3IJLA

Structure of dipeptide epimerase from bacteroides thetaiotaomicron complexed with l-pro-d-glu; nonproductive substrate binding.
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
336
structure length
336
Chain Sequence
KMTFFPYELKLRHVFTVATYSRTTTPDVQVEIEYEGVTGYGEASMPPYLGETVESVMNFLKKVNLEQFSDPFQLEDILSYVDSLSPKDTAAKAAVDIALHDLVGKLLGAPWYKIWGLNKEKTPSTTFTIGIDTPDVVRAKTKECAGLFNILKVKLGRDNDKEMIETIRSVTDLPIAVDANQGWKDRQYALDMIHWLKEKGIVMIEQPMPKEQLDDIAWVTQQSPLPVFADESLQRLGDVAALKGAFTGINIKLMKCTGMREAWKMVTLAHALGMRVMVGCMTETSCAISAASQFSPAVDFADLDGNLLISNDRFKGVEVVNGKITLNDLPGIGVMKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Muconate cycloisomerase
publication title Homology models guide discovery of diverse enzyme specificities among dipeptide epimerases in the enolase superfamily.
pubmed doi rcsb
source organism Bacteroides thetaiotaomicron
molecule tags Isomerase
total genus 120
structure length 336
sequence length 336
chains with identical sequence B
ec nomenclature ec 5.1.1.20: L-Ala-D/L-Glu epimerase.
pdb deposition date 2009-08-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13378 MR_MLE_C Enolase C-terminal domain-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.120 Alpha Beta Alpha-Beta Barrel TIM Barrel Enolase-like C-terminal domain 3ijlA02
3.30.390.10 Alpha Beta 2-Layer Sandwich Enolase-like; domain 1 Enolase-like, N-terminal domain 3ijlA01
3R0KA 3CT2A 4M0XA 1OEPA 4MMWA 1P43A 4FP1A 3GC2A 3RGTA 2PTXA 2GGHA 1EC8A 2PTWA 3MQTA 3Q45A 3DFYA 3MZNA 3DFHA 1FHUA 2PGWA 3VCNA 2PP3A 3GY1A 2PU0A 4K8GA 3PWGA 4HNLA 5FJOA 3H70A 3NFUA 3NZGA 3ZLGA 4J3ZA 4H83A 3UCDA 1SJCA 1JPMA 2MNRA 1KCZA 3IJLA 4E8GA 3DERA 3SN1A 2OVLA 3RCYA 1WUFA 1JPDX 3VC5A 3QLDA 1KKRA 5FJRA 3UJRA 3SSZA 5EU9A 1KD0A 1IYXA 3DG6A 3TTEA 2AL2B 1XS2A 4K1WA 5ENLA 3SN4A 3VFCA 2XGZA 3VDGA 2QDEA 2MUCA 3U4FA 3H12A 4FI4A 3T9PA 2I5QA 3I6TA 2XH4A 3TOYA 3FVDA 3FV9A 1YEYA 1NELA 2QVHA 5J04A 4A6GA 3N6JA 4IL2A 3JVAA 3ES8A 2GSHA 4A3RA 3S5SA 3TJ4A 3JW7A 3DIPA 2ONEA 4MKSA 2NQLA 3VC6A 3ES7A 2GGIA 4GMEA 2PSNA 4H2HA 3V5FA 4HCDA 3KUMA 1SJDA 1P48A 4YWSA 1R6WA 4IP4A 4ZCWA 3EKGA 3D47A 4HCHA 3T8QA 1ECQA 3UJFA 3FCPA 3S47A 3QKEA 5FJUA 3CYJA 3OPSA 2RDXA 1PDZA 3QTPA 4GFIA 3UXLA 2GL5A 2AKZA 4EWJA 2ZADA 3PFRA 1KKOA 3N4EA 3K1GA 3V5CA 3CXOA 3MKCA 2OZ3A 4H1ZA 4DN1A 3Q4DA 3CAWA 2AL1A 4HPNA 1EBHA 3D46A 2OQYA 1BQGA 2GGGA 2PP1A 3DG7A 1DTNA 2P0IA 3H7VA 2PMQA 4JN8A 3GD6A 4DYEA 3MSYA 3TQPA 3RR1A 3BOXA 4ZA0A 3JZUA 2PPGA 3GO2A 2HNEA 4G8TA 1FHVA 1NU5A 3PWIA 1TKKA 2QGYA 4KWSA 1EBGA 2QDDA 2FYMA 3SBFA 3V3WA 4HYRA 4GGHA 6ENLA 3QN3A 1JDFA 3SQSA 2P8CA 4J1OA 3VA8A 3R11A 3OTRA 3I4KA 3R1ZA 3TW9A 2AL2A 3RO6A 2PODA 4M6UA 3UXKA 2OPJA 3N6HA 2OX4A 3TWAA 1BKHA 3OP2A 4IL0A 1MNSA 2QJJA 1MRAA 3EEZA 1SJBA 4GGBA 2OZ8A 2POZA 4F4RA 4DX3A 1MDLA 2XH0A 3P93A 2P88A 5FJPA 3HPFA 3TJIA 3CB3A 3QPEA 4E5TA 3NO1A 4KEMA 2PGEA 3P0WA 3T4WA 3DESA 4A35A 3UJ2A 3RITA 2GGEA 3PK7A 3MY9A 3R25A 4GYPA 2OG9A 3IK4A 3DG3A 4GISA 3MWCA 3THUA 3UGVA 2OFJA 2OKTA 1L8PA 3SJNA 2OQHA 4X2PA 4HNCA 4DXKA 3STPA 3IJIA 2PP0A 3RRAA 4HN8A 2AKMA 3B97A 1PDYA 4IHCA 3R10A 5BOEA 3UJEA 1SJAA 1EC9A 3ZLFA 2PTYA 1TZZA 1R0MA 3OZYA 4E4UA 2QQ6A 3DGBA 2PTZA 3UJSA 3P3BA 4ROPA 3ENLA 4K2SA 1XPYA 3TWBA 4IT1A 2XSXA 4E4FA 2HXUA 4GIRA 3TCSA 2OLAA 4KPLA 3I6EA 3MUCA 3BSMA 1TE6A 4E6MA 5FJTA 2HXTA 4IP5A 4ENLA 3SN0A 7ENLA 3IJQA 3R0UA 4Z17A 3ZVHB 3BJSA 2P3ZA 4HCLA 4JN7A 2CHRA 2DW6A 3FXGA 2OZTA 4MGGA 3ZLHA 4JHMA 3V4BA 2XH2A 2HZGA 2QJMA 1EC7A 2QJNA 2PU1A 4DHGA 2XH7A 1JCTA 1ELSA 1MUCA 3N4FA 3ZVHA 3FJ4A 3CK5A 3U9IA 4GYPC 3VCCA 2OO6A 4H19A 3OZMA 4Z1YA 3OW1A 1RVKA 2FKPA 3DEQA 3NXLA 4G7FA 1W6TA 2O56A 2PA6A 1ONEA 3T6CA 3UCCA 3H8AA 4KT2A 3FYYA 2PCEA 1E9IA 3DDMA 1WUEA 2ZC8A 3ZVIA 4DWDA 2PS2A 1F9CA 2DW7A 2P8BA 5BOFA 2GDQA 4IZGA 1MDRA 5IDZA 2GGJA
chains in the Genus database with same CATH superfamily
4UTTA 4H4PA 2QUVA 4Q22A 4V1XA 1EX5A 1F8WA 3TUUA 3S5NA 3W71A 4GQQA 4HMCA 4C6PA 1UZHA 1GYMA 4WKFA 2X7VA 3BV7A 1Q65A 3MQTA 3W1LA 3NQCA 2XM2A 2V67A 4JQ2A 1M6IA 4QNWA 3NGFA 1EOKA 5HJLA 5FSDC 3B0UX 3CV2A 4DLMA 2Y61A 3UNDA 1JZ6A 3QV8A 2YL6A 1R3QA 2Z4GA 1GRTA 4NZCA 3HGOA 5CGTA 5T8GA 5D9PA 2B4GA 3S42A 2WZMA 4QQ3A 4AH7A 4YYFA 2VR4A 2G3IA 3URBA 2H90A 5CPTA 3QFAA 1WBJA 2G5WA 3G77A 3IJLA 3J7HA 4HMEA 4HU8A 1B3XA 3AXIA 2W54A 2X16A 2NV2A 1HKMA 4FMVA 2ZXDA 1R3RA 4LBRA 3KL0A 3QFEA 3H2EA 1H51A 1E3XA 1DJWA 1UH3A 3HTWA 2PGRA 3MJYA 4W86A 3OA5A 2NLYA 2PDPA 1A4LA 1OB0A 1QNSA 1UASA 3QH2A 3NIYA 1ZY9A 2CLOA 1KRMA 3M46A 2MUCA 1THFD 3QM3A 4F0LA 5C9XA 2UWFA 2B7OA 3EX6A 4O4WA 4YIWA 4M6QA 1IV8A 1BYAA 1N62C 5LGZA 1DNCA 1YEYA 3G3DA 3EWBX 2Z27A 4XVEA 6REQA 3B9DA 1GNXA 4OVXA 2EGZA 4NZ3A 3PFMA 2DZPA 1SFSA 2FJUB 3GG8A 1BYCA 1BVZA 2X8HA 3OGSA 3M5VA 3HN3A 2HJPA 1W1YA 2W91A 2VRKA 1K9EA 5A8PA 2IKHA 5JCKA 4G56A 1YQZA 5U7SA 2IKIA 4CQAA 2HPMA 5T9BG 3WH5A 4KFNA 3E74A 2AMGA 2NUWA 4C6DA 1XKJA 4L65A 4GXPA 3TZNA 1VQTA 2FLIA 1TZ7A 3NPWA 2J9ZA 4PUKA 4GUGA 1P0DA 3QZAA 3G2GA 2E9BA 4UTWA 1JDCA 2V9DA 5AFDA 4KERA 3C8NA 2FJKA 1XGZA 4LA1A 3PP7A 3O15A 3WQEA 5AYXA 5BWFA 1JQVA 2PP1A 3DG7A 3EX2A 4H6KA 1FWNA 1O5KA 5TR3A 3MPGA 3W00A 1ZQ5A 3CMGA 5JRBA 3N9KA 1XH0A 4B15A 1KM3A 3TYEA 5DCDA 