3IJHA

Structure of s67-27 in complex with ko
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
217
structure length
217
Chain Sequence
IVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSNNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin light chain (IGG3)
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
molecule tags Immune system
total genus 49
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-08-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijhA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijhA01
2QKIA 1CFVL 4FQ2L 2EDQA 3DUHA 1H3UA 5D70H 4E5XB 4M48L 1MY7A 5AZ2L 4ZPTA 1AGCB 2VR4A 3ARGD 3D39B 2DLTA 3QEQE 3QH3A 4PGBA 5DHVB 4HW6A 4F2MB 3FQRB 2ICWI 1WC7B 1JL8A 1X5HA 3KYMA 3VG9B 3KPRD 2NY2B 3W82A 3QXAA 2A77H 4FQXC 5EIIB 5L9DL 5BCAA 3SKNB 2AK4E 5EO0B 1L0QA 4S0TD 5GRUL 1T89A 4L8DA 4MDJB 5J4MA 3BRFA 2FR4B 4FFZH 2ILLA 3ZO0A 2HWZL 4MCYB 1JYNA 3G9AB 4AENB 5JW5B 5C09E 5IVZB 2FIKA 2E9IA 1QQDA 4LSRH 5SWZB 1S7RA 2IALA 3BYYA 4QXWA 4HMDA 1MQKH 4G6FB 4G7VL 1AP2A 4XBGA 2DYPA 1Y6MR 5FA3A 3FCTB 4KROC 4JFXB 5D2NB 4PTUB 2PCPB 3TBVB 4OAWB 3ABZA 2Y4SA 3DRQB 3QRFM 4OGYL 3UC0L 5FGSA 1ORQA 3QO1B 4JZOA 1L7TL 2WIIB 4FNLH 5CUSH 4NQVA 5C0GB 1JGUL 3U48A 3WFDH 3O6FB 3VGHA 3VWJC 4PP2A 4R0LC 5E5RB 5GRVK 5C0BB 5ICYA 1U0QA 2ARJA 5GRWA 1G7LB 3IU3B 3QDJE 5E08H 5EWIL 2VDML 5DVNA 5C0AD 5DGRA 4EIZC 1ZT4A 2R1XB 3K81A 4EUPG 4I0PC 1J8HB 1A3RH 2DLFH 2X4RB 1F5WA 4EDWL 3PGDB 1WJ3A 1JFQH 1V7NL 3FJTA 2D7QA 4JDZB 3SE8H 5E6IC 5BXFA 2RR3A 2OI9B 3E0GA 1BIHA 2Y36L 4G9DB 3PDOA 1A6UH 1QRND 3CCHB 3CGTA 3H9SA 4XNZC 5GRJL 3CH1B 4NQUA 4UQ3A 2SEBA 5E8DH 3GSQB 3R0NA 4JRWA 3O2WL 2XN9B 3O45A 3X13A 5KANG 3IDIA 2Y7QA 1KELH 1TJGL 3W0WE 2B1HH 1E4XH 3OJMB 3CUPA 4M6MH 2LU7A 1Q9WA 2V17H 3GJEB 2HLAB 2VLKD 4IMKA 4NO0D 4KROD 3TO2A 4D9LL 3ARPA 2ADJA 4D0BB 1DDHB 4KY1L 1SJHB 1TJHL 1X44A 4FQLH 5I1EL 1WTLA 2Z31C 3DUUA 4OV5A 1JVKA 3WSQL 4F57H 4XP9H 1H0DA 2Z4QA 5EULV 3AMLA 4AEFA 3GMQB 3TIDA 5J13B 1BQUA 4DK3A 4B0MM 1BGXH 1YNLH 2DI8A 3CMOH 1X5GA 1QFWH 3L3HB 4AG4H 2FBJL 2CIKB 4XWOC 1A1OA 3RY4A 3O11A 4MWFA 2YK1H 1M7DA 3GB7A 3GSUB 4PRNA 3V2AR 3CDGB 1M1SA 3BXNA 3QEQA 4NFDA 1ZLVK 2FJHA 2GJ6B 1I1FB 1MJ7H 4I0PD 1DBMH 2IANB 1LO3H 4C55A 1WIPA 3K74B 4DKEH 1KCLA 3OAZH 1EA9C 3ZE0F 3C60C 4MNHB 5E6ID 4HD9A 1OAXL 1D6EB 3BDYL 3LV3A 3ULVL 1OF2A 2BSTB 4NKIH 4YDVB 4A6YL 5TE4H 4JO3L 3QG6A 3QUXB 2DJSA 3EO1B 2EEAA 2JIXB 1MCWM 3C09B 2ESVE 5EBMA 1AGFA 5CGMA 5C09A 3WFHA 2FWOB 3ZMRA 4M1GH 1E4KA 4IRSC 4WW2A 1ZHBA 2HJKB 1PAMA 3GSXA 1OM3L 1JMXA 4X8JB 3FQWA 5I2IA 4RZCA 5D2LB 4TTGA 4P4RA 1B2WL 4OF8A 1MLBB 1T3FA 3GMRB 3MMEB 5T1MB 4Y4KB 3X12A 2Z31D 4PREB 4OIBA 1H3PL 3OB0H 3RGHA 5FHAH 4AMKL 2AEPL 1TQCC 1QSEE 3M8OH 3QHFH 3CFBA 5T3XD 2H9GA 2CDFA 2XYCA 3OKNA 4L8SC 3RWGA 2IJ0C 1U8OB 3QDJA 2XG5A 4IHOA 2G5BA 4OD1H 3PP4L 2W9EL 3B2VH 3CJJA 3KXFE 4MYWB 2ZNXA 5BOPA 2HMIC 3UO1H 3E8UH 4HIEB 4Y2DC 2D9QB 4JPWL 3S5LA 4UNVA 1NUDA 1X5ZA 4IDJL 2DQJL 5JDSB 4F7MA 5BV7C 4Y4HA 1FLRL 4ZO6A 1Z5LA 3DX9B 3QQNA 2IF7A 2ZOKB 1UB5A 2PKDA 1T1YA 1I9JL 1KXVC 1FYHB 1IC5L 5I1DA 3UYPA 3SGKA 2FO1A 4P23A 4X7DC 1QO3A 1ONQB 3ZYJA 3W0WA 5T5FH 4XPAH 4M6OH 4Q9RH 3UZEA 5I17B 1UT9A 1MFDH 2DN7A 1FORL 1SEBB 4X7CC 5F96L 4AIXA 4RDQF 5E2UL 2DDQL 4NOFA 4WUUE 5EU4A 4JFQA 4P3CL 5CEYA 2XNAB 2LFGA 3MRQA 3BZ4B 5TE6L 4JHWL 1G7HB 4GRMB 4GXVL 1BQLL 3L5XH 2EH7H 2FGWL 1QSFB 4XP5H 3U0PA 1ODAA 1EBAA 4OZIF 4Z7UF 2CLRB 1S7TB 3UROR 4XCFH 2HMID 4Y2DD 2Q1EA 4HLZG 4RWYH 5L2KB 5J12B 4R97B 3PIQB 5E8EA 2ZOLA 3V4VL 4IS6A 4PP1C 3VFNA 4XNQA 4PGJA 4WI9A 3UXFA 1AXTL 2ESVA 1G7MB 4JFEE 4Y5YC 4K3DL 2I24N 2ZUQB 4Z7QE 2R8SL 2EXYC 32C2A 5D71H 4N0CC 4HIHA 1I4FB 4OSUH 3SJVE 5EBWB 1KN2L 4BZ2L 1GC1L 2PW2B 1MI5B 3JZ7A 1HIML 3H9HA 2X7LB 2X42A 3LKOB 5JOPD 1KNOB 5IB3A 2IG2H 3MV7B 2YA1A 2A73A 2BVQB 4O5LH 4WHTA 2A6KB 5DHVH 1WV7T 1P9MC 4RMVA 1EEZB 1K2DA 3RBGA 4OCXH 2IMMA 1G0YR 1J1OH 1QSEA 3MLZL 3T0EC 2DLIA 1SHMA 5FDWB 2AW2A 3BT2L 1DTUA 4XMKH 1SBSL 4PV8B 3FFCE 4G6AD 5FYJE 3TA3C 5JA9A 2DBJA 1DN0B 3KXFA 1RJLB 3HFMH 5I1HH 1YMME 4MQTB 5TGBB 1KPVB 2OK0H 3KJ6H 5DD1L 1IARB 5JLZB 5F6HJ 1IEBB 1JPST 2X4PA 4PB9L 3J8F7 3P73B 5ENWA 3VFPB 3NCJL 3SE3A 3L3DA 1HI6A 3IF1A 4OZFB 2X1QA 1BEYH 1MFBL 3C2AH 1CTOA 4PP1D 1F6AB 5DQJB 1KTKE 4PGEA 4PJCB 1FBIH 2CDEB 2BY3A 2LAGB 4LPXA 4R4ND 4QY8B 4PB0L 3BEVB 2CIIB 4H0GA 1MCPH 2BFVH 5JR1H 3GJFK 3O4OB 1XIWB 1CN4A 4WEMB 1SJXA 3AU1A 2EXYD 1A3QA 1UACH 4N0CD 5SX4I 4H5SA 1U6AL 4S1SL 4NO3B 1TZGL 4GS7C 5F44A 5I0ZA 2GY7B 5EC1A 3SY0A 2NMSA 4FQQB 5FEBA 3MOAH 4I0KA 4WUUA 5JDJA 3KPRA 3F12B 3QDME 4LK4A 4YHMH 1CXHA 5D8JL 5F3HB 4YHIA 4F3FB 1NMBH 5FOBB 1CG9A 1ZANL 3T0ED 1YC8A 2A1WL 1ZT1B 4QRUB 3TA3D 1LEGA 4LDOB 4Z8FL 1RIHL 4HS6A 3U83A 2IFFL 1DLHB 4MZ3A 1F8TL 2IBGA 5LG1A 1CD8A 1EEYA 1AQDA 1URLA 5ANMB 3TF7C 4K9EC 4Y19B 3SDCB 1G84A 2VZOA 4ZOEA 4UB0H 3ARDD 4YHKL 1TJIL 1S5HB 2H8PB 5FCUL 3FFDA 1A1NA 1ETZA 3MJ9L 1RULH 1G1CA 3PV6A 2OZ4H 4EI5B 1WFOA 4JFEA 4P5TB 5I1GH 4DVBB 4P2OA 1MCRA 3FO2A 4GKOA 5DS8B 5I66A 4NFCA 4MA3A 4OFKA 2H1PH 3VH8G 5GGQL 5DI8B 5C6WH 2KBGA 3SJVA 3HNVH 4MQSB 4ZD3L 1A6AA 1HKFA 3C8KA 