 5CEXA 4MXQD 5HVHB 5J1AB 5EZIH 2CIIB 4QHNB 3NA9L 5KSBB 2GJ6A 5DJCA 1BFTA 4HWBA 4CVWA 4PJHA 4KJPD 1LE9A 3KXFB 1JGUL 2EIZA 3EAKA 2W60B 4OSUL 2EE6A 1A1NB 4R90H 3NAAL 5ESQA 3U1SH 5BQ7A 1YA5A 3W39A 1X5GA 1F45A 3TN0C 3QEGL 4NOBA 1Y0LB 2P8LA 3GMQB 2A77H 1A6WL 2YSSA 3E2HB 4ERSL 2E7BA 2HFTA 4XPFL 1QLRB 3W5NA 1MJJA 3MA9L 1MFEH 3FTGA 2OR8A 4BQCA 3HG1E 1U8QB 4J1UA 4HIIB 4PD4J 4OUOA 1NCCH 4L9DA 1AKJB 3CUPB 3VXMD 5D6CB 1MHHB 4K8RD 4ENEC 3SPVA 1RIHH 4UV7H 4NZJA 1YJDL 5IOPB 2AKRA 4OQTL 2B0SH 3B9EA 4P57A 1BJ8A 2Z35A 3KGRA 3P11L 3VGGA 5M95B 3QEGH 1BVKB 5I17B 5DQJB 1U95B 4XPHH 4XCFH 1UCTA 5HYSB 4NOFA 4LPXA 2VDRH 3ZDYF 3MRPB 1T1ZA 1H0DA 5B38G 4G6KL 4X6CE 3ZHLA 3VU2A 1S9YA 5F9AC 4CVXA 4F9PC 5EZLA 3E3QE 4ELME 5J13B 1RMFH 1T7ZA 4G6FD 2XN9D 1MIML 3QNZA 4KUCD 4P9HH 4WI9A 4Y5VB 2YD1A 3TH2T 2C9AA 1MHCA 3LKRB 4I18B 3V9FA 5EOTB 4HKXA 4UB0H 2XWJA 1G0XA 4PGBA 2QKIB 3QUYC 3VXSB 4JFZH 4F15C 4W68A 5F89B 5AEAA 4LCCA 3PGFH 3UTSE 5D70H 1JGLH 1GZQB 1A4JB 1FZMA 1OT2A 5GRJL 3T0AA 1KPVB 3BO8B 4M7LT 1S3KH 4TVPL 1ZGLM 3UTOA 3BKMH 3MRIB 3T8XB 1DZBA 1FVDB 1LP9E 4H8WL 4H1LH 4ZUUA 1DLHA 1MCLA 4LVNC 4DOHE 1EJOL 4YUEH 5A2FA 3LSOA 4J7RA 4UTBH 1G7HA 1RZKC 1YEJH 5IW6B 5BMFH 5GISH 1C16A 1KJVB 1H5BA 4NN5B 1X5HA 4Y19A 2QQKH 4LDLB 2JB5L 3BH9A 2YD6A 4LRIC 2R1YB 4W81A 3HCVA 4QNPE 5C0AB 4Y4HA 1N8ZB 4OV6F 4XMPH 2A6KB 3K4DA 3KVQA 4PJDB 5E0QA 3OR6B 2ORBH 1DR9A 4J4PC 4HS3B 4Y1AB 1I7UA 4PJCF 4N0YL 3HTLX 3VDCA 5DUBB 5JDJA 4L4TB 2FO4A 3MX0A 4R6UA 3GBLA 4N8CL 4PJ7A 4OLVL 4PJ8C 5C2BH 2EEAA 1HQ4A 3RWIB 2E9WA 1U8KA 1ZOXA 5K9JH 4FFWC 5K9OA 1SQ2N 5CILL 3I02A 1R3KB 3AB0B 4O58H 3AREC 3TN0A 3MJ9L 3Q3GB 4NN7C 4JRYB 5FYJD 2BY1A 4JO4H 3EO0B 3TT1L 4Y19E 4YPGB 1AO7E 1MLBB 4UINL 1PVHA 1U3HD 