1G5AA 1MO9A 3DI0A 4DYEA 3QEZA 1UA3A 2OGYA 4Q3MA 3BOXA 2E40A 1VEMA 4Y2WA 4MUPA 4Z1DA 1NP0A 4YWOA 3KCJA 4BI7A 1LROA 2GLKA 1F3PA 2ZC1A 1ONXA 2FFCA 3RX3A 1LOLA 3FYPA 2ISVA 1OFAA 4DWSD 1JI2A 4FXFA 1P0EA 4AY7A 3RM4A 1FH9A 1XLBA 4R9XA 3V0TA 3KRZA 4IOTA 3G0SA 3BCJA 1PTGA 3RO6A 1VQZA 2VRJA 4S3AA 3HO8A 3H2AA 4HHHA 4CD7A 2ANUA 4K7ZA 2FZDA 2ALDA 1PIFA 3KFTA 4HGXA 1ZUAX 4GX8A 4H4VA 1CGVA 2Z1VA 4MKVA 4C6QA 4FA3A 1VGAA 1W37A 2BOFX 2J47A 4FEZA 4H4XA 1J10A 1XYBA 3IUIA 5MKGB 3TJIA 1VS1A 1R3TA 4EVZA 2ZUWA 4A35A 4ZQPA 4QDWA 4DWSB 8A3HA 3DC8A 3WENA 4BWLC 3DKJA 3OOQA 2WHJA 3BAWA 2YYTA 1H7NA 3FN9A 4A21A 1A5SA 3FGCA 5LGXA 1V77A 4O1FA 2G4JA 3GYEA 4FX7A 1Q7ZA 2VC6A 5BRQA 2Z28A 3LCXA 1XP3A 4LX4A 4C6LA 2JIWA 1GVSA 3MSGA 4XZMX 4NJKA 4NZJA 1W0MA 3IJIA 1LF1A 2CZFA 2AKMA 2J77A 7ODCA 3TLLA 1CIUA 5J5DA 4XIMA 2BODX 3RHGA 4E4UA 2J8TA 4S39A 3S6OA 2X50A 3CTLA 1MZHA 4KFPA 4PSRA 3UJSA 3QQ0A 2QPXA 4CNPA 4XAFA 3WL1A 3JZEA 3G8EA 2OCZA 1RP8A 5E0CA 3EMCA 1KNWA 4MZ8A 1T8QA 4DAFA 4LB4A 4Q8MA 4E6MA 1D7YA 3KBJA 4KCWA 2TAAA 1O5RA 1LUCB 3CWOX 1YDOA 2NWSA 3MUIA 2QEZA 4K8EA 4LAOA 1ADOA 2HRWA 1PWLA 1TA3A 3LS9A 4HCLA 5HA7A 3HFTA 1LRNA 2OZTA 2A6LA 1ZBVA 5EFDA 1IIHA 3GIQA 2HZGA 4B5SA 2Q71A 3VDAA 4XD5A 4OUIA 4RKAA 1RQEA 5H6HA 1GTHA 1BHGA 1MUCA 4Q7NA 1KBJA 3WF1A 2YDSA 3W83A 3K5XA 3JUGA 3VIKA 1TWSA 2QW5A 1QO2A 4NNBA 3LV6A 1QXLA 2A1YA 1VDVA 3T7VA 1NDWA 1JRBA 1UB3A 4HKPA 1OZMA 2Y7GA 2HV5A 5CSYA 5FJIA 4YJ5A 1YE4A 2J78A 4EPKA 1TJ2A 1G4PA 4M80A 4W8LA 3TSMA 1A47A 2OWCA 1ICSA 2P8BA 1P7TB 4RDZA 3H53A 1VCVA 1AMKA 1RQBA 3BMWA 4UTMA 1JXJA 2YL8A 1TTQA 3L4YA 2C14A 4EKJA 3Q58A 3LQLA 4M0XA 5AN7A 4TVDA 3B8TA 6TIMA 5GVJA 3U2ZA 3G1DA 3GXNA 3W7LA 1IXQA 5HUOA 4M8UA 4C7FA 4R85A 4CLMA 4GYJA 1GVRA 1EGVA 5FA5A 1Q6EA 2ZUVA 3ATZA 3HA1A 3M0KA 2WPEA 2CKRA 2E3TA 2A3BA 1DWAM 4O16A 3BQ6A 5D38A 2WHLA 1NQKA 2H9AA 4J3ZA 3R0DA 4HZ8A 3IUDA 3S2JA 4H6EA 4NSBA 5JQ9A 3DERA 1EL3A 2E1DA 3SN1A 3P81A 1S2VA 1W9UA 1TTJA 2O4QA 5FJRA 4I9AA 4FR1A 4ZQCA 1YDNA 5FS6A 2VHLA 4C7DA 2ZX9A 4JTGA 4X9SA 3BLPX 2QPUA 3OYZA 3PTKA 1TREA 3W2JA 3GD3A 3QFWA 2RUSA 3TNOA 1FFUC 2XN1A 3NZPA 1W3IA 1PXGA 1HJXA 4REQA 3D3AA 3PZTA 4GZ7A 3SCWA 1V3MA 1Z9AA 5BRBA 1QDSA 1RZMA 4AMAA 4NI3A 1IEVA 1DIOA 3MHUA 4W87A 2OB3A 3I7QA 1V0NA 2C1GA 2B7PA 1JRCA 4CEXC 4JFUA 4S38A 1OG0A 3WDQA 1CXKA 1WDPA 3DBNA 4RNJA 4AHOA 1UKTA 1K6AA 2GGIA 3N2MA 2PDYA 3OLEA 4ACYA 1R9ZA 1YPFA 4J3SA 4AWUA 2PURA 1DWJM 3N17A 2WM1A 2VOTA 5LIWX 4AFYA 1I2RA 1YKWA 1UZ4A 3EX1A 1YYAA 4GHRA 3QTGA 2R24A 1Y5WA 1XBVA 4P7LA 2J88A 3F5LA 1KCLA 3IRDA 1I2NA 4H6RA 4DPQA 4H6QA 1AJ0A 2GVYA 4DJDA 4GFIA 4MNMA 1ME9A 5KZMA 4FNPA 3SR6B 1YADA 4F66A 4JTQA 1A5NC 3CXOA 3S1XA 4G6CA 3PN8A 2OQLA 2F2KA 4AVOA 1GOOA 3C0SA 1CCWB 4MJZA 3ZJ6A 4U5KA 4YTQA 4J28A 2OYLA 5DMLA 4MDOA 2WZEA 1E5JA 4GOAA 1GSNA 1REQB 3WFZA 3OYXA 4JN8A 5T26A 2YDAA 5LYRA 3UPBA 1J5TA 4IUGA 2NZLA 2VL4A 4IGHA 3M16A 3GR4A 1GQLA 4AWSA 5AHLA 3M47A 3GO2A 2OX1A 1KRBC 4RZBA 4HU3A 3VKBA 4QCFA 2QGYA 2VQUA 2X0YA 1BAGA 1DL3A 1KRCC 3L2MA 1L6YA 2WO5A 4HYRA 1J8VA 1FX6A 4F0MA 1RXOB 3P8IA 4J1OA 3VA8A 3FXYA 4MHBA 2YCEA 3WMLA 2PODA 4TVYA 1RM6B 1FDZA 1MEIA 4RDVA 4GH1A 4PB3A 3LMYA 5AYBA 1DTUA 3P60A 8TIMA 1NP2A 3NQDA 2PDCA 4HZ6A 2HS6A 4DX3A 1SW0A 4MIMA 4IQJA 1W1IE 1MW1A 3PZIA 1Q6RA 3PHAA 3BLIA 3NO1A 4IPIA 1M65A 1Y65A 1J2WA 1LP6A 1DQWA 3WSUA 3M41A 4PMVA 6XIAA 5C0QA 3EOLA 1V8EA 3WNLA 1M1BA 3W81A 4ZVJA 4LY8A 2XFFA 4JIQA 2NVAA 1J4EA 3SI9A 3T40A 1YMYA 3PUOA 2OQHA 5CCZA 1FFVC 3ICJA 3EAUA 3LK6A 4DXKA 1AH0A 1A5OC 1GVEA 1T3QC 3SUSA 5FF2A 4U2YA 3KBWA 3RRAA 1SO4A 2WCGA 3HGSA 1LPFA 1XF0A 2PDKA 1XFCA 4XVDA 5FOOA 4MLRA 1MXGA 4US5D 4A8NA 4IPNB 5D2YA 3WUFA 3HG4A 3BCDA 1Y7VA 1OJTA 4JBRA 3ENLA 2XIMA 4IT1A 1ZBWA 2YJQA 3KHJA 4IQEA 2PC8A 1KV8A 1X8FA 5CZ0A 4AUBA 1EUAA 4E4FA 3GFXA 4JTAA 2ABBA 1K4QA 4HQVA 1W3NA 3UZJA 4C6FA 4C60A 1ZHAA 4X9YA 4ACZB 3VGBA 4WY0A 2IMRA 1JYNA 5I78A 1WOBA 3VX0A 4ICNA 2RDWA 4W84A 2WAGA 1OM0A 5AC5A 3BPWA 3NQGA 1LOSA 5E9AA 2JGQA 3E96A 4UOJA 3S1VA 3NURA 3A7UA 3KOZA 4ZSTA 2XGBA 3BCFA 4FOUA 4UTIA 1QBAA 2R1NA 2PD5A 3W2KA 1J18A 4HA0A 3W72A 2C3CA 3FDKA 4DF0A 3CWNA 4CN1A 3N4FA 4QROA 4DPPA 1R30A 2JEPA 1ISXA 1EJWC 4ZTYA 1GKQA 1CLKA 1F6YA 2W3RA 3ZQ9A 5LA0A 2EPOA 3NGJA 3OZMA 1RVKA 1YTKA 2X0HA 2ZUMA 1PZ2A 1YPXA 1JOAA 4XK2A 1MQQA 1E9LA 1SZNA 2FGZA 1H7RA 5G1YA 4LNCA 3E2SA 2PDNA 1XC6A 3EYPA 1BTMA 4IJRA 2DW7A 4M6VA 2X09A 1I2PA 3APYA 1FVPA 4HSOA 1KFCA 3BMVA 1V3IA 1H6VA 5G4EA 4WXZA 3AIVA 2LLEA 4DBEA 4LIIA 3DYPA 1NWRA 4INFA 3ZWSA 3OEXA 1EC8A 3W22A 3N3MA 4PULA 3L5OA 1XUZA 2XVGA 4J5NA 2Y7FA 1CGYA 1WPCA 4C65A 1LT7A 1P0BA 3WK1A 1GERA 2PGWA 1R3SA 4RR4A 3LUTA 4IGMA 4Q32A 4J57A 4TTUA 1OY0A 1RJRA 5FJOA 1AH3A 4YTRA 2WKJA 3NZGA 3ZLGA 4IH3A 1CGWA 4BI6A 5K2ZA 2VWSA 2C16A 3CUZA 2ZUNA 4CEUC 1XLJA 2ZWZA 2D2GA 3SUVA 5K4XA 3AU6A 3MMWA 3LSCA 2GJXB 5LXEA 2YBTA 4QP0A 3T2OA 3NQVA 3VC5A 1V3HA 5G5IA 1RCOB 5JBEA 2R1PA 3WNOA 3PWAA 3KVLA 2VEPA 4XAGA 3ECQA 2VDGA 3EWDA 3VNDA 2J74A 3VDHA 3H12A 1GRAA 2OXNA 3IUHA 3B9JB 3G6MA 3NCOA 3BZJA 1NELA 3VABA 1Q6GA 2A21A 2WC4A 2DUAA 3UW6A 3G1RA 3H4GA 4UR9A 3LHUA 2OSWA 2TYSA 4CCDA 4G2DA 1V5XA 4FALA 2YCKX 3GNRA 3RNMA 1ZY8A 2XFWA 1XV8A 4OT7A 4UOQA 4JTFA 4V2XA 1C7TA 2WSKA 5M17A 1VPQA 3VDBA 4RCXA 