3IJHA

Structure of s67-27 in complex with ko
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
b'IVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSNNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin light chain (IGG3)
molecule tags Immune system
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
total genus 49
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijhA01
1RHHA 1FNSL 4IM8A 3NIDE 5DVMA 4CN1A 4N90D 2P8MA 1S7QB 3UTSE 2VLJB 3U30C 3QO0B 4TYUA 5HYJD 5IB3A 4HGKC 3BW9A 3IDNB 5GZNC 5D71L 1MHPH 5IVXB 4JRWA 2P46B 5IM7A 3ZE2F 1A4JB 4KV5F 3DGCR 4QEGA 2HFTA 2R69H 4YXKL 3NIGE 1HEZB 2HVJB 3KJ4B 4HT1L 1FORL 3AAZB 3DGGB 3FO2A 2AK4A 3QIBD 1F8TH 4K2UL 3MZGB 4Z0BL 4DN3L 3SGEI 4QXGH 3VFNB 3RGHA 5FKPB 2HJFB 2DKMA 4AM0A 2G60L 4O5LL 2PO6B 4PJIE 1FFRA 3QG6A 1F4XL 4YLQT 5INDA 1QP1A 4M6AA 4XP6L 4R3SA 4CMMA 3KHQA 4OZFB 4U1KB 3VRIA 3CDYA 4R7DB 1DVFB 3PGFL 3L9RA 3C6SB 2ARJB 5IVZB 2BXZA 3BD4A 4DKAA 3TIDB 4P3CL 1I4FA 1PX3A 5EBWB 3IT8D 4YHPB 1YECH 4MWFA 4NYLB 5T5FL 2PO6C 2FIRT 5B39B 5FYKD 4ODXA 5EORH 4O2FB 4MD5B 4YIQA 4OF5A 3CSPA 4QXGL 5E2WH 2WMPA 5L0QC 1NFDA 3MRPB 4I2XA 3U0PA 2EXYD 2MCPH 1P6AB 4R96A 5D2NA 1F45A 1L7TH 1ES0B 5GGVH 2APBA 3RL1B 3TVMB 1NGZA 1GGCL 4H0HB 1MUJA 2E7LC 4UNUA 4X6FB 3BN3B 1ZWIA 3FO0H 5FHBL 5EZLA 1K4DA 1MFCH 4AG4L 1UJTA 3R0NA 2Z4QA 4Z18A 2V5SA 4EVNA 1M7DA 4YE4H 5JMRA 3VFUB 3A0OA 2YA0A 3V5HB 2GHWB 4F3FA 3FHAA 4MAYC 1E6OH 4ZDHB 2JELH 4ZQKB 3TGXA 3CLFH 3ETBF 1EAJA 4OGAD 3MRDB 3OKLB 2CRMA 2EIZB 4N5UA 4NDMB 4GMTL 1RZIA 5DD3H 3UX9B 2VZSA 1F11B 5CSZB 4LL9A 3GSUA 3PWUB 2AABL 4ZFZB 3KPRA 4GT7A 3CZFB 1GSMA 2KZ1B 5F6HI 5DI8B 4PV9B 1CICD 4F2MB 1JGDA 4YHIB 4M3JA 2CJUH 3N1MC 4LMQI 4PJCF 3NFNA 1JE6A 3F7YB 1YNLH 5GGTA 3WFCL 5B21A 5B4MD 4DVRH 3ARWA 3VGEA 4Y4HA 2GT9A 3IJSA 4EVNB 2LTQC 3BO8B 5ITBH 4IRSB 3BUYA 3GKWL 2YSSA 1V3KA 3QDMB 1PY9A 1IEBA 3CD4A 3CFIC 3DECA 3DMMB 5ABDE 3OHXB 1KJ3L 3IU3A 3HZKB 1BVKA 2PXYC 3E2HC 4J3WA 2EDQA 2XT1B 3N0PB 3H9HB 5GS2H 1R5VA 2UZYB 4XVSH 5JMOC 4HH8A 4O2FA 5JHLH 3PF2A 4V1DE 4I3SL 1YZZA 3RUGA 2WBJD 3B43A 1V05A 4KC3B 2QSVA 5DHYA 2WIIA 4JO2H 1CDCA 2CUHA 1VEPA 5M94B 3VXRD 1ORSA 2P4AB 4P5TB 1C16B 1CFVH 3CFBA 3UTQA 3FN9A 4LEXL 3VRIB 5C0GB 1JGUH 2G75B 5IMOB 4GXUN 1RFDL 3RGVA 1C5CH 1IEHA 3U2SA 2VZOA 3RNQA 4C56E 1CDHA 3HLAB 1EDQA 3WLBB 1M7IA 1IILE 1KSRA 1A7PL 3PQYE 3BKCH 1ZHLB 2JJWA 4BQBA 3VWJD 4NZTL 1RMFH 1NMAL 1AO7D 2BC4B 3A67H 5MENB 4QXUL 3CX2A 43C9B 5HYQB 4LHUG 3D39B 3RRQA 5A2FA 1BREA 1NUDA 4QHNB 4KI5D 4QRRB 3OJVC 1TENA 1SJEB 3M17A 1PEZA 3ARFD 3BKJL 4WU5B 4UOJA 1QNZH 1H15A 3ILPA 4NQCA 2YD9A 4PJBB 2PYEA 3FFDA 1U42A 5DJAB 5F96L 1A3RH 3T2QA 1FLTX 2DWDB 4JHAH 3ZDZE 4ZNEE 1R6VA 2NLJB 4L8SC 4GUPB 1CGYA 3OF6D 2ICCA 5EO9A 1QVOB 2AEWA 3DXAD 3UTZA 5JIHA 1J0ZA 1D5IL 1HDMA 1OM3L 5SWSA 3U46B 1MLCB 1VEMA 2W65A 1S7UA 2AXJA 1DEEB 3RQ3A 5CZXD 5C08E 5C0FB 2WP3O 2MMXA 5D2LF 4XCYA 1AGFA 4FXKA 1I8LC 3I6KB 3O9WB 5D2NC 2H32H 2ZUQB 3MXWL 3MRBB 5E8EB 1CG9B 2C3XA 3U7YL 3F65A 3M17B 5JO5A 5KOVC 1HHHA 4P4KA 3KS0J 1NCWH 1OF2B 2VITB 3U7WL 3VFWB 3OMZA 3V6ZA 1A6TA 2ENSA 5DDHA 3O4LA 2HKFL 3STZB 3KYKH 3VXSD 1Z5LA 3RWDB 5J6HB 1YEDB 1S9YA 3ESUF 3F7VA 2VDPL 3HC0A 2X4TA 4NT6B 3LEYH 4OLUH 4YE4L 3MXWH 1IGJB 5CINL 1T6VN 3LKPA 2F15A 3BFOA 1OTTD 4KUZL 1EFXA 1LNUA 4GW4A 2FX8H 2ITDA 2IBZX 4O9HL 5JW4R 4G8GE 2YEZA 3U0WH 2DIJA 2B1AH 4XWGL 3LKQA 1C5DA 2GK0A 3RVXC 2XQBH 5ANME 1DL7L 3DWTA 1IQDA 4P5MB 3NFPB 2Q7NA 4JY5L 4S1DC 5FUZH 3HZMA 1Y0LA 3TO4C 4MS8C 4YFLI 2V6HA 5DRXA 3P4MB 4M5YH 2OLDA 4XPHL 2PETA 1U0QA 2AK1L 7FABH 2EEBA 3QQNA 1RURL 3MGAA 4WO4C 1CE6A 4WGWB 1U3HD 4L3ED 4EOWH 3QUKB 1AQKL 1UACH 5D8JL 3SCMD 4DTGH 1JBJA 4HHAA 3BISA 3E3QE 5D1ZD 4PR5B 5F89B 4XP4L 3LMJH 3BJLA 5DK2B 4WHYG 4U6HB 4NKQB 1A7RH 4FFYH 5F6IC 4H8WL 5JIKA 2OP4L 5HHMB 2XTJB 2QSCL 2IGFH 2NTFA 3NACL 3MRJB 3GI9L 4PY7A 1I3RB 1FHGA 1QUNA 1QLFB 4WW2F 4UAOC 4FXGA 2F54E 4YZFF 1H3XA 4JKKA 1BVKB 4TUKL 5KG9A 2X1PA 4K8RL 2BNRE 3BI9X 4L4VB 1T4KB 3GSNB 4MNQA 5BRZB 4LLMA 3G5VB 4FQJH 5DZOA 5HI4D 3S8WA 4LCCC 1KT2B 2XXMB 2PYED 4YDJB 5KW9H 3G9VA 3OZ9H 4CVXA 5BV7C 2X1OA 4XWOD 1XR8B 3G5YA 5DD0L 5FYJD 3CFEA 4I18C 5HYJB 4ZFGL 3QUYC 3T0ED 5F1NB 1Q0XL 3VFSB 2XNAB 4U1MB 3CU1A 4J12A 5JW4Q 3CFCL 1YMHB 3ZO0A 3EOTH 3QAZB 2V5MA 2XWTB 2X7LA 1S7XB 1IGIH 3QG7L 3VGGA 1QACA 1U3YA 4HFUL 4KRPC 3D3VA 4R0LC 5C0AA 3B9KB 3UBXI 1NDGA 3BUYB 4F7PB 1QSFB 4P57A 4R90H 2VH5L 2BNUB 2ESVA 4HC1A 4LHUA 3LRSA 2CUIA 2ZSWA 4KHTL 4XPTH 4I5BB 4FTVD 5T3XL 2C26A 1H5BA 4Z0XA 4AEHH 35C8L 1YY8B 3ULSB 3W9DB 1FG9C 2VABA 3HPLB 2JB5H 1JGLL 4KQ3L 3MRGB 5A40E 1XIWB 3JVGA 3UPRB 4LVOC 3D1MC 4WFGD 3ARDD 5L2KA 3L9RB 1BM3L 1JF5A 3GSQA 2IH3B 1C5BL 1TCRA 5EU4A 3WNKA 3DO7B 4LU5L 3GHEL 4L1HA 4K9EC 4O9HH 2V9RA 1H3TA 4BZ1L 1CQKA 5HGGS 2CIIB 2P5WD 4GH7B 1BHGA 5HGHA 2VXTH 4HIHB 4JFZL 3O6FB 2GW5A 5GRVL 3I9GH 1KTLB 3HE7A 2I5YH 3GM8A 1FP5A 3VCLB 5GS1A 1GOGA 2MQCA 1X5LA 1T7ZA 3O45B 4LRIA 4TSCH 4PGEB 2ZOLB 5DD6A 3EKCA 5D2NE 3RVWC 5C0EA 2P49B 2X1XR 4YHPA 1HH6B 5GS0C 5J13B 4G43A 4IDLA 2BY3A 2YS4A 1T0NA 3DTXA 4XNUL 1EO7A 4U1JA 5CILH 2FEEI 5I73C 1MIEL 