2LV4A 3QEHA 5ICYB 3OBAA 1A0QH 3C5JA 5E95B 4OZFH 2ZOLA 3GKZA 3SKJH 2X4NA 5SWQB 1FYTA 3DYMA 4JDTL 4JO2H 5JPNB 1T4KB 1BGXH 3ISWA 1FJ1B 5I1AA 2AGJL 5I15L 1OVZA 2FO1A 4NQCB 1HK6A 3KR3L 1U42A 1NJ9B 2MQCA 2PTUA 4XCNA 5HD8C 4OJFH 3SCMA 1HZHH 1U8LB 1KXVC 4X9BA 5TE7L 1CXHA 2UWEE 5E5MB 3O8XD 3MUGB 3SKJL 3VWJB 1MAKA 2YWZA 2Z4QB 3DGGB 1X44A 3V4UL 5HGAA 1IBGH 4LVOB 1KYOK 2FEEI 1QFWM 3GSUA 2NY3B 5KTEH 2V9QA 5F97E 4F7PA 2Y4SA 5E8OB 2JE8A 3SGJC 4EJ1C 2W0KA 4POYA 2IAMD 1CGVA 1GPOL 3SKOA 1BFVL 4YPJA 5BO1H 3IJSA 5EA0L 2Y9RT 3JWDC 3BDXA 4JDVA 5IFJB 4UQ3B 3FONA 4IMKA 4PJ5B 3T2OA 2Z93B 4WEUD 4L8BA 5IHUL 3ULVE 1AQDB 2F54B 2OI9C 2X05A 4NO2A 1I9EA 3PDOB 5HJ3A 3GUTA 1Z9MA 5J12B 3MLYL 3QIUC 1RMFL 3QIBA 1A6AB 4WU5A 3QISA 3Q1SL 5L88L 3VXQA 3KYMB 1HEZB 2F19L 2YUVA 4TN9A 1OTUC 4YBQC 1GC1C 3VJ6A 2I26N 3BH8B 4XMKL 3CH1A 4PLKC 2X4UA 1JGVL 3OZ9H 4QLRA 4R0LB 4X98A 2ADJB 3F7YA 3S5LA 5GZOC 4I2XB 3VFRA 4OB5L 4PLNC 1LEIB 1I4FA 4H8WH 1LD9B 4NPYB 3V4PH 3WNMA 2FSEA 1F00I 3NACH 2R0KL 5DHYA 3QCVH 4ORGA 1JF1A 1S9WB 4IJ3B 4FFYL 4OZGA 2Q86B 3X11A 4QY8A 4HBQA 1D5ZA 4P2YA 1ZHLB 1HIMH 2YBRB 3D18B 5CJXC 2DOCA 2AQ2A 4PTUA 4R8WH 4HS8L 5ILTL 3R06A 2CLVA 1QSEE 4YE4H 1VGKA 3SDAC 4LLYB 4WWKB 4Y4FC 2FHCA 1A7PH 3BZ4B 5EOCL 4DUWA 5C0FA 4XPAL 4F7CB 3KPMB 1I7RB 3VGDA 3WUWA 4PRHB 1DQQB 4ALAL 1A9BA 1EAPA 2EDRA 3MNVA 3ZL4H 3PWLA 3SE4C 3S37L 5C0DA 1CU4L 3WDHA 3SQOL 3PP3H 4HS3A 4Y5XB 3CVIH 1I7ZB 5D7LA 2XWBA 4ZS6C 5DJ2A 1MIEH 3MOQA 3DMMB 2FJFA 1HQRA 1HHGA 3EYSL 3QXAB 3QO1B 2VJXA 4TULL 2V5SA 4DQOH 2JLLA 5IV2A 4E0RB 1ROWA 4PJBB 4W4OC 5HYJA 1Z5LA 4MNHB 2AK1L 3GMLA 2BSED 4K94L 5I2IB 2C3HA 1CFVH 3LN4A 4F58L 4Q9QH 3ARFA 5KVGL 2GK0A 4ESKA 1HH6A 3QWRD 4HMEA 1HYSC 4OZHF 2P8PA 2XN9B 