3IJYA

Structure of s67-27 in complex with kdo(2.8)kdo
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
IVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSNNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin light chain (IGG3)
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 215
sequence length 215
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijyA01
5GRVK 5IFAL 3E1F1 3LN4B 4MNGB 5I1CL 3TF7C 3O2DL 2YBRA 4R4FH 1G9NC 3CDFA 3SDYH 3BPNB 3C08L 4KI1A 5BJTB 1DANT 4JPVL 2NY2C 3PDOB 5EO1B 2OZ4L 2CLVB 3MV8B 2APTA 4ODUB 1P5UA 3VD5A 3TJEL 4LRIC 1WWCA 4ZXBD 5JLZB 4PYGA 4Q9QH 3HB3D 3RU8H 2APFA 4Z7VA 4Z9KB 5C0RL 3UAJD 3HR5B 2ZOKB 3FTGB 2FJHA 1JPGA 1KIRB 3HS0B 1CBVL 2X7LA 2CRZA 4O2CB 2DQGH 1CFSA 4F80A 5LXGL 3BGFC 3BP4B 4MQSB 3BMVA 4M1CC 1P7QA 2CR6A 5DGRA 3O0RH 4XVJH 4J4PA 4KGLA 4EDWH 4O2EA 2BVQB 1QUNA 1XCTA 2BVPB 2BSED 1QSFB 4RRPA 4OZIE 5CP7A 3NA9L 4HK0A 2DL2A 1FNEA 3D9AH 3EOAB 3MLWL 4LK4A 4RGND 2YRZA 2VXVL 3FQUA 3INUH 2EDWA 5C09D 3ECBA 4JHBA 3X13A 1MEXL 4LAJH 1DQJA 3ARBD 3EYOB 1EO7A 2ICWA 1J8HB 1TZIA 1U8KA 1VFBA 1UZ8A 5EDXA 3P4MB 2HRPH 4NZTH 3AGVA 2XWTA 3V4PL 3SKMA 3CFIC 2X9YA 4LCWA 3LHPH 1AXTH 1JPFA 4P3DB 3QQ4A 2HKFH 5C09E 5DJCB 5HYJD 1H8OA 3U30B 1S9YB 4MDJB 3I50L 5DEGA 1KJVA 4Z7UF 2JCCA 3NCYP 4HUXB 1I7RA 1QRNE 1B4JH 2PYED 1F97A 1WUNT 3WSQL 4EXKA 4D0BB 1AGCA 2WMPA 3VFUA 3OGOE 2NY3C 4PV9B 1TJHH 4X8JB 3ZMRA 3REWA 3NA4A 1YYML 5HYJE 1PG7W 3BZEB 1HNFA 1FL6A 5F1KC 1FDLH 3NIGE 3CXDL 2MHAA 3TA3D 5I1HL 4MXWL 2BRRH 3D85B 4G6FD 4GOSA 15C8L 1E28A 2AJYL 1JGDB 2KBGA 3WLWC 1F11B 4ZSOE 1I3UA 4L8SA 1FV1A 4XMLL 4Y5YA 5ICXA 4TN9A 3T2QA 1KTKE 4L3AA 1UWXH 2FR4B 1M7IA 3CDGB 3L3GA 4K3JL 5I8EB 4JY4B 4BH8B 3QRGL 5GHWL 3ZE0F 3X17A 1T5XA 4JANA 4XPTL 1YEIH 1JMZA 1HIMH 3TO2A 3DYOA 4S1SH 2VUYA 2B1HH 4RMRA 4JPKL 5FYJU 2FH8A 1U8IB 1FCGA 3QNZA 2CO7B 3GMMA 3ZDYE 2VDNL 4O9HH 2ITCB 4TTDC 2YUVA 1HZHH 2P4AB 3MRFB 3BE1L 4KVNH 4LVHC 1QFUH 3WKML 5A2JH 4FZEL 4M5ZL 3NZ8A 4RMQA 5C0JA 3RL2B 4HAFA 3IF1B 2JJSC 3DIFA 4GS7C 3U79A 3WJJA 4JM2F 3VFNA 4Y7MA 1XGTB 3BP6B 4X99A 1G9ML 2J8UE 3FO0L 1IQDB 3I84A 3NIFE 2H9GA 1WZKA 1K3ZA 4N0UE 1CE1H 2CK0H 3ULUL 4HMCA 3T65A 5IVZB 2XN9A 1EZVX 1S7UB 2DLTA 2W0KA 4WU7B 4ZUTB 4B50A 5EU6B 1SJHB 2OM5A 3GSVA 3DBXB 5DFVD 2ESVB 3U7YH 1RURH 4JKPL 3T8XA 2DBLL 3AC0A 3QI9B 3HI1A 1DBKH 5DRNB 3ZT5A 2O26U 1T20A 1RULL 3BWUC 5KVEL 1I8IA 2H1PH 1H0DB 2NY5H 2DJSA 3MRRA 2XTJE 3ZZ1A 1EMTH 3BUYB 5I76B 3I02A 1NBVL 4LVNC 3FCTA 3RQ3A 2OTUA 3BD3A 5DQDH 1GJIA 3QXVA 1KJ2H 4D9RD 4IM8A 2NZ9D 4P46B 3RTQD 4PJ8C 4AL8L 2HH0L 3MC0A 1JNHB 1BVZA 1UG9A 3MBED 3C2AH 3ZSTA 3PJSB 1F4XL 1ZLUH 1FNGA 5H2BB 1OB1B 1NBYA 2HVKA 4C54A 3FONA 1BJMA 3JTSA 5FUZH 3HFML 2HP4A 1M4KA 2EECA 4MSWA 2QQKL 4KK5D 3GSXB 3EUUA 4X4XB 4XC1L 3WHE0 1P4IH 3IDGA 1PKQE 3M07A 2DTMH 4OV6F 2DDQL 4RGNB 2CO6B 1NEZG 3LKOA 3OJ2C 3TH4T 4HDIA 3SE9L 4ZG1A 3T4AB 1H3PL 3UBXB 1TJIL 4AK1A 2OTWB 3SBWC 5A16A 2QJDA 2YHGA 3WS3A 3ARBB 5MERB 4M03A 5F97E 2ICES 2FBJL 3U2SB 1AD9B 3UZVB 2JK5B 3P9MB 1UA6L 4UAOC 3E6FA 5FO7A 4PJHF 1U8QB 4WFED 2VWEE 1Q9OA 3IU3A 4FQXC 4C83B 2NTFB 2BVTA 3VXPB 4MA3B 4YUEH 3F7YA 4AIZA 2ZZUT 3NZHL 4OZGA 4OZ4B 5DD0H 4JZJB 3QFJE 4KY1H 1JIBA 3LZFH 1ES0B 3QIWB 4X83A 5ILTL 4JZNB 1AXSA 4CW1A 3O8XD 4K3HA 5CCKL 4HUUB 4ODXA 2LU4A 3VFRB 2EDHA 1S5IL 2W38A 3CFEA 2HWZL 4WFEE 4KVCL 1ZLVK 2F5AH 2YD4A 3ZT6A 1BWWA 2WINB 4MQ7A 5JO5A 4F7MA 3VWKD 1LK2B 5B39B 1EFXD 4BSVA 4RFEB 4X6DE 1KYOK 2XZAH 5DRWB 4EUPH 2W60B 3D39A 1SYVB 3TVMD 2IBBA 3T2NL 2WBJD 2R15A 1WICA 1M71B 3RZCB 4YBLC 2YK1L 5HHQA 1XH3B 1I8MB 4M5YH 4LCCC 5K9OB 4JFED 2A0LD 2Y36H 5IBLD 4W4OA 4P23D 3O41A 3DJ9A 4TULH 1KULA 2NX5D 4E41D 3ULVD 4U31A 1BFTA 4JDTL 4GQPH 1P9MA 4PY8J 4HWNA 1N6QH 1Q0YL 1LE9A 3N0PB 1INEH 1WC7B 5KOVC 4CVZB 2DD8H 3BRDA 4PRID 4Y4FD 3QIBD 1G0DA 1PX4A 4N8VA 5E7FA 4NQCB 4KPHH 4QWWC 4NSKA 4BSWA 5HPMB 1CGUA 5D7IF 1UCBL 2FGWL 4F7TA 3LS5H 3SQOL 4YAQA 1BFVH 2EYRA 5EZLA 4YDLB 2NX5E 5E00A 3UYRH 4E41E 5LQBH 3ULVE 3MODL 4DAGH 3TZVD 1TPXC 1U36A 5F9WC 3RFZC 4IJ3C 1CXKA 1DQQB 2EEDA 3CLEL 5HBBA 5KSAA 1NAKH 4KROB 5HGDB 1INDH 4EDXA 2AKRA 5IJVA 1VACA 4P2OA 1LO4H 4YHOH 5E2JA 5F3HA 3P9LA 3Q3GB 1YN6B 5IVOA 4BFIB 1N0XH 5I1JH 5GZNC 3P4NB 4LBEB 1W0WA 2NW2A 4NWTH 4IHOA 3MNZA 3J7HA 5KSBE 1VESA 1DQML 1FVCA 3X12B 5JOFA 4JHAH 3BN3B 1KELL 5T33L 3SE3A 1S8DB 4GG6A 5GGQH 1KC5H 4PRBA 3DWTA 1IGYB 3EYFA 1J11A 2NY2D 4LSPL 2Z92B 3PQYA 5FA3A 2LABA 5TDPA 2EDJA 5JR1H 3BT2H 5ALBH 3LKPB 1I7ZA 5D6CA 4Y2DD 4HWUA 1BOYA 1F02I 1A9EA 5INDA 1KCVH 4UV7H 2XZZA 4TNVK 3UP1A 4LEOB 3VMPA 1U8LA 2BFVH 3SDDB 2GEEA 3DV6A 4NZUL 4I0PB 5SWQB 3V6OE 1NLBH 1WT5C 3RDTB 5JW5B 3IFLL 1IC7L 1UQSB 4XVTL 2LU7A 4O58H 4OM0H 3IDJB 4P2YA 1WFTA 5DD3H 3SE8L 4WW1A 4QEGA 1YPZF 