4EBQL 3WLBB 4YE4L 3TEUA 3RUGB 3L3GA 5K9JH 4YDJB 2HTKC 5GGVY 1LDPL 3QXDA 4ELKA 1ZLWK 4Z18A 5ESVB 5E9DB 3WXWH 2X2YA 1Q9OB 5EPMA 4GKZA 1F11A 3TH4T 4HS8L 3TBSB 4FQXA 1Z3GL 4LSPH 2PETA 5D6DA 5L2JB 2HRPH 4Q2ZA 3FFCA 2R4RL 5E24E 4ODWB 4J1UB 3C9NB 4OF7A 3MRGA 3EDEA 1YMMA 3UTQA 4LLWA 2VLRE 1MHPH 1NAML 1IILE 3DETC 4PJBF 1QR1B 4YBHA 1TMCB 1K4CA 1S7QB 5D70L 2IQ9H 5D7LB 2DM2A 2IBZY 1KJVA 2VLKA 4RMWA 4D9QE 5IKCB 1BZ7A 1T0PB 3QQ9C 5SWSD 3WEXB 3WIFA 3OQ3B 2XA3A 1UVQB 1JHTA 5D7SH 3DNKA 3MFFA 1UZ6E 2A77L 5CD3A 2AKRB 1FG9C 3JTSA 2ADIA 3VWJA 2ENSA 3MOQA 3KPPB 1V05A 3U4BH 2BVUA 1XF1A 4FFZL 2ENYA 4TULH 3L5WA 1U92B 5EZLB 1YN7A 5E1AB 1IE5A 4OD2B 4NHUB 5DC9B 3RVTC 4Z77B 4LSRL 5C3TA 5F7UA 2HTKD 3MRJB 5A2KH 1MQKL 2Q8BH 3QDMA 4MNQD 2BK8A 1PX3A 1YDPA 4BH7A 1KLUA 4L9LB 4JPIA 3T4AA 4JY5H 1K85A 4FFVC 3VXSD 1PEWA 4S10A 4FFWC 3EOAA 4PJ8D 1HWHB 3MGOB 4PG2A 5D7JC 3BH9B 5CUSL 4FNLL 1BX2A 4OGAD 4XH2A 4LF3B 1PY9A 3WFDL 4QXTA 4R3SA 2AV1A 3AVEA 2WAHA 4RIRB 3FO0H 4UU9B 3TWCH 3OJVC 5BRZE 5CEZD 1T6VN 3OF6A 4HF5H 4G3YH 5E08L 4FG6C 4NQCD 4ZG1A 3QQ9D 2PYED 5C0IB 2DWEA 3MNVB 3U36B 1MHEA 1A3RL 2DLFL 3G5ZB 4XC3H 3DRTB 4K2UH 1V3MA 4GRLC 1JFQL 4U1HB 2DIJA 1SJEA 4LLVB 5CGTA 3SE8L 5MEOB 4NO5A 4IJ3B 1HXYA 1HH9B 4JFFE 1EJ6A 1GGIH 3ZE1E 4R2GB 1HE7A 3K2UH 1J88A 1A6UL 2J5LC 2FJFA 1XGRA 4HGWB 4ONFH 5E8DL 1ZAGA 4DKDC 4L3EB 4G8IA 1T7VA 4WGVB 1KELL 3U79A 1ZS8A 1KJ2A 3IDGA 3TYFB 2B1HL 1E4XL 4PJFE 5B38B 4M6ML 4LCCC 3I75A 4Y2OA 2V17L 3C60A 4FN0A 2AXGB 1EXUA 1P7KB 4WWID 3QUYB 3DJ9A 3UTZB 5C0DA 5FV1L 2FCBA 5F9DC 1KJ3H 3ROLA 5D1XB 2XY2A 4FFWD 4FQLL 3PP3K 4X0KB 3P30H 1A7PL 4U0RB 5GGTH 3EAKA 4F57L 4XP9L 1FAKT 4F37K 4RDQG 4J4PC 2VLRA 4F9LC 3QUMA 4IRSA 4KAQH 4NO2A 3NVQA 5ILTH 4KPHH 3CXHJ 3OHXA 1BGXL 1I3VA 1NGYA 1YNLL 3CMOL 1QFWL 3O0RH 1K4DB 3WNMA 4AG4L 2VNCA 4HUXB 2H26A 2VDRH 4Y4FB 3OG4B 2QQNH 4W68A 2YK1L 1S9YA 3STZB 1CGXA 2P7TA 1N2RA 5MENB 4H88H 3DV4B 2XFXA 1MJ7L 3VRLF 1DBML 1LO3L 1QLFA 4GRLD 4JFYA 3QIUC 1FG2A 1NCWH 4DKEL 3PWUB 3H9YA 5C0FB 4U1SA 5GSVA 4NNPH 4RQQA 1I75A 1NL0H 4LKXB 2ED7A 2J7LA 1MHCA 1FZMA 4YDLC 4NKIL 1EMTH 5TE4L 1TPXB 3DX6A 3SE9H 3U6RA 5AZEH 3DMMC 7CGTA 4QRSA 4M1GL 4LAQH 1YN6A 5EUKA 3EDJA 1NCBH 1IZJA 3BIKB 3BESR 3P4NB 2GT9A 5GXBB 3RWDB 1W0WA 4OF3A 2APTA 2E7CA 3LEXA 1R24A 3DXAB 3L95A 5D1ZC 5IQ9A 1Z9SA 1QBLH 3LQAC 2KL6A 4OZFH 1MHHA 5IROA 1FFOA 4MB4A 2HFEA 5E4EC 5I71B 1A4JB 2X4UB 5FHAL 1FQ9C 3QXTA 4YGAB 5E8NA 4J4PD 3M8OL 3QHFL 2EDOA 2WUBH 5KOMC 1IEAB 5HYQB 5F88B 3PGFH 5DJXB 3IU4H 5KJRH 4EDXA 3FOLB 1CFTA 4WTZA 2AI0H 4PRDB 4BYHA 4LASH 4JFPA 1XGPA 2W60B 3B8YA 3OL2A 4OD1L 4CRPA 3B2VL 2GK0A 2UY7A 3N06B 2IH1A 3WNNA 4E41B 3UO1L 3S9DB 3TZVB 3K8LA 5DJCA 5TF1H 3E8UL 2HFTA 4XZUB 3UTTE 3EJZC 5EORH 3MV8E 2DLEA 1TIUA 2QJDA 3I2CH 1ZVYA 5IVOA 1VGEH 4JFFA 4OLUH 1IKFH 5DEZA 4HIIB 5GHWH 4DW2H 3EYVB 1FZKB 4KRMB 2GAZA 1A22B 3ULVC 1ZWIA 3FTGA 4YXKH 4FMFA 3BVNA 1DEEB 3PWPB 4L29B 2PN5A 2XKSA 2PO6B 4NNXA 2WP3O 2YD6A 5LGJA 1B3JA 3QHTC 1NUNB 5T5FL 3UBXI 2WLZA 4GKNB 4XPAL 4M6OL 4OCYH 4PBWD 4PJFA 3FQTA 3DGCR 1U2CA 5FYLE 4Q9RL 5B21A 3DLQR 1FL5B 1MFDL 3EFFA 3KLAA 1IAIH 1RK1A 1MUJA 5D1ZD 5AUMB 4HKZA 1TITA 4I1NB 3LKQA 3VRJA 4LHJB 4Y5YA 3C6LB 4BFGA 2A83A 1CWVA 3QEUB 5TFSH 2V9QA 4LKCB 4KU1A 3BH8B 1WICA 1JZ2A 5DQ9A 5DSCB 3L5XL 1KBGH 2EH7L 4KI1A 2OL3A 5LKNA 4XP5L 3B5TA 1IKNC 3ZT7A 3S5LG 3C5JB 4NDMB 4XCFL 5D4QA 5T1KB 1BJMA 1ZLSH 4UAOC 4L8BA 4PJ7E 5AAWA 3RTQC 3PDDA 2FX8H 3TPUA 4RWYL 2YPKA 4WW1B 4IRJD 2AJSH 4V1DD 1FO0B 5T1DH 5EC2A 2BHYA 1BFSA 3GIVA 5CD5C 3TNMA 5FB8B 4KVNH 4JZJA 4KMQA 3WIIH 1BQHB 2VB5A 4XXDA 1CU4H 5DHXB 2FHFA 3I84A 3QFDA 3STBA 4YR6A 1EHLH 1CE6B 2E6JA 4F7CA 3IS1X 5FYKH 2DTMH 5D71L 4U3CA 3KNBB 4OSUL 1FAIH 2N4IA 1DFBH 1EFXB 1A21A 5HYJD 1OGAD 4NQCE 2IPTH 4HK0A 4BH8B 4IEFB 4NQDB 2IG2L 3OJDB 5A2LH 1T04A 4O5LL 4LCYB 1MCIA 3AS3A 3PL6C 5JHDD 4OZGB 4OCXL 5ESAA 1V3LA 2UV3A 3MLUH 3WHE1 3CU1A 1J1OL 1NFIB 2NY3D 3EOTH 4AEIH 4UDUB 1X7QB 4KKCC 4MSWB 1IEHA 2I9LA 1YEJH 4GRWE 1EEUA 1IC7H 2WM0A 4XMKL 3RQ3A 4UOW1 5EG6C 5DFVD 3GSOB 1UM5H 2UVFA 5EU5A 3HFML 1QBAA 2OXHA 1CBVH 5IF0A 4JPKH 3UTTA 1DBAH 4M43H 5F7DB 4QHNB 3MV8A 1MVFA 4OLYH 2OK0L 1E28A 3KJ6L 1C16B 3M17A 5FO7B 3RTQD 1JGEB 2IAMB 1G9NC 4EI6A 4PRPB 5FO9A 4Z0BH 5MHSE 2MWCA 3MRLB 2CLZA 3U46A 3RU8H 1Z2KA 5CD5D 1BEYL 3C2AL 1JGLH 2C1OA 5BZDB 4R4BB 4JANA 1FBIL 5I8EA 2R4SH 3RVWC 2VDNH 2HG5B 3VCLA 3RKPA 1MCPL 2BFVL 4G8GE 5JR1L 4NQEB 1I8MA 2DLGA 1BM3H 2PW1B 1UACL 2VUOA 3RIFK 3QFJB 4BKLB 3DBXA 1GC1C 3T3ME 4YEFA 3VFUB 5GRZA 5D1QC 3I3DA 5CEXA 2VJXA 4MA1C 4Z7VE 4ISVA 3KPOA 3IYLW 3NMEA 3PQYB 4QCIB 4X8XA 3MLTB 3MOAL 4HKXB 4YDKH 2ATPA 3EOBB 1CCZA 4OLZH 2PXYC 4YHML 1AIFB 1ZHNB 5DDHB 1NMBL 4KKCD 1C5DB 5J6HB 1MVUB 4QKXB 4QNPF 1AHWA 5J1AA 3AROA 1QLRA 3QYCA 1OPGH 1MWAB 3MRCA 5ID1B 5L0QB 2XACC 5F6HI 5MI0C 2P5WD 1KIUA 4ZQKA 1BF2A 3DVIA 4JQIH 5E2TH 1ZHKB 4PJ7A 1TVHB 3AXLB 3DTXA 3WN5C 2EIZA 1I8KA 2QQLH 3C6SB 4UB0L 1NC2A 3B2UC 3MCLH 5KSBF 1U8LA 1CYGA 2F54D 4PY7B 1IJ9A 1RUQL 3MA7A 1G6RB 2VL4A 1RULL 4JGMA 2OZ4L 1KGCD 1AKJB 4X4YA 3ZKNC 4H0IA 5I1GL 2ITCB 2ITDB 4BFEA 4MCZB 2MJWA 4U6TA 5HHVH 3SQOH 4UT6L 