1HWGB 2AJZB 1LE5A 3H9HB 2APTA 1MFDL 1KNOA 4YHKH 2IAMB 3HNSH 3HE7C 5JLZA 2OMBA 1EO8H 3SDXB 2DBJA 2W65B 5F3HB 1FVDA 1TTFA 4L8DA 8FABB 4NC1E 4U1MA 2DQHH 4DVBB 4RGNC 1H3PL 3GMMA 5T3XL 1INQB 3NA9H 3MUJA 3AU1B 3O2DL 1PGRB 1AXSB 1S7UB 1I7TA 2BY3A 1FG2A 4WO4C 3HCVB 2D4DA 5TE4L 3RL1B 4HBCH 5SX4H 5F7LB 3IU4L 3HE7B 4M62H 5DJXA 4JFZL 3TF7C 5IB4B 2A6KA 4XNMA 3QDME 3WFEL 5JXED 1MCOL 4NJ9H 4ZO6A 4M5ZL 5KVFH 5FDWB 3MODL 4Q97A 1A21A 5HTSA 3H9ZA 4P4RB 3I9GL 3UBXB 4FTVB 5EORH 1IM9D 3QXVA 1A7QH 5E70A 4Z7NF 1MAML 1XEDA 2JELL 5EO1A 4BZ1H 1EO5A 3IXAA 4MS8C 4UQ2A 1QSZA 3QWOA 5D1XA 1JYVA 3HI6L 1QLFB 1YEJL 1WTLA 5DD5H 2E6JA 5C0BE 2VR5A 1CG9A 3SDCC 4D0CA 1NAML 3UJTH 1RVFH 4K9EH 4U1KA 3EOBB 1VFBB 5CWSA 3BE1H 2OL3H 5I1IH 2AJSH 3WS3A 3QXUA 3KPRE 5D93C 3MZTA 3IDJB 4NN7B 1NLBH 3P4NA 1ZVYA 2Q76A 5F8RC 1MUJA 4U31A 3L3IA 1MRDL 4XNYL 4ZO9A 5EUOB 1RJLA 1D9KD 2DQHL 4LSVH 5BRZD 1HYSD 3CZJA 4IRSA 5BV7B 2ARJA 3PV6B 5IQ9A 3SCMB 3WJLA 4J8RB 3SGDI 1Y18A 1C5BH 2VZOA 4NHUA 1UGNA 5E5MA 1N4XL 1LEIA 4UUJA 2K7QA 1KYOJ 3MBED 3LKOB 2DQIL 5DD1L 3UZEA 2OI9B 3QHZH 3ARGC 4WO4B 2CQVA 4LLUB 2OYPA 4LIQL 1K4CA 4I48A 2NY5L 4N0UB 5DO2C 2BZDA 4F7MB 3RJQB 1MCOH 1P4BH 1ORSB 3NBNA 5DFTA 3B3IA 2P24B 3I6LD 4OCSH 5F7DB 1A1OA 3MV7D 3L5HA 3BKCL 4HGWB 2VLME 4MLIA 5CJOH 3WBDA 1K8IA 1FL3A 1I1AB 1IL1A 2AJXL 1JRHH 4AENA 5LWYH 1DEDA 3JTSA 5ETUB 2R4SH 2DI9A 1WT5C 2AJVL 4N0RA 4P3CH 3TZVA 4TYUA 1DLFH 2XT1B 1SYSB 3IU4H 4PTTA 3ARBC 4LSSL 5B3JE 3TIEB 1HSBA 4N5EC 2CRZA 4NSKB 1I3RA 2PXYA 1F2XK 2VXTL 4P5MB 4XP4L 3KPQA 4MNGB 3R0NA 2D7PA 3FOMB 3ARQA 1LDSA 1T22A 3SDDD 3FQWA 4KJYB 3CDCA 1JZ3A 4DKEH 3EDEA 1NL0H 1ED3A 1CVSC 1F4WL 2ZUVA 3BJ91 4WFFD 2A74A 4ZOCA 2FZ3A 4OT1L 4K9EC 3WO3B 1SJEB 4GG6B 3ARFB 