3CGTA 4IFRA 3M0IA 3GVQA 3UG8A 5EKYA 2VGIA 1UH4A 1VJSA 4AEOA 5TIMA 1H5VA 5I79A 2VX7A 3AIBA 4JQAA 4PEKA 2TMDA 1KTCA 3HPZA 3QKEA 3CYJA 1AUSL 5G4HC 1Q63A 3NQAA 3G22A 3AIUA 4H04A 2V5KA 4I3GA 1I0BA 5J5RA 3K1GA 4DBDA 4PUJA 4BQ3A 1HXJA 1GW1A 3V0SA 5B7ZA 3FAWA 5HMFA 3MMTA 3CAWA 1EBHA 1VLWA 1JFXA 1UKQA 1J6PA 1H1ZA 1XBYA 3K4DA 2NVKX 1MFUA 2DZSA 4O52A 3VTRA 2VFEA 2DVUA 4GQBA 4J2PA 1L2QA 4QSHA 2VP8A 4UTFA 3CGBA 4ZA0A 4HZ7A 1QAPA 3IK2A 3U4AA 4M29A 2I9UA 3S8HA 3SY8A 4MNKA 1NU5A 3NAVA 4XKYA 1VFOA 4G7EA 4L6OA 1PBGA 3V3WA 2I16A 4HP5A 6ENLA 1UD2A 4FLRA 2FZ8A 1I45A 3EX3A 5GQBA 3TMQA 3WMSA 2CBIA 3PNZA 3SEPA 1HVQA 4QJ3B 2W62A 1E6RA 3UXKA 3QBUA 3W6MA 3TCEA 2OLSA 1EJRC 4JIIX 4OECA 3W7JA 1MNSA 1TJRA 4JCLA 3GBEA 5LIXX 4AD0A 1VZWA 1MDLA 3IS4A 2KZHA 1AJZA 3C2FA 3OBEA 1JJKA 2CEQA 4Z1AA 4Q8UA 1ODUA 4WIWA 2XZ9A 2DT3A 4PBFA 4S3GA 4DELA 3AO0A 3NPUA 1H09A 2VZVA 3HJZA 1YTEA 1XLGA 2GGEA 2YA1A 1X1OA 2OG9A 3EXSA 2O0TA 4QE5A 4V28A 1WNOA 4Q4KA 4MUZA 1YIXA 1FWHC 1NIUA 3T2PA 3S6TA 3FJLA 4TMCA 4GWEA 3SR7A 2SFPA 4A8LA 1H61A 2ZDRA 4KGLA 1C9DA 4JIEA 2VUYA 3TOPA 3R8RA 4AZGA 1WO2A 3I3BA 1PZ1A 4OKDA 3BLOA 1AD1A 2CZDA 3R8HA 1X96A 4IFKB 2X41A 2QQ6A 4A3YA 3MO7A 1W1TA 1QNQA 3POHA 1XHGA 5BMWA 2GR2A 4F9JA 5F2GA 2OLAA 5H1WA 1W91A 4GY7A 3VINA 3WDJA 1O95A 3SY1A 2Z0IA 4UMAA 3F4VA 4Y9PA 3UZWA 3LM3A 4L4PA 1GQNA 1HIZA 2C6QA 3CV6A 1TV5A 4O1BA 3AALA 5HBFA 3R7MA 7ENLA 5CJMA 2DFAA 4W88A 4AY8A 4Z2JA 4D71A 1XCWA 3JS3A 2E68A 1AG1O 3UPWA 1DVJA 2J6XA 3W86A 1EYWA 5AHFA 3D0CA 1F5ZA 1KM0A 4GNJA 2V63A 2QJMA 1ZAJA 1UD3A 5ABEA 3R6IA 1NTHA 1SGJA 1XLDA 4MG4A 1DJGA 3TTQA 1RAKA 1VEOA 3CK5A 4RE3A 3TVAA 2ZRYA 5L9FA 1GJUA 2UBPC 4Z1YA 3AJ7A 3L5LA 2QF8A 3KRSA 5GNZA 1W6TA 4O0KA 3NVTA 1XJBA 2ZTJA 2ZRUA 4TTGA 1W9DM 4KT2A 3CAKA 3BW3A 5GJMA 4QG8A 2QYGA 4QX4A 5IM51 4NHVA 4F3HA 3EGJA 3KVKA 4EQRA 1KFBA 4K7YA 3O07A 3HB9A 3O6AA 5DF0A 3BE7A 3CUIA 5FKYA 1KLYA 4K3ZA 4MB4A 3LOTA 5HINA 4H4TA 3STCA 5BW6A 3GW3A 1ZALA 2Y62A 3GR7A 3BWWA 3VILA 5ABFB 1P43A 3UYCA 4XB3A 3QHMA 4FIRA 3OVGA 1D9EA 1GZ1A 2WSPA 4UQ9A 2CBJA 3AYRA 4MWAE 4WCJA 3QHOA 2ZX5A 5DY2A 2E3ZA 4FOJA 3WN6A 3B8UA 1E51A 1Q7MA 4LS1A 5I77A 2QCGA 4EIVA 2WJDA 2CFYA 3E0IA 2D2OA 4DNMA 3MZNA 1RLDA 1JEHA 3BLLA 2VZTA 3HQ1A 3R79A 2J9YA 1BRLA 2NVCA 2VYOA 1IEWA 2PU0A 1R7AA 1FXPA 1ZNNA 1XIGA 2P50A 1W5PA 2IQDA 3PWGA 3CTTA 4AZCA 4BEUA 3EOSA 3TU9A 3E0VA 4DYJA 2W79A 4OU1A 3EMQA 2H8XA 4LUJA 1RSCA 5AHMA 5ABHA 3RG6A 3VNYA 1ICPA 5JIWA 3VKJA 4S3FA 3RM8A 2VGGA 1XUUA 3HURA 1IYXA 4I6VA 3DG6A 1B9ZA 4PB5A 5ENLA 3UVAA 3MUAA 1V6VA 4LRSA 4W7VA 1F73A 5DELA 1EOMA 1FTXA 4R9OA 3NYZA 1WDQA 2WWCA 4PMOA 2I5QA 2QV5A 2FDSA 5BU9A 1KQYA 3TN3A 3WQVA 1U83A 1GETA 3A6OA 1WZLA 1V0LA 1TPEA 2Z7GA 4B5NA 4EPDC 4WKHA 1T8XA 3SCOA 4CD5A 1C90A 1ZP4A 1JNDA 3H4WA 3BURA 2G4FA 4BCEA 3NVDA 3U3HA 2O9TA 4JX5A 4UFLA 1HL9A 3CIVA 1JVNA 3BICA 3H24A 3HF3A 1WCGA 2J7HA 1CENA 1PYMA 3EB4A 4IFOA 2P5NA 3DFSA 4I9JA 2WJZA 2HS8A 1V79A 2DU2A 3GKAA 1TVPA 1XI3A 1NOWA 5EMYA 4RLIA 4GIYA 2A7PA 4PR4A 4LUTA 1FWGC 2WJEA 5CZSA 4JEJA 1UYQA 4H00A 2GSJA 4GVFA 3HV9A 3WFLA 4R7WA 5HXMA 5I24A 1YXYA 3DFNA 4KGJA 4H9VA 1GONA 1HP5A 2GRTA 2EQ8A 1UC4A 1U33A 1TWIA 4NRSA 1AW5A 2BB0A 3VOIA 1FHDA 3MU7A 2XUCA 1LG1A 2E7FA 1XRFA 2ZZ5A 4JEQA 9RUBA 4PBGA 4CCCA 3RCNA 3GC4A 3GWQA 3RNDA 3SRHA 3LLFA 3CZGA 4B5WA 4DXVA 2TRSA 1EJSC 4JY9A 2JK6A 1L2UA 4Q6XA 3JZUA 4US6A 1XPGA 3RJXA 2QGHA 2R82A 3CGCA 3K13A 4D6CA 4MSSA 3O0KA 2PRLA 1XM3A 1IGSA 3KZSA 2CPUA 3CC1A 1ZKQA 3EUB3 2IPFA 3B8SA 4CN4A 1ADSA 3IJ6A 3W1TA 8XIAA 4C6JA 3AIQA 3GVRA 3N2XA 4JQ3A 2GR1A 2CHNA 2VCAA 4XUYA 3ARPA 2EKGA 2XSAA 4UNIA 4N02A 1CXHA 3R43A 3LY0A 3ANUA 3WLQA 2AAAA 2OZ8A 2JIEA 4F4RA 4IMGA 2Y4SA 4HPXA 3SUUA 4TVCA 2XJ7A 4LYPA 1GK8A 2BASA 2XN0A 3GTXA 4UFMA 2WSQA 1A4MA 5FAJA 2YYUA 4EF9A 5CAHA 4MAVA 2V0TA 4O13A 2WANA 3PK7A 3W84A 2VVNA 1TIWA 3EWCA 1J0IA 1PKYA 3QFBA 4I5XA 4GISA 2R9RA 2VCCA 3QQWA 1UD5A 1BWVA 1F3WA 1LBFA 2FQIA 4X2PA 2Y8KA 4ZB5A 1M7XA 3A5VA 2GVJA 5I0DA 1CW2A 4LVFA 3C0QA 2OJPA 4HN8A 4C90A 3R10A 1XISA 6ALDA 1EC9A 1XRVA 2PLMA 3H23A 1TCMA 2VO5A 1JFHA 4LUSB 3ZOAA 2Z2UA 2CIPA 4P5UA 4F79A 3QRHA 4HSNA 3TXZA 1KCKA 1N60C 1JZ4A 5AC7A 3AWNA 5FEPA 2I56A 1QT1A 2C3DA 2IQTA 4Q8NA 4MDPA 2Z25A 4D72A 1FP9A 1JQXA 1GT8A 3MUCA 3WUGA 3PC0A 1XR2A 1WAWA 1A3XA 5LIYX 1MOKA 2YBUA 2F8QA 4JTUA 5KVIA 4PUUA 3UNTA 3GX9A 3V75A 4Z17A 2QIWA 1PJ9A 4C6KA 1ICQA 1XC4A 4AD4A 1VKFA 2DW6A 3CH0A 3EEGA 4GBDA 1XLFA 5I7GA 5AC8A 4GJ1A 3BJTA 2C1IA 3ELFA 5D9OA 3ZVHA 4J3XA 2J7GA 1PB0A 3OVQA 1VFFA 5BXTA 2XFYA 2Z1KA 3L2IA 4O11A 1RVGA 1T6MA 3W2UA 1LLOA 2FKPA 1O5QA 2UY3A 1JULA 4C6BA 1FWIC 2YIHA 4F48A 4Y9MA 1F4AA 3S3GA 4W7WA 3SCSA 2I57A 1IEQA 1VFHA 2PCEA 3IGUA 4EM4A 5E5CA 2E6AA 4DJFC 4XZIA 3LPPA 5FS9A 3U2CA 1AD4A 1OQFA 4OE7A 2XG9A 3CHFA 4KESA 1PKLA 4DJEA 5C9RA 2V5DA 3H2FA 3HIJA 2XIQA 3ZSTA 3R0KA 3CT2A 2ZRZA 3LRMA 3EB2A 4MMWA 5DN1A 4WSKA 3I6RA 1PE1A 4AEFA 4MWAB 2EQ9A 3A7AA 4IWWA 3NM1A 3S2LA 4N7QA 3PPFA 4HHPA 1VBUA 2GOKA 1G01A 1OVDA 5CSRA 5K9CA 1Q6DA 1Q4NX 3LA4A 2DV0A 4IX0A 4JCMA 1GOIA 2D1ZA 5AOUA 1K7XA 2WKLA 3W7DA 3GUGA 4NF7A 3THDA 1EPVA 5I02A 3GH5A 2IW0A 1WDWA 2PLCA 1SZRA 2DSWA 3W1MA 1E3ZA 4H83A 4NAFA 1SJCA 1TTPA 3WYZA 2ZVRA 1J79A 3OZOA 3MUZ1 1J6OA 3GB6A 2D0HA 2YXGA 