4ENEC 1WBXB 2H1PL 1VFUA 1S78D 1U8KB 2DQTH 2Z0BA 2LABA 3ARED 3HNVL 2EC9U 1YY8B 3ES6B 1P84J 4NQCA 3SDAB 1W0VB 5C0EA 1AGBA 4UINH 5FKAB 4PJDB 5D1QD 5K9JL 2BY1A 3DSNA 3S6CA 1JGDB 4JRYE 5KS9F 3EO0A 5DJDA 3CSYB 1CDYA 2YWZA 4L4TB 3WXWL 2HJLB 3L3IA 3S4SA 5BVPH 3IETB 4HWZB 3S98A 1S9XB 2PXYD 4LSPL 1JNJA 1BVKA 4OFYD 2HRPL 1FL6B 3QI9C 3NZHH 2E9BA 5F3BA 2UWEE 5HY9A 3INUL 3GSNA 4GW5A 1R3JA 2BVPA 4P2RD 2CRYA 5JIHA 3TV3H 4CMMA 4PJBB 2H6PA 3F7YB 5D72H 4PJAE 3SN6N 1MHPL 2NX5E 2IC2A 9CGTA 1HQRB 4JLRA 2E7LC 2R9HC 3CAFA 2EE9A 5DVLA 4R7DB 1T0NA 1BLNA 2IQ9L 4HH8A 4R7NA 1FYTD 3VGFA 4XPBH 2JJUA 3STLB 5I76B 5D7JA 4NZTH 3MCKB 1DQQA 3KYNA 5D7SL 2BXYA 2GSGB 4N8CH 4G8GA 4BSVB 4GW4A 3D87B 5IIEA 4FHBD 4K55A 5JQHC 3U4BL 3RWIB 2UYLB 2XZCH 4TULL 4Z7VA 2LVCA 4PJ5B 2P8PA 1U3HB 4ZAKB 1S7WB 1LGVA 2KH2B 3CDCA 3WL9B 4XCYA 3KYAA 2Q8BL 3CX5J 1RZGA 5GS2H 3VFWA 4U6VH 4DZ8B 1NDGA 2DQEH 3F58H 1J1XH 1F4WH 1BECA 3C2SA 4JY5L 3L7EA 1IM3A 1XF5B 3SDXE 1P2CB 3NZ8A 1Q9KA 3WIHA 3QCVL 1BOGA 3ETBF 3ULVE 3A6CH 1BJ1H 1XCQA 4XCEA 3IJHA 3JV4A 5HPOA 1I7UA 1CDHA 3P9MA 4EXPX 3AY4C 2BERA 4CN1A 4PLKC 4M4PA 3FO0L 4LMQE 2J8UE 2F19H 2VITB 3HZMA 2Z92B 3TWCL 2MPAH 4HF5L 4G3YL 2BNRB 1I85A 1T5XB 1QEWB 2M26A 2Z93B 4WFEE 4XC3L 4U1MA 4K2UL 2A6IB 1TZIA 1OAYH 3ARGB 1CICB 2A74A 4U1IB 4UUJB 2XTJE 4PJEE 4S2SA 4JM4H 1GGIL 5IJKA 1AY1H 1FZJA 1NCDH 3K2UL 5B4MD 4S1RH 3V6ZB 4WI3A 4DJMA 4GAYA 4PGZA 2B5IB 4ONFL 1T1ZA 4N68A 3I3BA 5BW7A 3ZKXC 4JRYA 3HAEA 3O9WC 1IQDB 1AO7E 1RK0A 4HV8A 1X5FA 2YZ8A 4X9IA 4M7ZB 3WV0A 4P5MA 4X6EB 3QIUA 3LDBC 4PJGF 4TVPE 4EN3A 5CKAA 1FO0H 1IVLA 2WP3T 3IB4A 1QA9B 1KJ3L 2YPLE 1MEXH 2UWEA 5DJYA 4M5YH 3P30L 1MJJB 3PWLB 5BJTA 3HUJE 5DURD 3L6FA 4JDVA 4LBEB 5DHYA 5GGTL 1UXSB 3ARFB 3DMMA 1NGWA 4PJAA 3BUYB 4YXLH 2BSSB 2NX5A 2ZCLH 1F90H 4KAQL 4XI5C 1CDGA 5ILTL 1S7XA 4KPHL 5HI4D 3BO8A 4PLKD 4HGKC 1T22B 3O0RL 3TCLA 2ZG3A 4H20H 3MNZB 2VDRL 5JOFB 1VEOA 2QQNL 5I9QB 2KZ1B 3O3BB 4HZLB 1JPSH 2YN3A 1HHHA 4H88L 3TN0C 2APWA 2NTFB 4D0DA 5MEQB 4ZOAA 2ERJB 4I2XB 3GKWH 5KW9H 4WWKC 2BSRA 3JV6A 4LLQB 3FT2A 3O8XB 4ZPVB 1NCWL 2FECI 1MCLA 3OR6A 3OAYK 2EYSB 1RJYB 2CJUH 3MLRH 3MUHL 2M2DA 1LILA 4NNPL 1IRAY 3LB6C 1NL0L 1J1PH 2NPLX 4ZUVA 5LWYH 2Y23A 3G6JE 1EMTL 3BZEA 4JAMA 3QIWB 3SE9L 3I9GH 2R2HB 2JCCF 3MLWH 3T77B 5AZEL 3HC0A 4LAQL 3ULSA 2DL2A 2VZUA 5INCA 4WV1B 5BOZG 3U9UA 1NCBL 4XRCA 3I3EA 4N1EA 4MJ5B 3DHJA 1R5WB 5I0DA 3P77B 5LJYH 5I1CH 1QBLL 2J2ZA 3SDXA 5AYQA 3BPLC 4KRPB 3GJFB 3HR5B 4A6YA 5HGGS 4ONOA 1NGZA 4O51B 1JMZA 4BSWA 2FNBA 2P4AB 2WUBL 4XI5D 2FZ3B 1UCTA 2NY0C 3PGFL 4C83A 3IU4L 5KJRL 4LPCA 1QSVA 4NCC2 2AI0L 4LASL 1D9KA 3MJ8A 4UDTA 5GIRA 3VFSA 5FFLA 1JNHB 2CH8A 3KPNB 3FT4A 5TF1L 4HUWB 4LMQI 1YYLH 2VZ1A 4HWBA 5EORL 3TN0D 1XR9A 1NC4D 1RSFA 4MQXC 3I2CL 4ONGH 1FFPB 4KGLA 4PJEA 3HZYB 1B4JH 1VGEL 4JE4B 4M93C 4NRYA 4OLUL 1IKFL 5D5ME 4XAKD 2N56A 5GHWL 4J8RA 1ITCA 4DW2L 4UV7H 5ACMA 2F8VA 5GISH 5TJWK 3TVMC 1LHZA 1BZ9A 4YXKL 4KZEH 3D3VB 1MWAH 5F89A 5IBUB 5ISZB 4G43B 5C0JB 1HNGA 2Z35A 1P7QA 1AO7A 2A6JB 4LPTA 3OPZH 4YFLI 4OCYL 3SCMA 1SYVA 4TUJB 4HCRH 4GG6B 2Q3AA 3F5WB 5HGBB 1IAIL 3FKUS 2V5MA 1RZJC 2YPLA 3RIAF 1V3KA 2VC2H 1IGTA 4L8CB 2YD9A 1A2YB 1A4KA 1G6RH 3CPLA 5JA8B 5DEFA 2JK5B 4X99B 2GJZB 5TFSL 2FJGB 1TCRB 4WTZG 2B0SH 3U0TA 1ZT7A 2B39A 3CU7A 1KIQA 1KBGL 2NY0D 1ZLVH 5F7WC 3PNWB 3HCVB 3CFDA 3K1KC 4ELME 4YGVA 4FTVE 1J5OH 3CFEB 4XBPB 1ZLSL 1CVRA 1MCSA 4OT1H 5IWLC 2OQJA 5B39B 2P5EB 3PL6A 3TH3T 2FX8L 3VFOA 5KSVA 2EECA 3T8XB 8CGTA 2HH0H 1JRHH 2AJSL 1ED3A 5T1DL 3VXOB 2EDBA 1IAII 4PR5A 3G6JA 3SE4A 4KVNL 3MCG1 5I30H 3TVMD 3WIIL 1T4KB 4RAVB 4YHYB 4NFBA 3FRUB 1CU4L 4G5ZH 4I48B 5DEGB 1NCCH 4AIZA 1EHLL 3RNQB 3JV0A 2UWEF 5FYKL 2DTML 2JE8A 2AJ3A 1VSCA 1FAIL 1G9EA 1DFBL 2CUIA 1X3DA 1SMOA 3ARTA 1OSZB 1DVFD 2IPTL 3CFKB 1WWBX 1PJ9A 3S97C 3IDJB 3T65B 5J7CC 4OFVA 5HD8C 3EYFB 3FQNA 1I8IA 5J6GA 4O2CA 5KTEH 1MIMH 3MLUL 3EOTL 1OP5K 4AEIL 5HHOD 2F5AH 2APBA 3GNMH 4Y0GA 1IM9D 3OB8A 2QQKH 1YEJL 1IC7L 1FVEA 4JN1H 1JHKH 4QRPB 2YUWA 1UM5L 1YECH 3P4MB 1FFQA 2VQ1A 5IW6B 1CXIA 3BD5A 5EUOE 4XGZA 5HVHC 4U7KA 2OP4H 1CBVL 4MMXC 4JPKL 2DQFB 1DBAL 4M43L 4BUGA 4D3CH 4OLYL 5FM4A 4XPFH 5I8CA 4S1DC 2ZCKH 2AS5M 1M7IB 3KJ4C 3QUZD 3BZFA 4Z0BL 1HINH 2PXYA 2IH3A 1EUTA 1QFWM 2WWMC 3RU8L 4DK6A 1CFQB 2YUVA 1JGLL 5IV2A 3C08H 4LEOB 4LQ1A 1NUFA 3NIFE 2AEWA 1T7WA 5IHLB 4NSKA 2R4SL 5JOEA 1T1XB 2VDNL 5DZOA 2OX5A 3ROOA 5IB2B 4OI9A 2JB6A 1ZA3B 4QHUB 1BM3L 3WN5A 4S11A 4WO4C 1A9EA 4MAYA 4YAQB 2Q6WA 1IGYA 1I1AB 3WMSA 1GZQB 2ARWA 1GZPA 2XQBH 4GUPA 2ZPKH 4DOHE 2DMKA 1FNGA 5T3ZE 4YDKL 5HD8D 2AQ3A 1HCVA 4Q74A 5HHQB 4OLZL 5C7XH 3H0TA 4APQC 1MCHA 2VH5H 2V9TA 2NY2C 1MRCH 3VXRD 3BGFB 4HPOH 2ZCHH 3VG0H 1IC4H 1OPGL 2CKBA 1GGCH 1HOCA 3HPLA 1KB5B 1KYOJ 1UM6H 1BPVA 5KZCB 4ELMA 1UB6B 3B4NA 4ZDHB 4FTVA 4IOIA 1KPRA 2GI7A 4JQIL 5E2TL 1T2JA 4N8PA 1T2XA 1JCKA 2CDGA 4JJ5B 5DJ6B 1DLFH 5J57B 4KI5E 5I15H 2QQLL 4U1KB 1C5CL 4S1DD 1BFOA 2F8OA 5SWQA 5MERB 2N1KA 3MCLL 3GMOA 3ZE2F 1KIPA 4NNYB 4WNQB 3DYOA 4XNMA 3VMNA 3WDHA 3O6MH 1EV2E 1MF2H 3FHAA 5D2NC 2OSLA 2P24B 3QCTH 3O4LD 3QI9A 5I1KH 4XP6H 1QFHA 1UADC 4HWEH 2YRPA 3QNXB 