2H32A 3R1GH 2V17L 1U41A 4WTZA 3D69B 3P11L 5DMIH 1FYTA 3TO4D 5BS0E 5D93C 1IFHH 4X6CF 1N5AA 3GMNA 1OVZA 2HKHH 3ILPB 2YD1A 3MLYH 4JO4H 4MXQC 4KKBD 3OR7B 3EKCA 1K2DB 5FHAL 3SGKC 3U0TA 3D0LB 3ARZA 4X7SH 5T5NF 5ESAB 2DWDA 2BY3A 3BVNB 1FZJB 5E24E 5FO8B 1T7WA 3BH9A 4P4KC 1FC2D 1YEHL 1A6WH 1BM3L 1NDMA 5C0GB 2R2HA 3BXNB 3RWGB 5JZ7D 4HUMB 3SDAB 4FQ1L 4NQSA 2OXGA 5AWNH 2R8SH 2I9LA 3HZVB 3R4DA 4NFDA 3X3FL 3DRQA 3OKEB 4PJ7E 1G6RH 1YECL 3FZUC 2ZSVA 2CIKB 3HE6A 4PB9L 3OKNB 1AE6H 4UNTA 4Z76B 5E8NA 1KLUB 1E6OL 2W92A 1VSCA 2P7TB 4HWBA 2A2QT 2R29L 5J1TC 1M7DA 4UUJB 2R9HC 3ZDYF 1EFXB 2D0GA 2UVFA 4OGZA 4X9FA 1A1NA 2GSIB 3IDMA 5GGUB 3UTSB 3PP4L 3N85H 4P5MA 2Q8AL 5GRJL 1ERNA 4ZPVB 2WBJB 5D71H 3MMEB 3LIZL 4EN3D 5TDNA 4I2XB 1T04B 5I30H 2LTQC 4MCZB 3GIVB 4Z7UA 5FKPB 3PABA 2GJ6D 3X14B 3OR6B 4PGBB 3TFKD 1HHHA 4XAKD 5E9DD 2CH8A 2H2PC 5L2KB 4JEGB 4UINL 3QUXA 4G6MH 4PJBE 1KFAH 2D4DA 4PRIB 5HDBE 2CDEB 5KBNC 4PJGB 4R26L 3U0WL 1BPVA 1G9NL 4X8XA 3MLRH 2FX9H 4PRPA 1DQDH 3HUJA 3EDKA 4TTDD 2F5BL 3GSNL 4XAKE 5E9DE 5JQ6H 1FG2B 3QUYC 4K71C 5D70L 3UYOD 4PBVC 4YFEA 5L7XL 3QDGA 2W9DH 2EE3A 2ZCLL 3MLXH 3KPSE 1OGAA 5F7FA 1IZKA 3QHZH 4QKXB 4LNRB 5M94B 2DIJA 4GJTB 3MYZA 3O6MH 4HSQA 2X4TB 4DUVA 1UB6B 1RK1A 3H42H 4X6EA 5CUSL 3VDCA 4GAGL 4PJCF 3O4OC 5I1DB 4BA8A 5HI3C 4YQXH 4MJ5B 1OAQL 3GSUA 2VDKL 5EWIH 4U3XA 4XPGH 2ATKB 1NCNA 2GQHA 5KOMC 4XPHL 3CFBA 3OXRA 1KT2B 1CICC 1NDGA 1HCFX 4GKNA 1DUZA 2R1YA 4LLYA 1NCAH 1KJ2A 5ETUA 3VI3E 4UB0H 5MENE 4JM2A 2YS4A 3QIUA 2NY2B 1O0VA 5CGTA 2MQ3A 5B3JF 4ZO8A 3T0EC 3TCLB 3EDDA 3PGFL 2LVEA 4QRPA 3GSNB 3BGMA 3LRSB 3TGXA 3I9GL 5C2UB 4QHMB 1J12A 1FN4A 2DM7A 3BZ4A 5A2IH 1RU9L 5F70A 5F7LB 2AXGA 1NCUA 2VXQH 3JTTA 2GW5A 4NQDD 4ZOEA 4PR5A 4KZEH 4PP1D 1T0PB 4I77L 3TIEB 4YHPB 5I8CA 3KYNB 2IAND 5ADOL 1D3CA 2VLRA 3BGFB 3JV4A 1B4RA 4XP6L 5DC9B 3UTTB 4Y5VC 5I1KH 3DROB 4CU6A 5JHDB 1MIEH 5IFHH 3CLFH 2HJFA 2PXYA 3DVFA 2O5YH 2YXMA 4KJYB 5DLMH 5HY9B 2Q6WB 4K2UH 1UB5A 4NC1E 4HS6B 4RNRB 2I5YH 3U36B 5HPOA 1SHMA 3D3VB 1BFOB 1KIQA 4ODTH 3OMZA 1AJ7L 5EN2A 2CKBH 3AS2A 4EEEA 3EOBA 5CLWA 2EO9A 3WNOA 2X05A 3HRZB 4HFWA 1P4BH 1MQKH 2E3VA 2IAMC 4JPIA 3QWQB 4RDQG 4S2SA 2AW2A 4OIIH 2EDRA 4OLUH 4ALAL 2GITB 1EH9A 1OP5H 5LBSH 4ZOCA 1F4WH 3MUGA 4G8IA 1NJ9B 5F21B 4EUPA 1EUUA 2E6QA 4QTIH 4HG4J 2F15A 4E5XA 4PS4L 4LSVH 4QRUA 2NY3B 4JRYA 4KH2A 3MREB 3S8WA 3O3AA 5F1IB 1JI1A 4MQXC 4WRLA 1ROWA 4NNYB 3D2UB 2WP3O 2NY1B 2R2EA 4IS6A 1JE6A 4S0SD 3S4SB 4TUJA 2A6JA 3RX7A 3T3MF 4HHAB 1H3TA 4PJHA 3T4YB 3IFOA 4WDIA 4YHLH 1XGUB 2Y07L 4XH2A 4LAQL 3VFTA 1FNFA 4UNVA 1AD0B 4KAQH 2O5XL 5IBUB 4JRXD 3FRUB 1D6EA 3QISA 2GJ6B 2EXWC 3T0XA 4ZFFA 4Q0XH 3QQ9C 5D1ZC 4YE4H 1ZHNB 1MFAH 5I19H 5C0FB 1V7MH 5E6IC 4EQ2A 4K7PL 1IGTB 3KPPB 1QD0A 1UYWL 3S5LB 1MRCH 4QWWD 2DJUA 4OI8A 2EDLA 5K59F 5L0QC 1W2KT 3QR2A 5E08L 4JRXE 4CVWA 4UBDD 3D48R 3PDGA 3WIHL 4KTEH 4YHKL 4L4TD 5I66B 1QA9A 1BQHB 2CJUH 4LVHB 2V2WA 3EGSA 4MA8H 4XCNB 2BY1A 8FABB 2Z35A 3L3DB 2AXHA 1B2WL 1S7VB 1P5VA 2Q8BL 4DK3A 1RY7B 4DGVL 4NN6C 4URTB 2QSCH 4XGZA 3QP3A 4NRYB 4NJ9H 1MFDL 2VABA 4AEHH 3I6GB 3BO8B 4DQOH 5GZND 3ABZA 3IGAB 2WIIA 3PGDA 4GLRH 1VEMA 4G9FE 2EE2A 3NFPA 4U1GC 3HE7C 3UEZA 1WTLA 3O2VH 1Z5LA 1N3NA 4NM8H 4Y89A 1OSPH 5CBEA 5KSVA 2FB4H 2BC4A 4XNQA 1H5BC 3D0VA 4XMPL 1XCQB 3Q6FB 3RUGE 3QWOB 3QULA 1AP2B 3L6FB 1ZHLB 3PWLB 4I3RH 4H20H 4B53A 3DXAB 5C0DA 1MI5B 1NCBL 3WXVH 5EPMB 3W82A 2QQNL 3RL1A 5BVPL 1D5MB 3FMGL 2BSTA 4LVNB 3N50A 4PJFB 5JIIA 5IR1A 3BQUC 3MRPB 3OKMB 1T21B 1RJYA 2PUQT 5C0IA 2PCPB 1E4XH 1RVFH 2C5DC 5AZ2H 6CGTA 3OGCA 2VDPH 4HJ0C 1JNNH 4RAVB 4PJ8B 4D9QD 4E0RB 3BJ91 5KJRL 4UV4H 3M8OL 2Y4SA 4J6RL 2IANB 3Q2CA 4LPTA 3UXFA 1Y0LB 1S9VB 5DJ2A 5IQ9B 1N6UA 3VFSB 2XA3A 3RY6C 4NFCA 2B39A 2C9AA 1RI8A 4G7YL 1RMFH 1M7XA 4Y4HC 1T1WB 2M1KA 3GMQB 2H45A 4Y0GA 3T77B 5JDSB 1C1EL 4MXQD 2VDOL 5DA0B 4D9QE 1BBDL 1Q72H 4XPAL 1A6AA 4LKXB 3RBSA 1CS6A 5EUKB 1LK3H 3BYTA 3JV5A 2VLKB 4X4ME 2Y06L 1CFTB 1Z9MA 2FH6A 2AGJH 2MNUA 4FQJH 1JUFB 3MJ8B 1ETZB 2ADGB 4LIQE 1QSEB 3SGDH 5DHYA 3BAEL 5EC1A 5EOCH 4UAOB 3VGGA 3VGDA 5AUMA 4GKZB 4LQFL 4LHUA 4FQXB 3FQNA 1QRNA 1YPZA 5D2LB 1JFQL 5EORL 4R2GC 4Z6AT 4ZPTB 2IWGA 3H3KA 4X6CA 1EO5A 1OP3H 4RQQA 4F3FB 1F6LL 5I8KL 1I4FA 2R0KL 2QTEA 4WGWB 3RGVA 4HIHB 3FZUD 4G3YL 4TSBH 3FQXA 2AABL 1PQZB 4JPWH 4L1HA 2AV1A 5DD1L 4J1UB 5JXEA 2Z93B 4HJGB 2ZJSL 3IVKB 1LDPL 1SJEA 2R9HD 5FGSA 1GOGA 5B39G 1KUMA 1YNKL 3QA3B 1BVKA 5IM7B 4NHUB 4QXUL 3LEXB 1EBPA 1HILB 3QHFL 2FX7L 1OPGH 2Z31D 5I16A 2F54E 4HS8L 3QNYB 4HH9B 1JF1A 2P5EB 3P0YL 5KVMC 3ARGA 2DQEH 5DJ6B 4DTGL 3LS4H 4IDJH 4LCCB 3RIFF 2J5LC 3WUWB 4HKBB 3WLBA 3REVA 2VIRB 4OLVH 5HHMD 4LLUB 4XWGL 5IVXB 3K2UL 5FYLH 1OW0A 2DOCA 1U8PB 5F6HJ 2H2PD 4PJAF 4MDIA 1FQ9C 1G7PA 2R23A 4R90H 