4EQWA 3NO5A 3OQ8A 5I3GA 1KV5A 1WOAA 3AS1A 3EPOA 3BGGA 3K4AA 1DKWA 3POCA 3FG2P 4LCSA 1LWHA 1G7VA 1ME7A 1QU4A 3SN4A 1TMQA 3LNPA 4Z2IA 4LAKA 2YW3A 4UQCA 3S2MA 2XINA 2ALRA 1RPXA 3CWHA 1V97A 4IPPA 1RUSA 4URIA 1S5NA 1GTEA 3FV9A 2JKPA 3UR7A 1WA3A 1NHQA 1V7AA 2F38A 3FSUA 5HR6A 3AMLA 4QQUA 4WOZA 1LL4A 3ES8A 1ODZA 2WVVB 2PWVA 4UNLA 1A80A 3E02A 3GNXA 2DH3A 2HROA 3JW7A 5BXSA 2ONEA 1HJWA 3OG2A 1I60A 1ONRA 3QR0A 3N4AA 2ZICA 3K46A 1F3XA 3QR3A 2BHYA 4CD8A 1W5QA 2PSNA 1SJDA 4J3VA 1P1XA 2Z2AA 4UQEA 5TD4A 1E0XA 1LVLA 4LOCA 2WZTA 4IP4A 2CETA 2G0WA 4UFKA 3WK3A 2V38A 3VGGA 3ERPA 5EFFA 5PTDA 1Y8BA 2EPMX 2PZNA 3BOFA 1JF6A 4GKTA 3QTPA 4E4PA 1KBKA 3VD3A 1I8JA 1N63C 1J0HA 1ZENA 3PBYA 4OV4A 3VZXA 4FF5A 6A3HA 4D6FA 1ITUA 2QJGA 1GYNA 3GHRA 3GVGA 4J35A 3NQBA 5T9CE 1YBQB 2DSUA 2OQYA 3KHDA 4WJ8A 2AOSA 3NQ2A 2ZXAA 2WMHA 1E0VA 4HNOA 4NXKA 1LQ0A 4FX9A 3H6OA 4WSJA 3RR1A 3KXQA 3LPOA 5E6YA 2R14A 3W2LA 1V0MA 3WD2A 5A2CA 2WP5A 3OIHA 1FHVA 2XGIA 2V5BA 1NJJA 3KCLA 4F0SA 1GQKA 4NEWA 1A50A 2PDWA 2Y6ZA 2WYSA 3QSTA 3BG3A 3C61A 2Y1HA 3PZOA 1JDFA 2FPTA 2PDXA 1U22A 4GYFA 2EPHA 5ABTA 4FO4A 4GUFA 3R1ZA 3VIPA 4JTIA 4J27A 3BAKA 2OPJA 3BG5A 1ZJBA 4DB7A 3F4DA 1DXLA 1N8IA 3UERA 3W70A 4JTLA 1WB0A 1BWKA 2WKGA 3TYCA 3RO8A 4JFSA 4Z1CA 3REQA 5FJPA 3RLGA 4PMQA 4WDUA 1NAL1 4H8NA 2W63A 4PUMA 1S38A 4V15A 1XIIA 3OB8A 1E1CB 2QT3A 4M5PA 4PA8A 4TX6A 3LXCA 4HVXA 3R2GA 3KM8A 3OC4A 4GYPA 4H50A 1TV7A 4JD4A 3P67A 1XH1A 4K6AA 2OFJA 3LD5A 2WMGA 3DKLA 4UCGA 4A3QA 2Q01A 3B05A 2CWNA 1M01A 1EBDA 4JDRA 4L7ZA 3ID7A 2BVDA 2Q02A 1XX1A 4M7SA 1GVOA 3S5OA 1VFLA 1JYWA 1S2AA 1WKFA 1OK4A 1XIJA 3GRSA 1QJWA 1Q2RA 2PP0A 3WD4A 1LWJA 3C52A 2RAGA 1W5MA 2WXDM 4XQ6A 3CH9A 1FQ0A 1XYMA 2WPFA 4UZUA 3LPFA 4QG6A 1CZ1A 2VX5A 4FOKA 5HNRA 4NNAA 3DH7A 2PTZA 1EQCA 3WF0A 5CGMA 2F61A 1EFZA 3U7BA 4IICA 2WMFA 5DBTA 2E6FA 2CNCA 3EKLA 1TE6A 4GZEA 3VCRA 1EWDA 3UA3A 1SW7A 2ACQA 2QLYA 1QO5A 1Z89A 2HXTA 5JXQA 4EM3A 2QUUA 1LCOA 1VCFA 3GXPA 2WHMA 3EWXA 1PX4A 5DFAA 3SCRA 1E9ZB 1SZEA 2TODA 1H1NA 3M0HA 1YE6A 2XVLA 4A2RA 3A4XA 4EAYA 1SR9A 1NH6A 2BNJA 3E0FA 2DT0A 4LS2A 4IJBA 2QCFA 1O1HA 3NJ3A 3SJ3A 2WBKA 1YTDA 2OWXA 3AXHA 2BTMA 3PZGA 5FEZA 2GPTA 5ER0A 3MP4A 3ARSA 3G5EA 3IV3A 4WJEA 4TX9A 3W2NA 5I03A 1J0KA 1OC7A 1HG3A 1IEXA 4YVPA 4MY8A 3U7VA 1B4EA 4GY0A 1F76A 3W23A 3LU2A 1JZ3A 2EF9A 4ADSA 3AM9A 3VNZA 4XWUA 4LJ3A 2CESA 1VYSX 3SADA 2IUZA 3BAXA 5BOFA 3NZRA 2A3LA 2VGFA 5E93A 5A6BA 4DWSA 1F07A 2EAWA 4GXWA 3EKZA 3B8IA 3LGEA 4CCZA 4JYDA 1O1ZA 3C56A 4B5VA 5FF7A 4PCFA 2I17A 4LF1A 3MMDA 5JUVA 4KS0A 2FZ9A 5D32A 1NY1A 1I2QA 5A6MA 5BXRA 1UBSA 3WQ8A 3S1UA 4AX7A 2D2HA 1BF6A 4F2TA 2X8CA 3DFYA 1FEAA 3C5QA 5FSEC 3ZIZA 5EMMA 1UQYA 3GDKA 1FHUA 1NM9A 4TO8A 2YZ5A 2C1HA 5D2XA 4UTKA 4O54A 1P0KA 4AF0B 3USZA 3PBWA 3K8KA 3OJGA 1G9HA 3SRFA 2Y8VA 3T0TA 4AEEA 2CITA 4GUHA 3AQUA 2FGLA 4W9TA 3WEZA 4H3DA 4KRTA 3WQGA 3BOLA 3EPMA 4LV4A 5CKSA 2IXUA 2BS9A 5C7HA 3FA3A 4H9ZA 1TRDA 2Z29A 3L4VA 2FH6A 3HOJA 3M5ZA 1LUCA 1GOXA 1HF6A 2PDBA 4LEQA 4AX6A 3NZQA 4WHBA 2NT0A 2XVNA 2WOQA 2V6OA 3ATYA 3ZR5A 3WQPA 2ZZ6A 4L9XA 1F7BA 3P8JA 3SAZA 3I6TA 5JCMA 5D2VA 1J0JA 1FFRA 3M5XA 3F2CA 1X6LA 7TAAA 1ITCA 4TVUA 6CGTA 3EB3A 3ZFHA 4R27A 1VJZA 3DENA 4OHQA 2V30A 2L5HA 4O1DA 1WYIA 3M0ZA 3M64A 5DCBA 5JU6A 2E25A 4S3EA 5EB8A 3WF4A 3A3HA 4O0ZA 2NQLA 2BOGX 2VCBA 1PV8A 3B06A 1DEDA 3QJAA 3U2EA 5AYZA 1OHLA 5A6JA 2WM0A 1Z32X 1W1A1 3O06A 2WC3A 4ATDA 4PRTA 2WVTA 3WBYA 3W7PA 5I3JA 4WVXA 3VNLA 1E0WA 3QV7A 4YWSA 3KRBA 1XLLA 5G2IA 4NIRA 4XTDA 2O9PA 4GXMA 2BXZA 3LLXA 1RY0A 4D6IA 1Q13A 1OFOA 3WEOA 1C8VA 3M6DA 5FEXA 4OTKA 4ADWA 3NSNA 1ZX9A 3A13A 2Y5JA 2E5BA 1MZRA 2VURA 5H8PA 3SCQA 1UUOA 4DYKA 3WBXA 4UTHA 3LENA 3CZJA 4LB3A 1TELA 1J5SA 3OO2A 3ABQA 2YDQA 1KTNA 1KGUA 4WD0A 2QDGA 2GGGA 1L9WA 2OEKA 2WOWA 1W3JA 5DBUA 2WOVA 1BEUA 2X2GA 4FNUA 4N9BA 1K70A 3W85A 4ZQMA 1TYTA 3NZ1A 2WQDA 4V1YA 2A5HA 1W3KA 5LNVA 1AODA 1UCWA 4WJXA 2X42A 2ZBTA 2X8GA 1KR0A 1LJYA 3LLDA 3KP1A 3BO9A 3VKCA 2BCPA 3EDJA 4RXFA 4B3ZA 1YNQA 1TWZA 4GA8A 3W7IA 2ODOA 3BARA 3DGRA 1FKXA 5LNWA 3W01A 2XM1A 2HBXA 3I4KA 3WNNA 2VQTA 1YHTA 4H7ZA 1A5CA 3LCHA 2BHUA 4EQSA 4V27A 2VFFA 5B80A 2X40A 5I3IA 5F2LA 3M0LA 2VD9A 1OK6A 3NL5A 2YA2A 3GDTA 4LAUA 3AS2A 1FECA 3P93A 5T91A 4Q33A 3CB3A 3H26A 4QLJA 2NQ5A 2Y89A 4J40A 3FGCB 4XBSA 4IMDA 4O1EA 3N3TA 4IJCA 4MVAA 3HU7A 3MI3A 4DM1A 1EZWA 1RQHA 3ZS4A 1WZMA 2CBVA 3GS6A 2WVUA 1B2YA 2VEFA 2PZ0A 4LT9A 1V08A 1JAKA 2DJLA 5AC4A 1X2GA 3NPXA 5AKQA 1VIZA 5C6MA 3UU0A 3WJSA 5BOEA 4M52A 1XCXA 3AMCA 4IQDA 4RL3A 3CQKA 2OODA 4JY8A 4QAWA 3DGBA 5A8OA 3FKRA 3WLHA 4Q8QA 3MSDA 1UOZA 3NDZA 4GQGA 1NDVA 3K4WA 1REQA 1PZ3A 1TA3B 3IANA 4NKCA 4W89A 1UBPC 4AZIA 4N0RA 3PBGA 4FK9A 1F74A 4XD4A 4UNKA 3L23A 4PTNA 2G3FA 3E3HA 1EEPA 4DNAA 4ZXLA 3AC0A 5AB3A 3D3FA 4KPRA 3W28A 2IQ0A 2PU1A 1QW7A 3LADA 4BZYA 3NM3A 1QK2A 4PUEA 1DWIM 3BC9A 3KZPA 3LRLA 3L4TA 4L5ZA 4ZE4A 4UQBA 3C2RA 3NQ7A 1A0CA 1RV8A 3VIFA 1DORA 3L21A 3RR4A 2O56A 4EMJA 3WD0A 3URQA 3PAJA 2BWGA 1B9BA 2KAUC 4GC3A 7XIMA 4I8DA 5J8LA 3ZVIA 3BAJA 1TVLA 5CH9A 2H3DA 2ADAA 3KOFA 4M51A 3RPDA 5IDZA 4YU1A 4IGNA 1EDQA 5KETA 3NWRA 4C6OA 4CUCA 1ESWA 1IXNA 5EMLA 1QBBA 2R1LA 4O18A 4Q8PA 3T4CA 5CPLA 3U8GA 3MT1A 3JU2A 4DBUA 1SO5A 2HE5A 3KTXA 1PKMA 