3BI9X 4JRXE 4TNWF 5HHVL 1WBZA 3SQOL 2DOCA 1CXFA 4BQCA 4X5LA 5F9JA 4OGZA 2DQTL 2HKFH 4JR9H 4UZGA 2Q86A 3O6FC 2E7LA 3NIGE 4C57C 4WO4D 1J87A 1TNMA 3LKSB 5EH1A 2VAAB 1C5BH 1ND0A 4OKDA 3OWEA 4UINL 1HQ4B 4PBXA 4X4ME 1HZHH 1U91A 3VFVB 4TSAH 5IK3A 4JDTH 5HGHA 3KDMB 3MJ9A 3RY6C 4OF5A 1K5NB 4NN5B 3D39D 4IMLB 5BVPL 5CBEA 2FBOJ 2FX7H 1U36A 1GCFA 2AV7B 5J11B 5E03A 1XGUB 3SO5A 4JY4A 3NZHL 2ZKHH 4CAGA 2OI9C 4OLVH 1XZ0A 1JNNH 5L8JB 1NCUA 3OKMB 5EUOA 2X4QA 3QHZH 3TV3L 4EXKA 3W5MA 4XCNB 1GPOH 5D72L 4Y5XB 3FO9B 1UFUA 1GYAA 5FUCE 3CFJA 1T1WA 4POYA 1KPUB 1UZ8A 3O3DB 5ETUA 5SWZD 5A43C 2OTWB 2QHRH 4G6FD 3WHXA 2J12B 3ARDB 4HJJH 4ZTOH 4XPBL 4TUOB 3VA2C 2W59A 3RWEB 2XWTA 4J3TA 4A2MA 4XNXH 4NZTL 5IB5A 1YPZB 2IFGA 3GJFH 1V7MH 2B4CH 3RWHA 3JWDH 4G6KH 4N8CL 3RNKB 1T21B 1P7HL 2KDGA 5BS0E 2KZWA 3PWNB 5J13C 3O6FD 2JELH 4ODUA 3AS2A 4CVZA 5EZIH 2XZCL 5IMKB 5J9PA 2R0LH 5C0BD 2Z8WC 5IG7B 3S4SG 3VXME 3V52H 4AJ0A 4JFDE 4NPYB 3OMZA 1CLCA 1J8HD 4U6VL 2DQEL 3F58L 1J1XL 2BXZA 1F4WL 3DX7B 4MQ7A 4K7FA 4C59B 1R5VB 2BY2A 3VD9A 3MBEA 2M1KA 4X5XB 5EU3B 1JPFA 2BJMH 3RI5F 4IOSD 1QTYT 3A6CL 3OXSB 4DKFH 5JIPA 1P4LB 3QUXC 3Q6FB 1WWAX 3IRZA 3MSPA 3C09C 3WLWD 2Z91A 3O9WA 1N5YH 4OB5H 3GUTA 1KACB 1NAKH 2V2TB 2F19L 2XN9D 4N90E 2MPAL 2JF1A 1VB9A 3QUKB 4U33A 4LLMA 5DGQA 4XVJH 2AJUH 1OAYL 1W72A 4ZFOB 3BD3A 1RAMA 4JRXA 2VL5A 3KS0H 2E7HA 4Y4KC 5DA4A 5DMYA 4Y5VB 3ZYOA 4NKOB 4JM4L 3TBYA 5E8PA 1B6DA 1JZ3A 1AY1L 5IMLA 1NCDL 1T0MB 4S1RL 4H0HB 3OKOA 3M1BA 3N1FC 3QA3A 1N59B 3KLSA 5FA4B 5ESQB 4X4MA 2V7NB 2VE6A 4MDIA 5BMFH 2ICES 4LNRB 5DJ2A 4UTAH 5HGDA 2MKWA 2AK1H 1RZIB 4WWKA 3QXWA 4NUJB 4HJ0D 1N5AA 2YUZA 1FO0L 2BC4A 4UBDC 5IFJA 3LRGA 2FATH 1A9BB 3VXSB 4M5YL 2HT3C 1N3NB 4PJ8B 2GFBB 4YBLB 1LNUB 1U8HA 2FSEA 1P5VA 4H26B 4YIQB 4YXLL 3QUXD 2BHZA 2ZCLL 1F90L 2JIXD 3D2UA 4MD4A 3BHBA 4ZS6C 4UT7H 2VRAA 4KDTA 2ZUUA 4OLWH 5E56A 3OX8A 4H20L 5CP7B 4ZUWB 1U41A 1MFNA 3QNYB 1JPSL 5EFIB 3LN5B 2ORBH 3GKWL 5E2WH 3HE7B 4YFEA 2E9JA 4MJ6A 1GOHA 1JTTA 3W9DA 1P6FA 1FE8H 2CJUL 3MLRL 4NKMA 5I1LB 4Y4KD 5TPWH 5BS0A 1J1PL 4WI8A 5LWYL 4D9RE 3WE6A 2HFFB 3HAEG 3I9GL 4RRPA 1EUUA 4ODSH 3FAXA 5I73B 3MLWL 5CLWA 2MOVA 3K80A 4KHTH 2L7UA 1R3HB 3PHOA 3QEGH 1S9WA 2CLVA 4HIXH 4YNYA 3VXMA 1D7FA 2PTUA 4JFDA 1TVBB 3BRGC 1KCRH 3TIEB 4PD4K 1LP9B 1JZ7A 2ICWB 4QRRE 4Z6AT 5J12C 5I1CL 4OGXH 1YEGH 1FP5A 2EIBA 4UBDD 4R97C 2WBJD 1VGKA 4MXWH 1R5IA 4ZPTB 3KGRA 3TBWB 3QH3B 2HT3D 4PGBB 1MSPA 1FZOA 5GRVL 1PEZA 3KYMB 5H35A 2XQYG 3QXAB 2ZUQC 4I9WE 4WRLA 1FVDA 2G75B 4ZS6D 3QPQC 1HSAA 1Q94A 5KVEH 1ZA6A 4L8DB 1D5ZA 2QR0A 4YX2H 3P4LA 2R23A 4JKKA 5GS1B 1HKLH 3NCFB 1WFUA 3EDKA 3VXQA 4QXUH 1YYLL 5CINH 5EO1A 2FIKB 3NTCH 1QQDB 3REVA 4ONGL 5IMOA 3SPVA 1QBMH 1B4JL 1S7RB 2IALB 2NW2A 1AP2B 3BRDA 2DYPB 4HBQA 1JWUB 4UV7L 5GISL 3E3QE 1XGQA 1GAFH 4KZEL 1HHGA 4HLZH 3WUWB 1MWAL 3P3YA 3WS6A 2C5DC 1KB5H 3R8BB 4E42A 2AP2A 2V5YA 3OPZL 4NZJA 4HCRL 4PP2B 3NAAH 1MRFH 4CDGC 2ARJB 1YNTA 4U1LB 4HUMB 4UIMA 5L2KD 3U4AA 1A47A 2VC2L 1N8ZA 3MRMA 1G6RL 1ZT4B 2GY5A 1RJCA 4KXZH 2ZSVA 3E6FA 3VFGH 2VLME 4URTB 4P4KD 2B0SL 5BXFB 1OVZA 5IP4A 1OGTA 3L9RA 1F2XK 1OCWH 1XIWC 3PDOB 3X11A 3QPQD 5HJ3A 4OIIH 3H9SB 4X6CB 1J5OL 4WTXA 4LRNH 2SEBB 3MROA 2VISA 4OT1L 3QIBD 3O45B 3X13B 3IDIB 3PABA 4YZFE 1FH5H 2Y7QB 3VWKA 3MV7D 2HH0L 1UQSB 3V7AE 4U05A 1JRHL 1PKOA 3DI3B 1X9QA 4RGMC 1JK8B 1Q9WB 3OKKB 6CGTA 3K0WA 5FO8A 1WSST 3TH2T 5CGYC 2VDPH 3TO2B 5I30L 3BPCA 5M95B 3WFBH 5AEAA 1QFUH 3GRWH 2C3WA 1MRDH 4Z7WF 4G5ZL 4KUZH 4OV5B 1NCCL 5CJQH 5DJZA 1KB9J 1H0DB 2Z4QB 4MJIE 4I18B 3JTTA 5IEKA 2Y07H 4QHLB 4QRRA 3SDCC 2C1PA 4HXBH 4WFFE 3RWFA 4F9PC 1I3RA 1JJUA 4NT6A 3GGWA 3O11B 1SY6H 1M7DB 3GB7B 4Q6YA 4PRNB 5F21B 3BXNB 3QEQB 3VE0B 1R3KA 2FJHB 5GS3A 5KTEL 4EI5C 1SJVA 2C9AA 1XF4A 25C8H 1KXTB 1JRHI 4RAUB 2F5AL 4P5TC 3GNML 5HGAA 2QQKL 4JN1L 3F7RA 1JHKL 2AK4B 2GTZA 2GCYA 1GOGA 1XIWD 1YECL 1YQ2A 3LV3B 1PDKA 3OZ9H 4M5ZH 1CTNA 2OP4L 4ACPA 5EBLA 5GSRB 4OM0H 1AGFB 2EO1A 4D3CL 5C09B 3WFHB 3BDBA 4XPFL 4J3VA 1AGCA 1IGFH 2ZCKL 5DHVA 5MP6H 3D39A 1ZHBB 5DO2C 2GJ6E 3BW9A 1HINL 1T5WA 3GSXB 4APQA 2IANE 2ATKA 3FQWB 3IDUA 4IRJB 4YXHH 1QP1A 4DKAA 5I2IB 3T1WA 1H3VA 3C08L 3ELAT 5EIIA 3SKNA 1VADA 3G5XA 3PWJB 5CGYD 1T3FB 5J8OA 3DO3A 1KIRA 1FFNB 5JW5A 4AENA 4O4YH 5SWZA 3CFBB 2H9GB 1CFSB 2CDFB 5ID0B 4Y19D 3SDCD 3OKNB 2BNQE 5HYSA 2XQBL 2XTLA 2ZPKL 4IHOB 2NXZD 4JFXA 4YHPA 4OZHE 2G5BB 1UWXK 3ZKSD 1TTFA 4I8DA 4JM2A 4YHOH 4ZUSB 2Y6SC 5C7XL 4EI5D 4LSQH 3S5LB 2VH5L 4P5TD 5C0GA 4HPOL 2ZCHL 3WXVH 4F7MB 3VG0L 1B9ZA 1IC4L 4Y4HB 3B9KC 1Z5LB 1IFHH 1DZBA 1GGCL 1UB5B 1UM6L 5LAXA 1K8DA 3D85D 3MGTA 1BF8A 2ZNWA 3GSRA 2VTFA 3QJFB 1KCKA 5I1DB 3DURA 3GM8A 4P23B 1QO3B 2Q7NA 1DLFL 3RY6A 3F6IA 2NY5H 5I15L 3W0WB 1NFDF 3X3GH 2D7OA 5T1LD 5H94A 5DO2D 2FX9H 2OTPA 2X40A 3O6ML 5E9DD 3LD8B 1MF2L 2FGZA 3GBMH 3QCTL 1M71A 4L9LC 5I1KL 5IB4A 1F3DJ 4XP6L 4HWEL 5FV2A 1FLTX 5E8OA 1E4WH 2H32B 3JV5A 3IAGC 3HMXA 1EJOH 3TJHD 4JZNB 5EU4B 2NW3A 3CH1A 4JFQB 5B8CA 2HKFL 4JR9L 3MRQB 4MJIA 2E27H 2X05A 2J1KA 3ZDYE 2B1AH 5CHNA 5K93A 3PE9A 5FYKD 1FNHA 3HA0A 1C5BL 5HDQH 4NRZB 1HZHL 4WUKH 3U0PB 5SV4A 1OWRM 4X6BA 