3TN0A 1XZ0A 1YDPA 4QCIB 5CGMA 4PY7A 1D5BB 5ENWA 4OD1L 5JUEL 4FFZH 2GSGA 5HHME 3BP7A 1AFVL 1X4ZA 2AV7B 3VI3F 3MUZ1 4L4TB 4F57L 3VFMA 5D1XD 4JGJA 1ADQH 3QUYD 5L9DL 1TPXB 4ZOBA 4V1DE 5F9WB 2J8UA 3VFWB 4IJ3B 3B8YA 5KVDH 2VAAA 5A2FA 4H88L 1BEYH 5LCVH 4TVPH 2ZUWA 35C8L 1HEZB 5J9PB 4N0UA 1R3KB 4PTTB 3GI8L 1DLFH 1JV5A 3JVGA 5FEBA 2PTTB 1IGFH 1JRHI 4HIXH 1XR8A 4LDEB 4MA1C 4QTHB 3QQNA 4QGYA 4RMWA 4XVSH 1T22A 2KKQA 1X5FA 3F12B 3TT3L 5I1AA 3K1DA 4WI6A 4Z78B 3MR9B 4Z7OE 3CX2A 1DQLL 1YUHB 4RGOL 4G8FB 4XNMB 1EJOH 2Y6SC 4FABH 4HWEH 4O00A 2OQJA 5HI5C 5GJSL 3C5ZD 1A02N 1G7LB 1JHKL 3U6RB 4K8RC 1RUKH 5C71A 1CGWA 1PBYA 1MCWW 1B6DA 4ZNCD 1CDJA 3CSYB 4O2FA 2COQA 5CGYC 4PJCA 3E8UH 4JZOA 1ZLWK 2X1WL 1I1AD 3O4LD 4CAGA 3OAZH 1LDSA 3ZKND 4CNIB 5C92A 2P8MA 3QJFA 1PD6A 2B2XL 5DMGD 4M6ML 5FYJD 4Q6IC 3LEYH 5DVNA 5BOZG 3NTCL 5JIKA 3QEQA 1MPAL 1S7XB 1UXWB 4C59B 5AZEL 3KHOA 3MLVL 3VD3A 4HC1H 3O4LE 4XHJC 4WV1A 4UDTB 1AGDA 1SY6L 3GKWL 2DLEA 3S35X 1YNLH 5C0BD 1WSST 4DUXA 3WO4C 2RQ8A 3HNSL 3QXAA 1NFIB 5SWZD 2GK0A 3BPLC 5ITFB 2QKIA 2V7HB 1TZGH 2H41A 5CINL 4EI6A 1N7ML 3AB0C 4NYLA 1T6VN 4KJPC 3CFCH 4HUKB 5E94A 4P4KB 4KZDL 1BQUA 5C0BE 5DEFB 4M1GH 3QFJA 4QY8B 3MV7B 5DF0A 4P5KB 1F6FB 1EGJH 4FTVA 5CJQL 2NW3A 3VMNA 4PJ5B 3KHQA 5T1DL 1GHFL 4GW4A 4K7PX 3RWDB 1U8MB 5E8PA 2BOCB 4XNXL 4ZUUA 5I71B 4ESKA 1QYGH 4HZLB 1T4KB 4L3CA 4Q6YA 3CC5B 1EEZB 5ISZD 3BPOC 4U1HA 5L2JB 3SEPA 1IMHC 3DETC 4HKJB 1F8TH 1ZGLM 1I9RL 4YGVB 1JJUA 1R3HA 3UTQA 3OHXA 1GGIH 1C12B 3D25B 3TLRA 1NMCC 3BISA 4RAHA 1C16A 2OJEA 1R5VA 1GOHA 4NKDB 5C7XH 2PTVA 2APWA 4D0DB 3S36X 4PP2A 1RJCA 4AEIH 1NC2D 3OJMB 2LTQB 1WZ1L 1HHKA 2J12B 1MCOL 2OX5A 3ARSA 3BIKB 3HPLA 3MJ9A 4KUCF 5TPWL 5DHXB 4K3DH 1HK6A 2J8OA 1MCEA 4XC3H 2NY4D 3BN9C 3BUTA 5FK9A 3JWDH 3S96A 3QQ9D 1OAUH 5CSBA 4PJ9A 1VPOL 3RVTC 4G8GD 4ODHL 3WIIH 1GGBH 1WLHA 3TPKA 3HC3H 5E6ID 5EBGA 3GSOB 5EZIL 5KN5A 1VGKA 4QOKE 3VFVB 3TH2T 1FRGL 2HJLB 1W72H 1R3LA 3FO2A 3JUYA 1EEYA 4FQ2L 1QR1B 4NDMA 2XZQL 3MUY1 5ICYB 4UT6L 3U1SH 1UM6H 5CZKA 1ZTXH 1XIWC 3NABL 4K71B 1BJ1J 2A9NL 4FFYL 4G8GE 4TSCH 1IEHA 5HVGB 3SGEH 2NXYC 1IGMH 3KPOB 4OCNC 5C0ND 3MNWA 4MS8D 4KHXH 2FWOA 4GRWB 3G5VB 5JMRA 4N5EC 2Z8RA 1NH6A 4TRPH 1S7RA 4CMHC 4OLXH 1UM5L 5KSBA 4HX1B 1MCKA 4P3CH 2P5WD 3MOBH 3DX7A 1OGTB 1PSKH 2VC2L 3O4OB 4Y1AB 4LP5A 5F89A 4UQ3B 3UTZA 4DW2L 1Y18B 4LCYA 3W0WE 1JNLH 3BZFB 3QH3B 1M05B 4OF6A 2WQ8A 1CICB 4GH7B 3NPSC 4OQTA 3OJDA 3VWJA 5AAWA 4OGYH 3X11B 4AM0A 5IGXL 2X40A 3RHWK 5D72L 1DN0B 3R0NA 4N0FB 3T0EB 1DE4A 4PYHA 3FFDA 3DARA 1XFPA 4NQCE 4Y5XC 3V6OA 4CRPA 5EOQL 1RZFL 3GSWA 4X9HA 4U1MB 4KK6C 3LKRA 2E7LC 5DFTA 3QEHA 3OKDB 3RVUC 1QLFB 2RGSA 5IF0A 4BYHA 1Q9KA 2M2DA 3R0MA 1X5IA 2JJTC 5D7JC 5EIIA 4AT6A 4LNVA 3LMJH 1K4DA 4HJ0D 5IHLB 1FPTL 3FRPA 2HLFD 1BZ7B 1A47A 1SM3H 3QQ3A 2YPKB 1QEWB 1KJ3H 3AM8C 5CEXB 2YZ8A 5BS0A 3V0AC 1YMHA 2E6PA 1MHHA 4NZRL 4XNUL 1FGVH 5DUPH 4OCYL 1IEAB 4CN6A 3QDAA 4Y5VB 4Z7QE 5FM4A 5KW9L 3BEVA 1BVLB 2KQMA 4YFLF 2CUIA 3FN9A 2YC1B 4NQVA 3ZLQC 1ZGLB 1D9KA 3NCMA 3TO4A 2RBLA 2X1PA 3IETB 4DN4H 4JO2H 2HT4C 2AXFB 1ONQB 4NQXA 5LVEA 5E8DL 5H8DA 1ZANL 4LPCA 4HMDA 4CVXB 2VLLB 2G5RA 1CGXA 1IGCH 4OFIA 5ADPL 2AK4B 3P30H 2IAMB 1J0KA 5IMKA 5IROC 3KLAB 4PGDA 2ZSWB 4KRMB 1Z3GL 1CF8H 3QPXL 1HWHB 2PR4H 2NNAA 3NCJL 4H26A 2XIDA 5ICZA 2FO4A 4N9OB 5ISZB 3F5WA 3ULSA 4CJ0A 5T1KB 3MLSL 3EDFA 5IMMB 3STLA 3PP3H 2DICA 4Y2OA 4RDQF 2VDLH 4LLQB 4XP1L 2FATH 1OTTD 4M7JH 4A6YL 2XY1A 2UWEE 3ES6A 2YA1A 4OZFG 2BSRB 2H26A 3L9RB 4RAUB 2LFGA 1JWMB 1WCBB 3ARED 4FHBD 3S3SA 3HMXH 3ARDB 3S37L 5D6DA 4ZFGL 4JQXC 3MGAA 1MFBH 4W6WB 4OJFH 5IKCB 4Q2ZB 3IDIB 5TQ2L 3L5HA 3OB8A 1VFMA 2G5BB 3O11A 4X4ZA 5FKAB 3VXRD 2VE6A 3VFGH 4OM1L 2C4XA 4QHNA 4Y88A 4FMKA 5D1ZB 4UOW1 2XXMB 3MLTA 1ADQA 4JPVH 1QACA 4LGSB 4APQA 2HJKB 2OZ4H 2DWEA 5E6IB 1QFOA 3DX8B 3CPLA 3S5LG 2IADB 5IJKA 3L7FA 1JYWA 1YEGH 4LVOC 5J1AA 4JAMA 5L0QB 1NC4B 3TJEH 4UIMA 2R1WB 3KPQA 3D18B 3KPSA 4NN5C 1JK8A 5T1MB 3BRGC 4WI2A 2ICWI 5C0RH 3MJGX 4PJIE 1RZIB 1T1XB 4A6YB 2QADB 5CZXC 3VGAC 4JJHA 1SMAA 2EICA 4R97B 1CBVH 5EBMA 5TGBB 4YHNB 5LXGH 5CWSB 4EDWL 1RFDH 2BOBA 1AQDB 4PJAA 3CK0L 3C8DA 1ZT4A 3WNKA 4NN6B 1OF2B 3E6HB 3GSQB 2BXZA 3SPVA 1NUDA 2DTSA 1TNNA 1KSRA 1YEDB 4PRDB 1F00I 5ACZB 2PW2A 3GNML 4WWKA 4R7NB 1KB9J 4MVBD 3UTSE 3K4DA 3NA9H 2W0LA 2FRGP 3MLWH 1XR9A 4PJEE 1HQ4A 2VXVH 4BK5A 4U1GB 3HE7B 5MENA 5E4EC 3MYJB 3T09A 1T5WA 3T1FA 1WFOA 3AS1A 1MEXH 3Q5OA 1CT8A 1NGWA 4UQ2B 2HRPL 1H5BB 4NZTL 4HUWB 4M3JA 3DMMA 1BD2A 4FFWD 4RX4A 1KTDB 4DVBA 4TPRL 3V5HA 3L3OB 5DRXB 4UTAL 5EC2B 1I8LC 3V4PH 1GC1C 4PJXB 5CMAA 1FH5L 3S3PA 2DLIA 5KAQG 4NNXA 4PJGE 3PL6C 2F53A 2X4OB 3WS6C 2UVEA 3BQUB 4Z7WB 4GG8A 1OLZA 2Y25A 4X4YB 1Q0XL 4IMLB 3I50H 1YJDH 4OBSA 1YN7A 1DLHA 