4ONFL 5FF6B 2GCYB 2NZ9D 4YDIL 2ADGB 5F7NC 4X0KB 1MFEH 4XB8A 1S7XA 3MRGA 4OF0A 4Y1AA 3AS3A 3TJHD 3WFZA 4NNYB 1KCUL 3KPRD 4I2XB 1CFQB 1IAIL 2UZIL 3W9EB 4K7PH 1H5BB 4Z0XB 4AJ0A 4N0YH 3MRQA 4PYHA 3WS6C 3TT3L 5E2UL 4Y19D 2GJZB 5FYLH 4HC1L 1I8IA 4OSUL 1KIRB 4FQ1H 4S0SD 3FRPG 3QQ9D 4WY7L 2IG2L 3UZQA 1MIML 2DLEA 3BIAX 3P2TA 1KFAH 4MD0B 1W0YT 4QF1B 1R0AL 3KPLB 2ICWI 3HPJB 5JR1H 3TBSB 1KXTB 3EOYG 4OD1H 4YXHH 1K8IB 4LQFL 4X7DC 4IRSC 1NJ9B 2XACC 4HUNB 4E0RB 2BK8A 3VXOB 3L3GB 3WN5C 4M7ZB 4N0FB 2CLZB 4XBGB 2XKUA 3VXNB 3QFDB 1OSZA 3IFNH 4G5ZH 5ICXA 1G84A 5I17B 4K9EH 1BFOB 4GAJL 2EDJA 5A2LH 1W72B 1FZMA 3QDJB 4JO4H 4MXWH 3UZVB 3NZ8B 3QJHB 1G1YA 5EG6C 1BD2B 3VGBA 1CE6B 4Q7DA 3F12A 1A7RL 4FFYL 3HC3L 3T0DA 1QR4A 4ZUVB 4GBXA 2B4CC 2WLZA 4G9FA 3TWCH 4KAQH 1ACZA 4QO1A 2FHCA 4Q6IC 4G8FB 1GXEA 5EC2A 4DOHB 3W2DL 4R8WL 1MQKL 4LHQB 5F89A 1D5XA 4YO0B 3JV0A 1OTTC 2AV7A 3OPZL 4OKVB 3DNKA 4PS4L 4I8DA 4HF5H 5DTFA 2DQGH 4ORGB 1YEHH 2EIEA 4GAYA 4LPUA 5GGQL 1CD9B 1MF2L 5FXCH 3T1FA 2IQAA 3CVHA 2E7CA 3CFDA 4NWUH 2NY7H 3MRQB 5GS0H 5DD0H 3MYZA 5DJ6B 4RGOH 1NPUA 4YHLH 3QUML 1AD9B 2XRAL 5J11B 1TDQA 3HCVA 3P11L 4R2GC 1X4ZA 4WEBL 4ZFOL 2BVPA 4UQ3B 5KVDL 1NL0H 4QNPF 4M62L 3O3EA 2C4XA 1ETZB 4LSUH 4ZXBA 2O5YH 4LSTH 3C8HA 4HS8L 3DIFB 4G7YH 3PDDA 5FB8A 1ZSDA 3QIUB 1ZS8B 4LFHG 4U6TA 3T4AA 3QDMD 4DQOL 1WZMA 4G6JL 2ENYA 3FKUS 2Z31C 5EU7C 3EGSA 2BVOB 4MJ5B 2C9AA 3OGCB 3UDWC 4RGOL 4YHLL 3PL6A 1U6AH 5EU6A 4LPVA 3TVMD 1C5CL 1QRNA 2WANA 2YD3A 1E4KA 3BZDA 4MDIB 2HT3D 15C8L 2IPTH 3MUY1 5E1AB 3MLSH 2VXUL 2O5YL 5GGSY 1JGVH 1YPZB 3RWCA 3S35L 1RZJL 4NKDA 3JV6A 3U4BH 2CUMA 5F7MC 4DQOH 1SQ2N 3L3JA 1ACYH 5T1LA 3QEHA 3GMPB 4GXUM 3TH3T 4G6MH 3X12A 2QQQA 2WWKT 1A7QH 5HI4C 1A3RL 1FFOB 1I7ZB 3IF1A 2CR6A 1K6QL 4NFBA 3MA7B 4OLEA 3KDMA 1K2DB 4EIZC 3GJFH 3ZTJH 3EOBB 3MUHL 4KMLB 4U6XA 4YGVB 1PDKA 3LN9A 2RIKA 3H7BA 5JXAL 1NGPH 2C1OA 1HOCB 2VDLL 4XPBH 5ANMA 3QFDA 3TZVA 2KQMA 3E0GA 2P8PA 4JAMB 3G6DL 1SBSH 1CVRA 1SM3L 2NZIA 4TUJB 1CFSA 4HS3B 1A22B 3EYFB 4HFWA 1G9NL 4JRYB 5D1QA 4J2XA 5TQ2L 4N8VG 1T5WB 2J8UA 1BQHA 1HXYB 4ZFOA 3SDAA 1FG2A 3IU4L 3MV8B 4QOKD 5D2LB 3R06B 5BQ7A 3NH7H 1F02I 3PABA 2XG4A 1BZ9A 1AIFA 2CDFB 3RU8H 2R1XA 3HUJF 3OB0K 2HTLC 5DQJB 2VDKL 4OZIE 3MRDA 1NFKA 5HDBF 1TVHA 4Z7WB 1BBDL 2BMKB 4DZBA 4HBQA 3QI9B 5IR1B 4Z0BH 4WV1B 3U0TA 5ERWA 2OBGA 3TN0B 3G5ZA 3MLYL 4KI5F 2HJKB 3PE9A 2FATL 2NQCA 3Q1SL 4AIZB 2QL1A 5IROC 3RIFF 3QWRD 4FFWD 5H37H 1XCQB 3IFNL 2V7HB 3KYMA 4ONGH 1KENL 4OQTA 5DUPH 5E5UB 3HR5A 4LOUD 4JQIH 4TUOB 3V7AE 5IEHA 1HHKB 1JL8A 4FQIL 4N8CL 5IMMA 1BBDH 1IL1A 4YZFE 1G6RH 4L8CB 1YEFL 4HKJB 1IC7H 2C1OB 4UDTA 4L4JA 3RVUD 5BV7L 2GJ6B 3MRRA 5KOMC 1OB1B 1L4IA 4C54A 4E5XA 1UB5A 1ND0A 3O3BB 2J1KA 4X4YB 4XMPH 3V8CA 1FL3B 3WNNA 3QDGD 4KMQA 3E6HA 3DETD 4MA3B 3S34H 3DYMA 3I75B 4NBZB 2C4FT 1DANU 4PJ5B 4KJWD 1JI1A 1CBVH 4NO2B 2J5LB 3EO1A 5CLWA 5IOPB 1PX4A 4YHNA 3LPGA 1EBAA 4NDMA 4EOWL 5DA0B 5E8DH 4ZAKC 4C58B 4H20L 1RAMA 1QHPA 5L8JB 2YPVL 2A77L 4N90E 4C55A 2CDFA 1T7XA 2ED9A 3LVEA 3CX5K 3VFTB 3NCBB 4Z5RB 3HR6A 2H32B 3JWOL 3GSNA 4MNQB 3SQBA 4JLRB 1KCRL 1MSPA 5C7XL 3OJMB 3A6BH 3C2AH 2BDNL 4LPYA 1T5WA 3ULUE 3WFHA 4LSTL 4PRDA 2QQNH 1VESA 1BJ1H 4O4YH 2DTMH 3T0EA 2IFFH 2BVPB 2X7LB 3P11H 1B6DA 4NJAH 5C6TH 4BFBD 5I8KH 1I8KA 4JAMA 2R1XB 1F8TL 3VFSA 1Z5LB 5J6HA 1RUQL 1RD6A 4PRHE 2N7AA 5AZ2L 3QA3B 5SV3A 5MEOB 3G6AB 3PNWB 2DI7A 5DUMH 3NBNA 1OAYL 5ADPH 4HG4J 3S88L 5BS0B 1GCFA 3F58L 1KT2A 5F71A 1CG9A 3QQ4B 2GSGB 2LE9A 3VXUB 2H41A 3UMTA 1XGTB 3F7QA 4RGNC 4PREB 3TVMA 2Y7QB 3RVWD 4X98B 1WTLA 4JFPA 3PXHA 3PL6D 4LEOA 4YHKH 1BEYH 3CH8A 3SCMB 4YBQD 4DN4H 4HKXB 4JFEB 5ACLA 3MRFB 3WKML 3RU8L 2EH7H 4NWTL 5DRWA 4OV5A 1ZAGA 5BXFA 4GKNB 5INCA 4YEEA 3UTOA 2BOCB 2NY4B 1MJ8H 1MLBA 2D4FA 4LCYB 4TOYL 3F5WA 5FHBH 4EXKA 3U9PL 2J5LC 1QBAA 2A73B 3IJYA 3MYJB 2ZUSA 2F53B 3I50L 5F7LB 4CVWA 4F7CA 1RV6X 2Z93A 5EH1A 4NKDB 5MEOA 4Y2OA 5BZWA 1EVUA 3NIGF 3DIFA 1T7WA 4NWTH 3L5JA 1T1YA 2XZCL 2XOTA 4MDJA 3C5ZB 4NZTH 2FJHB 1QQDA 3HMXH 3MLXH 4HUXA 4M1DH 1JWMB 5T1KD 1WFUA 1AO7E 1G6RL 5B38A 2DOCA 1OQOA 5FV2A 1MJ8L 4GRMA 5DMGC 1DN2A 4ZPTB 2FDBP 3I9GL 3MFFB 3U2SB 5EN2B 1IE5A 2P5WA 1ZLWK 1QNZL 3SE4A 4IOIB 2GK0B 1C16A 4ONFH 3FQXB 1XFPA 3IDMA 2NY2B 4QY8B 4LSVH 5IB2A 1CR9H 3Q6FA 3ARED 2UZIH 4ONGL 5DUPL 4JHWH 2IQ9H 4LPTA 4KK5C 3FQUB 2EDOA 1RK0B 4LHJB 3RWHB 4YAQA 3VXUD 4KDVA 3P4NA 5JLZB 2NLJA 3MCG1 4ELMB 3WHXB 4JFDE 3X14B 1LP9E 5IG7B 1G7MB 1L6XA 1KN4L 3ABZA 3V5DB 3JWOH 2D9QB 2NY5L 2VLKA 4QHMB 3L7EB 2VYRE 2RCSH 1W72A 5EN2A 4OLWL 3E8UH 2AK4E 1MAJA 1TCMA 2YC1B 1T66D 3SKJH 2A1WH 4PJCB 2C5DC 1TJGH 3MO1B 4NQSA 1UM4L 4HUXB 3HMWH 4OCYL 2DS4A 4JANB 3H9ZA 3X13A 43CAB 1DCLA 3MCLL 3NZ8A 3LEYL 1X5AA 5B3JF 4XH2A 5DUML 4FHBD 4KMTL 3FCTA 2QEJA 2BOBB 5JOPE 5L9DH 3GI8L 4RDQF 2L0DA 2A6JB 3LQAC 4FQCH 4XC3H 5ERWB 2C3HA 4OLXH 4NRZB 1TQBC 4G8GD 1AD0A 1JUFA 3GB7B 1RIHH 1O7VA 4JFED 1IGYA 4AT6B 1QHOA 1U93A 4S1DD 4KI5E 1HXMA 1WVZA 1ORQB 2PN5A 1RJZB 4HEPG 4OF7A 3QEQA 1I7RB 5IW1A 2VR9A 5CJ8A 4ODTH 4OD2B 4P46D 1KCRH 3UTTB 4BA8A 5C7XH 3O3DB 3OKOA 4KKNA 1A4KB 3FQNA 5I76B 3O2VL 