4TSAL 2HLAA 4JDTL 1GRWA 2EDRA 3QRGH 4D0BA 4JFHE 2VWEC 1HXMA 2DL9A 2FX7L 2QSQA 4JY6B 3UMTA 3P4OA 4MD5A 3RX8A 3T2NH 4IJ3C 1YZZA 3JUZA 3SGEH 4KZDH 2HRLA 2RFXB 2EDFA 3EOYG 3JBG7 4JPVH 3SBWC 2ZKHL 1XT5A 4OLVL 3ZSSA 4R2GC 4V2BA 3QR2A 5EU6E 3VFNB 1JNNL 3NA9H 1R0AH 4NRXA 4CBPA 2EEBA 4QRTB 2DMCA 3QHZL 3WBDA 4CKVX 2NXYD 3U7WH 1GPOL 3V8CA 3ZDXF 5K9QG 1QSFE 5HI5C 2FYYA 2VMFA 3GSUA 3G08B 3CDGA 1JN6B 1B0RB 2GJ6A 2IANA 1IGCH 3NCEB 2QHRL 5E70A 4HJJL 4X6DF 4JGJA 4ZTOL 3TGXA 2GSIA 3KHOA 3IVKA 3QUYC 1D6EA 4XNXL 4PJIF 1V7ML 2BSTA 3KPSE 2B4CL 5D1XC 2A73B 2VOTA 3JWDL 4G6KL 2NY1B 4U0RC 3FL7A 4PJHE 2FWOA 5KAQF 1QSEB 1R3LB 2C3HA 5C6PB 3ZYZA 1MH5A 2JELL 2HJKA 5TQ2H 2CK2A 5EZIL 4NKDB 3ZDZE 2BNQA 2R0LL 1JF1A 4LDLB 2F53E 3FHQA 4OZHA 4Y4FC 3ZSTA 3PHQA 3KXFB 1MI5E 2KQMA 3FB7B 3TNNA 3V52L 5J1TC 4Y4KA 2EKJA 4NCC1 4YHNA 4PREA 2YSSB 2IEPA 2X09A 5ENWB 3MLVH 4HSQA 4OFDA 4WHDA 2E3VA 2O61B 3CXHK 3R0MA 3L3DB 4JN2A 3IF1B 1NMAH 4HS3B 2BJML 3DVNA 1W8OA 4H1LB 4R2GD 3S8WA 3KYOB 4DKFL 1X4YA 1TPXC 4M8QA 3VDAA 4PGEB 1F97A 1U8OA 4M61A 2G9HA 1L0YA 4G8FA 2YD7A 1N5YL 4OB5L 4Q6IB 2X4TB 4MMZC 1NAKL 4L3ED 4G80A 1HYSC 5IBLC 2XKNB 4P99A 1EH9A 3AU1B 1UYWH 2YS4A 2WSKA 4H5SB 4I4WA 4XVJL 2AJUL 5I18H 4RAHA 1XF3A 1W0YT 3DX9A 4N5EC 5KSAC 5EC1B 4K7PY 3QUYD 3SY0B 5DRNA 5C86A 2RBLA 5D1XD 3MBXH 4WUUB 4PJCE 2EE3A 4PLOB 3TT1H 1ADQA 5I71C 1BD2E 4W4NA 4B53A 5KANI 3P9LA 4YHIB 5ELIA 1CG9B 5H37G 4BQ8A 2BVYA 4F58H 5I17A 2I27N 5BMFL 3UTOA 1LEGB 4M6AA 4Y4FD 4UTAL 4HS6B 4R9HA 1EAJA 3QSKB 2AK1L 4POZD 1RUKH 3TZVC 1FGVH 5FECA 1DQLH 1EEYB 1AQDB 1G0DA 5MEND 1R6VA 2IBZX 2WLYA 5CIPB 1JPTH 4AY0A 1JZ5A 4DFHA 2NZIA 3SDDA 4UTBH 4CN4A 2DI7A 2FATL 4U3XA 2X41A 2M8XA 2GW5A 3FFDB 1A1NB 1ETZB 3HG1D 4C56D 3PV6B 1IT9H 1QSFA 4JFEB 4F7TA 2QLVB 5IVXE 4JVWA 4P2OB 2PO6C 3CIQA 3B3IB 2IMNA 5I66B 4I3GA 4UT7L 4MA3B 3DARA 3IKCB 4OLWL 1HYSD 4GAFB 4GXUM 3SJVB 5DLMH 1A6AB 2MFNA 3C8KB 3MV9E 1TETH 2ORBL 1YMHA 3PIQA 5E2WL 4EKXA 3L3GB 3DXAD 3KPSA 3IDNA 4JO2H 3RY5A 2YD8A 3TBTB 3QJHA 4XBEH 4F8QA 1GJIA 2NY7H 1QPPA 4OZ4A 5GGTA 4ELKB 1FE8L 1A7BA 5TDNA 1WUNT 5TPWL 4XVUC 4PJHA 4QRQB 3C6LC 5DMIH 5EPMB 4GKZB 2R0ZH 1F11B 4FXGB 1LE5B 5IFHH 5GZOC 1CD9B 1QR4A 3RZCA 8FABA 4MXVE 3B8SA 4GAGH 2WINA 3MLPA 5IB1B 4FZEH 2P47B 4ODSL 4Z7NF 2VZ3A 4Q2ZB 3NN8A 4KHTL 3FFCB 2F53A 5EBWA 2EIEA 3QEGL 1MI5A 4HIXL 4LSTH 5L8LB 1Z9LA 3LKOA 2X7LA 4I3RH 3MRGB 1YMMB 4M03A 1MREH 4LLWB 4E41D 1KCRL 2BVQA 2A6KA 1D6VH 1AGDA 1MIEH 5GS2D 4BQ9A 4D2NA 4OGXL 5E7BA 1YEGL 2H2SD 1BZ7B 3WIFB 3N1PC 4MXWL 5FDWA 4KJPC 1KC5H 2JLLA 4PV8A 3C5ZA 4MZ2A 5D7IE 1JHTB 3LEVH 2VR9A 3PWPD 3MFFB 3QDAA 3RRQA 4IOFD 3JTSB 3VW3H 4HPYH 5EOTA 1U8MA 2BMKA 5KVEL 3RVVD 3QWQB 4LCWE 4YX2L 1CE1H 3MOBH 4N8VA 1HKLL 3S35H 1S9KC 3P73A 1KCVH 2AGJH 5D7LE 4QOKE 3L5WB 4QXUL 3VFPA 5CINL 2Y5TA 1NJ9A 2GJJA 4M6NH 3NTCL 1PW3A 1U2HA 3L1OH 2X10A 1F6AA 1QBML 3LS5H 3FOMA 4PJCA 3QDMB 5L6YH 5CZXC 1BD2A 5D2LF 4QY8A 4XVUD 4RRPG 1YDPB 3C6LD 3IAQA 1KLUB 3D0LA 3ESVF 3T4AB 1GAFL 1S7UA 3EYQC 4X9BA 3EOAB 3UTSE 4JCMA 1KB5L 3TJEH 1N7MH 5CBAB 1ES0A 1BX2B 1XR8A 4XH2B 4JVUA 1CGTA 4QXTB 4R3SB 2AV1B 4LCIH 3SGJA 1NLDH 4LHUA 5IHBA 3NAAL 1EAPB 1MRFL 4N0YH 2IAMC 1H3GA 5F3HA 3O2VH 1A7QH 3RVUC 1GGUA 2P8MA 1LD9A 2DWEB 1MHEB 1ZT1A 3DSFH 3QWOA 1GHFH 5K9KB 4QRUA 3VFGL 4KJPD 5IVXA 2IBBA 2H32H 5F7NC 4RWHA 4RGOH 5EOQH 5C0CE 3S37H 1OARH 3BPNC 3OAUH 1OCWL 2P49B 2Q20A 4YC2B 43C9B 1CFBA 4OIIL 3MV9A 2FJFB 5I74B 1EFXD 2H8PA 5CSZA 4LRNL 1XGRB 3OAYH 4J3UA 3L3JA 5TDPB 4NQDD 1FH5L 3A67H 4G42B 4L3AA 3NACH 2VWEE 4GH7B 4F7EA 4LVNB 4P5TA 4DVBA 5C0RH 4C54A 1VFOA 3G5YB 5DS8A 2JJTC 5CZXD 3I75B 2MSPA 3QBTB 4K71B 5C2UB 1EXUB 4PRIE 2VDPL 4CNIA 5DZNA 5EIVA 3WFBL 5DI8A 3EYQD 3ROLB 5HTSA 1QFUL 1VPOH 3GRWL 3NBNA 1MRDL 5L0QC 1LO5B 4KUZL 4MX7A 3VI4F 5CJQL 1NFKA 3BGAA 3MC0A 4DUVA 4Z95H 2VLRB 3G9VA 3TESA 3QUMB 4ODHH 2WWKO 4IRSB 4KK8D 1FGNH 2Y07L 2XICA 4KK6C 3OHXB 3GMPA 4HXBL 4HBCH 1NGYB 5ESVA 3CVIH 3T2OA 1JBJA 4PRPD 2H26B 4Z0XB 3V0VA 1SY6L 3RVUD 1MAMH 4YO0A 2P7TB 1N2RB 4WI7A 2RAMA 4OCRH 2XFXB 5D7IA 25C8L 1RURH 3RZWA 1HILA 1QLFB 3BFOA 4QHMB 4JFYB 3C9NA 2HTLC 3MLYH 3LIZH 1U42A 3T0BA 1MHCB 4NQED 1FZMB 1MCOH 1EFQA 4LCWA 5GS0D 3OZ9L 1S7QA 4M5ZL 3QFJD 3DX6B 5D7LA 4QOKA 3U6RB 3GSWA 3SDAC 4OM0L 3WEXA 4XB8A 3SO3C 5H8DA 1IGFL 5HPMA 5MP6L 3B6SA 3BQUD 1ACZA 4J3SA 1UVQA 1YJDH 3ZE0E 1K8IA 5DJ8A 4RMQA 4YXHL 3D18A 2GT9B 1W0WB 2AKRA 3VFMA 1GOFA 3LEXB 1R24B 3B9KA 3L95B 3KPPA 3UTSA 3K7UA 5I16A 2AEIT 4H1LH 1FFOB 4Z78A 2HFEB 4F15B 1SEQH 1U92A 2CXGA 5EZLA 5SX4H 1RHHA 1Y18B 1PGRB 4O4YL 2BOBA 5JIKA 5E8NB 4Z77A 1ZHLA 3QDGD 1HDMA 2QADD 5BRZB 4KK6D 4EDXB 1CFTB 3RX5A 4LQFH 4JFPB 3FN9A 1XGPB 1DVFB 4L9LA 2GK0B 5F6IB 2IH1B 1QSZA 4YHOL 4ZFOL 4FABH 2NY6B 4LNVA 4LSQL 4OI7A 1AKJD 1OB1A 1L6XA 4QTIH 5C0CA 4JFFB 3WXVL 1J0ZA 1IM9B 2HTLD 1M05A 1IFHL 3UBXB 2GAZB 3V95A 1KTLA 5DMKA 3OXRA 1A6ZB 1YC7A 3BP4B 3BVNB 4KDVA 1U3HC 4WFGD 4ZAKC 1NEZA 3NOIA 3VH8A 3IFOA 3KAAA 4NNXB 1YEDB 2NY5L 3X3GL 3O41B 3D48R 3F62A 4PJFB 2F74A 1QD0A 2FX9L 4LVHB 3CC5A 3EDDA 4L4TD 5MEOA 5CIPH 5CJBA 3H3BC 4NC1C 3S36H 3GBML 4PRIA 1HH9A 3HI5H 3KLAB 1RK1B 1E4WL 