5H37G 2VLJB 1TJHL 3TESA 3OKKB 3NGBC 3H7BB 4BKLA 3KJ6H 1FDLL 1OP9A 3QWRD 1KTRL 2BRRL 5HTSA 5EB9A 4M3KB 2JIXA 3CXDH 4RBPK 5IW3A 4MXWH 4Y4HB 3KNBA 4HGWA 5IB1B 4PGJA 5MEOA 2AJYH 2DYPD 1IC5L 2QSQA 1K5NA 2ILLA 4OKDA 4XMLH 1EGJA 1SVZA 3M17A 4Y4KA 2GCYB 2W9EL 2YD9A 1I9EA 4KJPD 3VRJB 3NACH 3ULUF 3DO7B 4K3JH 5I2IB 1A22B 3V5KB 4OIAA 3OPZH 2YXFA 3GDBA 4X9IA 5D7LD 3QRGH 1F58H 4DFIA 4KI5F 4Z18A 4UDUB 5SWSD 2B1HL 5C08B 5D1QD 4XPTH 4JO3L 2NY6C 2BVOA 2DLFL 2DF3A 1B0GA 3DVIA 3EFFB 1WWAX 1DSFH 4R7DB 4R2GB 5JMOC 5CSGA 5EZJB 4JPKH 4KDTA 3FFCD 4KVNL 5GIRA 4MD4A 2VDNH 3IFNL 1QFUL 2VL4A 4OAWB 3SY0A 3L5JA 1DBAL 4MNQD 4ONHB 3BE1H 3NCFB 1OLLA 2ARJQ 2CLZB 2VQ1B 4WEUD 4M00A 3TNNA 1BIIB 3WKMH 4M5ZH 3STZA 2P46B 4ZTOL 3MO1B 1BGXH 4M7LH 4GAFB 4N5UA 1BQLL 3C6LA 1MJJB 2CRIA 1G9MH 1P1ZB 3FO0H 3Q5YA 3QUML 4XCEB 4GMSL 1VFOA 4MMZC 4QYOA 3QEUB 4NQEA 1CVRA 4MNQE 4MJIE 1ACZA 3W2DL 1QSVA 1SBSH 3FB7A 2FX8H 1NGYB 1I3RA 3C60A 3U7YL 1YNTA 2J5LB 1E0OB 4H0GA 4PG9B 3VXRB 2DMBA 3BPCA 2VYRE 3BN9D 1QZ1A 1FJ1A 4MD5B 4JKPH 2DBLH 1N59B 4POUB 3VDAA 4ZDHB 4FMFA 2IH3A 4JRXA 5ESVA 2D2OA 1EMTL 1RULH 5KVEH 3K4ZA 3KPRE 2Y7QA 4B41A 4U1IB 1AGEA 5D7SL 5DJ8A 1KLFA 4NKIL 4N68A 1NBVH 4GMTL 2B1AL 4K8RL 1BREA 2FD6L 3MRGB 4L29B 4P3WA 5B4MC 2BNQD 4K94C 1ORQB 2HT2C 1S9XA 1XIWD 2DQJL 4D94A 3P3YA 3MNVB 4GBXA 3QUMB 2ZG2A 4AL8H 3PDDA 2NXYD 3ZHDA 1BP3B 4L3EB 5C9KA 3ROLA 1F4XH 1YMMB 5CJOL 3MRCA 4B7IA 5KS9B 3CUPA 4RIRA 4L8SC 3HFMH 4NJAL 4X0KB 4Y5YC 3WN5B 2DTML 4G9FA 2QQKH 3H9HA 5BZWA 1CD8A 3WJLC 2W0FA 1IAII 4MA1B 4WNQA 3R8BB 1SYSA 1H3PH 5ID1A 3CJJA 1TJIH 1HKFA 5DD5L 1A2YA 3IRPX 3H3PH 4OFDA 4GRMA 5D7KD 3MGOA 3IXAB 4PV8A 4HIEA 3OV6A 5GPRA 1EHAA 5I1LB 2GJJA 2FBJH 5B38B 4M61B 5EH1A 2V5YA 1IJ9A 3HCVA 1CLZL 4FQIH 1UA6H 3LDBC 1Q94B 5MEQA 3RY4A 1N0LA 5I6XC 3AU1B 5A3ID 4IOSD 4YX2L 1JMXA 1VEOA 4X7DC 2HMIC 3ZDZF 2NY7H 3RVUD 3SDXB 3LN5A 4AZ8A 1NLDL 2B4CC 4U0QB 2F5AL 1KCUL 1MY5A 4QXTA 2GY5A 1S5IH 4Q6IB 2FSEB 1G7HB 2HWZH 5D5ME 5E0QA 1LO5A 3KVQA 2FJGB 3FO1A 2NZIA 5IK3A 5F3BB 1NMAH 5HHOE 1Y6KR 3BEWA 1LMKA 1P69B 4HV8A 3RWCB 3WO4B 3T2NH 4ELKB 2R2BB 2A1WL 2A6DB 3K8MA 4KTDL 2YK1H 3ARFA 3C6SA 1JPST 1C08B 1KIPA 3LN4A 5DR5L 4MNGA 2GK2A 4TULL 2Q76B 1X5AA 4Y19B 3VH8G 3S37X 4KDVA 5BJTA 2HT4D 4QRTB 5EO1A 3HR6A 3CFKB 3AB0B 4TUKH 5IEKB 5DMJB 5HGGS 1KB5A 1U8OB 4OCMC 2CLVA 1WV7T 2DKUA 3MV8A 1K8IB 4JDTH 2BJML 2VDRL 5JW4M 1Q0YH 4KPHL 5D7LB 3IDXL 2VR5A 5SWSB 4PB0L 5JLZA 3BHBB 4ODVH 5LWYL 1AO7E 3LS5L 1CDIA 2HVJB 4LHJB 5LQBL 1BJ1H 4W81A 5LG1A 3HR5A 3I6KB 2FGWH 3FFCB 4XCCL 3SQOH 3FTGA 4DAGL 1KN4L 2QHLA 3LKQB 1KIRA 1MHCB 4GUPA 1INDL 3BPOB 3NN8B 4R9HA 3CLEH 1T89C 4KJQC 2X89A 4LGPB 4L8DA 4G5ZL 2YMXH 2BVQA 2F54A 1QSFA 5IESL 5T3ZD 5D2NE 4Z0XB 1IL1B 1NMCB 12E8L 5BRZB 3EOAA 4ZOAA 1V3JA 4YNYA 3O2DA 4F9PA 4RCAA 43C9A 1ZVYA 4JFPB 1H9VA 2OZ4A 1YY9C 2YUZA 3EYOA 4F7EB 5DVMA 4XPFH 4IMKC 1A6TB 3S97C 1WVZA 1RJLA 1DQMH 3SCMD 4LLWB 5FYKD 1EXUB 1KELH 5T3ZE 1YQVH 4L4VE 5T33H 2V2XB 4HAGA 2VLKE 1O7VA 3TPUB 3W9DB 3BT2L 1T83A 4O5LL 4L9DA 4OZHB 5DJCA 2YN3A 4GW1B 3SKOB 5L6YH 1MCFA 1S9YA 4MDJA 4UV7L 4V1DA 4Y16D 4HUXA 5FYKE 2N56A 4NO2B 2GAZA 1UEMA 1URLA 2YPLD 3C2SA 4D0BA 1TZHA 5T1LD 2EDFA 2KQNA 2BNQB 4JFHD 3KWWB 4K7FB 1EEQA 2IPKB 5DI8A 5DURB 1XIWB 1E4KC 4NZUH 2ED8A 4O58L 3CNKA 5FECB 2NXYB 4PJGF 3IFLH 1IC7H 2B7DT 2FEEI 2KZ1B 4QHKI 5TFSL 3K8KA 5D1XA 5TH2A 2XY2A 4NC0B 3D85A 5CZVL 2YPLE 3SE8H 4H8WC 3GMLB 4JFHE 1F11A 2E9JA 4W4OC 3C9NA 4YPGB 3P11H 3GRWL 5JXAH 1XF1A 2V9TA 5FHAH 3TBVB 2P5EE 4GRLC 5C07B 4N1EA 1A6WL 2EKSB 5C8JB 1T6WA 4IRSC 3LQAC 3WL9A 5IB2B 4M4PA 2D7TL 1J05B 4MJ4A 1WF5A 1WCQA 1VEPA 2X2YA 1U8IA 4MAYC 4MYWB 1FNHA 1CFBA 1WJ3A 4OFKA 1PG7X 4PLKC 1UACL 5ID0B 4LEXH 1Q1JL 4KJWC 4Y5XB 3MRFA 1G6RL 1S7QB 2DM3A 3X3FH 2JB6A 2XNAA 1NCCH 4PGCB 3RL2A 3IF1A 1YECH 5SX4I 4XAWL 2D0FA 4PB9H 5D7JB 3EZ8A 2YD8A 3S98A 5BXFB 1XGTA 1E6OH 3BP6A 3GGWB 1T3FA 3WFHB 4PJDB 1IQDA 2Z91B 2R29H 2VQUA 1VHPA 4U7SA 3PXHA 2MOVA 4E42B 1U3JA 1J1XL 3VXOB 4ZTPL 1INQB 4XTRC 2I25N 4KWUA 4WO4C 5EU5B 4NKMB 4BQBA 2E7CA 1CXLA 5IVZA 1S7UA 2X9XA 4HCRA 3SE3C 3PP4H 5I1EL 2Q8AH 5GRJH 4ZUTA 5DMYA 1NANH 1SJHA 3MRQB 3LIZH 5GGRA 3GO1H 3DBXA 3WXWL 2ESVA 4U1KB 1Q9WB 4WFFE 2RFXB 1EO8L 3HMWL 3QI9A 2CUHA 5DRNA 1H0DA 4HZAA 4Z7NF 3F62A 1MCCA 4XRCB 3OKYA 3BUYA 3HZMB 1G6RB 3WFBH 1MIML 2ADJB 4UINH 1TVDA 2GIYA 4P5TC 5B21A 3FB5B 1G7QA 4R26H 5CEZE 1FAKT 4J12A 2NY6D 3QPQC 3RGHA 4BSJA 5BQ7B 4P46A 3GJFB 2FECI 3FQWB 3VG9B 3PJSA 5D70H 4LP4A 1OB1A 2GTZB 4U6HB 1A7PL 1P53A 3BWAB 4LDOB 1P7QD 5L7XH 3VGBA 4PLOB 4J4PD 3MUJA 4KKCC 3GSXA 3OWEA 4XI5C 4X4XA 3LEVL 4WI8A 3H42L 4J3SA 3WIFB 1RZKC 1B3JA 3IDNB 5CHNB 3RNKB 4YQXL 1T2QL 3T4AA 3TYFB 4GAGH 1NFDB 3UBXA 5JIPA 2OTWA 4F33A 5J3HC 3TBTA 4LCUB 3MQIA 