5ANME 5DYOB 1G0YR 1S9XA 2VLLB 3LB6C 3DURA 3CSYA 1QSVA 1U0QA 3BP4B 2FHBA 4AQ1B 5D1XD 1XCTA 2F5AH 7FABH 2MTPA 4XX1G 3FHQA 4G3YL 4OZGE 4P4KA 4ZSOB 1JHLH 1I9JH 2BSRB 2EE3A 3QZWB 2ZSWA 4U4BA 4OZFB 4WW2C 5DRNB 4RBPH 1JI2A 1KJ3L 4WO4D 2I9TA 1PYWA 1ZHBB 4QRRD 5HDBE 1L6ZA 5E2TH 2CLVB 2NY6D 3SBWA 2YRPA 2G5BB 1XIWB 2XZCL 4CU8A 4ZFGL 4NKIH 4NQDA 1HHJA 3OB0H 5F7EH 3DSFH 1N4XH 2DRUA 2J2ZA 2XG4A 1QBBA 1TQBB 4Z8FL 5INDB 3HNSL 3JV0A 3GEWB 4YWGH 3W0WB 5TFSH 5C9JB 2WUCH 4LKXA 1JL8A 4KKAC 2XWTA 3BT2H 3FJTA 3VFTA 4LPCA 1WEJL 4PBVC 2BMKB 2ZJSH 1KTRL 2MJWA 1DTUA 4F57H 2A1WH 1CCZA 4LPUA 5B4MC 4O2FB 5J7CC 2UZYB 2WLZA 3T3ME 1WCBA 4HCRA 5HDOA 4F9PA 1DL7L 4DUXA 2G2RA 5JHDB 2VIRB 4I3RL 1EJ6A 3QWRA 3QRFM 1EEZB 3IDMA 4Z95L 1IT9H 3DX7A 4QF1B 1A7BA 2O5ZH 2ID5A 5F9OL 1ZA6B 3TIDB 5IVNA 3QUXC 4ZUTB 3STZA 4F33B 4G6FB 1QKZH 1YMMD 4U6YB 1MHPL 3IDJA 4JFEB 4JO1L 3BVNA 3EGSB 1OAKH 4PIRF 4MJIA 1JPTL 2IBBA 5J6HA 4OF8A 4AEHL 4YDIL 5EIQA 3BGFB 1LK3H 1PG7X 4R7NA 1TMCB 3G04B 1MVUB 4OI7A 2CIKA 1CE6B 4LNRB 1CR9H 1JI1A 4PJ5D 4GAFB 2FX8L 3SY0B 4OD2A 1XF2B 5IMOB 5CBAB 4FQHB 4OQ1A 3WKNA 3VXOB 1SMOA 3UDWA 2VZVA 4JDTH 4LASH 4M7ZC 5DD3L 4JGMA 3FCTA 3GJEB 3O2DH 5DJYB 5I1LB 3QG7H 5C3LD 5CBEB 1PKQB 1SY6H 4N5UA 4XVTH 3DVIA 1KN4H 4XWOD 3D2UB 2BVUA 4ORZC 4YDJA 5D7SH 4YHYB 4P2QA 4YR6B 4OZIB 4YE4L 1LK2B 3EFFA 5DFVC 5C1MB 1CWVA 3DUSA 5BVPL 5JZ7D 1IAIL 5C0CE 4DZBB 1FORH 3MUY1 1XF5A 2OSLA 5D6CA 1Q9KB 3JSSA 4AENB 3NFSH 1WVZA 1A6ZB 5TE6L 3D9AL 1A2YB 3VFSB 4R3SB 5B3NA 3HMXA 4L8SC 3VRLE 1I8KB 3P73B 4PYGA 1HSAB 2JCCA 2W1NA 3BPCB 5I75C 1J8KA 3UPRA 5LXGH 2EDDA 1GGBL 1ND0B 4KROD 1QFUH 3QRGL 4OFDA 4D9LH 5GGUB 2P8MB 4QRPE 4MJ5A 1VESA 1AGDA 3QDJB 3P77A 1Z0NA 1ZLVK 4P23C 4OLVH 1FV1B 2Z31D 