3QQ4A 1NGXB 1EJOL 2IPUG 4HGWA 3W2DH 1U9KA 4RGNE 2E27L 5HYSG 2B1AL 2D9CA 3CX5K 5DQ9B 1OW0A 3LSOA 4QLRA 4LLUA 1DSFH 4NQSA 3L5HA 5HDQL 2OL3B 6FABH 2BX5A 4WUKL 3E2HB 1UJTA 2YD2A 3QRGL 5E5UB 1C12B 3ARGC 3LHPH 3QWRA 4I0CC 1WZLA 1VA9A 2YPKB 3T2NL 1F4YH 4KZDL 4S0SD 5EC2B 4HWUA 4LCUA 4JPVL 3GIVB 1NGQH 3TNMB 1ZXQA 1JF5A 3NA9L 1R0AL 4JZJB 2J6EA 4OZIE 2WBWB 3U7WL 3VD3A 4Z7UE 5FYJH 1RJZA 2B5IC 2FL5B 4WTWA 4XXDB 4PJ5D 1U3HD 3QFDB 4ZAKD 4P48A 3RA7H 5AYUH 3GFUA 1FL3A 3BZDA 4HUKB 4M7ZC 1NKOA 4PIRF 4NOBA 3EYOA 4KJYA 3OSKA 4P46A 1KT2A 4RBPH 3RUGF 5C08E 4PJIB 3SQBA 4HK0B 3ARWA 4X80H 4QGTA 1WCBA 1G7JB 3MRIA 3LS4H 4HKJA 5ESAB 1FC2D 1U3ZA 1VESA 4PJ9A 3U2SA 3QQ3A 5TQ2L 2I9LB 3HS0A 1HNFA 3K8MA 5AWNH 3ARQA 3BIKA 2CKNA 2R1YA 1P1ZB 2IADB 5EU5B 5I9QC 2X1PA 2VLJE 2BNRD 3T3PF 1FNAA 5KSAA 5IF0B 4DQOH 4MB3A 3UTTB 2L7JA 1P69B 2ERJC 1E28B 4G9FE 3M17B 5EDXA 3IDYB 3QXUA 3V0AC 3O8XC 4RX4D 1CICD 2OMBA 5F1IA 4U1GB 4EI6B 5FO9B 2X4UA 3MLVL 2ZUSA 4R8WH 3ULUD 2CLZB 3U46B 5C92A 1UJ3A 1NMAL 1HHKA 3ARBD 3ZTJG 3IXAA 2C1OB 4N1CA 3QZWA 3QIWC 3FOLA 1WT5C 1I1YB 3ORJA 4EQ3A 5HXMA 1UGNA 1B88A 2I5YH 3VCLB 3I6LE 3TZVA 3F8UB 1I8MB 1FV1A 1E6OH 4WV1C 5C1MB 3KS0J 1UYWL 3KR3H 5D7KE 5FKPB 3DBXB 2XPGA 5FM8A 1YEKH 5I18L 4ZFFA 3V6OE 1ACYH 5CEXB 4ISVB 3KPOB 1I1RA 5JTWA 4KRPC 2B4CC 3MBXL 3NPSB 2ATPB 3TT1L 3JWDC 3NCYP 3VGAB 3SKUD 2PO6A 3ARFD 3KPMA 3TYGH 4WJ5B 3H2WA 2DIAA 3MA9H 3LCYA 3WKMH 5IQ7H 2BOCA 2A38A 5JXEC 1AHWB 3IKKA 5J1AB 4HMCA 4GLRI 3FQUB 4AK1A 4F58L 5FGCE 3MRCB 2HVKB 3WJJA 1P4BL 5DF0A 2AQ1A 3BMWA 1W2KT 1OAZH 1OLZA 4ZQKB 5C07E 3MUZ1 1RUKL 1FGVL 3FRPA 1KJMA 1DQLL 5AUMA 1D5BA 3PQYE 3VXTB 3DTXB 4YK4B 1QYGH 2EIZB 1JPTL 3EIFA 3O8XD 1NC2B 3WUZA 4UTBL 3W81A 4LLYB 4NWTH 1U8LB 2W07A 2VZVA 4OBSA 3BH8A 2VXUH 3MA7B 1IGJB 5TDOB 1EVTC 4OZIA 2P44B 4ODVH 1IT9L 4OLXH 4Z7UA 5LGHH 3QIWD 5HVWA 5DFTA 2FD6H 5LGKA 1MQ8A 5ECJE 3C87A 3HC4H 5ICXA 4NDMA 5T1KA 4PRHD 3QUMH 1U93A 5DLML 4MHHG 4PG9B 4CN6A 5C08A 1J12A 1TETL 5C0EB 1EHAA 1AGBB 3MR9B 4Y1AE 1PKQE 4LPVA 1X6LA 4JO2L 2OR9H 4XBEL 1XH3A 2NY7L 4HJGB 4KRPD 5HYEA 5DJDB 4QT5A 1B0GA 5DMIL 4FFYH 3L3IB 2R0ZL 1AE6H 3S4SB 4WU7B 5IFHL 5AAMA 5LQBH 5CWSA 4RMSA 1BVKB 4GAGL 4GRWB 4RFEA 4FZEL 3K46A 5JXED 1M7XA 5C3LD 2CO7B 5MEPA 1EFXA 2D0GA 3L7FA 4ZO7A 2EO9A 2VLJA 4LSTL 1NANI 2BVPB 1E0OB 4XXCA 5BZWA 1A1MA 1RZKC 4I3RL 5GJTH 2H6PB 1MREL 3NFPB 2CMRH 4JQXA 3MRNA 4G9FA 3UJTH 3Q3GA 1D6VL 1MIEL 1DQDH 4JLRB 4F8TA 4U2YA 4CW1A 2N7AA 5JW4N 4UDUA 3V7MA 5C2BH 4R7NB 3UTPD 2C3VA 2WWKT 5DFWH 1KC5L 4P2QD 5EOCJ 5F7FA 3VXUE 4WEUD 5D7JB 3LEVL 3D3VD 2D2OA 2EDJA 3LKRA 1DQQB 4YHYC 4L9DA 5ISZD 4G8GB 3WFEH 4PJBE 4GW4B 4XPHH 5IIEB 3VW3L 4HPYL 1O0VA 2IAMA 1CE1L 3MOBL 5M7QA 3S35L 1KCVL 2AGJL 3V6OA 3S7GA 4Z7VB 4M6NL 5E1HB 3B9VA 1DR9A 3L1OL 2P1YA 4HUUB 4K3GA 4BSJA 4XCYB 3CD4A 3LS5L 1OQOA 1RZ8A 3VXPA 5L6YL 5GRXG 3LKPB 1RZGB 3PHSA 1MNUH 3VFWB 5ABDE 4I5BB 4ZSOE 2V2XA 2X1WL 4NQEA 3MLSH 1N6UA 3L7EB 1IM3B 2PW1A 3EHBC 1UEMA 4M3JA 1FRGH 1H15A 3TJEL 3NZ8B 1Q9KB 1N7ML 3CLEH 1BOGB 4MVBC 2W9DH 4YJZL 2X4NA 2V5RA 3AAZA 4MD0B 4EEEA 1XCQB 2H2PD 5C07A 1ULVA 3JV4B 4L4VE 3P9MB 5ALCH 3PQYA 1H3WM 4LCIL 1NLDL 3CZFA 1H3XA 4ZUUB 4N0YL 2P5ED 4Q9BA 3HZMB 4HLJA 4ALAH 2JJTA 3RWJB 1T6WA 3O2VL 1A7QL 1ZHNA 1J10A 2MCPH 5J6HA 1AD0A 2VDKH 5DK2A 2IPUK 3DSFL 1GHFL 2WBJB 4P2CG 3S35X 4U1MB 4W81A 1W8NA 1J0HA 1TZIB 5ID1A 2DS4A 1HCFX 2A74B 2PF6A 4ZXBD 4X6FB 2ZP0T 4RGOL 5EOQL 3S37L 1OARL 2D7TH 1FNEA 3OAUL 4N8VG 3G04A 3D6GA 1KOAA 1FZJB 1EO5A 2R2CA 3BKJH 3C6SA 2DMBA 3MRFA 4GAYB 2OL3H 3BP5B 5E94A 1T1ZB 1I1AC 4PY7A 2YD5A 4Y1AA 1PKQA 4JRYB 3A67L 5SX5K 5F9OH 4N0UE 4HV8B 2P8LA 3NACL 4QYOA 4DZBB 2ITCA 4DCQB 5C0RL 4EN3B 1WBXA 1PVHA 3KPRE 1U8KA 3OGCA 3VMPA 5FIEA 4UNUA 1VPOL 3EHBD 3FQXB 4ZO8A 5DJYB 3QCUH 4QRPD 2Z8RA 3Q6GH 3QDHA 1DN2A 5BJTB 3L6FB 4JDVB 4LHUG 4MVBD 4U6XA 5DHYB 3SDAA 4G6AC 1YEIH 2L4OA 3HE6A 2EXWC 4PJAB 4Z95L 2NX5B 4ODHL 3GSVA 1FGNL 1S7XB 1DCLA 2HT2D 4KQ4H 4A2LA 1VEMA 4RFNB 4HBCL 2P48B 3CVIL 1INDH 3S37X 4KMLB 3TCLB 5DD0H 2DKUA 3IETA 1X5LA 1S9XA 1I7ZA 1CD1B 1MAML 5CJOH 1HHHB 1KCUH 1KTRL 4KVCH 3KWWA 3RDTA 4OCRL 3VXUA 4PS4H 4D0DB 2X89A 1KYOK 3JVGA 1INQA 3TM6A 1RURL 5A2FA 2BSRB 3JV6B 4JQVC 3WS3B 4LVOC 3OR6B 4W4OC 5GGSY 4PGCA 4PJBA 4P4KB 2XWBB 3MLYL 4R4NC 4G7YH 4AL8H 3LIZL 1LQSR 3BEWA 3GI9H 4ZUVB 1MCOL 3BZEB 4JAMB 4R7DA 3DPBA 4JKLA 1S8DA 3BMVA 1PSKH 2W65A 1I1AD 1VACA 4W6YB 3VRLE 3MJ7B 2DKMA 3HC0B 3ULSB 5I76A 3KHQA 4M9PA 5C0AE 3QIBB 4LFHG 1YJDL 4AZ8A 3MCKA 3U9UB 4IBLT 1IGMH 5IJVB 4ZSOA 3BP6A 4XRCB 1X5YA 4J23A 5J89A 4LPWA 5J11C 5B3JF 1VCAA 4NGHH 3SDXB 4ORGA 1RU9H 4OZGF 4H25A 1LO0H 1LE9A 3D69B 1SEQL 5F70A 1QRNE 5KZCD 4L4VA 5LVEA 4Y5XC 2EXWD 3IJYA 1MLCA 2XI9A 3CMGA 4TYUA 2Y06H 4RNRA 2J8UB 3V5KA 2KQNA 4C83B 4LQFL 1D9KB 5GIRB 3ARDC 3VFSB 1AJ7H 3OR7A 3FT4B 4QEGA 1XF5A 2VLKE 1XR9B 4FABL 1UXWB 2F58H 2VABA 3LRHA 2XTJB 1RPQA 3EZJB 1YY9D 4PJEB 4NN6B 4QTIL 3DGGA 1P53A 3HHRB 2OTUA 5LXGH 2R15A 4J8RB 1RIUH 4Q9CA 2VITA 1BZ9B 2K3TA 4NBXB 1REIA 5F89B 4AIOA 5E6ZA 1S9VA 1GSMA 1ZGLM 1U3JA 1P7QB 2Z35B 1AO7B 4N0UA 1NH6A 3HI6H 43CAA 2R2EA 4ETQA 3ARGA 3SCMB 5E00A 4U1IA 4UUJA 