3DUSB 5MERA 1OAQH 2P24B 3IKCA 1PY4A 1CD0A 4GAJL 3V5DA 3U2SA 1AD9A 3GEWB 3IAPA 4LCWD 1UM4L 2JK5A 3P9MA 4WI5A 4XPHH 1NCAL 5H35A 3CCHB 4UB0L 5I75C 3GMRB 3JXAA 4QOKA 3WE6B 3VJ6B 1A7BA 1NC2A 1U8QA 4C83A 3GMPB 1LNUB 2EH8L 2NTFA 3MRKB 5JNYB 3VXPA 1P84K 3MFGB 4MA3A 7FABL 4OZ4A 4JZJA 3VE0B 3QIWA 4HT1H 5IVNA 4JZNA 3H9SB 3MV7E 3ILQC 4YDKL 5J11B 2YD6A 2BNRD 3I9GH 4HUUA 1S5HB 4LVOB 1GC1L 4XP5L 4XP4L 3B9VA 5T1LB 4PIRF 2LQRA 2VXQL 4NN5B 5B4MD 1JZ6A 1L7IL 2GT9B 1RU9H 2HT2D 2GHWB 2W0PA 1RIHL 1T0NB 4L4JA 1S78D 5CP3H 4FZ8L 3VGAB 5B39A 4TUOB 2A6IA 2HTLC 2W65B 4RFEA 4JDZB 5DRWA 1ZAGA 2BNRE 5ADOH 1SYVA 3ZKXC 4ZUVB 4XP6H 1RSFA 5IB5B 2CQVA 3GMOB 5C2BH 1ZS8B 3KPLB 3W0WA 5I1IH 1I3VA 4JFXB 4EQ3A 1I3GH 4YH6A 1A7NL 5DLML 4D9LL 4K2UL 4RMUA 5T3XD 4HGKC 2B0SL 2LVCA 2AK1H 4RWHA 4RFNB 5K93A 5TQ0L 4NWUL 1WC7A 3Q48A 3HI6L 4CVZA 3C8KA 1WIUA 4NQCA 3AVEA 3KDMB 4LSUH 4ZUWA 5J57B 5DQ9B 3WBDA 5T3XE 1MH5B 5E2TL 4ZAKB 3ZKSD 1D5IL 4P57B 4FQCL 3PL6B 5LBSL 1F4WL 5GSVB 3GM8A 1DQQA 4ALAH 4QTIL 4LPYA 5DYOB 1TIUA 5HGDA 3LKSA 2Q7YB 4KKAC 1BBJA 5DJYB 5EU4B 1U8NB 3GHEL 4LKCB 5KAQF 1RQ5A 3NGBB 5DJAB 3Q3GA 3S35H 4PJFF 3SQBA 4BFIA 4GRWE 1IILE 3P4NA 4LBEA 5I8OL 2XN9D 1HINL 4IRJB 4JVUA 4AENA 1CR9L 2F19H 2HFEA 4WHYG 4YHLL 1EV2E 4KRPC 1WEJH 4OKVB 3EDEA 1L0QA 1RAMA 2CKBB 2DIBA 4JHWL 2Y07H 1S8DA 3KS0J 3I3DA 4LAQH 3T0VA 1NGQL 2M26A 4QRRB 5DJ0A 4H5SA 1IGYA 2D0HA 2WLZA 2O5XH 1T7VA 3AMLA 1MFAL 2Z92A 2XN9E 5I19L 3LPFA 1V7ML 3H9YA 5EBWB 4CL7A 1ZOXA 2DQFA 3KR3L 3AMKA 2XICA 3BZDA 4K7PH 5JPNB 3KLHC 4M7LT 1UYWH 4LEOA 2NY6B 1CXIA 3SDDA 2FJHB 3W9EB 3FQRB 5BO1L 1JPGB 2GFBA 4I0PA 5SWQA 5E08H 4POYA 5EG6C 3MX0A 3RDTA 5JW5A 3R8QA 1XMWA 2PKDA 3WIHH 4MA8L 2C1PB 2ZNXA 1I85A 2VDML 4I9WD 2JE8A 3SJVB 3IDJA 2UWEA 2NY0C 4EJ1C 3FT3B 2ZCHL 3IB4A 5D2LF 3ET9F 4K94L 5FGBC 4J3VA 5CJXA 3D69A 5H37H 5SX5K 1B2WH 4XVUD 2Q8BH 3ILPA 4AY0A 3HKFA 4DGVH 4AEHL 3OR7A 5JORB 3X13B 3D0LA 4I9WE 1DQJB 1MFDH 1OT2A 2XG5A 3BVNA 3QNXB 1FZJA 4OIBA 2A73B 5FO8A 1RZ8B 3O2VL 4NM8L 2FB4L 5C9JB 1U93B 4JY6B 1LGVA 5C0GA 4RZCA 3BXNA 2MTPA 1DBML 3QQ4B 3RWGA 3T3PE 2PNDA 2CXGA 4M6NH 4XNYL 5BZDA 1CXFA 3W11C 3HZVA 5I15L 1DVFA 4NC2B 2LAAA 3OKEA 1NCBH 4NRXA 5BVPH 2QQNH 4WJ5B 1EAPB 3VRLE 2CIKA 3FMGH 1AGCB 3L3HA 4I8DA 1KLUA 5HHVH 1C5BL 5AZ2L 4M9OA 5IVXF 2VDPL 1AKJA 2P7TA 3REWB 1JNNL 5A1AA 1ZHBA 1IKNA 4NFBA 4UUJA 2MHAB 2EDEA 1GZPA 3D39D 4LOUD 4D3CL 3RVXD 5KJRH 2GSIA 2DLGA 2VUOA 1XGPA 3M8OH 4J6RH 3UTSA 2B4CL 3VFOB 5F7NC 1FORL 4ZPVA 4L8SB 3MMEA 1ZSDB 3LSOA 4FFVD 5I0DA 3VXTB 4G7YH 4I2XA 4LCIH 1T04A 3ZYOA 2DKSA 4MCZA 3GIVA 3BD5A 4WUKL 1QNZL 1C1EH 3DRTB 1LK3L 1MSPA 1IAIM 5F6IC 2VDOH 1BBDH 4XPAH 3X14A 3D39E 3QG6B 4PGBA 2LU3A 1AGBA 3AY4C 1T66C 4JANB 2X1QA 4PRHB 5L2KA 2Y06H 3TO2B 2CDEA 3K74B 3B83A 4PJGA 5EOCL 4Z95L 1YYLL 5KZCD 1RIUH 5ERWB 2ZUUA 3LDBB 1KXQE 4PLKD 1CU4L 1LO0L 4LQFH 3OKLB 5I6XB 4L8BB 4KJWD 5EORH 1FG2A 5KSAD 3OSKA 1T1YA 3B5TA 3FKUS 5I8KH 2R0KH 2NXZD 4XMKL 3U82B 4P2OD 4X99B 2HTKC 2WBWB 4G3YH 3CXHJ 4LNRA 2EDQA 2AABH 4IOFC 4F8TA 5DD1H 4R4NC 2ZJSH 1MHEB 1UB6A 1LDPH 3DSNA 4QRSB 3HG1D 5J8OA 1YNKH 4MJ5A 1IVLA 3LVEA 4HUNB 4QXUH 1BF8A 2PW1B 4OLYL 3QHFH 2AQ2A 2FX7H 5I0ZA 3T8XB 3MLZL 4G8EB 4EVNB 3QDMB 3RNQB 1K3IA 3WDIA 4MCYA 4DTGH 1PGRB 1EPFA 1I8IB 2ZNWA 3PQYD 3HG1E 4HUVA 2APVA 3I02B 1YC7A 2I26N 3K2UH 2X09A 3TCLA 1RHFA 3QUZB 3O9WB 5E2VL 3GSNA 2AEPH 4S10A 1X6NA 3LRSA 4UTBL 1K8DB 4QHMA 5TDOB 1LO3L 4WTXA 2AEQH 1WBZA 4HIIA 5HHPB 5F71A 5IP4A 1A7RL 4NO0B 4MB5A 4OD1H 5JUEH 2BNUA 1IKFL 3RIAK 3OG6B 1HXYB 5D1QA 1IAIL 2OI9C 1J87A 1AFVH 1NBYB 3U4BH 4M6AA 2ZPKL 1FIEA 2CLRB 3TIEA 4F57H 4ISVB 4YHPA 4MQTB 1NSNH 4OI9A 4R0LC 2F74B 3RBGA 4NNPL 1LEKA 1JWUB 2X6MA 1JBJA 3UTTA 4H88H 1FYTD 4OTXL 4MJIA 4PD4K 3DROA 35C8H 3FOMB 2Y5EA 5JHDA 1R24B 5B8CB 3LKOB 4YEEA 1N6VA 2GJZB 3GI8H 1CDBA 4TYUA 2EDKA 3HRPA 2L7UA 4C57C 3WS3B 1FAIL 4YXKL 2Q6WA 4RNRA 3U36A 1FYTE 3P4OB 3JSSA 3D3VA 5DUML 2WNGA 3TT3H 4DKFH 2GY7B 5CILL 1JGEB 1KPUA 3KPRA 3IU3B 5LAXB 1YEEL 1DQLH 4RGOH 4M7ZC 3FB8B 4WU5A 4FQHB 3HRZA 1IE5A 5GJSH 5DUBA 1JHKH 3PWPB 1AXSB 1WWWX 1N5YH 4QHLA 1EZVY 3HE6D 5CP3A 4NOFA 3LQAL 2VQTA 5C08E 1VFAB 4S0TD 3G08B 1NJ9A 3CFEB 4KMTL 4BH7B 3ARVA 5IB3B 4MQ7B 5F88B 4JFFB 4F7MB 3MREA 4NP4L 5F1IA 5HYIA 4BSVB 1UWXK 2B2XH 4M6MH 4NNYA 3D2UA 3S4SA 4I18B 2HTLD 3ALXA 3NTCH 3PV6B 4HS3A 4HHAA 2GTWB 5ALCH 5GS2H 1MPAH 4HC1L 1N8ZB 2XKNB 3TA3C 1CG9A 3MLVH 3B3IB 2XWJA 4WFHE 3ZTNL 3ARGC 1NGXB 4U7MA 5DK0B 1K4CB 1UZ6F 1SY6H 2YA2A 3GKWH 4EOWH 4ETQB 1AD0A 1OW0C 3HNSH 1LEGB 1AR1C 3FRUA 1E4JA 1HH6B 4M93C 1LE9B 1GOFA 5C70A 4GRWF 3QUXD 3CFCL 1ZHNA 4GRLB 4N8VB 2K7QA 5CINH 5DVOA 1C7SA 1N7MH 5C0FA 3O3DB 3JZ7A 4IRSB 2BY0A 2WLYA 3KPPA 3S5LA 4F7TB 2YN5A 3Q5TA 3PWNB 2DRUA 1D6VL 4PRPD 2CDFA 1JPSL 