3HZVB 1A5FH 4OLXL 2MFNA 3EJZC 4XC1H 5CSBA 1WFOA 1T3FA 2GY7B 3WFDL 3IRPX 3TO4B 4LAJH 1TNMA 2LABA 4R4ND 1OARL 4KROC 4N9GA 1MREL 4PJEA 4HJ0C 4X6BA 2SEBB 5K9KB 1QEWB 3WJLA 3EW3B 4TULH 4ZTOL 3BE1L 4DUXA 1FN4A 3MLXL 3HRZB 4AIXA 5LBSH 2AW2A 1KTLA 1QSZA 3PL6C 4WHCA 4HQQL 5KSVB 1E4XH 4NRZA 5HVHC 2Z31A 4F8QA 1JZ6A 3AVEA 1T0NB 3DTXB 2Y9RT 2WWMD 1RMFL 3ALXA 2AEIT 4I0PA 1GZPB 3FB5A 3DROB 4AM0B 3FOLB 5MP6H 1YPZA 4JKLA 3TCLB 1YQ2A 2M8XA 4DN3H 3UTTE 3PWPB 5GS3A 4ZFFA 5GRUL 3V6OE 5C0DB 4P2RD 4KKBC 1I85A 1OL0A 2HP4A 3ARYA 1EERB 2PYEE 4MJ4A 3NCJH 3FRUB 2AS5M 1U8JA 5C07A 2VQUA 5A43C 4S11A 5L0QB 2VQTA 2H3NA 4MJIE 2PKDA 3BP7B 2H6PA 4QHUA 3AM8C 3ECBB 3H3KA 4FQ2H 2VSDA 4X6EB 3BIKB 4TSBH 5CD5C 4UT6H 4ZUWB 2ZCKH 4NPYA 1E4JA 3ZSSA 3QI9D 5T3XD 3MUZ1 3ULVL 4KRNA 4J1UB 2H9GA 3CFJA 1LVEA 1WZKA 1NANH 4Y2DD 2R15A 3JV6B 4YXLH 3MOQA 2XN9E 3I2CH 5FUZL 4PUBL 3CFEB 4KTEH 3QIWB 4Z7VA 3RWGA 3U0TB 5FM8A 5HXMA 4A6YH 3TCXA 3I84A 4NYLA 5B39A 3L3DA 3K8KA 1BJ1J 4P57B 3EFDL 4OZHE 3OR7B 4GLRH 2X4UB 2VXSL 3OX8B 5EU7E 4NO5B 1XGQB 4PY8J 1BM3H 1AQKH 1UACL 5D8JH 5E8PA 5I19L 3X3GL 3HNTL 1KEGH 1B0GB 1QA9A 3WIHL 5FYLE 1WICA 5F9WB 4BSWA 3RGVD 2R0KL 3B6SA 1KYOK 2VLKD 2NY5H 4DZBB 1D9KA 1KPUB 3C9NA 5GGUB 4X5LA 4KK6C 2VKWA 4K71B 2NY2C 3ZDZF 5IFJA 1WEJH 3CSYA 3EYUL 5HHOA 3OKDA 5JOEA 2C3VB 3VG0H 2J88H 1UZ6E 3QXDB 4P4KB 5HGDA 3H9SE 3PV6B 4BSVA 3BVNB 2BCKA 2EZ0D 1RIVH 4Z78A 1IFHL 5ESQB 3I6KA 4WI4A 4J3OC 3O2DA 4ZAKA 4PGCA 3T8XB 4XAWH 3OZ9L 1TMCB 4GLRI 2DWEB 2XPGB 4LF3A 3E2HB 2R2EA 4PLJD 4XVTH 4YHOL 5H94A 2YUXA 1B3JA 2ZNWA 4FXLA 2ZOKB 4P46C 5ALCL 3VXQB 2CD0A 1QFWH 3VD7A 4LAQH 1LILA 1IKFL 2VDRH 1MJUL 4HPYH 2VNCA 2Q6WB 5IM7B 1QKZL 1KCKA 3L3OB 4S0TD 1I8MA 1A1OB 1MVFA 4XP5L 5JOPD 5MERA 4PB9H 1RK0A 3TV3L 3FB8B 4MAUH 2OP4H 1EK3A 3O2DL 3HG1A 4LPCA 2C3VA 5DK3A 5E00B 2RR3A 5H35A 1PBYA 1IGJA 4G8IA 5HDBE 5DWUH 3W81A 2EYSB 3H9SB 4MB5A 2APWA 3OQ3B 4JFEE 4KQ4H 3PP4L 3REVA 2W60A 2R1WB 1KF9B 1DQMH 5FM5M 1UADC 3MLTB 3S97C 2GCYA 4QRQA 4JRXE 3LKQB 5IBUB 4H5SA 1N0XL 1RUPH 1RIUH 3NCYS 4R6UA 2BHZA 4G43B 1EHLH 2OTPA 3HZYA 2DLIA 2YD5A 3OBAA 1WBZA 1XCTB 5LQBH 4GKSA 1RJLB 4RFNB 5C0GA 1MLBB 5JHDB 4D0BA 1VKXB 3BH9A 1WWBX 2FJHA 4OV5B 3RVTC 1T1WB 2V5YA 5IBTL 4PLOB 1CFTA 2BNQB 1MOEA 3ZE1F 4LVHB 4A2LA 2DI8A 4BZ2L 1G9MH 4OLYH 1FZJB 1AXSA 5C09D 1R3JB 4L8DA 1P84J 4NN7B 1JYXA 1N0LA 4PJBA 5DJAA 2EIDA 5KSBB 4MVBC 3SQOH 3QIBB 1F4HA 4WFHD 4P5KA 4GG6E 4DGYL 5FUCE 4K7PL 3CSBA 1X44A 4OF8A 1U91A 3QHFH 1D5BB 4P2RE 4PJ7E 1Z0NA 3IKKA 1SYVB 4OLYL 1DVFC 4JREC 3E6FB 1NL0L 4PREA 3AY4A 5DR5L 4JFQB 5C0DA 5J57B 1OAKH 2GJJA 5TGBA 1XMWA 4TSBL 2PYEB 3FFDB 3FT4B 5LAXA 2B1HH 5CUSL 2CRYA 2ZCHL 4NC1C 1J0YA 1AQDB 5HPMB 1UQSA 4FQLH 5CBAB 4NCC1 2XNAA 4U1MA 2XY1A 4YXLL 4PRPA 3X17A 4XVUD 1ADQH 2EIZA 3D3VD 4HIXL 3V4PH 3KPOB 4F37F 3ROLB 5F7DB 1X5JA 5IFAH 4XNUH 2Q7YA 2F5AL 3GMNB 1G7LA 4NC1E 1MAML 3PWPA 3RPKA 2DQIH 3G08B 1EGJL 4DGVH 3DBXB 4PGDB 3HC4H 3UYOD 1BZ7B 4PLKD 3QUYA 1K4DB 1EIBA 2V5TA 1SEQH 4U1JB 1I1YB 1KJVA 2H1PL 4M48H 4JJ5B 4JY6B 4NKMB 4PB9L 2YR3A 3ZYIA 2P8PB 1FNAA 1XH3B 2A6IB 4U2ZA 2G2RA 2X89D 3V0WL 2HWZL 4UDTB 5TDNA 1IC4H 1BOGA 3CZJA 3ZE0F 4KK9C 3MBEC 4P5KB 3GSXA 4HMCA 1PG7L 4B53A 3ALPA 4Z7NE 2ZUYA 3OAZH 3QFJE 2GEEA 5FF6A 1FZKA 3HZVA 4PBVC 3QI9C 1FO0A 4NRYA 5DJZA 3SDCB 3CDCA 2FJFA 3Q5YA 1FQ9C 1UQSB 4OUUB 1OY3B 1G7JA 3T04D 4HPYL 4PP1C 3TPUA 2AJYL 1S3KH 4JFYB 3IDGA 2LAAA 3LEVH 3HZMB 1FVEA 3QI9A 2HVKA 4GRWF 1TTUA 4P5MA 3O3AB 3VI3E 1T21B 4QRUB 1EO5A 4ALAH 2NY6B 2F19H 4U6HA 5KAQG 3HG1E 4WUUB 3MJ9H 3OKEA 1OGTA 4X5XA 2CXGA 3N9GH 5ID1A 1TJGL 4J23A 3RVTD 1N7MH 5HHVH 3UBXG 2GKIA 5IHLB 4ZO9A 5F1IA 1I8LA 4WW1B 5D7IE 2MSPA 1NSNH 5JDSA 2EKSB 5I2IA 4S1QL 3P0VL 2B2XH 5FYKL 5HHMD 3DLQR 3B2VL 4IRZL 1Q9OB 4OGYH 4WU7B 5CJOH 2XA3A 2YK1L 4LQ1A 5F8RC 15C8H 4OD2A 4PJHF 1LP9B 3AREC 4OIBA 4I0KA 1MRCH 3VGFA 3VXRE 1A1NB 4LNRB 2H26B 1RZJH 4I5BA 1YEIH 3QCVH 1UWEL 4YGVA 3OAUL 2W9DH 1OLZA 1UXWB 4I9WE 2VE6A 1AD0B 1JUFB 4U0QB 5LCVH 1GHFL 5B4MC 5GS0L 5IIEB 4KJPC 3DUUB 5GSVB 2H8PB 1CFSB 1II4E 3WFDH 4L4VA 5F9DC 4HX1B 3FAXA 4Y16C 5TH2B 1JF6A 1CBVL 2OTWB 4FFVC 3L7FB 3QB7C 3KYKL 4G8FA 3HI5H 3G6DH 4U1NA 2X05A 1HQRB 1R5WB 1WBYA 4GW1A 2D4DA 4P3WA 3RBSA 1JNHA 1G7QB 1OSPH 5KSUA 4K7FB 3O4LB 3GIVB 2IAMA 1BVLB 4LLYA 2X4QB 3BT2H 3GMOA 4OF6A 5EUOB 1GIGH 1YPZF 2UUDK 1FSKC 3GDBA 4BM7A 4HWBA 3DRQB 2OJEA 3FB6A 5C2BH 2NXZD 4M6OH 4WWKA 1NAKL 5I1CL 3W11C 3QUYD 1OCWL 2G9HB 3BP6B 4M61A 2ZPKH 1JWMA 4NQCD 4WI2A 1JFQH 3L3IB 3SEPA 5T1MB 5C0FA 2Z9TA 4C56A 3REWB 4YDLB 5EDXA 1KYOJ 2UWEA 2AEPL 3WNMA 5DJ8A 1MLCA 3MLYH 5DRZB 2EXYC 4GMSH 1U8QB 3LY6A 3QCTH 4MQXC 1PG7H 5ACZA 2JB5L 4NUGH 2MCG1 4OGAC 3MLZH 2Y07H 1WBXB 4J7RA 1MFDL 3B9DA 2IAMB 3QO1B 2Q8AL 3O3EB 2CDEA 1KCLA 2CO7B 1EGJH 1GOHA 1ADQL 4P23D 3S36X 1MCPH 3MR9A 2DBLH 3VXSE 1SBSL 1QZ1A 3IJHA 4WVRA 4U6VH 5IFAL 4UAOB 1F6FB 4F7TB 3QEGL 2AJYH 3W9EA 5L88L 4DZ8A 4ZUSA 2NY6D 3RTQC 2EXWC 3TFKD 4JREB 5TH2A 1CVSC 5F88A 5B8CC 3HUJB 2GY5A 4OKDA 2AABH 4NUGL 3MLZL 2V2XB 4GRLB 1WFNA 2Y7QA 2NY3B 1MRFH 3T0EB 4LLWB 1T1ZA 4KJYA 1IEBB 1BFVH 1U8PB 4U7KA 5JW4N 5F96H 