5DD3H 5KG9A 1XGTA 2VO5A 1A6TB 3S36L 1FHGA 3HI5L 1CL7I 3DROB 3K4DA 3VGGA 2YPLB 1IGTB 4LLDA 1G9MH 3S34H 3CPLB 3HUJB 5DEFB 2BRRH 5CZKA 3W2DL 3R06A 3WCYA 3BIBX 2UZYB 1IQDA 2QBWA 5DRXA 4YHLH 1DSFL 3E6HA 1ZT7B 1KIQB 5I6XC 6FABL 2VZTA 4NP4H 1QVOB 3CFDB 4AEEA 5A1AA 4LSSH 2NXZB 3CFIC 5EN2B 4LSUH 4YHZH 2CPCA 3HRPA 2OQJB 3IDMA 5HHMD 3LHPL 5KSVB 1I8LA 4Y89A 3TFKC 1DJSA 1F4YL 1ED3B 4Y5VC 3BUYA 2BSSA 2P43B 4LRIC 1NGQL 3LVEA 1WIOA 3G6JB 4GRWH 1NEZG 2NCMA 2XA8H 4WI6A 3S36X 1U8QA 5T3XE 1UA6H 3D85B 5FYJL 4MGXA 2H45A 4D8PA 4RFOH 5HVFB 5C0AA 3RA7L 3TO4D 5MEQA 2NY5C 1N0XH 5H2BA 2AVGA 5GGRY 1F4XH 2AJ3B 2V7HA 4ORZC 4ZPVA 5T1LB 3N0PB 3GMNA 5E95B 4PJDF 4KKNA 2E8ZA 1MOEA 4X80L 1L6ZA 3CVHA 1LDSA 3LS4L 3QIWA 2MQ3A 1WT5A 3FQNB 3SEPA 4O2CB 4PJ8C 1QRNA 3T77A 4Z5RB 4U2ZA 1WIUA 2XWJA 4OGAC 3RKDC 1UWXH 1FVEB 5AWNL 4OF0A 3V79C 1T83C 2X44D 3ILPA 2HYMA 2VQ1B 4FQ2H 5ITBH 4X7EC 4PTTA 4DQOL 4NO0A 3VD5A 1FN4A 3IDXH 3T0AA 3GJFA 2EDLA 3HR5A 1EHXA 5I8CB 4O51A 5DK3A 3DUSB 5ACZB 3TFKD 1CFNB 3ME0A 2IH3B 4R8WL 4NIKB 5T5NF 4WEBH 5D5MB 2BZDA 5IV2B 2HJFA 3CSPA 1RVFH 5MI0B 1CS6A 3WIHH 1Q8MA 1M6OB 2NXYB 2UY6A 4R0LA 4CADA 1JNHA 2I5YL 4TN9A 2JB6B 3O3EA 3AM8C 1E6OL 2FO4B 3WN5B 4M9OA 3CLFH 3KR3L 4I0PA 1A9EB 4MAYB 2RCSH 3D25A 1AD9A 1PD6A 1YEKL 1IGYB 2Q6WB 4R4FH 1YEHH 1ACYL 1GZPB 4GUPB 4P59H 5E6IA 1ZKAA 3W11C 3VFTB 3D3VA 1QKZH 3PDGA 2YEZA 4X9FA 3TYGL 5C0JA 3H0TB 1OAKH 3MA9L 3WKML 5IQ7L 2I25N 3C5SB 3WFZA 2DICA 2GUOA 3RKDD 3V5HA 4HFWA 2CKBB 3F5WA 3HPLB 4ZMAT 5HGBA 4ELMB 2OBGA 4FTVB 4IOIB 1I9RH 1F4HA 5HYFA 1OAZL 1KPRB 5GS1C 2C4FU 5FK9B 2CDGB 4HC1A 4ZTPH 3VGEA 1PQZA 2DM4A 5JOPE 5IEHA 1QYGL 3HE7D 1U58A 1GIGH 1BFOB 4L1HA 5SWQB 3GMOB 5JW4M 1KIPB 1MAJA 3QZWG 1MCWW 2Z31A 4NWTL 4QNPE 4XNMB 3JWOH 2VXUL 1UM4H 2OSLB 4ODVL 4OLXL 3MRKA 5LGHL 5TF0A 2FD6L 4OQTH 3ULUF 3NGBC 4PGDA 3O81A 3HC4L 3P11H 3H9ZA 3ET9F 3KVQA 3DX8A 4ZOCA 3CFEA 3V9FA 1S7SA 2I07A 5F9JB 1BBJA 3QUML 3REWA 3HZKA 4XHJD 2PTTA 2Q86B 1V3JA 4K7PH 5KSBE 5DD6B 2AXFA 3MRBA 4C58B 4D0CB 4NUGH 4NJAH 4XP4H 1X5IA 4L1DA 1U91B 2F5BH 2OR9L 1KLGA 3MUGA 5IK3B 3OKLA 2EKSA 3W11D 2CD0A 3LQAH 4K3EH 3ZKMC 4FFYL 1JIBA 1AE6L 5K59F 3B9DA 4I48A 2EC9T 5HBBA 4QTHA 5LQBL 1VERA 1C08B 1JYWA 1PBYA 5ALBH 3FRPG 4Y16B 1XZ0B 5EUOB 5GJTL 1S5IH 5KS9E 1CD0A 5DJAA 3IDJA 3DECA 1AR1C 3UJTL 3CFJB 1DQDL 2DQIH 1T1WB 1JF6A 3ZZ1A 3RFZC 1UZ8B 1XF2B 3SKOA 3FO1A 4P57B 4BFIB 5C2BL 3BN9D 2Q8AH 5IBTH 2DYPD 5FXCH 1WCQA 5IGXH 3T0EE 1FSKB 4C56B 3HG1B 1F00I 3C8HA 4WFHD 3RWHB 4L8SA 3WFEL 4F80A 3GM0A 2VN7A 4WVRA 4XPHL 2GEEA 3TT3H 3KLHD 4M7JH 2VZSA 4I18C 2DJ4A 2YBRA 4Y2DA 5F7MC 4CVZB 3N1GC 5J9PB 2X70A 5CSGA 5I1AA 1A8JH 1CFQA 2H41A 4DOHB 3VGBA 5JMOC 4LEOA 2NQCA 4FOMA 4CVUA 1QG3A 3I02A 2A2QT 4HWBH 4RMUA 3ZKMD 1MNUL 2XZQH 1ZGLA 5HDBF 4QHUA 3U30B 5DK0A 3MLSL 4MQ7B 4K7FB 5CKGA 1DBJH 4FQHB 2HVJA 3MBEB 1FRGL 3NFNA 5CJ8A 1JPFB 3PJSB 3CLEL 4WIQA 2DLHA 3EYSH 3MRDA 1NBVH 4OD3H 2W9DL 3LPWA 3GBLA 4OBRA 1J18A 1Q9LA 1DUZA 5ALCL 3H9SD 1L4IA 4X98B 2Z91B 2RIKA 3O9WB 4YFDB 5DUMH 1ERNA 1AR1D 4ALAL 2DI9A 4YPGB 3LDBB 3RGVB 1EBPA 1AC6A 4TVPH 1OD7A 3DOSA 3B5GA 2MCPL 4IRJC 2VDKL 4LLMB 5JQ6H 3CZJA 3B43A 4CU7A 4X5WB 1W72B 1UB6A 4ZDHA 4YUEH 1FNLA 1OD9A 1NDMA 2D7TL 3WD5H 4ZYKB 3TBYB 2ADGB 5E8PB 5F7LB 1NMCB 4KUCD 4B50A 3QT2A 5K33A 5KSBA 3BKJL 2JB5H 4KKAC 5HHNA 5MERA 3OKOB 2OL3L 4FP8H 3QA3B 4NNYA 4WNQA 2EH8H 4ZODA 1U8NB 2VE6B 4MDIB 5DJ2B 5SWSE 5F9OL 4GG6F 2YUXA 3WO3B 2VLLB 4JQVA 3QEQD 3IFPA 2GKIA 1Q38A 1T7XA 5DC4B 5IESH 1N5AB 2NY3C 2BC4B 4GO6B 4Y4HC 5BVJA 1JWMA 2VIRB 3KLDA 1IAMA 2AK4D 3QCUL 2QL1A 3Q6GL 4B5EA 5CMAA 2VAAA 5DFVC 1IL1B 3FB6A 1U8HB 1YEIL 1WZ1H 5KS9A 2FSEB 1ZEAH 4TPRH 5J06A 5KVGH 3VFVA 3SGKC 3GHBH 4P23C 3D2UB 4MD4B 4KQ4L 5C09D 4PJGE 1INDL 1K5NA 3AGVA 4NN7B 5DD0L 3OX8B 2R1WA 3P40A 1G9NH 3WHE0 3MJ6A 5ADPH 1P9MA 4MNQE 3MACH 5CJOL 1KCUL 3LD8C 4KVCL 2AV7A 2IPKA 4UIKH 2WMPA 4PS4L 5CLTA 3T0EA 4UOW0 3VXSE 4WDIA 3OKMA 4MJ6B 3W9DB 2AXHA 4NKMB 3TA3A 2PTVA 4AL8L 4G7YL 5KN5A 1VHPA 5BS0B 4K23H 4OCWH 1ZLUK 3GI9L 1DQTA 3U82B 3F7PC 1VKXA 4R90H 3WE6B 4KKAD 3DIFA 1MCJA 4BFBD 1PSKL 3ARDA 3PHOB 5A16A 5CEZE 3EW3B 2CLVB 4XPGH 3QDJD 4YNYB 4YH6A 3VXMB 3RBSA 1FVCB 2KKQA 1CT8A 4JFDB 5JW4R 2PYEE 1EGJA 5A40E 1IGML 1A5FH 2DWDA 1U8PA 2R2BA 3MLXH 4CU8A 1OTTC 3BGMA 4NGHL 5DJ0A 2JJSC 1RU9L 4DEPB 2B20A 1VGKB 2JCCE 4Y4HD 2D7NA 1LO0L 5TH2A 2QTEA 2O5YH 5KVDH 2Y06L 1VEPA 4P23D 2ZUVA 5I1HL 1FVDB 3W0WD 1HSAB 1Q94B 2J88H 4HEME 1IAKA 4U6HA 1RUMH 4GSDH 1DUYA 1D5ZB 2R23B 4BK4A 1AJ7L 3DYPA 1RY7B 5IHZA 1X5KA 3NCJH 1TVDA 4X5XA 2F58L 5EO1B 2LV4A 3CNKA 3REVB 4PRAB 3OXSA 3SPVB 5T33H 4KV5F 3MUY1 2NW2B 2NY1C 3SKJH 3BPOB 1LEKB 5LXGL 1RIUL 3ARYA 2V2TA 5IW1A 3VXNB 1S78C 1NUGA 1XGQB 3O2DH 3ALWA 4PFEA 5T5NG 1JI1A 3AREC 2CKBH 3ARUA 4M62H 1WVZA 1ROWA 4MB5A 4HX1A 5JZ7C 5SWSA 5GGUA 3HI6L 3L3KB 3RX7A 3VD4A 3BQUB 4O00A 5DD3L 1NBYA 2X4SB 4NKOA 4LRIA 1YNTB 1BVLB 2XT1B 2V9RA 1OTTD 2W91A 1N8ZB 3SE3C 1U95B 1G9ML 3S34L 1RI8A 2BRRL 4JG1H 5CILH 3RL1A 5FUZH 2V7NA 3GEWB 2ESVD 5GQBA 2DKSA 4Q6IC 4YHLL 4PJGA 1RZIA 5D93B 1OGTB 3L9RB 2WNGA 3EO9H 2D03H 3QDGB 2QADB 3X11B 4NP4L 3MV11 4MNQA 