4MAYB 4KTYA 1UVQA 3LQZB 2DQHL 3MJ7B 2D7PA 2VXSL 1GHFH 1BQHA 1LD9A 5E99L 4XNXH 4XCNA 4D0CB 1VACB 2JJSA 5DZNA 4LSTL 4YHYC 8FABA 4ZUSB 4KKAD 1GZQA 4XB8A 4XNZC 4PRPE 5F3HB 1ZT1B 2ZUVA 1S7VA 5HHOA 3LRHA 2XQBH 4BFBD 3SDCA 1I9RH 2AXJA 4I4WB 4L3EE 4NRYA 1W0WB 1QO3B 2NW2B 1QQDA 2VOTA 3MNZB 3VXSE 4ZFZB 3UTPD 4WO4B 3IGAA 1FVCB 3PE9A 5C7XL 3O2WL 2XTJC 3ZE0E 1RZKL 4GG6B 3C09C 4LSQL 2X41A 1I8KB 3HI5L 1UKSA 2MKLC 3UDWC 4JM2D 3QIUD 5DFVC 5JPMB 1XCQA 3Q6FA 3PQYB 1S9KC 4G6KH 1MCOH 5TPWH 1OAUL 3VRIA 1AP2A 3L6FA 1ZHLA 3PWLA 5GRYA 3UTPE 4QRPD 3DXAA 1AO7A 5D6CB 1MI5A 2WW8A 2XPGB 5GSRB 2FL5A 2C1OB 3WIIL 5EPMA 1ZLUK 1CTNA 1A4KB 3KYKH 5LJYH 3EYQD 5FXCH 1FLRH 3QYCA 4P5TB 3NAAL 3TH3T 3DV6B 1MOEA 5EZIH 3KLHD 1T21A 1AHWA 3G6JB 4MJ6B 2PCPA 2DJ4A 3RWIB 3U9PL 3WNPA 1FRGH 1X5LA 1AIFA 4QRPE 5EFIB 2NZ9C 2XZQH 3OTTA 4UT6H 3QDJB 1OWWA 4YDIL 5ESQB 2VLRD 4O51A 3NABH 5E2UL 2A9NH 4WUUE 2BVEA 2NY0D 1OCWL 3CH8A 3VFSA 4TRPL 3GMNB 1NL0L 1HOCA 5L8KB 5DQJA 5CSZB 5GRWA 5CJBA 2PXYD 5TF1L 3T77A 5FYJH 5JDSA 2B5IC 2VLMD 3GBML 1C5CH 3B2VL 3VXUB 4LKXA 5EUKA 3VA2C 2VWEC 3AS0A 2VC2H 3BH9B 2NCMA 4L4VA 3FO9B 4DW2H 2VLKA 1CFTA 1WITA 3GK8H 1ETZA 2ADGA 1OY3B 1QSEA 3D87B 1A4JB 4I0KA 4Y19E 1OT1A 2UY6A 5I75B 1W72B 4GKZA 3SCMA 4FQXA 4BM7A 4U1SB 5D2LA 4DFHA 1FE8L 5IGXH 3CFJB 2ZSVB 4F3FA 1ZHKB 5E8NB 2QSVA 4HIHA 1ZA3B 1AI1L 5E5UB 1F3RB 3O8XC 1RZFH 4JRYD 3HPJB 2NR6D 1G0XA 2ADIA 4J1UA 3FT4B 1QTYT 1SM3L 1I9JL 5FM5M 3V0WL 1YZZA 1A1NB 3O3BA 3WNLA 3QA3A 4L1DA 4QHUA 5IIEB 4U2YA 1FGVL 1HH9A 3JV0A 2MQCA 4NHUA 2AJXL 4NZRH 3ZKXB 1JYVA 4XNUH 3QNYA 4OCYH 4HH9A 5H94B 3KS0H 2P5EA 5KW9H 4X5LA 2VZUA 3PABB 4WW2A 3WUWA 4ZODA 2KDGA 5DSCB 4PJHE 2ATPB 1TQCC 2R0WH 5IBLC 3F7VB 4LLUA 5IVXA 4P23C 1TENA 3MV9B 4LVEA 3ULVC 2FECL 4MD0A 3O6FB 1T66D 5F9DC 1MAJA 1FL3B 2IPUG 5E8DH 1ZANH 3QIBC 2R39A 2ZWLT 5I1GH 4QCIA 4JDVA 3HUJB 1D5BA 4MLIA 4Q7DA 2VZ1A 4OZHE 5ADPH 1CF8L 3QDGB 5IOPB 3B6SB 1GGYA 1R5IB 2IQ9L 1ED3A 3VFWA 1OGAB 2QR0B 3JWOC 3DURB 1Z3GH 3QPXH 3NCJH 1NBQA 5I17B 1EIBA 1G7MB 2YEZB 3N1QC 4IIQB 4I5BB 3L3IB 1HEZA 3K1KC 4PJXF 5BMFL 1R3KA 4JREC 4PTTA 1RK1B 2VDLL 3MLSH 2XYCA 1OOAA 3FT2B 4MNHB 3MXVH 5HYSA 1KF9B 1P4LB 4XP1H 2PTTA 32C2A 3CMOL 3QJHB 2V5MA 1TCMA 4A6YH 5IQ7H 4Z7WF 5DRZA 3BKJL 1EFQA 4DEPB 2XWBB 1D5XB 2EC9U 4OF3A 5BV7C 1F6AB 4OUUB 4KRPB 3WD5L 1EERB 3IKKA 1MFBL 4Z78A 2PO6A 4OJFL 4GKNB 1S7SB 5F72S 3S37H 1QFHA 3MR9A 1YUHA 4G8FA 4XNMA 4ZFGH 5D7IE 5HYQA 1XGQB 1QBLL 5E8OA 1G7LA 5TQ2H 1QFWI 4JHZA 3U6RA 5C07E 2I60H 4JFYB 1LE5B 3V6OC 3BDYL 1CYGA 3FHAA 4OM1H 1K6QL 3WFZA 1D7FA 3PIQA 4XHQA 2VN4A 3CSYA 3B4NA 1YEGL 3CSBA 4Y2DC 1QPPA 4HJJL 4C56B 2AXGB 1CD1A 3B2UD 2CDGB 5F7MC 1FVDA 4HK3N 4YHIB 3FOLB 3MZGB 4NO3A 1VCAA 2XKSA 2XQYK 2VLRB 5F9JA 1FFRA 4KRLB 1S7XA 3U0PB 5FUOL 2G75B 2FJFA 5FHBL 1RFDL 4RRPG 4CU8A 3IDYC 2K9UA 2XA8H 4XWOD 1D9KC 4M62L 3TO4C 4MJ2A 3CK0H 3B9KA 4ELMB 5HGHB 1ZK9A 2BHYA 5ITFA 4KKBC 4Q74A 2V7HA 2E7BA 3GNMH 1OAKL 3FB6A 3HZKB 5T5FL 1TQBC 2X4PB 4P4KA 4YZFE 4WHYH 3EOBB 3E0GA 1DEDA 4HFWB 5DEFA 3F7QA 4QY8A 4LHUD 1OQXA 1QRND 3MV7A 5BCAA 1R3JB 4P5KA 1YQ2A 3FL7A 5JZ7C 5IEHB 4TPRH 1JTPA 4UTAH 5DJDB 4PJ5A 3BKCH 4GAYB 4K3EL 1ZVSB 5C0AE 3RGVD 5JW3L 1FH5H 5FDWB 4JCLA 4P2QE 4HF5H 2BOCA 2YPVL 1TXKA 2ZOLA 4HZLA 4CMMB 5JXED 1EEZA 2UZXB 3DUUB 2R1XB 1YJDL 1YPZE 1MELA 2WBKA 1I7UB 5E1AB 1CDCA 1Q0XH 4YGVA 2BNRA 2R2EB 4X6CE 4TUJB 2A6JB 3LH2L 2IH1B 3KJ6L 3Q1SH 4YO0A 1LEIB 4I3SL 1SEBB 3T2PA 2AJ3B 4R96A 1N64L 4WFGE 5D4QA 5C0CB 3HAEA 4XH2B 5FB8A 3ARGD 5IG7B 4UMGA 3VFTB 4NKDA 3ZE2E 1MCBA 2EYTA 4D0DA 4EN3C 4MWFA 2VZSA 2CKNA 4ONGL 3BIKA 2IG2L 4OD3L 4ZFFB 2Q86B 1AR1D 5F6IB 4NCDA 4OCWL 1IC5H 3HN3A 4APQC 1CGVA 5KS9F 4OCSL 3NACL 3TFKC 3EO9L 3LB6D 5IJKC 2W9EH 3TN0D 4HK3J 3OPZL 3QCUL 1MVFA 1F58L 1HQRB 3GSOA 4B0MM 5GRVL 1CXEA 1PG7H 3VFVA 4U1NA 1G6VK 1YY8B 1II4E 2E5EA 1DSFL 1QR1A 5ICYA 4J3WA 4EI5A 4JO3H 2DLFH 2V2WB 3EGSB 4WGVB 3VXME 1LP9B 3H9SE 4P0DA 1RV6X 5HHNB 3RX5A 4Z0BL 1B0WA 5ACMA 1U3YA 3IFNH 1DBAH 1BF2A 1HHIB 1RPQA 1TVBA 3G5VA 1BGXL 3DVGB 4LU5L 4M7LL 4POZD 4ZTOH 4HX1A 1V3KA 3T2OA 4QNPF 2L4OA 4OLWL 1BQLH 1KNOB 1OGTA 3PGDB 5ELIA 4M8QB 4G6AC 5GS1C 4UQ3A 3W39B 3QUMH 1SBSL 4GMSH 2FX8L 4BQ8A 1Z5LB 2I07A 3QCTL 5C3TA 1N3NB 3RWEA 4DK6A 3SDXF 1UJ3A 5CBEB 5KSVB 1JWSB 3W2DH 2R0LL 2QQQA 2XTJD 3BZFA 2CMRL 3QH3A 4WI9A 1M05A 3QULB 2N7BA 1X9QA 3WHXB 3QFDB 4CUCA 5EU7E 3ZYZA 4P99A 5CIPB 4S1DD 3X11A 4ERSL 5I9QC 4YBHA 1DN0A 3T0EA 1WQVT 5GZOD 5CEYB 1KXTB 4YGAB 2XZCL 2CPCA 5C0IB 4YWGL 3ROOB 2EIZB 1C5DB 2XG4A 1JYXA 3OGCB 4ZXBB 1QLFA 3V95A 5D7SH 4AIXA 4NKIH 4GMTH 2B1AH 3GSRB 4K8RH 3QEQD 4DKEL 2OI9B 2FD6H 1BZ7A 3ZL4H 4OZIB 1Q8MA 2YPKA 1QEWA 2YRPA 5CEXA 4FXKB 4PJCE 1FGNH 1PDKA 2CD0A 4PP1C 3K2MC 4R0LB 2DQJH 3OF6A 4P2RE 1KV3A 4AG4L 