2CDGB 3CAFA 1Q1JL 4G3YL 1ZT4A 5GRZA 3DX7B 3HNVH 3RI5F 4U33A 3V0WH 2CLRB 5CILL 4JFFD 3G6JF 4FQXA 3TO4D 1INEH 5B38B 1HHGB 3GSOB 4KDTC 4FA8A 5FYJE 3T09A 4O58L 3ZKNC 2G9HA 1MELA 2R0KH 2V7NB 3SPVB 1A47A 4BSVB 3H9HA 5EUOE 3U6RB 2ATKB 1J05B 4OZGA 5HD8D 3OKKB 1VPOL 5FCSH 1S9XA 3W5MA 3QBTB 4MD0A 1NCWL 3A6CH 3FO1B 4HFUH 4R8WH 4YQXH 2IFFL 2JIXB 5IW6B 1BPVA 1SJEA 4CN6A 1NBVL 2VABB 1X5YA 3HPLA 3LRHA 4ZPVB 5C0RL 4N1HB 3TEUA 3MRFA 3FQWA 1IGTB 2BSRA 4KKAC 1N3NA 2B0SL 2HTKC 3K8LA 1RFDH 2D0GA 4JQVC 5JW5A 1DUZB 1WC7B 4RMWA 1QSFA 3B9EA 3VMNA 2BJML 3HG1D 1BD2D 5F8QC 4LASH 4CRPA 4QXTA 1NSNL 1PKOA 2EDHA 1A6AB 4V2BA 1XCQA 3VXRB 5C1MB 1VERA 1QPXA 4DK6A 3FOLA 2DLFH 4HWUA 1CD8A 3BPCB 4ZFZA 5CJOL 3I6LE 3FT3B 2Z8RA 3GBMH 1I3GH 3NTCH 4L8CA 5D7IB 3OAUH 1J1OH 3HC3H 1N64L 1B0WA 4OCYH 4IOSD 4R26L 3CH1A 4RISH 1JNNH 4R0LB 4G6FB 2AEPH 4LNVA 3FN0L 5HI5D 1NCCL 5AG9A 5I8CA 4TTDD 5GGQH 4QHKI 4OZIB 5E24E 1G7IB 2IPKB 1EHLL 3VJ6A 1D5IH 2IH3A 5E7FA 1XF5A 5LAXB 2QQLH 3VRLE 2A6DA 3TN0A 3O8XA 4PJ8A 4D9QE 4JHAL 4WUKL 4KWUA 1N64H 1RJYB 2D0HA 2ZUQC 4LSSH 3QSKB 3S88H 3HI1A 1LO2L 4WWKC 2VXVH 3PP3H 5EOCL 2V17H 5L88H 1K6QH 3WD5L 2DJSA 3V8OA 1IGCL 5T1DL 1NAML 2RJMA 5IB3B 3I75A 1Q0YL 1MJ7H 4Y4KD 1MIMH 5JXAH 4HMDA 4NPYB 5IG7A 4PV9A 1GRWA 4P99A 1O5DT 3S96A 3OB8A 4HLZH 3QYCA 5AG8A 5MEPA 1OARH 4H0IA 2GSIB 1OP5K 5L6YL 3OXSB 4G8EA 2X9YA 3VFNA 4YK4B 1HOCA 1INEL 2AJ3A 5M7QA 4ZPVA 3QUMB 2AJSL 4L8SA 4HJGA 4XNMA 1F4XH 1LE5B 1FBIL 2W0KA 4Z7OF 4YC2B 1B9ZA 5DR5H 2YWZA 4JPKH 2JLLA 5DHVH 1PD6A 1J1PH 3KLDA 1KJ2H 1A7NH 3TBVB 1VPOH 2VKXA 1B4JH 5EULV 2HJKA 2UVFA 2RB8A 3ZL4L 4FFVD 4FNLH 1MHPL 4Y19B 3MRJA 4S2SB 4H88H 4JFQA 1T0PB 4PRBB 1RUMH 1XAUA 2FATH 3LHPL 2V2XA 1UM4H 1NKRA 2GTWA 1KELH 1IAKA 2I26N 1J0JA 1NUGA 2WINB 3QRGH 3C5ZA 3QEUB 4U3CA 1AJ7H 4RX4D 4H1LH 5CJXA 5H35B 5EO0B 4C57C 5DVLA 3WS6A 3NIFF 1WWWX 2IBZY 1E6OL 2EDEA 4HIXH 2DLTA 1V3JA 1UH3A 4FQIH 4N8CH 5GQBA 3TJEL 4NFCA 4MJID 4OCMC 3MRBA 4PJ7B 4IHOB 2F54A 4P2RB 1CGSL 4LLWA 2V2WA 1AGFB 1A4KA 3FQNB 3L3KA 2JB6A 4X99A 4UQ3A 4LKXA 4FOMA 4O58H 3NACH 1YQVH 2FD6H 4JG0L 4UILH 4JZJB 3VW3L 4YQXL 4MCZB 3M1BB 3MRNA 4TNWF 1E28A 3KXFB 3TJEH 4M62H 4NQDB 3V5DA 1RSFA 2FBJL 3EYOA 2VXSH 2AJUH 5CWSA 1ZGLB 3R1GL 4Q58C 2BNQE 1R3JA 5E8DL 1QYGL 1S9KC 4U3XA 2OSLB 4OKVA 5E6IA 3LKPB 2YPLB 2DQHH 3DX6B 3RWCB 3LV3A 4XP1H 3BGFB 5JHDE 3VXMD 5IT2L 5E1AA 4YHMH 3MRMA 2R1WA 4FQHB 5HYSB 5HVHB 1QLEH 2OXGA 4GBXB 4U1LA 1YUHB 3MLSL 3PL6B 4U49A 5GGRA 4OCXL 3EYSH 4HDIA 4HS6A 3KPSB 2FYYB 1IGCH 4XZUA 1HINL 3Q0HA 3HZYB 2VDQH 1RZ8A 4GXVH 4P46B 3UTTD 1ZGLP 1REIA 5D7JD 5FK9B 2Q20A 2YD7A 3QNXB 4G80B 3UPAA 4GRMB 5LWYL 4ZYKB 3FN0H 4ORGA 1FV1B 2X4TB 4LCIH 5JW3H 4MAYA 5B39G 1JHTB 2VE6B 4ZMAT 1DQLL 1HQRA 1WBYB 4L8SB 4XNXH 2AXGA 3L5WA 3QWOB 5BVPL 2PF6A 5MENE 4MNQD 2DKSA 3SGJA 3P77A 4EI5B 3D2UB 1QFHA 3L6FB 1HINH 5E8OB 3HZKA 4YX2L 5IB2B 1NAMB 4LSSL 3RX8A 1A1OA 4PP2B 3G9AB 1XGQA 1I1RA 3VH8A 1DN0A 3SKNA 3F6IA 1T20B 4PTUB 5D96B 4XP5H 4L1DA 1FFPA 5J3HC 2CPCA 4P2OC 4APQA 4I3RL 5DLML 3TWCL 5E6IC 1JYNA 2BVQB 5C0EB 1WV7T 3O4LE 4MCZA 4HS6B 1VB9A 2VXTL 3LQMA 4HXAL 4UIKH 1G1CA 4PJGE 3V2AR 2CLZA 2P42B 1FLRL 3LPFA 4YX2H 5C6TL 3LPWA 5D96C 4MDJB 4OLVH 3TLRA 3PDOA 5ESVB 1AC0A 3EO0A 5ILTL 1GIGL 4NN5C 3B3IA 1U92A 1OAXL 1BIIB 1U2HA 3TBSA 3VD5A 5FYKU 4K94C 3NIDF 4POZC 5F44A 4BYHA 3BWAA 3F5WB 3G5ZB 2OXHA 4NUJB 5F7WC 4PJAF 3LS4L 3BEWB 1OSZB 5SWSE 2NX5D 3MMEA 3PHOB 2VXQL 4RA3A 3QNYA 4P2CG 2CKBH 4M7LL 3QRFM 5DRWB 2BHYA 3H3PL 2A6DB 4NJ9H 1HZHH 3TA3D 4Y4HD 4LSQH 3V0VA 2Z4QB 3DROA 2V2TA 2APXA 1K9TA 1WZLA 4JHZA 3KWWB 5EA0H 3C5ZC 5HHNA 5K9JH 5E94A 4YHZH 2G75A 3SDCA 4HK0B 4J3UA 1INDH 1KB9K 1L0YA 3RI5K 1XF2B 1F3RB 4Q97A 3ECBA 4X6EA 1YN7B 5F3BA 4GFTB 1F2QA 3T2NL 5HD8C 1WGOA 2OJZL 1XR9A 3RAJL 4DKDC 1T83C 1JF1B 2WV3A 1NC4A 2FEDC 2FGZA 5C07B 1TZIB 1YMME 5EO0A 2C1PA 3D87B 1MFDH 2AQ1A 3PWLB 1XF1A 1XR8A 3G5YB 1ZKAA 4OUOA 5IR1A 2J4WH 4H20H 1QFWL 2VB5A 4BZYA 3RFZC 3QNYB 3P40A 3LS5L 2NY5C 5MI0C 3O6FA 3MMEB 3CFKB 3MX0A 1JP5A 3WDJA 5KVEH 1PYWB 1FRGL 2A38A 5CS7A 3WFHB 2X42A 4GJTB 1DUZA 1RUAL 3LEXA 4Y0GA 1UZ8B 3HNVL 4UINL 4D0DA 1NC4D 3UBXA 4UIMA 2FR4A 2APTA 5C0CD 3RA7H 2R4RH 4JN1L 4O51B 4NKIL 3SPVA 3WXVL 3FRUA 1BBJA 5BRZE 4CBPA 1IRAY 5TGBB 2J4WL 4MB4A 1PLGL 4Z8FL 4NJAL 5I8KL 2QQKH 3CLFL 3MO1A 4NQSB 1A2YA 3HE7B 1JTOA 5FUCC 5F9AC 5I1EH 4UQ2A 3QDGB 5IVXF 3PHOA 3DV4B 1F2XK 1Q9LA 3G6JB 5IJVA 3MGTB 4RNRA 3SCMC 4DGVL 2C7UB 4QRPB 3ZKMD 4UINH 1S7WB 5EU4B 4YNYA 1YEKL 1LMKA 1MJJA 4LCCB 4PJIB 4OZIF 3FT4A 3H6JA 2YBRA 3O0RH 4XCFH 5AYQA 4JPVH 1MCOL 3CVHL 5E2TL 3LIZH 2RCSL 4LIQE 1LD9B 4LAQL 2P5EA 1JPSL 3MLRH 5I1LB 3QR2A 5F7EH 2NNAB 4M7JL 4DAGH 1RJZA 3VWKC 2FLRT 2JJTA 3D18B 1J7VR 4KTDL 1MPAL 3NFPA 4OB5H 4HIJB 5GXBB 4XTRD 2ZUVA 2VERN 2F8OA 4JGUA 5DMKB 4ZS6C 4U1KA 4GW4B 3FHQA 4BQ9A 5JW5B 4MNGE 3QG6B 2Y5EA 1Q9KB 4M6ML 5TDPB 4G8GB 4DVBA 3P77B 3GO1L 3RGVC 4FTVE 4ODXB 3FO2B 2XTJC 5HHPB 2DYPA 1I1FB 3S6CA 5BOPA 1FNEB 5C0CA 1K2DA 3V0AC 5AUMA 2ICWJ 1BD2A 3FQXA 1FAIH 3NAAH 4KRPD 2ARJA 1IQWL 5CUSH 3PABB 3RUGF 1MFAH 3S35X 3UYPA 1SVCP 3MV8A 4RGNE 1BF8A 4OBRA 