5HJ3B 4LSSL 1I9IH 5IT2H 3G6DH 1J05A 4LSUL 3MROB 4YHZL 2VISB 3LAFA 1A9BA 4LGPB 5D9SB 3VXSA 1WAAF 1OP3K 1JV5A 4PJ8A 5DZLA 2GFBA 3PABB 3VWKB 4OUOA 2GITB 5CZVH 5EBGA 4YIQA 3NH7H 2LVEA 4H26A 4F37F 2NY1D 3A6BH 5FO8B 1OSPH 1QSED 4X4XA 2XA8L 5JW3H 3BPCB 1UA6L 1T83A 4EIGB 1IAOA 4NC0B 4RFOL 4UQ2A 5HVHB 1P6AB 2IQAB 4X6CE 4CVXA 5JZ7D 2D3VA 3KXFD 2XIDA 1N0XL 2PYEA 1F4XL 3RPKA 3JTTB 3KJ4B 4GKSA 5IEKB 3BISA 4QRRB 2C1PB 1WLHA 1I3RB 5JPMB 2CSPA 3U0WH 5F1NA 4NT6B 2JCCA 3GGWB 7FABH 2APFA 2CR6A 1R3KB 2DRUA 4FS0A 4DFIA 1XF4B 5DT1H 4P2OC 5D6CB 5HGAB 2GHWB 3BP7A 3LH2H 5DTFA 2WQRA 1AFVH 2FIRT 4OM1H 1KN4H 2GCYB 4HH9B 2ICWA 4NCDA 5ITBL 2YMXH 1JWSB 4NQTA 5EBLB 3IDXL 4ODXA 3PUCA 1KTDB 5H37H 1K3IA 5T3ZH 3TBWA 4DAGH 4Q58C 3BW9B 1T5WB 4APQB 4WUUD 2ATKB 4WEBL 5F93C 4TRPH 4RSVA 2BNUA 1YPZF 5D6DC 3OKEA 2G75A 1VADB 3G5XB 1RVFL 3WIHL 5B4MC 1I3GH 4M00A 1K3ZA 3UEZA 5GS1A 1KIRB 2DQDH 2FH8A 3KPTA 1L0XA 3UYRH 5J0BA 3KYKH 2I9TB 1Z0MA 5J3HC 3CLFL 5I1JH 2E9WA 2RCSL 4GRLA 3RL2B 3V5DA 1OAQH 4R4FL 1YEHL 5GGSB 5HYSB 4O2FB 1JWUA 4P59L 4MAUH 4YHPB 2JKXA 2QSVA 4O2EB 4V1DE 3JUYA 3F6LA 2ZZUT 4CVWA 3WUWA 1QKZL 4JM2B 1W72H 3HPJA 1OAKL 2RQ8A 4JFED 3MYJA 3S3SA 4P2OD 3D0VA 5HI4C 3HNTH 5LAXB 1K8DB 1I9RL 3LMJH 3MGTB 4Q7DA 3SJVD 2AJZA 3GSRB 5HYJE 4U1LA 4LCCA 4ZTPL 1OGAE 3LN4A 3DURB 4XPTH 1S7VA 4LDEB 1ZVSA 3MRHB 1GIGL 2VUYA 3MPCA 5H94B 1VFMA 3O3AA 1RUAH 5JHDE 1FCCA 3JWOL 4MNGE 4PV9A 4P0DA 1UM4L 4J4PA 4I77H 3PF2A 1M71B 4F9LA 4FQXD 1OL0A 3ARBB 5IB4B 5INDA 4OQTL 5F71A 5E8OB 2VDQH 3P11L 4PG2C 3X14B 3FFCD 4X6CA 3BE1H 5FYJD 2NW3B 4JG0H 5B8CB 4MJIB 3NCYS 5BO1H 3ZE2E 1YMMD 4K7PL 1MAKA 5CHNB 5J3HD 3V8OA 1UQSA 3N50A 3I6KA 4NUGL 5I8OH 4NJAL 1Q0YH 2FECL 2K9UA 4XP4L 1JK8A 3SKMA 3OKKA 2F5BL 4X6BB 5IBUG 2V2WB 3LQAL 5DYOA 5EB9A 5C9JA 4K3EL 1HSBA 1GVIA 2OJEA 5ITFA 1HXMB 3RVXC 1A7PH 1II4E 1P4IH 3P4OB 4MD5B 4ZFGH 1PYWB 4GMTH 3MO1A 4HUVA 3GHEH 1ZSDB 4I18A 5ALBL 4YC2C 3VWJD 1IMHC 4XB7A 1FNFA 4QHLA 3CDYA 4NRXB 2FEEL 4LP4A 1S5IL 5I74C 2FYYB 5B3NA 5D1ZA 2DQIL 3VE0A 2ICEB 3GO1H 4KQ3H 3DV6A 1OY3B 4LVNC 4RAUA 3BKMH 3QDMD 2Q8AL 5IBTL 4K71C 2GSIB 4K7PX 2AK4A 5ADOH 5JO5B 1N64H 3IVKB 5IGXL 3WNPA 4IIQB 5B39G 3U7AA 4DGIH 5GSRA 2P5WE 3TT3L 1A7OH 4M7JL 1PFCA 4QF1B 4PRHB 1MH5B 4WENB 4KJWC 2YA2A 2EDYA 4O58H 1JUFA 2BNQB 1JF1B 2EYTA 2EDXA 5ERWA 2FEEI 4IRJA 1D5XA 4OZHB 4V1DA 3PHQB 3OF6D 1G7QA 2Z8SA 1RZJH 2F54E 3TNNB 4LGRB 3PWJA 4HWBL 3FB5B 1LP9F 2XZQL 3S3JA 1KGCE 5F97E 1FFNA 2XG4A 4YHNB 3RVXD 4MA7H 2EE6A 1DBJL 1EVUA 5EZJB 4EUPB 4JN2B 3RIFF 4OD3L 3EYSL 1NBVL 4KRNA 5GGRB 3DVNB 1CFSA 3HI1B 4BQ6A 1ZE3C 2W0LA 5ID0A 5IMMA 4PJXB 1QNZH 2CGRH 4M8QB 5HYJA 4M61B 1WK0A 5DR5H 5GS0H 2G9HB 3LZFH 1OGAA 4N0FA 4G8FB 4HKBA 4XWOD 5DUML 5AD0A 1ORSB 1AGEB 3BSZH 4G80B 1CI5A 4ZUSA 4G6JH 5JHDA 3MRPB 2MQCA 4BQBA 4TVPL 4MNGA 3QO0A 4I4WB 5JQ6L 3C60D 1XF3B 1E27A 4LU5H 4P2QB 5DRNB 4YUEL 5IROC 4U7MA 3QJFA 3WD5L 4EVNA 4F15C 1IKNA 1DBKH 4P2RE 1HEZB 3P9LB 4GMSH 2JB5L 1UCBH 2VLRD 3QAZB 4LIQH 1LEIA 4IRSD 4FP8L 3RTQA 3MX0A 4KJWD 4AM0A 2EH8L 2CR3A 1VENA 1E4JA 5EZOH 4OUUA 1WFTA 4D9QD 1DVFC 2ZUWA 5F6IC 1FYTE 3GBNH 1FDLH 4JFZH 5FECB 1PZ5A 2H32A 2NY6C 4JZNA 5IESL 5KBNC 4PD4J 3L3OA 1XGYH 3I6GA 3SDDB 2H3NA 4XVTH 5KVFH 4R6UA 3BYTA 2O5ZH 5EU6B 3VFRA 1VFBA 4TSBH 1DANT 1WZ1L 1ZEAL 4TPRL 4NRZA 5C6TH 4F7TB 5KVGL 4OCSH 3GHBL 3K1DA 3WNOA 4OKVA 5FGBC 3Q0HA 4CJ1A 1UENA 4M4RA 3V4UH 2Q3ZA 4NHCH 2YD4A 4X6CF 1G9NL 4JY6A 5ADPL 4LVHC 5E6YA 2LTQB 2MHAB 3VI3E 3MACL 3OBAA 3QUZC 4U31A 2ZUTA 5JMRA 1CF8H 3IJSA 3NIDF 4UIKL 2JJSA 2RFXA 1YMHB 3KPSB 3IDNB 3QJHB 4QRTA 4OZ4B 1NPUA 4L3CA 3OKDA 5TDNB 1IQWH 2P5WA 4ZXBB 4O9HH 4PJHB 1TTGA 4K23L 4OCWL 1Y0LB 3G08A 3FT3A 1JN6A 4R90L 3RZCB 8FABB 1B0RA 3U9PH 1LK3H 1FJ1B 2WINB 3W9EA 3RWCB 5A3IC 3CK0H 3NN8B 1UWEH 4KUCF 2F53B 5BRZD 3EJJX 3E2HC 4ZNCD 4XPGL 1CK0H 2F54A 4HDIA 2YRZA 4BM7A 2ADFH 5CFHA 4JO4H 1YEEH 1A5FL 1AGDB 2NY6D 3MLXL 5F7HA 2UUDK 2ZSWA 1R3LA 4JFFD 4LEXH 4TOYH 4E0RB 4R96B 4NKDA 2R0KH 3AREA 5C0NC 2YC1A 4JZJC 4LARH 3C5ZB 5JORA 2VXSH 1YQVH 1MCKA 3HMWH 1OWWA 5KSUB 1BIIB 2O5YL 3FB7A 5FM5M 5KVDL 5D1QA 1A02N 4GBXB 2O93L 5EOTB 3MRRB 1U8MB 2BMKB 2G2RA 2J88L 1RUML 3FZUC 4GSDL 2DBLH 2YSSA 4N8VB 4F7PA 5FYKU 4HGMA 2O61A 4WW2F 1NLBH 2Y5TB 4OFYA 1AI1H 1NJ9B 2A9MH 4HS3A 4H1LA 2E6PA 3KYOA 4WY7H 5T33L 3FOMB 3SKJL 2CUHA 5HI3C 5IVNA 5GJSH 4P2RA 4RBPK 2QSCH 1BD2B 4Q6IA 2X4TA 3AS1A 3W39B 4C4KO 3D0LB 2PR4H 1NEUA 1S7UB 3K4ZA 3O2DL 4DN3H 2XKNA 1VDGA 1IGIH 2CKBL 4M62L 5SX5H 5F9WB 4AH2B 5A3ID 2Q7YA 1I7TA 1IBGH 4GJTB 3H7BA 3SHSA 3LPFA 4X83A 4AT6A 1FYTA 1ES0B 1GGBH 2G60H 1QACA 1XR8B 1NSNH 1JZ6A 3B5HA 4LHUB 2NLJB 4BA8A 5FF6A 3IDYC 5E4IA 4RGMB 3G5VA 4U1GC 3VD7A 5DRWA 3VG9C 2P8MB 3UAJC 1LD9B 3ULUH 5IHUH 3UPAA 5DQDH 4JG1L 3QWOB 3VJ6A 4L4JA 5CILL 5GRYA 3GIZH 5FUZL 5IR1A 5C0ND 2J8HA 5IVXB 4QGYA 1AXSA 5IOPA 3HMXH 2W92A 4X7TA 3D5OF 5SV3A 4M7LT 1LK2B 3EO9L 2D03L 1WEJH 4QXGH 1WZMA 4N1HB 5CIPA 1G7IA 3F7VA 3FZUD 1I9IL 3MV9B 3PWVA 5IT2L 3VRIA 1AR2A 5CSZB 3G6DL 5I75B 4U1NA 1RUQH 3MREA 3L3JB 4ZUTA 5CZVL 4Z9KB 1ZVHA 2YPVH 3NH7L 4J2XA 3NPSC 2LE9A 4F7EB 5K9QI 3VGAC 1X4XA 3A6BL 5HI3D 3B3IA 1T20A