1ZWIB 3RIFK 1C12A 5ISZD 5GQBA 2KKQA 5C86A 4GAJL 4PRNA 2QKIA 2QQNH 1SJEA 2Y36H 5D7KE 4QGTA 3T0XA 3DHJA 5CLWA 2R1XA 4Z0BH 4NUGL 4HGMA 5DD0L 4M6NL 2ZOKB 4NWTH 4AIZA 4LASL 5DD3H 4C4KO 2NLJA 1MCRA 4ZUUB 5FB8B 3PJSB 1X5FA 4OZ4A 1SM3L 5DRNA 2OXGA 4FMFA 3PP3K 1CQYA 1Y6NR 3FFCB 1I1CA 4P2OD 3DX6B 4WW2F 4EN3C 3IDXL 3NIGF 2W9EL 4EDWL 2FR4A 5D1QD 3O4OB 1JZ6A 2VLMD 4PBXA 3O3DB 5T33H 4QRUB 5T1LA 3D1MC 3O8XA 5FYJL 1UZ6F 2CJUH 2E7HA 4UV4H 4UIMA 3NCCB 5MP6L 1WFTA 3HZMB 5DRWA 5HHXH 4YEEA 2BSTB 3VXUD 3FT3A 5DMKB 3D39B 1AHWA 4X7SL 4XHJD 4PJXE 1Q9WB 3O6LL 4XI5D 5TDPB 4GKNA 1U8JA 2VLKA 3MROB 5FYKE 1YPZA 1EV2E 5TF0A 1MHCB 5EU6E 3C60A 4MNQD 4JFQA 4LLVB 2AK4D 5JHDA 5F7HA 3O6FA 2NY2D 4HMDA 4PJ9B 5T1DH 1AD9A 2DQTL 4ZFOB 3Q3GA 3BWAB 3DURB 1EUTA 4KQ3H 3VWKD 3F7VA 1O7VA 2H45A 3U7WL 3CC5B 4W4OA 5D71L 2E6QA 5JDSB 2NY1D 3RDTA 2DJ4A 3MPCA 1BEYL 1YNTB 3HKFA 4CVUA 1WITA 2JF1A 3L9RA 2ZCHH 3DGCR 2HFFB 3F65A 4ZPVB 2COQA 3FMGH 5DO2D 3SDAD 4ZTPL 4NQCA 5HI5D 3MRFB 2WUBH 3G9VA 4PRDA 1CE6A 4LNRA 2XTLA 4PJEA 3KDMB 5D7JB 4AG4L 2VZSA 1CICB 1U8LA 1X6LA 1GOGA 2P45B 5MEOB 2V2XB 1FHGA 3B43A 3BKYL 5FKAB 4JRXA 3SDAA 1AKJA 3BX7C 4OCLC 2C1PA 6FABH 3MACL 3LEYH 3IFLL 1CXFA 1BVKA 2R56L 1Q9LA 3MRJA 5IKCB 5JW5B 1T1YB 4J4PA 1QNZH 1GHFH 1U6AH 1UYWH 3OG4B 5FIEA 2EDNA 2GIYA 3VWKA 5HGHB 2DWEA 2HJKB 4FQIH 1DE4A 2OSLB 1RIVH 3R1GH 2WBJD 3V6FB 3JWNC 4U1SA 3O6FD 3UCRA 1UACL 3I85A 1NGXA 3KJ4C 3GB7B 1B3JA 4L8BB 1HSAA 3PIQA 2Q7NA 5DURB 5D1XC 3MRNB 1KFAL 2DI8A 4RAHA 4WHYH 5HHVL 4JFXA 4ODSH 1FYHB 3GRWH 2IANB 4KZDH 3PHSA 3BO8A 5BRZA 3NCEB 4H8WC 1A8JH 5IFAH 3PHOB 1NAMB 1KTDB 4K9EL 25C8H 3L1OH 3SY0A 2ADJA 3F7YB 1K8DB 2J12B 1ODAA 1OL0A 2ZZUT 5D1QA 3RI5K 4PJHE 4PP1C 1P7QA 5JMRA 4KAQL 