2INFA 3OBAA 1JI1A 1EH9A 4EANA 1JROA 3W7KA 1TRIA 4NG3A 1QHOA 2OSYA 4OBRA 4GPNA 1F2JA 2H9AB 5M1TA 2G95A 1PSCA 4XSLA 1E6XM 5LIKX 4H41A 3K30A 1XRTA 2I7GA 1V6WA 1DIKA 2HK1A 1C3FA 4AWEA 4CNNA 3NEHA 1EHAA 1E4NA 2E6DA 1LT8A 2D22A 1V6YA 1HKKA 4N9CA 1BWCA 4WF7A 2Y2WA 3ITGA 4N4PA 3P80A 2B0MA 3NVYB 1DXFA 1NF0A 3IVSA 3P7YA 3AOFA 1KKRA 1VFTA 1CPUA 4R7OA 3SSZA 4GCAA 3DFTA 1LQ2A 2PE4A 3ZT7A 3VOGA 2BY2A 4M81A 4US5A 5LA1A 2XGZA 4GC4A 2ISSA 4DJED 2PWUA 3CIXA 2REQA 4E8CA 4JDBA 4AZ5A 4YVVA 1OZQA 3GIYA 2PBOA 5U1OA 1XGEA 3P5YA 2WCAA 2OKOA 4ZMGA 1B3ZA 3QXBA 4GH3A 5FS8A 1R46A 4WDWA 2V3DA 1PIIA 1GZJA 1SPQA 3MCNA 1XBXA 3IJ9A 3L67A 1QTWA 1H60A 1PTDA 2WPCA 4Z42C 3H2CA 5C9ZA 2Q8XA 2G8ZA 1NPXA 4HCDA 1RR2A 3GNOA 3QOMA 1RA5A 2ISFA 3F03K 1VAHA 1XIEA 4UZSA 4FZIA 1OG6A 3MHFA 4I7VA 4CCEA 1JGMA 1VPXA 1HL8A 4P7QA 1ECQA 3FCPA 3F2DA 3W4RA 4XD6A 3ARRA 4D6HA 1UZ1A 3QZ6A 3N9SA 1AVAA 4MB5A 1ZJAA 5LHEA 4B2DD 4JTSA 3BAIA 3PANA 2RHGA 3WLMA 2J3NA 3N4EA 3QV6A 3V5CA 2QUTA 4JQ4A 2OT0A 4BI5A 1UQZA 1N5WC 2VJXA 4LRTA 3MDWA 4BWLA 1MUMA 4AZ6A 5C2GA 3BVJA 2FVMA 4Z08A 4PMNA 4XO6A 2DIEA 3LHWA 4XIAA 3DN5A 4ZOHB 4JKMA 4LVAA 3VD7A 1PIGA 4H9MA 2V3EA 3LB8A 3HJEA 3TN4A 1ITQA 1EX1A 2E5CA 3DFQA 3PUDA 3W27A 5CJ5A 4JKLA 4Q4RA 2OYKA 1V02A 5F7UA 4NY2A 3ONBA 4QE4A 5FL1A 3DHDA 1O68A 3T09A 1Q6QA 2GJXA 3DU0A 1LG2A 4LXFA 2ZE3A 3BAYA 2QMKA 1EIXA 3W7RA 4RXGA 1N8WA 3ARTA 3V7PA 5HDRA 4NAEA 3AXMA 3HQOA 4RX0A 5FL0A 3EWYA 3UWYA 3CO4A 4RUBA 4LH8A 2V5JA 3MI2A 1QOQA 4K7VA 4MNJA 4JTHA 2RJHA 1LWIA 4NASA 4YCPA 1RD5A 3G1HA 4GZIA 4IL0A 1RCXB 1QW9A 1OCNA 3ABSA 3VM7A 4AZBA 4E2DA 3CPUA 4PFMA 2P88A 3WUBA 3B04A 2J4GA 3RX2A 2NPXA 3PTQA 4HTYA 5I23A 3F4NA 3T4WA 3H55A 1JCLA 3C2YA 2QZRA 2ZX6A 5G5GB 3QGKC 3WMBA 4QR6A 4R33A 1QI5A 3KDNA 1RALA 3QZEA 1ZJIA 4M6PA 1X7IA 3VAVA 3A4AA 2OKTA 4R3UA 1W1B1 1ADDA 4QE1A 1A5BA 3S2CA 2HDJA 3BH4A 4ZBCA 3AHXA 3F2BA 1KFKA 2D73A 5A6TC 1XYCA 3LI0A 2E6YA 5A3HA 2C15A 2X05A 2G37A 4AYSA 4F2UA 3WL0A 3SURA 3GU9A 3ZLFA 1ALDA 3GBDA 5XIAA 1KBIA 1JCYA 1G4EA 5CG7A 4DQWA 3E1F1 3S46A 4ZO9A 2CZ5A 3GAKA 3A24A 2HNHA 1TQJA 5HMSA 4JICA 4TV6A 4MOZA 3A4WA 2AAMA 5I6SA 4H7CA 4MFEA 5FJJA 4O17A 3W7NA 3WLOA 3UF9A 2BZNA 4KBXA 2VXNA 4H4QA 3TN6A 2DGAA 2YLAA 1NOUA 3CZLA 1IWPA 4ERIA 3IJQA 2VI0A 2I1OA 3TN5A 3AN1A 2V5LA 2CLEA 2YZRA 3CUHA 5D9MA 1TE1A 5IOBA 3W3OA 1JUBA 4IXHA 5KEZA 4DHGA 4NILA 5CLWA 1TUFA 4KCUA 2HSAA 4Y9OA 1E70M 3ITYA 4ATLA 3STGA 3WLKX 2W3SA 1BZLA 5DRCA 4I7WA 1TV8A 1WAUA 3TYUA 2NQ9A 4GRTA 3UZZA 2EO7A 1SFTA 4ONVA 1E5NA 5U4NA 3W7MA 2OU4A 2C13A 3KVMA 3WG6A 5CZKA 2GQ8A 2ZC8A 2HBVA 3FIGA 4JHOA 1KA9F 1B31A 1SUXA 1ENUA 4PE8A 1UPMB 1J0ZA 3DFPA 1X38A 2E28A 3LZ5A 3GC2A 3KTCA 2XZ7A 3RGTA 3M9YA 2VX6A 1IT8A 2WPGA 3VM5A 3BG9A 1VD6A 4HSHA 3MB9A 3B8WA 4Q7BA 4JKKA 4QS5A 4WOQA 5F2IA 1BVNP 4M3PA 4YTTA 1SQ7A 1BVWA 3DK9A 3W7GA 3SM0A 3PZVA 4UMCA 3VCNA 3ARWA 1AZ1A 3UG5A 1N5XA 3MYOA 1QK0A 2YB1A 4I7UA 1BXCA 3M1ZA 1HO1A 4HNLA 3NFUA 1AQ0A 3TJXA 3DK8A 2NSOA 5KTLA 3PR2A 4TR9A 4DXXA 1QNRA 2YFNA 3T8LA 4HHMA 1OWQA 4B3KA 1UKSA 1CX9A 1IZJA 5HOSA 4GR1A 3T44A 1OF8A 2NXIA 3BLDA 1QWGA 2GUYA 3PULA 3WLLA 4IM4A 1EQPA 4GD0A 2PB1A 3HQPA 3AUJA 4QEHA 4QNEA 1E6QM 3CBWA 4FS9A 3TJLA 2V2DA 1MUWA 1OT1A 2A6NA 1JZ5A 2NSXA 2Y8UA 3EWWA 4H4SA 5A6BD 3DCPA 3C6CA 3MV01 3TOYA 2XH4A 1OX4B 2DZXA 3FVDA 3B9AA 2VEMA 4B9YA 3TA6A 2A85A 4P7OA 3N6JA 3KAOA 3LXBA 3DX5A 2A2IA 4UB9A 2Y63A 3EOEA 3H21A 3KBNA 4RDYA 1KWGA 1MFVA 2WZHA 5U25A 3HFYA 2V82A 1E0UA 4AMCA 3KWXA 6TAAA 4AZHA 1EYEA 1HP4A 4JNMA 4H9XA 3GXTA 3L4UA 2WBAA 1I1WA 1ME8A 1H0GA 2BY0A 4UMBA 2QJHA 4RE4A 3ITXA 2H8ZA 3D47A 3ZR4A 1LRTA 4XG1A 1Z8AA 5DX7A 3UYIA 2GQ3A 3C4UA 4DO5A 1UR9A 3PG8A 4NZ5A 4CQDA 2FVLA 3QOKA 2QXWA 3N13A 4NRRA 3DGZA 2ZZCA 4X3ZA 3W2MA 3QYSA 4RZ5A 1IQ8A 2QMJA 1SSGA 3Q4DA 2GJPA 4Z2KA 2AL1A 2XIOA 3GAYA 5HQEA 1Q7QA 5C8BB 4RNFA 1UWQA 3OGVA 1HKIA 4ZO8A 1KBBA 4Q4QA 4JYEA 1F3TA 1QNOA 1N7KA 5E1QA 4XKYB 1IT7A 3K1DA 1UZDA 4G7EB 1GVQA 2JE8A 3GHTA 1UG6A 4DEFA 2WNWA 1XH2A 4Y7EA 1WV2A 1R47A 1VBJA 3HMCA 2PWHA 3KP0A 4G8TA 3EDFA 4D6DA 1QPNA 2GDVA 9XIAA 3DFOA 4KF1A 3WQFA 4DY1A 3SBFA 4EWND 4IPJA 3AXXA 3LI1A 1M41A 1RD6A 1PYFA 1HKWA 1OF6A 4XTIA 4HN4A 3AROA 2JKEA 2FTPA 1ZBCA 4XZHA 4JYFA 3PBVA 1RBAA 2VR2A 4B91A 1FWSA 2FMOA 4PBEA 3AHVA 1ZGDA 2J25A 2J9XA 4YXGA 1BKHA 3MCMA 1XG4A 2C79A 1H2IA 3EEZA 1FWJC 1ZB5A 1FUYA 4JQ1A 4LAMA 3T2QA 2YBVA 3B4YA 3GNNA 4UQDA 1AL7A 2D3NA 2C18A 1TPUA 4IISA 2A3HA 1UJPA 1QHZA 2QNEA 3EDKA 3IK4A 4NX5A 3MKKA 3DG3A 3EA2A 3MWCA 1C92A 4CN6A 1SSDA 3M0XA 2J8FA 5M5DA 2QUNA 2VRQA 1MEHA 1AJ2A 1OC6A 3BDKA 3II1A 3THQA 3CJPA 4L56A 3ZJ8A 1ZAIA 1BGAA 3N73A 4GBUA 1W1ZA 2V6AA 4J2MA 3R89A 3VNJA 2I14A 3VIJA 4YPJA 3W1AA 3GTNA 3M0JA 4L64A 4AU0A 3OHIA 1M68A 4JTDA 1UP0A 3OU8A 1XIMA 3WLIA 3MP3A 3OZYA 4A3UA 4UFJA 1M5WA 3B0PA 1Q3NA 2VDHA 5JVLA 3T0CA 3LB0A 1JUEA 4H4ZA 3CU2A 3AJXA 4ROPA 1GWJA 1WDRA 4CVWA 4CU7A 1Z6KA 3WF2A 3TR9A 4LBSA 4ICMA 1MQPA 4LC8A 4DZHA 2BP1A 3NQ8A 4IMEA 3M43A 7REQB 3HBLA 1XLCA 3SN0A 1GG1A 3NRZB 4WR3A 3TDFA 2Y7EA 1L6WA 5DO8A 4L6HA 3T07A 3OG3A 2ZYFA 2NX3A 3V4BA 3WZ0E 2XH2A 2YCLB 1OFPA 4MTVA 4H9UA 3W6LA 4NYUA 2DUZA 4HOXA 3B4UA 2AQWA 1TX2A 3TYZA 4HA4A 3WQ6A 4GK8A 4P8XA 1EGMA 1FFQA 2QJIA 4DO4A 3LERA 4MY9A 2Y7DA 1FEBA 2PA6A 