1MWAH 1RI8A 1V7NH 4JB9H 2HKHH 2VZ1A 3QUKA 4JKWA 1JPGA 4XPAH 1YY9C 4PJCE 5CD3B 4ZPTA 5TQ0H 3D3VE 3ZT6A 1S7SA 1F6AB 4OQTL 3VXNA 1IAIM 2B2XL 2AK4B 3P0VH 4XCYB 3P4NB 3L3IA 1VACA 3S4SG 4X4XB 4B41A 4E0RA 3FZUD 3IDYC 3GSOA 4LLAA 1FAIL 5I1KH 2I9TA 4I0PC 2CLRA 1BMGA 3WS3A 5IMLA 4I1NB 3I6GA 2HLFD 2AJZA 3UTZB 4ZTPL 1XZ0B 3S5LG 3QJFA 3DRTA 1D7FA 1VEOA 3V95A 2YUZA 3O6FD 4OCRH 1N59B 2VAJA 3WFBH 2ATPB 2B4CH 3SDAD 2NYYD 4LSQL 1KPVA 4PP2A 2NY6C 2R2BB 3V4VH 5C0CB 2VZ3A 4FRWA 1MCWM 4QCIA 3SE3A 1FSKB 3GSWA 2NX5E 3MRHA 4FQQA 4PG2C 2FX7L 4K8RC 4TSCL 4LKCB 2G5BB 3LQAL 3WBDA 2DM3A 5AZEH 5FECA 4WO4A 1KPUA 3C9NB 4GAYB 5J6GA 3SDCC 3STZA 5B8CA 2LAGB 4S2SA 5L6YH 2CRIA 5IIEA 1KENH 1NCBH 2EECA 2BRRL 1OF2A 2R0WL 1CYGA 3WUWG 3RY6A 3V4VL 1FVDB 2WLYA 1UXWA 1VFOA 5K59E 3PQYB 3VD3A 4C56B 3GMRA 4N0YL 3V4UH 4K3GA 4LVNB 4ZAKD 5MHSE 5GS1B 1AC6A 1P4LB 3L3DB 1TITA 1BJMA 1MHCA 2GJ6D 4TNWK 4FQ1L 4BQCA 1BWWA 2QADB 3LZFH 3K81A 3QXAB 1Z3GL 1ZHLA 1OP9A 1OHQA 3NVQA 5BV7B 5JUEH 1XF4A 4DCQA 3T3PF 3BDXA 1KCSL 1KC5H 2YD8A 5FV1L 4M9OA 1O7SA 4GAFB 1GPOH 1KLGB 2H2PC 1W0VB 1G0YR 4HGMA 1JNHB 1NFIB 2I27N 4POYA 3KXFA 1BFSA 2QR0B 5HGAA 3O6KL 3O8XC 1IKFH 5F93C 5KTEH 1U8QA 1WIOA 4P4KC 1YEKH 5CEXB 1WEJL 2ZKHL 3QA3A 3GRWL 5DJ8B 2OCFD 4XMKH 3THML 4J4PD 2QHRH 4WTZA 5J12B 4JFXA 1ONQA 3JWDH 1KJ3H 2AK1H 1G9NC 5FCUH 4NCC2 5IKCB 4MD4B 4DEPB 3BH8B 1VCAA 2P48B 3KNBA 1CGXA 1OTSC 2MOVA 1H15B 1Q1JH 4G3YH 3HLAA 4L5FL 4ODUA 3WLBA 2W59A 1ND0B 4OI7A 2AGJH 2CH8A 3KYAA 1BFOA 4X9BA 1N8ZA 3IDXL 5D1XD 1E4XI 5IF0B 2Z31B 1U8JB 1ORSB 1NDMA 4M7LT 3OJ2C 5C6WH 4J4PA 1YEGH 3HI1B 4MAYD 4ZUTA 5DD5L 1R3KB 3CIQA 4AEIH 4N0FA 1D5ZB 4YDVB 2YUWA 2R23A 3OR6A 4JGJA 3VRJB 4MLIA 2VQ1B 3KXFD 2I24N 4X6BB 4UDUB 1HNFA 3G5VA 3BKYL 4I77L 3R06A 2V9TA 4AIZA 4UBDC 5IQ9A 3PJSB 2VLLB 3LRSB 3VD4A 5AD0B 4TTGA 2J8UB 5E5MA 1T3FB 4OAWB 5BVJB 1FL3A 1F5WA 1QSEB 4MJIB 4WHDA 4QRUA 5IKCA 2X2YA 5CEZE 3IKCA 4K23H 5FGSA 2NY4C 1H0DB 3VCLA 3F8UB 3HKFA 4LPXA 4PJ5E 1FJ1B 1NBVH 4KFZC 4TRPL 5JW4M 3ZE1E 4LPWA 1VENA 5FAAA 2A2QT 2H26A 4NHCL 2SEBA 3UZEA 4UTAH 4RFNC 1GZQB 5I1LA 1FH5L 3FQTB 4PJBF 4F80A 4A6YB 2KQNA 1CK0L 4WHTA 1V3MA 4EEEA 1DQLH 4YUEL 1A3LH 1YNTB 2HH0L 2JTDA 1U58B 3KLHD 4NN6C 4WI5A 4Z7WF 2XA8L 4NZUH 4FQXC 5CSZA 3IJSB 5T3XH 3NABH 4XX1G 4BK4A 1IGTA 4YWGH 1GL4B 3LQZA 2CKNA 3V79C 1LO3H 3TVMC 3OG4B 2FZ3B 5D6DA 4F15B 2XICA 4HUMB 3GHBL 4PTUA 4EDXB 2HH0H 2O5XL 3T0VA 2YEZB 4PY8I 5DK2A 2A6JA 3BZFA 4Y4HC 4OJFH 4UIKL 3BW9B 3IDNA 4Y1AD 1QBML 3VMOA 5AD0A 3LEXB 4JFFE 2AXFB 3QIUA 4GS7B 4NO0B 2QV2A 3S3SA 5IFHL 3SOBH 3VWKD 4R0LA 5FO9A 2QLVB 3VRJA 3HC4L 1DFBL 2ORBL 4G9FE 1NUFA 3X3FH 3IU4H 1CR9L 2JKXA 3M45A 3ALWA 5BW7C 5DD1L 3PIQB 1HSAB 4LLUB 4YHOH 5CZVH 4EDWH 2GTZA 1R24A 3T0XA 1ITCA 1HXYA 4ZFOB 3RZCB 1N4XH 4KK8D 4OV6F 1JPTH 3TP4A 2FYYA 3TIDA 2CDEB 1JV5A 2CK2A 2YUVA 5ENWB 1FFOA 4PY7B 1U8KA 1RHHB 3EYFA 4ERSH 1AGEB 1NFDE 4TUJA 3AB0C 3TIEB 2EYSA 5K9QG 4UOW0 1K4CB 4N0UE 5EC2B 5DJCA 3MUJA 5J1AB 3KHOA 2LVCA 2AXGB 3LDBC 3SKJL 1I7UA 5F7DA 2I07B 4QHLB 3R4DA 5FGCB 4HUVB 1T1YB 4XP4H 2IG2H 3I3DA 5ESAA 5EFIA 4JEGB 2Z35A 2X4NA 3NFSH 3WSQL 5FK9A 4WU5A 3IETA 1PJ9A 4UT9L 1OGAB 5EU5A 5HGDB 3WJJA 1G0XA 3U30B 4NBYB 5E8EA 1CL7I 2X4QA 4JFOA 4E41D 2VC2H 3ZTNL 2KUTA 5DK0A 5KANI 5CP7A 5KS9E 4FXKB 4GG6F 3MLVL 2R4SL 4CU8A 1CLYL 5F9JB 2DYPB 4W6XB 4FP8L 4L4TB 5I8EA 4BUGA 3DO3A 2QJDA 1ZEAL 1ZLUK 1HDMB 3MA9H 4MLSA 3B2VH 5I1DB 3HN3A 2FHFA 1IGMH 5A2IH 3QIBA 1B2WH 5C70A 4D9QD 5ECJE 1ZHBB 4M6NL 3NGBC 3LB6C 3BOVA 3INUH 4R2GB 1T1ZB 4KJYB 5SWQB 3WHXA 4OTXH 3BRFA 4JVUA 1YYML 1UT9A 4KRPB 1QR1B 5LBSL 3ZDXF 1VFBA 4NM8L 4FABH 1YJDH 3MZTA 4OFYD 5DDHB 3STLB 3D85D 1IAOA 1PKQA 1MI5B 2OTWA 5L7XH 4NM4H 4G42B 3CVHB 1LD9A 4NZJA 1UJ3A 3ARBB 3EOTL 4J1UA 5A2JH 1JPSH 1XGRA 5AYUH 4IMKA 1H3PH 5DMIH 4HQQH 2PW1B 2ICWA 2O5XH 3W11D 4WW1A 1G6VK 1N59A 3INUL 4IOIA 3RNKA 1JV5B 3EJZD 4XP9H 3FFCD 5K59F 1OP5H 2CLVA 2DQHL 5J1AA 3IGAB 3UTSA 3RWGB 2I9LA 5JZ7C 5EZJA 1A9EA 4APQC 3O45A 2GYSA 2PTTB 5C92A 4UI2A 2ADIB 1JGUL 3IVKA 1JN6A 5ALCH 2ESVE 4QLRA 4NNYA 2OS7A 2IALA 1S7SB 1OPGH 1IQWH 4D3CL 4M8QA 3DX6A 5ENWA 1I1AB 4KGLA 2I5YL 1KCVH 2OL3L 3EDKA 5I66B 5DJXA 1WJ3A 4LSPH 3TT1L 4WFHE 4QF1A 4BJLA 3GSVB 4JLRA 3GSRA 5EOCH 5LWYH 4BUHA 4CVZA 1JPST 4PJDF 1GGIH 1CD1B 3QNZA 1J0IA 3RKDC 3IFOB 2IPTL 3GIZL 4XPAL 4HJJL 1QEWA 5FGBC 3ARGC 1TZIA 4O51A 2DQEH 3NA9H 1T66C 5IUSA 3BZ4A 1ZVHA 1UA6H 4PJ8D 2N56A 4PJFE 3ARGA 4OZIA 1I1YA 5I9QB 4NRXA 3P30H 1FNHA 1QRND 1ZWIB 5I30L 2BVUA 2V7HA 1CGSH 4NQCB 5ALBL 2CMRH 3C6LA 3MV9E 5B22A 4EDXA 5I8OH 5HTSA 2FBOJ 1T1XA 5I19H 2C3GA 2XWTA 4XHQA 3WFEH 1KCUH 5B3JE 2EH8H 4Y2DC 1J8HE 3C60B 4UILL 3ARBC 1CLZL 4PJEB 3RTQD 3LAFA 3VG0L 4YJZL 1H3UA 3SE9H 1FDLH 3EJJX 4WTXA 5BZDA 5I2IB 1H9VA 1DVFA 5TQ2H 5J9PB 3V7AG 4OZHF 5TE6L 4FZ8L 3U4EA 4DJMA 1ZLSH 4R2GD 2IC2A 4KUZH 5EBGA 3SJVA 4PJAE 4QRPA 2D31B 2J6EH 4G7VL 1YY9D 1YC7A 3JWDC 4Q6IA 4EJ1C 1KN2L 2XG5A 1XIWA 3NFSL 1A9BA 1NGZB 1Q9WA 1A2YB 5I1AB 4M1DL 4Y5YB 5LGHL 2B5IB 1MFBH 1PG7W 3DSNA 3OAYH 2E9BA 4U0RB 4CVZB 3K46A 1FCGA 2G5RA 3QIWA 4G5ZL 4Z7VB 2VC2L 3BWAB 3B5TA 1QLRA 1YJDC 1FPTH 