4UU9A 3BP7A 1DUZB 5D7IE 5GRZA 5I8OH 3BSZH 3ARVA 2XZZA 4B7IA 2R1XB 1CFQA 3IETB 3MCLL 2G60L 3O9WC 3T0EA 4QY8B 4G6KH 2GAZA 5CINH 2P5WB 1TZGL 1CFSA 5CGYC 4URTB 3QNXB 5LGHL 2Z91B 4GSDL 3DUSB 2IC2A 2FX7H 1G6RB 3BWUC 5JW4M 3H9SA 4OCMC 2AVGA 4OGYL 5IIEB 3RU8H 4DGIH 1CDIA 3B2UD 4JPKL 4LVHC 2AERT 1GIGH 4R3SA 1HXYA 3WHE0 5DVKA 4WI3A 1P4BL 2GJ6D 2H32A 4CJ1A 5HGBB 1NSNH 1OGAE 2VE6B 5M7QA 1U8KB 3MBXH 3VH8B 4E41B 3GK8L 1U3HC 3BKCH 1KG0B 2LVCA 5FHBL 1IGIL 2EDBA 3O4LB 3HRZA 4MJ2A 2Y07L 3WIIH 4G8EB 3WIFA 3MLRH 5MHSE 1UWGH 2NY1C 4JG0L 3EO0A 1RY7B 1TVDA 4XAKD 1WIPA 4XBGB 3GRWA 4MAYA 1NGQH 3REVB 4XBEH 4K7PX 1J10A 5CEZL 1KJMA 5K9QI 1OP3H 1VFUA 3DLQR 1LEKA 2HTKD 4LSTL 1EXUB 1OTUD 5ID1A 1PZUB 1LEGB 3LKQA 3VFRB 5E9DD 3HRPA 4WNQB 4AH2B 3BZDA 25C8L 5KN5A 1BLNB 4NGHH 3R4DA 4M1CD 2BNQD 4FP8L 3P9MB 4FA8A 4ZODA 1KCUH 3MRMA 5JDSA 3MRQA 5FYJE 4WFGE 2ZOKA 5HYQB 4JFFD 3MJ9A 1R5IA 5HHPB 4M62L 5FCSH 2W65A 1F6LL 3B6SB 2MSPA 4ODTH 4R2GC 4S1SH 1WBXA 3MCLH 5BS0A 1P9MC 3RKDD 4GRWB 2NX5A 2XFXB 3RWDB 4YAQB 2NXZD 4TSBL 3ARGD 5LG1A 4QRUA 1J1PH 4KXZH 3QIWC 3K8KA 2B1HH 3QSKB 4P99A 4N5ED 4U6VL 3SJVB 1IGTB 1A9BB 2CLZB 3RVWC 4QTHB 4LAJH 3MNWA 2MKLC 1KF9B 3I3BA 3DXAB 3IDIA 5JORB 2E27H 3ZTNL 3F5WB 2JTDA 1MI5E 1T80A 1YMMA 1TJGL 3GUTB 4PRIB 3MYZA 2NX5D 3P40A 3GMOA 1F6FB 3VXMB 5J9PB 5BS0D 2H6PB 3MLUL 1J0YA 5A3ID 1KLUB 1T5XA 3QQ4B 4R26H 4Q6IC 3IGAA 4GW1B 2YUZA 4Y5YC 5HHNB 3MREA 4RAVA 1U93A 5KSAB 1OCWH 1P5UA 1VEPA 3CFEA 4JFFA 4R97C 4WY7L 5HI5C 2XKNB 1J05B 4PY8J 3WS6A 4NFBA 5GGTH 3UROR 5F44A 2FL5A 2AS5M 3TBYA 4QRTA 2LTQB 3H9HA 2D03L 1NGZB 5J12C 1A1MB 1JGVH 1AP2A 3MJ7B 5GRUL 3EW3B 1RUPH 1TCRA 1VACA 1FFOB 5F7MC 4EIZC 2BCKA 1S9VA 2JELH 2XA8H 2P44B 2ZUWA 2HFFA 3LY6A 2E9IA 