3NUKA 4NYYA 1JEZA 1STZA 2DZWA 3W87A 2OLHA 3Q2DA 4D8ZA 4RW5A 4GFSA 2O7SA 5CPNA 4GG9A 2VFDA 3GNPA 3NYDA 3U5UA 1GW9A 2ASHA 2XVPA 2E09A 3PJTA 4H4WA 3IGSA 2J75A 4YTSA 1ZRQA 1QNPA 3VUPA 1R86A 1DPMA 1U30A 1BKSA 1DXEA 5DT5A 3DK4A 4J4KA 3WLSA 3KBVA 3BGJA 3RLUA 3CHVA 1BRLB 4KKXA 1QVBA 4U4MA 5D2TA 4C6MA 3T55A 4FHAA 3SGUA 2BGNE 2CW6A 2CLKA 1SMAA 4M24A 4AAJA 2YAUA 1EA0A 4RV3A 3MTWA 1WXJA 1JPKA 1FWTA 3A5FA 5AC6A 5E6ZA 2YSWA 3KX6A 1NDYA 1DQUA 4BF9A 1V7YA 1OX5A 3LGDA 2W67A 4LUSA 4RZ6A 3VOCA 1TIMA 1ECEA 2VELA 4RJEA 4B16A 4MYXA 3DBPA 3CLWA 4XAYA 2INZA 4PCTA 1KCZA 3IVUA 4ZEPA 3UG3A 3R4IA 3QV9A 3RCYA 4DZ5A 2DUXA 4BKNA 1CI1A 2MANA 3VGEA 1TWDA 1E4IA 4FB7A 2JQXA 1VH7A 1ZPTA 3MP5A 4Q8VA 3SGGA 4GVGA 3YPIA 3OVRA 1F4HA 1P1MA 1JYXA 4G9PA 4P8UA 2DVXA 3RFAA 3BJFA 4FI4A 1KXTA 3B8VA 4FPSA 5K9XA 4MZYA 4HHLA 2DSZA 3G1AA 1LBMA 5CSUA 4EPBC 3JVAA 3TH6A 4A3RA 4Z2GA 2H3BA 4PUDA 1XLIA 1UWSA 1L6GA 2E9MA 3VC6A 1S1PA 3AXKA 3WQCA 3VE9A 2QV4A 1WBHA 3BANA 2VX4A 5TNVA 3V5FA 5CAKA 4Y8FA 4DUVA 1C8XA 3MI6A 4POCA 5A6KA 5E09A 3W1QA 2PI6A 2XWDA 2O7QA 3AIWA 5FJUA 1VEPA 2PF0A 3EDEA 1EB3A 4KEVA 3LMZA 2YL9A 2WVSA 3PFRA 2ZA3A 3P0XA 3QPYA 4C6NA 3VIHA 3CV1A 1SO3A 2X1SA 1HKJA 3FSTA 5CC5A 4MJ4A 2WW5A 4HK6A 5A1AA 3WBEA 3H7VA 3H4KA 4OBSA 3H2NA 1RK5A 2PMQA 3LHVA 1FH8A 1W3LA 3O3RA 1R3VA 3FY1A 1VCGA 2TPSA 1YXDA 1GREA 2R8WA 2HNEA 1IWBA 3KLJA 1MNZA 4UCFA 1EXPA 4GJIA 3OZPA 3F7JA 3B03A 1PO9A 2OMAA 4UOZA 3WX7A 2ZA1A 4W5ZA 3OLDA 2FYMA 4M82A 3NNTA 2WQPA 2FB3A 2Z2BA 1DE5A 2KX9A 2OEJA 5AVHA 5IBXC 1UUMA 5HWMA 2ATMA 3RN6A 4EK7A 2A8XA 3OTRA 1R9XA 4YHGA 1VB9A 4IIDA 5D8WA 1K9DA 3L68A 3NVVB 1PKNA 3N6HA 3Q37A 4FNSA 3I4EA 2TSYA 1J11A 2Y0FA 2Z00A 3SCNA 2OX4A 1VFSA 4K36A 3QY8A 4PGLA 4EQXA 2PWEA 4CD4A 3OP2A 4RNHA 4M1BA 3GK0A 2QJJA 1MRAA 1TPVA 2OSXA 1GKRA 4WY0F 2GR3A 2V8ZA 1UD4A 3UXAA 1JPHA 3CGEA 1NOFA 4BQ5A 3G3MA 2EQ6A 3QPEA 2PTDA 3N2TA 2Z6IA 3MUY1 3N2OA 3RIKA 3GDRA 3Q67A 3WK0A 1YLVA 3C3UA 3SSJA 4OFCA 4O1CA 1I4NA 4PCNA 1GQJA 3CAQA 4Y9AA 1S3HA 3H4XA 3VKAA 2OELA 5EY5A 1Y5VA 2RJGA 3M7SA 4KCTA 2WJFA 2YVGA 3TTYA 5IHRA 1OSEA 6PTDA 3TTSA 1UHVA 1B4KA 2PDHA 3U2OA 4AHPA 1EF2A 3MYPA 1PX8A 2ZXQA 3UJEA 5DY3A 1M03A 4MF4A 3ONCA 1TZ9A 1OFQA 3L12A 3TFCA 4IUOA 3GRTA 3Q65A 2AGTA 4MNLA 4JFVA 4YNGA 1NWTA 2VFIA 3LHTA 5C70A 1LL7A 1G67A 3UBPC 3GHUA 1OD0A 4UIOA 3B9EA 3DAQA 3L0GA 4TVWA 2QAPA 4WKAA 3OVPA 4OOZA 1X7FA 3WEMA 1W9VA 1DJQA 3ALGA 3SIZA 4ZO6A 1EF3A 5D8ZA 3R0UA 2Y85A 3ZVHB 2Y24A 4UR8A 4IIFA 1BPLB 3N2CA 5FMHA 2BC0A 1X2HA 1SB3B 2D69A 3ZLHA 1HN1A 1T5AA 2J66A 3M44A 5GPRA 3OGRA 2GR0A 2C8NA 3WDRA 1O60A 5H8UA 1EO5A 1ZP3A 1PEZA 2ZE0A 2VC9A 4RW3A 1Z41A 2WB5A 4J7RA 1CXIA 3HQNA 2DZVA 2ABAA 3VIMA 2WMIA 1F05A 3HMJG 1BQCA 2QPSA 3UP8A 1LL6A 2Z1SA 2QAEA 4NZFA 3IEBA 4BQ2A 3EOUA 3SY5A 1G0CA 2PS2A 4GRSA 3RF9A 2BX7A 1IZKA 3SZ8A 1E72M 2DORA 2W61A 2AGKA 4LF2A 4XBJA 4R53A 3WELA 4XKMA 4C1KA 3AHZA 1W54A 3B3DA 1XDMA 2PTXA 1M9HA 1MQRA 2GGHA 3WF3A 3S9ZA 4GE8A 4H2CA 3CXBA 5FIPA 3OLIA 3WY1A 4DAIA 1H7WA 3CHCA 1MI3A 2YPIA 2B81A 1WXYA 3TYAA 1B54A 3P84A 1Q2SA 3UVIA 3E0WA 1OBAA 4NAFB 3VZZA 1LTDA 2FDMA 4L80A 3B0VC 1W9XA 3FFSA 2DZTA 1R9YA 1L8NA 3NQ6A 4QLLA 4ZXOA 1FRBA 1LZOA 5F4SA 5DRIA 4ZOCA 3IV8A 1EPXA 4ZO7A 5EBAA 3WH8A 2WNZA 2G97A 3CLMA 1G6CA 1ISYA 1XQKA 3PPCA 1OD8A 3M4HA 4BK9A 2BG5A 3URNA 3BMXA 3F4CA 1G4SA 4LV9A 2PDGA 4CNUA 1V3JA 4DF2A 2Q3RA 1JR1A 1U5JA 4ZQRA 3S1GA 3SW6A 3LSBA 3WUEA 1C93A 5GNXA 3DHUA 1BTCA 2X1IA 4Z2LA 4S2BA 5BOOA 1QW8A 3BL3A 2ZZ7A 3VFCA 3R94A 3NEVA 1H63A 3W26A 2GJNA 3GNDA 1N82A 3W7EA 3R5EA 1M7PA 4AB4A 5F4XA 2ZZBA 2EG6A 5J04A 3DHFA 1CB2A 2V3AA 4PB4A 4HBKA 2WLZA 1K8YA 4AXKA 5AHIA 3S5SA 1TV3A 3WLPA 3PB2A 2X99A 4IIGA 3CL8A 4NX0A 3VOHA 5E70A 4S3KA 3RU8X 1GG0A 4CQCA 2VVSA 4M1RA 1VRXA 4BY3A 1EEXA 4WUIA 1ZS2A 4EOUA 1MMFA 4IP7A 1XLAA 3PBUA 3TW6A 4MWAC 3ABXA 5EGRA 4UFIA 1S2CA 1P48A 5HAOA 4FXJA 4NJGA 2ZZ2A 1I0DA 3L0KA 4UFHA 4JZ5A 4JPGA 3GXDA 5BWAA 2ZX8A 3ITTA 1KN0A 3OPSA 3KEHA 4M7TA 2GJLA 3KBSA 1VBHA 1OYAA 1PDZA 4WZHA 4E3VA 4C6IA 5E9XA 1GVFA 4W85A 1GEQA 2NXHA 4OBTA 3KTSA 1H41A 4W8BA 2Q8LA 1U5VA 1FXQA 1FCVA 3WJXA 1GOQA 2QKFA 1RLCL 3GIPA 1QI2A 4JTKA 4U5IA 1EDGA 3STEA 4ZR8A 4ERGA 1X1NA 4F0HA 1GESA 4ALDA 4K68A 1TUXA 2ZVIA 2V2HA 2CYGA 3CASA 2UV8G 3VD9A 4ATWA 3AMDA 3GD6A 1IR1A 3VO0A 3PG9A 4TQTA 1QUMA 4DVOA 2X30A 3GLCA 4BHYA 3G1XA 1KQZA 4AF0A 4LS0A 1SZGA 1N61C 1CXFA 4PUWA 4D6GA 3THAA 1VLIA 2VFHA 4YLWA 1XG3A 4AW7A 4R88A 1Q1WA 1KBLA 1BSLA 2X7WA 1BYDA 3A3WA 3ORWA 3L4XA 3PY2A 3EWZA 4ZTXA 2X1UA 2BXYA 1PWMA 4W93A 1J12A 3A12A 1HQTA 3IIXA 3F5JA 1S5WA 4FLSA 2CLLA 3SFKA 1S2UA 4PTWA 1JDDA 4PODA 4AIOA 2ZRXA 2WC7A 3REQB 3GDLA 2Z1BA 4I5RA 1EHNA 1A5KC 2JFEX 5ABGA 1RCQA 2WWDA 4H4RA 3KOWA 2HMCA 1RJPA 3L2LA 3GM8A 1D8CA 5I06A 2YCJA 2FZBA 1GEHA 3QW3A 4QS6A 2ZX7A 1GQIA 1MXSA 1GXFA 3FHQA 3P0WA 4B4HA 5KSWA 2E9LA 3APTA 4LFYA 4OV9A 3LG3A 1FDYA 3UJ2A 4YVXA 3H7RA 2OGJA 4NEVA 1W1VA 1S5TA 3EPNA 3NDYA 5CZTA 2ZRVA 4JFTA 3NR0A 1KGWA 2PLKA 3QMTA 1BXNA 4GINA 4NQ1A 4O8RA 4Q8OA 2YXXA 1U1UA 2IS7A 3LBOA 3W6YA 1S7MA 3STPA 2P0OA 3OA3A 4DJFA 3VD4A 1HL2A 3VOJA 2G41A 3WDPP 4QG9A 1V59A 2XHYA 4N4QA 2FZMA 1E6SM 4IIBA 1BF2A 3E5PA 2R6OA 1TZZA 1H5YA 1R0MA 5KINA 1CDGA 3QHNA 4N9DA 3JRKA 4HJFA 1DHPA 1GKPA 3FHAA 