3EZ8A 3RWIB 1LE9A 5EBWA 1RURH 4GKOA 4RMTA 1TQBB 4E42A 4P2QD 5L2KB 5ESVA 5CKAA 3QUZC 3BIKA 4IRSA 4YAQB 2ID5A 2OJZH 1R3KA 3T2OA 4XNXL 1DBKH 3JBG7 5JORB 1CICC 4M3KB 4Z7WE 5JQHC 2BVQA 3HS0A 5I71C 3SKMA 5IQ7H 1YNKL 3OAYK 2IH1B 3OKNB 5EO1B 3RWFB 5SWZE 1U8OA 4U1GC 1G7MA 1TPXC 4PGZA 3OGCA 2YHGA 4XC3L 5BVJA 3SDXF 1AI1L 4LSDA 5HYJE 4M93B 5HDQL 5T3ZE 4KVNL 5T1LB 1JI2A 5KVFL 3GSNL 3BN9D 4OLWH 3VG9B 4JFXB 4HIIB 2YN5A 4UDUA 2AJVH 5J13C 3PG2A 1NGYA 2WK2A 2VQ1A 1I3UA 4HZLB 4U1LB 1JZ7A 5I1IH 3TA3B 4Q74A 4DUWA 1J9CT 5JXED 5MEQA 3GB7A 3WL9B 3QO1A 1KIQB 1SYSB 2QQLL 5C09B 4PRPB 5CEYB 5EB9A 3OB0H 3UJTH 1T4KA 4GRLD 2NR6C 5E6IB 4P46A 4RGMC 5F97E 3EGSB 3QCTL 4HLZG 5CBAA 3CPLA 1FVCA 3H42L 2NY0C 4XBPA 5EBMB 2PO6A 1JCKA 4AY0A 5SWSD 4YPGB 3GI8H 1JVKA 4OIIL 5IK3B 4FQPA 5FUOH 5GJTL 4JRYA 5D1QB 4HUKB 2IAND 4RZCB 4ODBD 3VFRA 4WEMB 3GJEB 5FDWB 3U4BL 4L9DA 1AGBB 3O3DA 1QQDB 1BZQK 4BQ8A 2NY4D 1IM3A 4AH2B 1SEBA 1I3GL 1S7UB 3QEQB 1P5VA 3PQYA 1FE8H 2Z93B 5I1JH 3DYPA 4UT7L 2UV3A 5KSBF 1QR1A 2FWOA 3IJYB 3MYJA 4TRPH 3VH8B 3GIVA 3KR3L 4M7KL 2Q6WA 4R7DA 2VR5A 3KPNB 3P9MB 5ETUA 1C5BH 2XZAH 4EN3A 1SM3H 1FZJA 1E28B 4XB7A 2DB8A 2W1NA 3IDJA 3QUZA 3MV9B 1P4IH 4NQCE 3C5SA 3KJ6L 5CJBA 4F7EB 5D7LD 2O61B 2GAZB 3K4AA 3S9DB 5J06A 4RDQG 4XMLH 2NZ9C 3K80A 3RKDD 4L9LB 4MJ6B 5FOBB 5IB5B 3EFFB 4MAYB 3JXAA 3D69B 1YDPA 2OK0L 4PJ7F 3GNML 4U7MA 3PGFH 5I30H 4R97C 5C3LD 3SKOB 4H88L 3C8DA 4XCNA 3GBNH 3ARSA 5E56A 1GC1C 3ILQD 1Z9MA 4ODWA 3RVVD 4LHUD 3B9AA 4XPFH 1MCDA 1NFDF 2Z35B 3QHZH 3JZ7A 3LKSA 1BQLL 3MLTA 3X3FL 1FNEA 4W68A 2J6EL 4ENED 3ZE0E 2YD1A 2CO6B 2NXZC 1HYRC 3AM8A 1KXQE 1MCFA 5T33H 2ZG2A 3VI4E 1I9JL 1NGQH 4BSWB 5CD3A 1IMHC 4GAGH 2FIKB 4JHBA 4PJ9C 2BVTA 4RAVB 1DDHA 1BD2E 3SDXE 3PDGA 4KGJA 3H9SD 4HGWA 1ZA3B 4X83A 1DJSA 3DUUA 5T1KA 4NQDA 5KSAC 1D3CA 2H6PB 4QHUB 5AUMB 2WIIB 1NGXA 1CGTA 5CGYD 4KVNH 4E5XB 5AWNL 4UV4H 5KVGH 3C08H 3PHQA 1AY1H 4PGEA 1S3KL 4V1DD 1CLOH 3CUPA 1RZ7L 2VIRA 3BRDA 2WNGA 1RUML 1CN4A 2EYRB 1LDSA 4LLQA 1LEGA 3LQAH 5EOCJ 2HTLD 3VI4F 4ZAKB 3O8XB 5HGHB 4HH9A 4PJ7A 1T04A 4PJXA 3OSKA 4G9DA 3VG9C 3MJ8B 1ZLVK 1X3DA 5F7FA 4O02H 2A73A 4DKFL 1LO0H 5C0AE 1QFOA 1IVLA 1QOKA 2ZOLA 4AZ8A 1NCUA 1R3IL 2A0LC 1J10A 1I8KB 4JY4A 5D9SA 1C12B 1UH4A 2VAAB 3NCFB 1FN4B 2HG5B 4N9OB 3VXOA 3SE8L 4KXZI 3RDTC 2DQTH 1A9BB 1KLUB 4HUWA 1FVEB 3HNSL 1CU4H 4RA0C 5BQ7B 2Y4SA 3P9WB 3BDBA 1QLRB 1DBJL 1MJ7L 3I6LD 4P5TA 3UTQB 1FZKB 5A1AA 1U58A 3CFKA 5T3ZD 2BMKA 2X4SA 4O2EA 4MNHB 5D2NB 4G6FD 3FAWA 5EPMA 5KTEL 3F58H 1J8KA 3PNWA 4E9LA 1AIFB 2B20A 1R5IA 2DQGL 3MFGB 4JCMA 4XMKL 2HLAA 4Y5VB 4M43H 3LKOB 2ZUWA 1XR9B 1UZ8A 1SMAA 3OL2A 4AYFA 4PRHA 3ZHKA 5BO1H 4JG1L 3QPQD 3VFOA 1HK6A 5HI3C 5LGJB 3IAPA 1IJ9A 5HVWA 1S5IL 3T3MF 3QH3A 3GBNL 2YRLA 1BLNB 1UCTA 1ONQB 3H0TB 3FB7B 3OKEB 2UVEA 1L7IH 3GMLA 2DQUH 4ONHB 1XGPB 5SX5K 1Q9LB 5LJYH 4NNPH 4APQD 1X5FA 1U6AL 2FL5A 2J2ZA 1FL6B 4MDIA 1GAFL 1IM9D 5IEHB 2VDMH 4Y8AA 3P0GB 2EE6A 5IHBA 3CC5A 4G6KH 4JR9H 1BAFH 4I3GA 4ZNCD 1NCBL 5FOJA 3EO1B 4MJ5A 3UJIL 2IWGA 4GMSL 1W8OA 1S9XB 5E6ZA 1QSFE 5DMJB 2QADC 1G9EA 1TJIH 5J12C 5BW7A 4KZDL 3B3IB 4XAKE 4H1LA 5FO8A 1F13A 2R0LL 2D7TH 4ZXBB 3N50A 3BUTA 2COQA 2ZP0T 1KJMA 1D9KC 1LEKB 5E5RB 1RZGA 4YR6B 3C87A 1EPFA 3RWHA 5JTWA 2L7JA 4P59L 2EYRA 1C12A 1KEMH 2VAAA 2W0FB 3L5XL 1VKXA 1A6WH 1CI5A 2WSKA 3CXHJ 3EAKA 4KRMB 1CIDA 3FO0L 1J86A 2A6KA 2B4CL 4GS7C 2FB4L 3GSVA 4BH7A 1U95A 4D9LL 5F7UA 1T22A 4DGIL 1F6LL 4C4KT 1EH9A 4YUEH 2X41A 2ZUTA 2D9CA 5KZCD 1RULL 1CF8H 4C59B 1YYLL 3BEVB 4L4VE 3QDHA 3DI2B 5I76A 5ISZA 3W39B 1OAXH 2Z8VC 5HHNB 1AH1A 5ACZB 1JK8A 5FKAB 3KVQA 4FFZL 1IZKA 1YECL 4QTHB 2FLBT 4YBQC 4H25A 3LN5B 1M71A 1JWSB 2APVA 4P23B 2BSRB 2EE2A 1G7PB 5DJDB 2DQIL 4PRNA 2CGRH 1U8LB 5HHXL 4IDJL 1CL7L 3IJHB 4K3DL 1IQDB 1VGEH 32C2A 2BX5A 3HE7C 4UZGA 3U0WL 9CGTA 1DQDL 5TE6H 2ZUUA 2BNRD 3UO1L 2Y06L 3EO9L 1LEIA 3VA6A 1RQ5A 1QSEE 2AJZB 2WIMA 1GVIA 3QZWG 3QIUC 5F3HB 5DRZA 5H94B 5C0RH 4HDIB 2I9TB 4U05A 1I85C 1KB5B 4XXCC 2YRPA 2J8UE 1VFUA 4I4WA 5T1MA 4WO4B 3I3BA 1HNGA 1HEZA 2HVJA 4U1NB 3HMWL 4MXVE 4PG9A 2YPKA 2G5BA 2ADIA 5BVPH 1D5BA 5ESQA 2A83B 1FV1A 3BESR 5BJTA 5D6DC 3LV3B 5EZOH 3IGAA 4I0PD 3SDYL 3UTSB 3GSWB 4XXDB 4GW5B 5IEKA 4QRTA 2WUBL 1UC6A 3DSFH 3ZT7A 2FHBA 2JELL 4P4RB 5EO9B 2EDDA 5SWZA 4XZUB 1TJHL 3ZL4H 5JPNB 1Q8MA 4PJDA 2J7LA 3WE6B 2UWEE 2CJUL 2WBKA 4PJ5D 1CDUA 5D7LA 4H8WH 3WIFB 4U1IB 1I7UB 1DBJH 3MRMB 4NQEA 5EUOF 3CDFA 2F19L 1MI5A 4RIRA 35C8H 2PTVA 1IC4L 4TPRH 3KYNB 3PP3K 1P5UA 4WFGE 4IOFD 3CK0L 4IOFC 4K07A 1JWUA 3MXVH 5TFSL 2E7LA 3D25B 4D0BB 1EV2E 5JDSB 2Q76B 5IK3A 2YA2A 3AS1A 3OR7A 3EDJA 4Z76B 4ZTOH 4DWHA 1YEGL 4HIJA 2P5WB 1DVFD 3QEQD 5E1HB 4M9PA 2ZCLL 4PRNB 5CEYA 3T77A 5MEND 4LOUC 1M71B 1P7QB 1CFNB 2P5EB 1SY6H 5CMAB 5C08B 3GHBH 4QWWD 2XY2A 4OIAA 3QG7H 3B9KC 1NGYB 2VXVL 4RZCA 1OW0A 3VFGL 3VFRB 2O93L 4RMUA 3VI3F 4YHNB 2VITA 3VFWA 3AREB 4KTDH 1XGUA 2QHLA 4QYOA 2VDNL 5EU5B 4EXPX 3RZCA 4WJ5A 1JZ2A 4M1CC 2AQ2A 4LIQL 1KJ2A 5DJZB 3ARBD 1BAFL 2ZJSH 1DBML 3VFTA 4YDIH 3WL9A 3KPRE 1OAZL 4ZXBC 4YHKL 3KLSA 3MRNB 1S9WA 3ARXA 4E41A 1A3LL 5DD1H 1A7PH 1NAKH 