3H7LA 5DZOA 3TJEH 1VERA 3MRHB 3U7WH 4HIJB 1HOCA 1Q72L 1YYMH 5BRZB 2DQEH 1F58L 2JJSA 1ES0B 4PJ8D 4BZ2H 5ALBH 1OGTB 4XNZB 4DCQB 4IRSB 1RZKH 2DDQL 2GI7A 5IQ9B 1CICA 1Q8MA 4K8RH 3PWNB 1T1WA 2MHAA 4QWWC 3W82A 5SX4I 2Y25A 1FRGH 3KYKL 3QFJB 3GI8L 5IHBA 2Q87A 4BSJA 2AABL 3P9LA 4FXKB 3V6ZB 2NZIA 2IBGA 3HMXL 3ES6A 1S7VB 5E6YA 1E4WH 5FDWA 3QUMB 4Q6IB 4DK6A 5C0FB 1U8NB 5SX5H 3W39B 2BOCA 1ZTXL 4GMSH 3D6GA 3LQAL 4DN3H 1V5JA 1FFPA 1JTOA 2KZ1B 1CFSB 4K7PY 3B9KC 4WUUE 4ALAH 3WFCH 1A7NL 2UV3A 1QLRA 3HNTH 4GKOA 5I9QB 4KWUA 4KQ4L 4IIQC 3RTQC 4HGWA 1TZHA 1FNEA 1YEHL 1JPGA 4I0PC 4Y5XC 2H32H 3H9SB 5IJKA 4U6TA 1WT5A 2VZUA 5DMIL 3NCYS 1KT2A 5TPWH 2CPCA 2VDLH 4XX1E 5CJBA 1RZFH 4HJJH 1MH5A 2BSSA 4IDJL 1NEZG 4JY6B 5IK3B 1QRNE 2H32B 5JOFA 5BJTB 3KR3H 1NLDL 3K2UL 4PB0L 5F3BB 3U9PH 5FO8A 4R4FL 2I60L 3BT2L 1DN2A 1NGYA 3DSNA 3KLSA 1FNHA 3HC4H 3OWEA 3RI5F 4S2SB 2J5LB 3Q5TA 4P48A 1BVLB 4QRRB 1JK8A 2V9TA 5HPMA 1RUPL 2W9LA 4O58L 5JIPA 4PR5B 1RJLB 4PJGA 1I1FB 4MXVF 5F3HA 8FABA 2CK0H 2ICCA 4GFTB 3IFNL 1NEZB 4RWYH 4LEXH 1G7PA 5C71A 3LQMA 4RGOH 1KBGH 5TH2A 2G75A 1J8HB 4IRJB 5D1ZB 2IQAB 2XN9E 3VXSA 1P7QB 4HIEA 2VDNL 4G6ML 4IRSC 4LCCB 1CLOL 1UH4A 1YN7B 3TA3A 4D3CL 1FLRH 2CJUL 1ZS8B 1B0WA 1VKXB 2O61A 4MQSB 1OTTD 3ZDXF 2R23A 3QZWA 2DBLH 3FQTB 4NN5C 4AYFA 3I6KA 1ORSA 3OPZH 4WHTA 4DVRL 5HI3C 3VGBA 1NCBL 3QNXA 2ZUTA 1T20B 3FRPG 3T1WA 2I9TB 3EZJB 3QPXL 3U2SA 5GGQL 1RFDH 4W6YB 1RJYB 1IL1B 4YAQA 4M6ML 4NZRH 2XKUA 4P57B 3NPSB 5JIKA 4PJIA 2Z35B 2Q7YB 5E94B 1CFTA 1N3NB 1CXKA 1HNGA 2NCMA 4LSUH 4X0KB 4UIKL 5HGBA 2VDPL 4HS6A 4N0CC 5EU5B 4XAWL 1JZ4A 3QG7L 3D69B 5I8EB 3OQ3B 3MRPA 5BO1L 3UTPE 4YZFF 4NN6C 3U30B 4MD5B 1LQSR 2YPKA 4YBQD 4G8EA 1RULH 3WIFB 4HHAA 3QEQD 2YWYA