2E6JA 4NC1C 4Y5VA 5FO9B 4LLVB 1BVLA 5CJOH 4NBXB 1IRAY 2CR3A 2OR7A 3QEQE 2YC1A 4NJAH 2Z4QB 1ZGLA 2RAMA 2ICCA 2EC9T 1ZT7B 5B3JE 1BZ9B 5C1MB 2AXFA 1TTGA 1ONQA 4RBPH 5C09B 1OP5K 1SEQH 2EYSB 3H3PL 1J8KA 2VLLA 3QFJD 5DD5H 4LHUB 3FQNB 4JQVC 4ZD3L 4M7ZB 1XGRB 1AXIB 4FTVD 1H3VA 2AK4A 4FQIL 4KDTC 2IAMA 4P4RB 1I4FB 1SJVA 1CLZH 5IV2B 2FDBP 3KLAA 4U1JB 5E2WL 4WEBH 4XCYA 5HYJB 4DKDC 1V7NL 1FIGL 2AV1B 2W07A 2NY7L 3MBXH 4YX2H 1GGUA 2ARWA 5FF6A 2PYEB 3K4AA 2Y5TB 4FTVE 4KQ4L 4IEFB 1SJEB 1S7WB 5T1KA 4F7PB 1L7TL 1RK0B 1FLTX 2G60L 2HN7B 4OZHF 1BVKB 1NLDH 1QSZA 1Z9SA 4ZSOB 4Q9CA 1KCUH 1JHTB 1WIOA 4XPBL 4HEME 2VXTL 2YWYA 3L9RA 4RAUA 5I16B 1NMAL 1JWMA 1WCBA 2IGFH 3ELAT 3H0TB 4UT9L 3TA3B 4MHHI 3ARGB 3ARDA 2BRQA 2XXCB 5D9SB 2GUOB 4G6FB 3RPIA 1MLBB 2DB8A 4DOHB 1VERA 3N1GC 5J89A 5IKCA 4Q2ZA 1FZOB 3DI3B 4LLDA 5EIQA 1JZ7A 2Z9TA 2G5BA 2A1WH 5FKAA 4PJ9D 4TNWK 4KTDH 4M93B 5DA4A 1ZLSH 5DR5H 4TUKL 4L9LC 5TJWK 5D1ZA 2A9ML 4N8VG 3F65A 5JHLL 2R23B 2HJKA 2EIDA 3DX8A 4PY7B 2IQAA 4J8RA 2IADA 3QCVL 3SO5A 2BJMH 2VDRH 4ODVL 2OSLB 4M48L 3IDXH 5EO0B 1UCTA 1NC4A 4JLRB 1EVUA 4PB0H 4PRNB 3VFMB 2R1WA 2RR3A 3D18A 4PG2A 5LWYH 4UBDC 2VTFA 2J8UB 5EOCJ 4HWZB 5T1MA 3CFDA 5DK3A 3M1BB 3AFLA 1RZIA 1T1XA 4XCCH 4RMVA 4NM4L 3T3ME 1JRHH 4JFDE 5DHVH 1KN4H 2YA0A 5D8JL 2J88L 3O6KL 5TGBA 4YHNA 5EOTB 3OKOB 3NIDF 2G2RB 4XNZB 2YMXL 2ITDB 5DO2D 5CWSA 2VMFA 1AQDA 1KTLA 1OF2A 3E6HA 4G5ZH 3UCRA 1XR8B 4JN2B 4MZ3A 3ZHLA 1YEDA 4PRDA 5ACZA 3NCBB 4GW5A 1T22B 4R7NA 5KVGL 5IESH 2AAVA 4BQ9A 3WMSA 3G04B 4J3UA 12E8H 4LPXA 3HG1A 3EO1B 3HE7A 4UU9B 2DQTL 2XTJB 4XPFL 1HHJA 2OYPA 1NKRA 1V05A 2ZUTA 3C09B 3MUHL 3VWJD 4UQ2A 1H5BA 4HUWA 1YQVL 2D03L 1KTDA 5K59E 4PREB 3L3OA 2FO1A 4NCC1 5DRXA 4KXZI 5EC2A 4PJXA 1WZLA 1A6VL 4X7TB 5L6YL 5TE6L 4KC3B 4O5LH 4AH2B 1HSBB 2X4OA 5J4MA 2HFFA 4YZFF 5FGCE 3BQUA 3QO0B 3QZWA 4X4YA 2VISA 5CD5D 4RA0C 3PNWB 2VLJA 1J10A 5BS0D 1PKQB 4UIKL 2EZ0D 5HDLA 4KK8D 3RTQB 3H7BA 3MBEB 4WTZG 1EHNA 1MUJB 2OCFD 2OTPA 2ZCKH 3RY6A 2CRMA 5TFSH 1J86A 1L6XA 4ZQKB 1T7ZA 2WWKT 4I48B 3CX5J 1KCLA 5HI4C 4Y4HA 4PTUA 1D9KD 5IB1A 5CZVH 3UC0L 4X6BB 4CADB 5JXAL 2B5IB 4UILL 1BECA 2YR3A 5GISH 4Z5RA 3GRWH 4X6FB 1MFCH 2QL1A 1OP3K 3KXFD 4XP9L 1CDGA 4OGAD 2Q7NA 3DO7A 3QDME 4J3OC 5I2IA 3ARXA 4OLEA 2VERN 2FEDC 1CCZA 3ZE2F 4UDUA 2NW3B 3CVHL 5C08A 2E8ZA 1NFDF 1KCRL 2D7TH 3ULVL 1MWAL 3EFFA 4R7DA 3L3KB 1H8SA 1DEEB 4LEXL 1Q9LB 3IFPB 4FXGA 3KXFE 4C4KT 2KZWA 4IOIB 4ZYKA 3DX9A 1UACH 2OP4L 5HGBB 1NCCL 1Q1JH 4X6DB 1CFQB 3O8XB 4NOBA 1U2CA 4M1DL 1BIIA 1ZKAA 4XB7A 4XAWH 3MO1A 1E27B 1MRDL 2ENYA 1MJJA 1P1ZA 1J1PH 4XCEA 1R5VB 3GJFH 4WWID 3QEUA 3VWKB 1NBZA 5HVWA 1WK0A 1J1XH 4ZTPH 4PP2B 3TVMB 2Z31C 1V3MA 3GO1L 4HW6A 3LRGA 5I1EH 1CIUA 1P2CB 4K23L 4PBXA 5FYLE 5IMOA 5T3ZH 3S6CA 4EIZC 3CVHB 4JFEB 3WXWH 5BV7L 4P23B 4MD5A 3NH7L 1QOKA 4APQD 1N59A 2NX5B 1EO8H 4E41B 1MWAB 5F1NB 3HMWH 3UPRB 3ARTA 1DBBL 3WFBL 5IFJB 4Y4FB 5F44A 1R3LB 3QIBB 1EVTC 3KPSD 4KRNA 1MIMH 3UBXI 4H25B 3PWPE 3A6CL 5CBAB 5BVJB 1LWRA 4L29A 3WYRA 1ORQA 3RIFK 1TNMA 4NHCL 5K9QI 5D1XC 2YSSB 3MOAH 4TVPE 3TZVB 3MNVA 5F7EL 3QUMA 4L3EA 4G80A 2LV4A 1WAAF 1YMMA 3VXSA 2VSCA 1A7PH 4JREB 5KSBB 4K07A 1N2RA 5JIHA 4BQ6A 4X0KA 2QEJA 3WN5A 5J06A 4WWKD 1BFSA 4K7PY 3LEVH 4HXBL 3G5ZB 3STBA 2VAJA 4G6AD 1LVEA 5MEND 1RUML 2IALB 5BV7B 2PYFB 1QHOA 4JFQA 1T2QH 4PJAE 3QXWA 4RX4D 3DMMD 1BD2D 1XAUA 3OJDB 4OD2B 3IXAA 3DLQR 3OAZK 5I1LA 4GAJH 1U3HA 4RA3A 1JF6A 5B38A 4M61A 1DE4B 1H3XA 1UM4H 3C5ZC 3IXTB 5AAMA 4JQIL 2F53D 1Q94A 3R06B 2BY2A 1OQOA 3THML 3ETBF 4HT1L 2EH8H 7FABH 4OCXL 1BD2E 2AJVL 1EAJA 4Y2DB 4Q58C 1HXMB 5AD0A 1ND0B 4C55A 1K4DB 4YDKH 4WUUA 1I1AC 2ADFL 4QHKJ 4DGIL 3ZKNC 1GC1H 4U49A 3JV6B 4XP4H 4XP5H 5BS0B 2F53E 1YMHB 4Q6IA 2FSEA 5DMGC 1G7HA 1L7IH 1A6UL 2FJGA 1RIHH 2JIXD 2WWMD 1G9EA 4FZ8H 3F7RA 3E3QE 2CRYA 5C0EB 3IDYB 4N8PA 5C2BL 3N1PC 3K8LA 1F4YL 5I1IL 5EU3A 1D9KB 4KDWA 1DP0A 3TO4B 4ELKA 2A6DA 1BOGB 1FFNA 4NIKB 4Y4KD 1C08A 1I3GL 4U6YA 2P44B 2Q76A 4Y19A 2AK1L 4QRTA 2CSPA 4M43L 4ORGA 1A7NH 3CFKA 3H3BC 4TVSa 4D9LH 5IEKA 4OV5A 1TQBB 4M8VA 1U8OA 5GGSY 2B0SH 4PJ7B 1K8IA 1KOAA 3DPBA 5HHXL 5TQ0H 4NWUH 3HI6H 4LSUL 4JG1H 5J6GB 3BHBA 1DDHB 1GPOL 3BOVA 3T1WA 2HVJA 2VDQL 4JY5L 3I6KA 5ICZB 1UENA 5E2TH 3LKQA 2G9HA 4NRZB 3ULSB 1ZXQA 1D5IH 3ZKQD 4FQCH 1MHCA 3BSZL 3NN8A 4LSDA 1I7TB 4QF1B 2RCSH 5ANMB 4TNWF 3C6LD 4NQTA 4FQPA 3VMOA 4NQED 4LPUA 1PZ5B 1QFWL 3S35L 3GHEH 1UGNA 1IL1A 5BRZA 1KCSL 1Z2KA 2P49B 5JA9A 4OZFB 1CN4A 2F19L 4HGMA 2AERT 2R69L 1WEJL 2XRAH 3C60D 1GSMA 5I8OH 1HINH 1CR9H 4PJBB 4EN3B 3O11B 2A6KB 3W5NA 3RWFB 4NQEE 4QHNB 1EXUA 2IMMA 4N90E 2V2XA 3N1MC 4JHWH 2IBZX 2NY4C 1NGQH 4OCRL 1ZEAH 3DO3A 3TPUA 3W9DA 3QIWC 3VXNA 5E9DB 2D9CA 4OZHA 4LRNL 4KHTH 3ESUF 5C6PB 4YC2C 1OAXL 