2YKKA 4LALA 3LBCA 3XISA 3QY6A 1ZJHA 4QHRA 5DMNA 4KETA 4I9TA 4J3TA 5D09A 2BVTA 3IIZA 3L4ZA 3MC5A 3AS0A 2ZKMX 3FKKA 3AYVA 1GEUA 3IIOA 5I3HA 3H54A 1D2KA 1VFUA 4ZENA 2ZZ1A 2C0AA 4TOQA 5CJNA 2V5CA 3HPSA 2GVLA 3BJSA 2FB2A 1AMYA 5CSSA 4W4QA 3WLNA 1ISWA 4QJ1A 3WH7A 4U28A 1GCYA 4MAZA 2VNCA 4Q8WA 1JCJA 3C2EA 5LXXA 2OO6A 3SGZA 4QM1A 5CC3A 3VKKA 4LY4A 5FD0A 4C5YA 2YVFA 3NXLA 2QCMA 5KZ6A 1POKA 2NX9A 4PTMA 4EPEC 2YA0A 2CLMA 3GTHA 1TPB1 3CPRA 1H50A 1X97A 4GIEA 4D9PA 1EO7A 3N29A 3K8MA 1TJ1A 3L0NA 2Q8ZA 4O15A 5D37A 1XLHA 1WUEA 1MWOA 3CB8A 4B3LA 3CPGA 4GACA 3QR1A 4QJ5B 1XANA 3TEVA 3TSDA 5DMMA 1F6PA 2XIJA 3QGVA 3IIPA 2D24A 4H4UA 2OYMA 2WV8A 2GGJA 1IXPA 1TYPA 2PRHA 1UA7A 4XV0A 3EF6A 9XIMA 3NXFA 5CC7A 2INEA 1OIFA 3D6NA 3BSHA 3I10A 4DUOA 3W9ZA 5HWJA 1FWRA 1QPQA 4NVTA 3MUXA 5CC6A 2WMKA 3WJYA 4CKQA 4XZWA 1S3TC 1GYLA 4JN6A 1TPC1 4JL2A 3PB0A 1R2TA 3RMEA 3AICA 2PDMA 4X60A 5LNUA 4OGZA 3DFHA 1QMLA 4JHZA 3FS2A 1A5MC 4LGXA 4HB7A 4XAPA 4ZOAA 3GY1A 4GNVA 4TXEA 3RYSA 3DJGX 4LCQA 2W0UA 1I6NA 1D3GA 4GQRA 3UZ5A 4KWUA 2J7FA 5HULA 1E1EA 3U6WA 5EYWA 3FEQA 1XIHA 3MCOA 4N42A 5HNNA 1UKPA 3SCPA 3EXRA 3VD5A 3MA8A 1AQHA 4G1KA 5JIPA 1MSSA 3S5ZA 5D30A 1KXQA 3BZGA 4D8LA 3M0MA 3NO3A 3UEQA 1VR6A 3QLDA 9CGTA 4GO9A 4NZ4A 4O10A 3UJRA 5EU9A 1KD0A 3WH6A 2EPLX 4B4FA 4K1WA 4ZQNA 3DYOA 4PUNA 1Q6OA 4NJJA 2VGBA 2PWDA 3WLJA 3U4FA 5LIUX 5CPMA 2VEIA 5D04C 2D23A 1GHRA 4AZ7A 1OGGA 4FX6M 1QI4A 4UTTC 1CXEA 2WOIA 4ADUA 4DUXA 1M7OA 2QHAA 3K8LA 4FAMA 1GOWA 3TJ4A 1FWFC 4G5DA 5GJNA 1DYSA 3U5YA 5D05A 1J9YA 1UWRA 4HIBA 1UH2A 1UR8A 4PTVA 3IAPA 1Y0EA 4H2HA 3AWOA 1RPKA 2GH5A 2JGYA 2QCDA 4IG2B 2CXGA 1E6PA 4HOZA 2WK2A 4MPQA 4B5UA 1MW0A 3GZ3A 4C1NA 4LANA 1DJIA 3T8QA 4AQLA 1BYBA 1U1JA 1XRSA 2A0NA 4CVUA 1PL9A 1VF8A 4K39A 2C71A 4GQ0A 3HG3A 4QIUA 3UXLA 2GL5A 2YB4A 5REQA 1XHCA 4A29A 2XYLA 3VUSA 4UTUA 4EAMA 1KKOA 3RLVA 3DOPA 3TKFA 2E4TA 2POTA 1Q8JA 2OZ3A 1L6FA 4H1ZA 4NZ1A 4TX8A 1DP0A 1MYRA 2GVEA 4YN5A 4N2YA 3O63A 3GW0A 5M2FX 2P0IA 3LYEA 4KH2A 1V02E 3INPA 1FHLA 3TSBA 1XQLA 3TAOA 2VEGA 4MFDA 1TR9A 5TBOA 1Z48A 3EX4A 2PWGA 3WO8A 2ICSA 3TQPA 2WZIA 2V3GA 3VVGA 4MY1A 4ZFCA 1TSIA 3PWIA 4O4VA 1TKKA 1AFSA 1PPIA 1QCWA 4W5UA 4LSBA 3D5HA 3QW4B 5CPSA 1R7OA 2JBMA 3GFZA 3ZXWA 2PLJA 1EA9C 1C91A 3TW9A 4FLOA 4IIEA 2RDTA 2O55A 1SR0A 2EQ7A 4KMQA 4XZNX 3SDOA 5KVHA 4P61A 3UFYA 1NWSA 4WGXA 3LBMA 3TA9A 4GABA 5FI8A 4QSFA 2W9MA 1D3CA 3D9XA 3SRDA 2NUXA 3GE7A 2ZRWA 4H4YA 4JFWA 1JRPA 3WQWA 2XH0A 1YRRA 3ISIX 2GK1B 3KBMA 2EPNA 1KC7A 3HPFA 1L6SA 1V93A 5TF0A 4MWAD 1OIMA 2QCNA 4F0RA 3S0CA 5HMDA 4JIHA 2ACUA 2PGEA 2ZWYA 3IWPA 2PC4A 1HKVA 5LKYA 3P61A 1D7KA 3LN3A 2C3ZA 4UTWC 1WZAA 1FP8A 3TV8A 1H4PA 3R25A 3A47A 4C91A 5GNYA 5SWUA 4YS1A 1V6TA 1XBZA 2IKJA 1P6CA 2CZVA 4AD5A 1YNYA 2ON3A 4FDCB 2ZUUA 3GTIA 4E38A 3T08A 3LV5A 3AZSA 1PUDA 1OINA 1PVNA 4OQVA 4AD2A 1A0EA 2CFFA 4IQLA 1NEYA 2BLEA 1DWGM 2O9RA 4O0QA 2NQZA 2A3CA 3B97A 2XISA 3W1UA 3BLEA 3V16A 4C1LA 2J7BA 1FCUA 3ITLA 3PSWA 5I3DA 2GQAA 2XFRA 1EUNA 3H22A 8XIMA 5GRTA 1NFBA 2RFGA 4RK8A 3W02A 3TNBA 1K4HA 2E5DA 3P3BA 4QXIA 2IPGA 3LTYA 2FHBA 3AUOA 2XSXA 2AAQA 4V33A 4GIRA 3URAA 1HZYA 1S2TA 1X98A 4FSAA 1Z44A 4U33A 3SCUA 3O2LA 1AK5A 1W3HA 3RM9A 1Q1RA 1CWYA 3MBDA 4TV5A 1RA0A 3ZR6A 3LEPA 4DIAA 3VI2A 5KZDA 1B57A 4TIMA 3EOOA 4B2DA 3RU6A 2P3ZA 2GYIA 1G69A 4JHMA 3AMKA 4PMXA 1G7UA 2ZFAA 3V5OA 1GORA 1E71M 4A8IA 3V18A 1POJA 3OQEA 4JDYA 3RK8A 4YCOA 2VD8A 1DXIA 3TQVA 4BFAA 1QI3A 3GG7A 4DUWA 2EG8A 3U57A 2AQVA 3CEUA 1A53A 3RJYA 3OODA 2WPBA 4ZSUA 4APNA 3DH9A 5AZ0A 3RX4A 3GQYA 2JALA 1HX0A 2OOFA 5IRPA 4JX4A 3R12A 1K03A 4MJ2A 3SECA 4DI9A 3BTNA 4PCPA 4DI8A 3URHA 2VDIA 3L5MA 3Q94A 2NLIA 1FO4A 1K9FA 4LVGA 5K7JA 1ZL1A 3EBVA 5F4WA 5XIMA 1TTIA 4IZGA 4XZLX 2HISA 3AIEA 1D7FA 4X0NA 2OO0A 4QITA 1V6XA 3GTFA 1CYGA 2XIIA 1Z7AA 3PZ9A 4XD3A 1H49A 4LVBA 3NL2A 2G3NA 3H2MA 1JYVA 4K37A 3WK2A 3Q45A 2F7FA 4EMWA 1KM5A 3QGAC 1TR1A 2DIJA 1KFLA 3ALFA 1K02A 1W3TA 4RDWA 4DZIA 4HZMA 4MB3A 4J56A 2VENA 3MZ2A 2DZAA 3SQMA 2Q6ZA 5A2BA 4D2JA 1T99A 3L8KA 3B8DA 4ES4A 1JAEA 3ZT6A 1P6WA 1JPMA 4I6KA 3CQJA 1QI0A 2A3AA 5DCEA 3PAOA 3VOFA 2VZSA 1KW1A 1ISVA 2J7EA 3TAKA 1FBAA 3ITCA 2W4XA 2EHHA 5HJXA 1FA2A 1VENA 4OWGA 1K7EA 4FLQA 1FOBA 1VJIA 2REQB 3ZWTA 3UY8A 3V1HA 4H01A 2AL2B 1T40A 3WJWA 3GH7A 1IF2A 1AZ2A 1IWAA 2C19A 3MJMA 1K8ZA 1AL8A 2V2CA 4D6JA 2W0HA 3W1PA 1GGOA 4ECLA 2F5ZA 4BR1A 3B40A 3EZ4A 3MBFA 3L7RA 3THCA 1KGXA 3RDKA 2VMFA 1GRFA 1KTBA 3UZYA 1Q45A 1UD6A 3A9IA 5JBDA 3T42A 3WBAA 3CQIA 3G0UA 5C5YA 4XBKA 1WQ5A 1R87A 4NJIA 1NF7A 4Q4SA 4PMZA 1HW6A 1BFNA 4EACA 4MKSA 2D0FA 3P14A 2HEJA 1TJ0A 3ES7A 5H2ZA 2XWEA 3VDCA 3SUWA 1A5UA 1K77A 2O4MA 1GPFA 2CWXA 3XINA 1B3VA 3KCOA 3E2VA 3E5BA 1JGIA 2QCHA 2XU2A 4LTSA 4Y90A 1SO6A 2GSEA 4O28A 4IGSA 3CAVA 4TU1A 4ERAA 1FCQA 5IFTA 3KRUA 4U3AA 5L6UA 3P5ZA 1A3HA 2VTFA 1JDEA 5FCZA 1BGGA 2J79A 5EL1A 2OOGA 5JBFA 4Q4MA 1VYPX 4HA3A 3GC5A 3VU2A 3ZJKA 3PZMA 2NT1A 4GVIA 1ZDLA 1K6WA 3WFAA 2CERA 1C8YA 1QRQA 2EKCA 4NI8A 4EF8A 3G1VA 3MKCA 5HANA 2YLLA 2EG7A 4X63A 1X1ZA 1DHKA 2WLYA 3KDOA 1B3YA 2QF7A 4HYWA 3W88A 1F6KA 2WP6A 1KM6A 1LORA 2VM8A 3A3XA 4LNYA 5K9DA 3BLKA 4FIQA 2F6KA 4GKLA 3ME3A 4JL1A 2ZCGA 3CZ8A 1J93A 3G1SA 3LPGA 4QRNA 4UTJA 4JIPA 2GZXA 2DQWA 4NAEB 3KS6A 