2D3VA 2R29H 2CIIA 1MH5A 4G6KL 4JR9L 1E0OB 3WKMH 3K4ZA 1BQSA 3RY6C 3G5XA 3BP4A 1NC2B 3KPTA 3CLEH 2OL3B 4PGCB 3T8XA 1A6VL 1UZ6F 1A6WL 2D03H 2NX5B 1CT8B 1PSKH 2DMCA 3SO3C 3VXUA 2BCKB 1U8IA 4XT1C 1U8MB 5C0CE 1Y6MR 4HWEL 5GISH 4L4TE 3FFCE 3MJ7A 1JNLH 5E99L 2EIBA 2M26A 3HFML 4Y4HB 3L3HB 4CW1A 1JGVL 3CSYB 2Q7YB 1E27B 3QDGA 4YH6A 5I1HL 1MY7A 1TQCC 3K1KC 1KELL 3N1FC 4JM2F 4MNGA 3GBLA 4WCYL 5E9DA 5C0IA 1K8IA 3UC0L 4HKZB 1M7DB 4PRAB 4UBDD 4Z7QE 5CIPH 1MFEL 4MA1C 2UYLA 1FIGH 5DVNA 5J11C 1Z2KA 4XGZB 1A7QL 4JO4L 3L5HA 5JZ7D 4P2OA 1MVUB 1IGFL 2FRGP 4JM2B 2NTFB 2ZZUT 4X6FA 4XNQA 3RWJB 2DQFA 1HHJA 2NPLX 3K2MC 4H0GA 4HS3A 3CH1B 4W81A 5JUEL 4CVXB 1RZFL 3DX8B 1QFUL 2RHEA 2OTUB 3WNPA 4OFYA 4KY1H 1WITA 1NFDB 4Z7UB 3UC0H 3MACH 1I1CA 2R0WH 2DQJL 5C3TA 3BKMH 2DQEL 3NA9L 2W0PA 5D72H 2FH8A 3OKMA 1FIGL 4Y16A 1T1XB 3CXDL 3VGAC 1QLFA 1DUYA 5CHNB 3V9FA 4ELKB 4YXHL 1E4KC 2IQ9L 2P8LA 4L8DB 1M7XA 1MUJB 2R2HA 4MNGB 3BP7A 4WHTB 5FCUL 5E2VL 5DC0A 3S37H 2W9LA 1KTDB 2DAVA 3BZ4B 4WI6A 2X4OA 3SE4C 1YY8A 3ULSA 3W9DA 2ICEA 2EDYA 4D9RE 3C6LD 3T08A 1MHHB 3D48R 5F7HA 3GGWA 2IANA 2K7QA 1A7BA 1F3DH 3HR5B 1GGCH 5GGRY 2DLGA 4PJGF 4PRID 1W0VA 2HAZA 4MXWL 1CGWA 3EYSL 4NUJA 4RGND 2BXYA 2XIDA 4K7PY 4MD4A 3O6KH 3ARGB 1NBQA 1NCDL 3QT2A 1RZKL 1EZVX 2J8HA 4RFEB 1AE6L 4DKFH 4IRJD 3ZKND 1C1EH 1GGBH 4UV7L 1DBMH 5TF1L 1HIMH 2ESVD 5C6PB 4DFIA 3KLAA 3X13B 4EKXA 5HHOE 1HN1A 3SGDI 3G6JE 2KKQA 1DQML 3T65B 4F3FB 1IC5H 2WQRA 6FABH 4RWYH 1YEJL 2MKWA 2EKJA 4HLJA 5LGKA 3VD9A 1RVFH 2IADB 5IVOA 4HKBA 1NCDH 2W0LA 1FFNB 3T4AB 2L7UA 1WZ1L 4NM8H 4PP1D 4EI5C 3KJ4C 5TF1H 5FO7B 5BJTB 4MMZC 3BZEB 2RGSA 5ITFB 4NN7C 3X14A 2A0LD 1JWUB 4P2QE 3VFVB 5LXGL 2MNUA 3S34L 4M8VA 1SYVA 3FZUC 4Z95H 3TO2B 5E99H 4CKVX 2YD2A 4FQJL 2PXYB 3U36B 1KB5L 4X9GA 1VADB 2VDLH 1ORQA 3IFLH 5EIQA 2VR4A 2H2SC 1UKTA 4HXBL 5DGRA 4TSAL 4ZXBD 1T80A 3VWKA 2XN9A 3ZDYF 1P1ZA 1LO2H 3O6FC 1G9NH 3TNMB 3K7UA 5HI5C 2ICWB 3BKYH 2NY1C 3D0VA 1J8HD 3QEHB 1RZ8B 3QJFB 4UTBH 3NN8A 3QXDA 1N5YL 1JRHI 3F7RA 1M1SA 5GZND 2NTSP 4JDVB 4Y4FD 3O6ML 4KROB 1HWGB 3SCMA 3PGCA 43C9A 5HYQA 2ZWLT 2AVGA 5GGUA 1KBGH 4L3EA 4GUPA 3OXRA 1MCNA 1OSPL 3JWOC 1S9VA 1XGTA 1UWXH 4ODSL 2WUCL 4KJPD 3SJVD 4YPGA 4LEXH 1WBXA 2ZCHH 2HYMA 4L3CA 4Z7UE 4KJQD 2EE3A 5GZOD 4WENB 1FBIH 4L9LC 5ICXB 5FHAL 3AS0A 5FUOL 1UWGL 4Y5XA 1J1PL 5JQ6L 4M4RA 3REWA 3QUXB 5C07D 2ICES 4GRLA 1DQJA 4J8RB 4S1SL 2D7OA 3NPSC 1KBGL 4WI7A 5BXFB 1ADQA 25C8L 3OAZK 4OM1H 1EXUA 4GG8B 3ZYJA 5ITFA 4QHKJ 4G8IB 5DJDA 4FNLL 3NAAL 5JXEA 4QXWA 4XCEA 4EBQL 1WAAA 4MSWB 4HPOL 3WFEL 4JFPB 3MR9B 5HVGB 5E8PB 2OQJA 5CKGA 1G7HA 5FHAH 4N5EC 5T1LD 1TVDA 2Q8AH 4Y4FC 3TZVD 2P44B 4HV8B 4P49A 3CCHB 1CICB 4FFZH 4U1GB 4MA8L 1I1FA 2V9QA 3ILQC 4FZEH 1U95B 2GT9B 3U1SH 4QRRD 1DEEA 4YGAB 5DD5H 5CAYB 3TIEA 3BHBB 3GJFA 1N4XL 3ZMRA 2EDRA 3OJDB 1UCBH 1T03H 1MCKA 4ZUWA 4Y19A 2YSSB 1R0AH 2BNQD 1MCJA 1HHHB 1UB5B 3DO7A 4F7MA 3LKOA 4PJIF 5ELIA 3RZCC 3SDAC 5E9DE 5F9OH 1K5NB 1HI6A 2DIAA 1A14H 1F4YH 1ITBB 3UDWA 3KPSE 3F7YA 5JR1L 4MNHA 2VLMD 1D6EA 5DEFB 4M93C 3VFUA 3PWVA 1KNOA 4M6NH 4RAUB 5CHNA 1HIML 2WBJB 4ONHA 4LQFH 1OGAD 3BPLC 5HDLA 1X7QB 1FH5H 5TDPA 3TBWB 4HIEA 3H9YA 4GAJH 1WISA 3ULVF 4PD4K 1MJUH 5CP3A 1AP2B 2XWBA 4C83A 5GSVA 3PWNB 5D1XC 3ARFB 4WNQB 4Z7UA 1N2RA 3HI6H 4Z7NF 5KZCB 3SDXB 1AGDB 5GS0D 3IRZA 4R97B 5DC9B 2QKIA 1KTRL 1FL6A 4LNRA 3D9AL 5J89A 3DXAB 4ZO8A 3MOBL 1XGPA 2B0SH 4MD5A 3KXFE 3MA9L 1U93B 1G6RA 2EDFA 2Q3ZA 3OPZH 3SJVB 2P45B 1BQHB 3QXTA 5I1GL 1KC5L 4JB9L 4L3AA 1XEDA 2HKHL 5LGJA 1ZVSB 4QOKA 4X7SL 5I16B 4HK0A 1CXFA 2BSSA 4OZFA 4K3EH 3QUYB 4DTGL 3EYVA 2AEQH 5CEZL 2VDOH 3JWNC 5L9DL 5IJVB 2H2PD 5A2KH 2O26U 2ZKHH 5J56B 1KB5H 3CUPB 3N1QC 1KLUA 1R3IH 5C0AD 1INQA 4U6XB 3GK8H 1TVHB 1TVBA 4OM0H 5KVDH 4PJEF 1VA9A 1WWAX 1ZANL 4ZFFB 1VGKB 1K5NA 1EEYB 4HJ0D 5IVZA 4NP4L 1OCWH 4MZ3A 2YA1A 1G7HB 5CP3H 2FR4B 1DR9A 2X10A 3SBWC 3H8NA 3MV7A 3GSUB 2CIKB 2FIKA 2LVEA 3K3QA 4MQ7B 3RHWK 3SQOL 4ERSL 1F3DJ 1SBBA 1NEZB 4WUKH 3S7GA 1FE8L 4ELMA 3J8F7 4ZQKA 1FLRH 3O9WC 3KPMA 3P30L 4OLUL 1OPGL 3GRWA 4Q9CA 3WD5H 1KJ2B 2ZSWB 3O4OC 3KLHC 1A7OH 5IMMB 4XHJD 4WIQA 5GIRA 4JDTL 4APQB 1JMZA 3BPNB 1ZVYA 3QQ3A 2IBBA 3GFUA 4WI8A 4M8QB 1E4XL 3MREB 4LLDA 4QRPE 5I18L 1A6UH 4R9HA 5DEGA 5GPRA 4EBQH 1Z9LA 2EO1A 3QIWD 5DVKA 5AWNH 1A8JH 25C8H 1LK3H 4DZ8B 2A1WL 4MA7L 3VXPB 1I9RL 1H8SA 3RP1A 1QRNB 4G7VH 3UJJL 2Z92B 1MRFL 1NFIA 4N8VB 1P6FA 4EUPH 2E6QA 3F6LA 1Z3GH 1DBBH 2P47B 3C2SA 2C4FU 3KYNA 1AQDA 3WXWL 4L3CB 1FGNL 3U1SL 5AEAA 3RL2B 1Q72H 2MTPA 3MRCA 3W0WA 2HT2C 3BQUA 5BRZD 5I8EB 5K9OA 1YMMB 4RCAA 3UCRA 3QULA 4FQHA 1DLHB 4GQ9L 5E7BA 1YJDL 1AJ7L 4L8BB 5A16B 4YFEA 4FMKA 5IHZB 5ICZA 4MA1B 5IBLD 3T77B 4F58H 2AAVA 1ZT7B 2JJSA 1OTUC 2F53A 4QT5A 2WM0A 5K9JL 3HB3D 3NIFE 3ULVC 5I74C 1A6PA 2R0ZL 4UB0L 5D1XB 2X4RA 5J6GB 5GS2D 4CMMB 4AEIL 4JM2D 2VDOL 5ITBL 3IFPB 3S37L 3M1BA 2I25N 2J12B 1RK1A 3MSPA 5DXWA 1IC7L 4XVUC 4JFOB 3O0RL 5SWSB 4I77H 3D39A 3GK8L 3ZKMC 4UNTA 1IAMA 3F7PC 1MCBA 3SKUD 1WLHA 2R2BA 4XMPL 3GKWH 2HJLB 3QJHA 4LASL 3MOBH 3TNMA 3VDCA 4OT1L 5CIPB 1M7IB 1QYGH 5BS0A 5FIEA 1FZMB 5SX5H 4XAWL 