2BGQA 4KWSA 4P2VA 5EBKA 1SW3A 3I7SA 3NVZB 1ZU8A 1OT2A 4GI6A 4AXNA 4UWMA 1UOKA 3QN3A 3E12A 1Z3NA 2W5FA 1AQFA 3KLLA 3WKZA 4R34A 1E4MM 3L66A 2A3EA 1XXXA 1FCBA 1KFWA 1X6NA 3QMSA 1XIFA 3ANYA 2E5AA 3GG0A 2OWWA 1F3EA 1ITXA 3KOYA 1OX4A 2FZNA 3WJZA 1NVMA 4L1WA 4JIRA 4KW2A 2POZA 1MEWA 2PEVA 2EEXA 4E5TA 3G0XA 4DJDC 3CUXA 5HNUA 3PJUA 2E1WA 2ESCA 2ISDA 1UR0A 3ANVA 5I3KA 3RITA 2GQ9A 5FESA 2HPIA 4E0CA 5MKGA 5A6SA 3FVMA 3ZO9A 2QAFA 3SJNA 3I3DA 2NQHA 5LSMA 4CU8A 2P3EA 1X6UA 2PCQA 3GXFA 4G1NA 3N11A 2PUZA 1R2SA 3AS3A 1M53A 3UESA 2RGLA 1L0PA 2PF8A 1KCXA 3N6QA 1QWKA 3IIVA 4Z0JA 4KFOA 4QISA 4QCEA 2NV1A 7A3HA 3G6LA 3FYOA 4JTJA 3CZKA 3O6YX 3CEPA 4XX6A 5A8GA 2CHOA 1Q6FA 1US0A 2WSRA 2FPVA 4JTCA 4LC6A 1CT5A 2P1FA 1XSKA 1VHNA 3WNKA 2OTDA 2F6XA 4Z1BA 3BSMA 3P82A 1A49A 3P62A 1JZ8A 1DWHM 3TW7A 3S9IA 1EIBA 4PCSA 3WLRA 3RUBL 3GUWA 5G2HA 3W1XA 1IR2A 2HE8A 3KW3A 3VK5A 5I07A 5EBUA 2OR2A 3CL7A 5MF5A 3L4WA 4O19A 3VKDA 1OX6A 3FJ6A 5LHFA 1UP3A 3UG4A 3BUVA 3UT0A 1B1YA 1EP2A 1AH4A 4EE9A 1EC7A 3CGDA 2QJNA 1UROA 3JR2A 3G1YA 2W3ZA 3PZUA 3HM7A 5H8MA 3QVQA 3TXVA 1V0KA 2Z7KA 4S1FA 2BV9A 1Y5XA 6REQB 2R91A 4HT3A 2HQMA 4WSHA 2NXGA 3PPGA 2GWNA 3PBMA 3OW1A 1XIDA 3BLFA 4MKNA 3U0HA 3TIMA 3N04A 4ZB0A 3EA3A 4DJFD 1QASA 4HMDA 1DIDA 3PM6A 2W66A 4MADA 2GOUA 3O0HA 5EMKA 4PRWA 3DDMA 4XO7A 3TYDA 1XIBA 2G50A 5C2XA 3BW2A 2Z26A 5C2CA 1XD0A 2J7CA 5D4YA 4LU0A 3W74A 1KLZA 5I5RA 3CS2A 2HWGA 4MJMA 4KWWA 1GRBA 2X2YA 4FXRA 4FP1A 3PUEA 1UWAA 1CB7B 5IXEA 3UR2A 1T96A 1P7TA 8CGTA 3V1PA 5IFPA 5K4ZA 2YXOA 3GRIA 5CXPA 3UWWA 4PMJA 1E43A 1D8WA 4JNZA 3U48A 1DBTA 4L9YA 3OBKA 1US3A 2Q09A 2NVDA 4KCVA 4AIUA 2QVNA 3II4A 2XSBA 2J13A 5LA2A 4FNTA 3H70A 3NDOA 3TMLA 4QGCA 4KIRA 2CU0A 4BEQA 1M7JA 5A6LA 2EJAA 1X8CA 2F9RA 5BMXA 4JAWA 1GOMA 3K2GA 3EMZA 3QLLA 2FVKA 4L9ZA 3KS5A 1Q6CA 4M19A 1WUFA 1JPDX 1PHWA 3ARYA 4O53A 3QF0A 3SCVA 4CNSA 2HK0A 1CECA 2DH2A 3WDHA 7REQA 1AW2A 1B30A 3BV4A 1XS2A 4NUWA 1AOGA 3GYCA 4OIFA 5A5WA 3GH4A 2QDEA 3WNMA 4BA0A 4D1IA 1B3WA 2XVKA 4X22A 3T0BA 3VIOA 2YCLA 1ISZA 2CXEA 4IMCA 2YQUA 2QVHA 1DQXA 4CQ8A 1XL9A 2ISWA 3TC6A 2FFIA 4R7JA 1VP5A 2HVNA 2BGSA 4GCXA 4C5ZA 3CV7A 2WNQA 3ABZA 2VZOA 3IRSA 1N55A 2HVMA 2RGMA 5I00A 2A7RA 1RBLA 3DIPA 2EXOA 2QR6A 3ZT5A 3HGJA 4GMEA 4IXXA 1SU5A 1ZK7A 4L4OA 1C7SA 1TFVA 3AFBA 3IGXA 5A95A 1C8QA 4GIAA 4LVDA 4L61A 5DLCA 4CGTA 1J2BA 2J24A 5G5HB 3RPTA 4LYRA 4U3CA 4ICCX 2PRMA 3EKGA 4O50A 1XICA 1DIEA 4HCHA 1NFPA 1DOSA 2VEKA 3S47A 3SQPA 4H7VA 5D33A 2BHZA 3W29A 1ZFJA 1KRAC 4I5UA 1NSJA 3EWUA 1OFEA 1WKYA 3BSGA 1T0OA 1JNEA 3ITVA 3A7RA 1TV4A 1J01A 3GXIA 3N25A 2ATSA 1WE5A 4BURA 3VIIA 1BQGA 1N8FA 2R1MA 1GZGA 1DJYA 1DV7A 4ILSA 1KXVA 2DT2A 4O57A 1GVIA 3MWAA 5HMEA 3N18A 1MW3A 1YPIA 2XIBA 4PYSA 1MRQA 2PGFA 4LBUA 1ONWA 2VC5A 3ARQA 3GHSA 1EP1A 3L5AA 4O14A 3VIGA 1ZXIC 3HPAA 3AIRA 2CZEA 1PS9A 1P0NA 1GPWA 3W75A 3WCZA 1UIPA 1KFEA 2RKXA 3LCFA 4AD1A 5F2MA 3IC9A 2QDDA 2UY5A 3V0UA 4EX4A 4GYKA 3N9RA 4FXSA 1IXOA 3MV11 3STFA 4IF2A 1B5TA 4RE2A 1TWWA 3MVTA 4GO8A 2XPKA 3R11A 4IMFA 3WQDA 4Y9NA 2E0PA 3SFWA 3KVJA 4H8HA 4QAIA 3NQMA 4U2ZA 5DT7A 1IGWA 3CIWA 5DEZA 3W37A 1NHPA 3O16A 1A0DA 2NX1A 2ZZ4A 1E1FA 3TX9A 1DJHA 4XISA 3NL3A 4GGBA 3AZTA 1B0IA 1JDAA 4FX8A 3W7HA 2OT1A 4AIBA 4QEEA 4PFHA 4FNRA 1TCDA 5ECUA 1R38A 1BXBA 2X1RA 3MMUA 3GFYA 1EJTC 2F2HA 1HJSA 1S39A 5LZLA 4B9ZA 7TIMA 2G3MA 4UR7A 7CGTA 3GVWA 1S5VA 1XD1A 1K7FA 2YVJA 4EXQA 3R07C 3B9OA 3SCTA 3UETA 2WBGA 1PDYA 4JTTA 4HNNA 4B90A 3N1AA 3O9NA 5CQ1A 4WEVX 3ZJ7A 4J3UA 3DUGA 3FJNA 3C86A 4L6DA 4ZB2A 3T0DA 4KWVA 2Y5EA 2WMJA 3AISA 3MDUA 4K2SA 1X39A 3FA5A 5DXYA 2FGBA 3OLGA 1UJQA 1LM1A 5AYYA 3FW6A 3ARXA 3C8FA 3QC3A 3NSXA 3FLUA 1GRGA 4H8UA 3O05A 3E6EA 3DECA 2D3LA 3E9AA 2J7DA 1EKOA 1ONFA 3W76A 3QC0A 5A94A 5IDIA 1S46A 1ZLPA 5KMYA 1JCXA 3LNMA 4HD5A 2RABA 3WQ4A 1TJPA 1TMHA 4ACZA 1FWWA 3MKVA 4REQB 3ABOA 3UWEA 3A4JA 4HJWA 1U1HA 2A79A 1EWEA 1K4GA 1V3KA 1KO0A 4BF5A 3U9IA 2Y5SA 3PTMA 1GHSA 5HNTA 1K1DA 2H6RA 1Q4WA 3VCCA 4D8AA 4DJDD 5FEWA 1OYBA 3O1NA 4E3TA 3FA4A 1LLWA 1V6UA 3W7QA 5MHBA 3WDIA 3E2QA 3UWZA 1TYGA 1YNPA 2QS8A 3LX9A 4GI4A 3UCCA 1B3OA 3APGA 1U5HA 5FF3A 1E9IA 1Q5MA 3M0YA 4AG0A 3UXIA 4EXAA 1XYAA 4DWDA 3LQGA 3FOKA 3GU1A 4PEEA 3VX1A 3WBWA 1F9CA 1QPKA 5TAOA 1MDRA 4HTBA 5HQMA 2UY2A 3LHZA 4A05A 4Q4OA 2NV9A 1V4YA 2I9EA 4MB1A 3LM7A 5G1TA 5AHEA 3UCQA 2DT1A 5CPQA 3E2RA 2RH9A 2PTWA 3FX4A 3UWVA 3G24A 4PL1A 5G1MA 2UZ9A 3LXAA 3TQ0A 4IMAA 1DJXA 3RMJA 1P5BA 4GI9A 3SO7A 5AZ1A 3I65A 2FTYA 1VBGA 2HQAA 1N2VA 1PCKA 3WIJA 4P8VA 3AYSA 3S5YA 3ZZ1A 3F1QA 3FNDA 2DP3A 2Z6JA 3UCDA 1CGXA 3CHEA 1FWCC 3MW7A 4YWIA 2GDUA 2CDUA 4E8GA 4E2BA 2BDQA 1EDTA 3GVVA 2OVLA 1NQ6A 4DO6A 2PDLA 3B0XA 4HPJA 1Z69A 1HUVA 1O6IA 3WNPA 3P74A 4EMIA 4XZBA 3VXGA 2C7FA 1F61A 2JK2A 3GU2A 3ZMRA 1HO4A 3WLTA 4HOWA 2R1KA 2GUBA 1H0IA 3PSVA 3RPMA 4OOUA 2Z24A 5DMYA 4CNTA 3AI0A 1PX3A 4HU0A 8RUCA 1EGZA 4Y6GA 2EJ1A 4JR5A 3T81A 4A6GA 2B31A 2E8YA 4FNQA 4Q6JA 1QR7A 1KXHA 2QIIA 3BXWA 4Q8TA 3CM4A 3TE9A 4NXSA 1CLVA 2VOMA 4AISA 3MANA 3WD3A 1FY6A 5LNSA 2WHKA 4HNTA 1OFBA 5A8QA 3AHYA 4W7UA 1GUVA 4PTDA 2AQOA 4RNIA 4I90A 4PMYA 4RPPA 2YL5A 5CBIA 1NDAA 1E6NA 5EMJA 2X8RA 1E4LA 3UJFA 4J3WA 4AC1X 3TFXA 4QLKA 4HYVA 4U10A 1JCMP 2AKZA 1YDVA 2ZADA 3DZ1A 1DJNA