4I18A 2OJEB 3FB6B 1TETH 4NQUA 2J8UF 2ZOKA 4OZ4B 4PJGB 1Q94A 1G7PA 5AZ2H 4EI6A 2PXYA 3B2UD 4LF3B 1YUHA 5JHLL 5KSAA 4ORZC 3X11B 2E7BA 1W8NA 4XBGA 4IRZH 4OGYL 3ZLQC 3ROOA 1FYHB 3A6OA 1JGLH 3SGEH 5IWLA 2F74A 4ZO6A 1BP3B 2NY1B 3BQUB 5D1XA 3BZEA 4X6CB 3L5IA 1J8HB 3MNWA 5EZIH 1NCCH 4TNVK 4Y4KB 3JTSB 3MBEA 2R1YA 4UU9A 1AKJB 5JO5B 3SGJC 3CPLB 5ID1B 4JN2B 4XAKD 4BKLB 3EJYD 4ODVL 1XT5A 1FO0L 1GHFH 2HT4C 4LCYA 3SDCD 3FONA 3LRGA 2GFBB 1HSAA 4B7IA 4MX7A 4J6RL 4O2CA 3V6FA 3CMOL 1YEIL 1T89A 3O41B 3QCVL 5D7SH 2JCCA 4Z77A 3D85A 3VXQA 1ZTXL 1YMMA 2GJ6A 3L5XH 4NOFA 2AJ3B 5D1ZA 4MHHG 3T0EE 2F8XC 4HKJA 2D7PA 4NN6B 3IFLL 1UG9A 3W2DH 5IJKC 4OUUA 3P4OB 2H9GB 2Z31D 1U3HA 5LQBL 2F8VA 2FEDD 5GRJL 3KJ6H 1S7RB 2C3WA 1I9EA 2F53D 4LK4A 1EA9C 1ZT1B 4WGVB 3GMMB 5D1QD 5FYJH 1W72L 2H3NB 4XNMB 5IHUL 2Q86B 4WO4D 1UH2A 2P5ED 4GOSA 2FL5B 4NQXB 1ZLVH 1RHFA 1P7KA 3GMQA 1F42A 4EDWL 5CZVL 3UJIH 1IAKB 2BNUA 2ESVB 2RBLA 1H0DA 2YPLE 4ZTPH 3CFJB 3DX8A 4GQ9H 4P4KD 4MJIA 4CVUA 5DMIL 5GRJH 1QBLL 5E8NA 1FGVH 3B6SB 3WFBL 2MQ3A 4MQ7A 2R0LH 5I6XB 3U9PH 1UGNA 4OCWH 5C0JB 1BZ7A 4AK1A 2YXMA 3C60D 1P4BL 4Y5VA 4F9PA 3P0YL 3HE6C 1GZQA 1MHEB 4QOKE 4PJXE 3RTQB 3BXNA 3PWJA 1UWGH 1IBGL 4HFWB 4WV1A 1SJHB 3PGDB 1MCPL 3MNZA 3I50H 4YDLC 2GJZA 3UJJH 1NEZA 4IMKC 3RBGA 5J0BA 4KROD 5D4QA 4PJ8B 2GK2A 1QFPA 3MOAL 3GMLB 1R3HA 3WO4B 4BKLA 4UIMB 1HSBA 4JM2C 1BLNA 3V6OC 5KVGL 4YHZL 4I0CC 1I7ZA 3IF1B 2JK5A 3QDMA 5L2JB 3L1OL 3TYFB 2OI9B 3OKOB 3OJDA 5DYOA 3RAJH 1K85A 1XGYL 1OB1A 3NCYP 3G5XB 4ZSOA 5FKPA 4XPFL 1NGPL 2DYPD 2R0ZH 4UB0H 2XTLA 1QO3A 1G7LB 1DEDA 4Y19E 5CZXC 2X5PA 5DJ2A 4GQPH 3MLVH 3ARDB 3V7MA 4XPHH 2X44D 1HH9B 2VL5A 3LH2H 4WCYH 3T0AA 1SJHA 3PGDA 3RNKB 3Q3GB 5DD3L 4PJHB 3GSRB 3ARFA 1ZEAH 3PV7A 5FA3B 5BOZG 3QEQE 3N85H 5DJXB 4D2NA 2OL3A 3H42H 3IXAB 2ILLA 1TCRB 3E8UL 1UCBL 4CAGA 3AREA 5IB4A 3T0WA 2NXYC 3AMKA 3HE7D 1CU4L 3PDOB 3WJJC 4X4ZA 1B4RA 3AXLB 1T2QH 3D0LB 1P4LA 4CMHB 3HCVB 1NMBL 5D5ME 3C08L 3UAJC 4LGPB 4N0UB 4LRNL 1TJHH 2ITDB 4N9GB 2CLVB 4C83B 3CFDB 5C09E 4UT7H 4XBEH 4DKEH 3ZHDA 4G6JH 3QIWC 4LRIC 2YOCA 3MCKB 3O81A 4QRTB 3RDTD 5AYUL 3VXRA 1DN0B 5ICZB 3JUYA 5DMGD 3GM0A 1KGCD 1W2KT 3EDFA 1OAQH 1TFHA 3PP4H 1AXSB 4M03A 1WAAE 5ADOL 5IHUH 2PW2B 3HE6A 4Z9KB 3V5KA 1V7MH 1X5XA 2YC1A 5L8KB 3VA2C 4ZFGH 1OTSD 1RIUL 5F6HJ 1MCLA 4LFHD 1J1OL 4G9FB 1QD0A 3F62A 2EYTA 4JFDA 1ZTXH 3N1GC 2GI7A 2YN3A 4QHMA 3MA7A 4X9FA 1FGVL 2YKLH 3D25A 4ONOA 1KLFA 1GAFH 4L4TD 5KJRL 5INDB 4OI8A 5JPMB 1CK0H 1YNLL 3ARBA 3S4SB 3FT2B 3ZSTA 1I1AD 3T0BA 3KPQB 4R26H 3MBEB 5IMLB 2R2EB 3CXHK 3MRHB 4FQQB 1LWRA 5KSAD 4NT6A 3TBYB 1QSVA 3AAZA 3ZTJG 5GZOC 4NGHL 5DQ9B 1I9IH 1NJ9A 1S7VB 1A4JA 1E6JH 3NABL 1IARB 4HJJH 1P7HL 4JQVA 4KKAD 3P9LA 2PR4L 1JHKH 2YPLA 4Y2DB 1QG3A 3QQ3B 4MHHI 5I6XC 3HPJA 3I85A 4LU5H 3IETB 5HJ3A 4JO1H 4JG1H 3L3OA 3H3PH 3CVIL 4XVJL 2BY1A 3JSSA 5C8JA 1D5MB 4JO3L 1G7QA 5KSUB 5T1DH 3KYOA 3LKNA 4GKNA 2CKBB 3WDIA 1NCAH 5DS8B 4KY1L 3EUUA 3BT2L 4AEHL 1CLZH 4LGSB 4NNPL 3S36L 3QCUL 5D72L 2VUYA 3FN3A 3QFJD 3HTLX 5HYSG 3VFPB 2WAHA 2UWEF 1S5HB 4KV5E 1N6UA 2NW3B 2K3TA 4GG6B 1ZGLA 4JQXC 3BPOB 4IJ3B 3QQ4A 5FYLL 4HCRA 3TA3A 1NCAL 3ZKQD 1K8DB 1EBPA 2Y6SC 2E5EA 3U7WH 4KTEL 4LLUA 2BHUA 5IHZA 4KRLB 3QCUH 4JFZH 1DSFH 2DN7A 3ULUC 2Q3AA 4RQQA 3TO2A 3C8KB 5IB1A 4X9HA 3OKYA 1JPFA 4PJFB 3VFMB 1A6TB 3ET9F 5CBEB 1CD0A 2JJVA 2CQVA 4A6YL 1YNTA 5EBMA 3WXWH 3C5ZD 5GGSA 1V5JA 2W91A 4POUB 2HMID 3WHE1 1DSFL 2WWMC 5H37G 2OTUA 1FNFA 4O00A 1LE5A 2QQKL 5TE7L 3EJYC 3QIBC 1DBKL 5FO9B 3T3PE 3DUSB 3TH4T 3OXSA 3WIIL 4I9WD 4BFEA 4YNYB 1RJCA 4K9EL 5JIIA 1CS6A 1T0MB 4MA3A 1VGEL 4K55A 5BO1L 4RSVA 1GPOL 2XKNA 3U9UB 1MCIA 4AMKH 4WUUA 3LEVL 4I48A 2PCPB 3GJFK 3T4YB 1NEUA 1HILA 2LTQB 3VE0A 3JTTB 5E2TH 1I8IB 3MBED 3EO9H 4PJ9D 2DJUA 1SJVA 2IPUG 4Q6YA 5DHXB 4ACPA 2AJUL 3OF6A 1GYAA 1AKJD 1MRDH 3P3YA 4JHWL 3ARDC 1NBZB 1IFHH 3S37X 4PIRF 5IB4B 4YEFA 1CDJA 3MV11 2IAMC 5DYOB 1UENA 5GGTH 4X0KA 5HY9A 4ODUB 1AXIB 4EUPB 5E6ID 1H8OA 2D7QA 2EZ0C 4FFWC 1ZMYA 5I16A 3GO1H 3MV8D 1QKZH 3QXVA 1WAAF 1JGDB 1F90L 4PRDB 3B83A 5BZDB 4ZOBA 1DUYB 1SY6L 4U1HB 1AXTL 4K3JH 3RNQB 4AQOA 3CDGB 3VJ6B 1LE9B 4LGRB 1T0MA 4Q2ZB 1MCWW 1I7RA 1AO7A 1V7ML 4XVJH 4ZS6D 5TDNB 5TPWL 3C60A 4C4KO 2ICEB 3O11B 1DANT 4M5YL 2GQHA 3ROLA 1NMAH 3VXMA 3RUGB 4TVSa 4GXVL 2OMNA 5I1AA 4RAHA 4PPTA 5E70A 4MX7B 3DI3B 4R4FL 3M8OH 2DQDL 1MQ8A 3W0WD 1FC1A 5KAQF 5KJRH 4HHAB 4NN5B 1ZA6A 3SDAB 4LP4A 1I9IL 4X4ME 4YHYB 3T3ME 5FFLA 2DIBA 2AJXL 3G08A 3ARRA 3OWEA 5DUBA 1GH7A 2JJUA 1I3RA 3QXAA 2HT2D 3UXFA 5K93A 4HZAA 4OTXL 3GSXB 4LLQB 1N6QL 1L6ZA 4QRSB 5KANG 2OR9L 1LO5A 4QTIL 3VXSA 1GGIL 1X4YA 1HXMB 3CMOH 4PB0H 1FYTA 3EIFA 4HMEA 1AGCA 7CGTA 4MQXD 4MWFB 1EEZB 1FG2B 5FGCE 5BMFL 1NGXB 2F54D 4UTBL 1KJVB 8FABA 1QSFD 2Y25A 3SKNB 1U92B 3D3VB 1JNNL 2IALB 3U9UA 4XHJC 3LD8B 4G6AC 5HY9B 1U3HB 1G9ML 1X5KA 1KOAA 3GHEH 4PGDA 5DZLA 4RX4A 4Z7UF 2YWYA 5AAMA 3TBWA 4JDVA 2Z8SA 2QSTA 1DP0A 2Y72A 2XN9D 1MH5B 3B2UC 3VDAA 1UM5H 4CJ0A 3MV7E 1BQLH 5GHWL 2NY3C 4Z7WA 1NAMH 1UVQB 2QR0A 5HGAB 1JHTA 3MODH 3UPCA 2VDPH 1ZT1A 1ZANH 3IDMB 5EORL 1DQTA 5EU6B 3MRKA 3PHSA <