1L9NA 3TNMB 3SKOA 4JAMB 3B5GA 2FZ3A 3KR3H 5GS0D 3KPQB 2UUDH 5IBTL 1NGZB 3HC4L 1P7KA 4YHZL 3PGCA 2E7MA 4KUCD 3KWWA 3WFEL 2IPKA 4GBXD 3CH1A 5BO1H 5E5MA 2P8LB 4O02L 5FECA 1MCDA 1A14L 1OTUD 2WUCL 4YBQD 2VDMH 2YD5A 2VR4A 1ZT4B 5C0NC 1CFNB 4GS7B 4G9FD 1JI2A 5C3LD 4MS8C 3UTOA 4BZ2L 1F90L 2ZCHH 3S88L 4P9ML 1XF4B 1PLGH 4JJ5B 3GMLA 4K94H 1PEWA 3NBNA 4XXCC 3BKYL 4UT7L 4YPGA 3S36L 4YDJB 3I75B 3ZE1F 5GS1B 1EHXA 1PYWB 1P6AB 5D7IA 5DDHA 3PWVA 3TBVA 4NBYB 1CT8B 1AC0A 4HG4K 3IT8D 5C07A 5IWLA 2EKSA 2C3GA 4FA8A 2Z8WC 1F3JA 3V5HB 5C8JA 4P49A 3TWCH 5HDQH 3G6AB 5AG8A 1J05A 2OR9L 4M6NL 3BH8B 5SV4A 1DBMH 2CIIB 2JJUA 5I9QB 1KENH 5T3XH 1GXEA 1HYRC 4XNYH 5ID0A 1MCPL 3ZSSA 1UXSB 5F9OL 5I15H 2N1KA 1MFNA 2W9LA 1YN7B 4NKQB 1DLHB 2EDNA 4CJ1A 4PGCA 2IMNA 2E7LA 5HHVL 4HBCH 3GB7A 2JJVA 5IW1A 2JJTA 4ONFL 5D7JA 3RJDA 1C5BH 5BXFA 4GXVL 3GGWA 3RJQB 4FQQB 3UZEA 2HLFC 4NQDB 2P42B 3GFUA 3AM8A 3EJZC 2MCG1 1M6OB 5DJXA 4NCC2 1W0YT 4E42A 2JIXB 1HKLL 5EU5A 3KNBB 1PX3A 3NCYS 4D3CH 4YFDB 1S7TB 5HI4D 1OTSD 2X4NA 2B4CH 3ARFD 1FORH 4LCIL 1CE6A 3LKNB 1K5NB 5FYKU 4P9HC 3IJSB 4M7KL 3MRQA 3U7AA 4OSUL 3RWJB 4LL9A 2V6HA 4DZBA 3MV8D 1QNZH 4WUKH 4KV5E 1NANI 5FA4B 3P77B 1MJ7L 4ZO6A 4DVRL 3G6DL 2MSPA 4XRCA 5FV2A 2FEDD 1G6RA 1BLNB 5C0AA 3LV3A 4LHUG 2P47B 4X7EC 2ADJA 4MNGE 4P2QA 5TF0A 1B0GB 1MF2L 1RIUL 2Z8SA 3PP3K 3SDDC 3FB5A 2VB5A 1L0YA 4Z95H 4NUJB 1YYLH 5GIRB 5KVFL 1A3LL 3AXLB 5IROA 5BQ7A 3MV8E 1GGTA 5GGVL 1F4HA 1TTFA 5T5NG 5GGSB 1CU4H 1LO0H 2BZDA 2X89D 3KG5A 2GTZA 4IRZH 4U6HA 3QO1A 1GL4B 4XMKH 5CJXC 2VITB 2F54D 1QSFD 1HDMA 4WVRA 6FABH 2OK0L 5DGQA 5SV3A 1R3IL 3WIFA 2R0ZH 1JZ4A 1OTTC 1WTGT 1D5ZA 1A0QL 3TJHD 2O93L 3FB7B 3IDNA 2QV2A 3RNKA 4D2NA 3TYFA 2Q3AA 4TSAL 4JGMA 4W4NA 4LCUA 1U8HB 3AREC 4EKXA 1DR9A 1YNTB 3DUSA 4JN1L 1SMOA 2FYYA 2P24A 1QSFE 4JQXA 5IMLB 1YEFH 5C6WH 4YBLB 3BPCB 4OLYH 4ZFOA 1FJ1B 3MLZH 4EBQL 1CVSC 4MB4A 4JRXB 3VJ6A 1JPTL 1DVFC 4L9LB 1EK3A 2F9BT 2Y7QB 1LNUA 3MRKA 5JNYA 1ZGLP 3DV4B 1J8HE 3OL2A 2AEPL 2EXYC 2AI0H 3VE0A 4V1DD 3VXMA 1ZV5A 3H9SA 1G7IB 5E2VH 2AEQL 5L88L 1J0IA 4RFOH 4GXUN 4UTBH 4YPJA 1S5HA 1R5WB 1LO3H 4R3SA 4HIJB 1S9XB 4HLZG 2HYMA 3F8UB 3U4BL 1A7RH 2RIKA 2D9QB 1ACYL 1T0NA 3RWHB 1IKFH 3ROLB 1IAIH 1NSNL 2VH5L 4TUOA 2W65A 2ZPKH 3D85D 3TBYA 4FS0A 4NNPH 3LQMA 5IB5A 1A6ZB 1JN6B 1ZS8A 3KPLA 1I9IH 4OTXH 3C8HA 4WNQB 1JNJA 1RHHA 3RUGB 5KSUA 5E7BA 4F37F 4KMQA 1T1ZA 4MVBC 3B9EA 3FN3A 3U46B 2P45B 2X4SB 3MGOB 1FAIH 4LIQL 4YXKH 4HBQA 4DKFL 4DCQA 1ITBB 3B8SA 4R4BB 4H8WH 1UKTA 2J7LA 3ZKMC 3U9UB 4LSRH 4Y8AA 5DUMH 3HCVB 1IAMA 5CILH 2N4IA 4FFWC 1KB5L 4HULB 1WAAA 3ZT7A 5DQ9A 5MEQB 1YEEH 1N5YL 4ZAKA 2JF1A 1FZKA 3PL6A 1IQWL 4GG6F 1L6ZA 1LILA 5GSVA 1GAFH 4B7LA 3LQAH 5DYOA 1J1OL 2ID5A 2BCKA 4F7CB 4QXTB 1HYSD 4DN3L 3T0AA 4KMTH 1LP9E 3B9DA 4HPOL 4P2RA 2V9QA 1U8NA 1X5YA 2MFNA 3T0DA 1NCTA 3FO1B 2O61B 4NP4H 2HFTA 5ALCL 1IAKB 3DOSA 3BEWB 4DZ8B 3G6JF 4ZNEE 4IRJA 3VW3L 2VNCA 4PRAB 4OKVA 3DHMA 3C6SB 2ESVD 1KIPB 3ZTNH 4EOWL 2CKBA 5D93B 4U0RC 3VI4E 1U58A 5DK2A 3QI9D 3GI9L 1I1YB 2VL5B 5GS3A 4QRRA 1KB5B 2V2TA 2H6PA 1A1OB 3MV01 3AAZA 3VH8B 2RJMA 1PFCA 5EBWA 3PWUB 5EU6E 3GUTB 1KEML 3VGFA 2ESVE 3DVNA 1IM3B 2JELL 2UZIL 5JPNA 1CD9B 4U1LB 4P46D 1MFEL 3G5YB 5D1QC 3P73B 3I2CL 2GKIA 3W9EA 3FQRA 1D6VH 1JPSH 3VG0L 1QLRB 3NFNB 2DQHH 4GUPB 2LAGB 1KLGB 1RJZA 2C1PA 3SJVA 2VXSH 1X5ZA 2D7QA 4L8DB 5E99H 3ULUD 3FT3A 4GQ9L 2F54B 4LSTH 2XQBL 1OL0A 3NFSL 4KI5D 4HKXB 1NPUA 4YNYB 3EYVB 43C9B 1NUFA 2A83B 5JORA 1FZMA 5CS7A 1VGEH 2H32H 3O81A 3SKNB 3QNXA 3ULUE 3OXSB 1PVHA 2A73A 1RZ8A 2EH7L 4KGJA 4X98A 1RJLB 2Z31B 5C9JA 1U93A 4JY6A 3O2WH 4QOKD 4X9BA 4KI5E 4RGNE 1RZKH 3FQTB 1TCRB 4LSQH 4G6KL 3DX6B 3HI5H 3IJYB 5HHMB 1JF5A 3QIWD 3OZ9L 3BMWA 3KYKL 4P59L 4V1DB 3WDJA 3IU4L 1FLRL 4WJ5A 4CN1A 1EAPA 1WBXB 2GAZB 1UEYA 1TZHB 4JFDA 4XBPB 4N0RA 3NAAH 2CK2A 5DI8B 1ZA6B 2NY1C 3U9PH 3KPMA 5F93C 3VA6A 5TH2B 5D1XB 3QUYB 3TBWB 3O3EB 4YDIH 2PYEE 5IHZB 2EE6A 4G42A 5E2UH 3HUJF 3BGAA 3H7LA 2O5ZL 3L5XL 1UH2A 4HWBH 3W0WD 3VFOA 3RZCD 1MNUL 1LQSR 5EO9B 1OCWH 3C9NB 1R0AL 1ZSDA 3VXTA 2NLJB 5HVFB 5FYJL 2MCPH 1NL0H 3WJLA 3F58L 2BSSB 4N8CL 2C7UB 5FCUL 1C5CL 1CWVA 1KN2L 3DI2B 5TF1H 3ZDXF 3DRTA 1FNSL 4NPYA 3CD4A 2K7PA 4HCRL 2ORBL 3GBMH 3ARWA 2FIKA 3B2VH 3V9FA 3QG6A 1RUPL 2D7MA 3GK8L 4DOHE 3WL9B 1B9ZA 4NQCD 4PRHA 1QPXA 3CDCA 2BP3A 1DCLA 1TLKA 1QLEH 4NUGH 2ZP0T 5SX4H 4LASH 1ZE3C 2DQIL 3C5ZB 5MP6L 5ERWA 2DKMA 2AJUL 1CL7I 5DWUL 4WI3A 1KJMB 4V2BA 2JB6B 3OKLA 2XNAB 4KV5F 1FE8H 4L8BA 3IAGC 5DMKB 3PHQB 4KROD 5HXMA 5A3IC 3MLUL 1K9TA 4QO1A 1IBGL 3FRPG 1AI1H 1I1AB 1T3FB 3O4LB 5DEZA 1B0RB 3SDCC 3PV7A 4NBZB 1A3RL 1OARL 1MHEA 3L5WB 1AGFB 2WAHA 3EJZD 3QEGL 1I9JH 4YDVA 4QRSA 4LARL 3V0WH 2D7NA 3V7AE 2DQUL 3NCCB 3EO0B 4NN7C 5EZOL 1FO0L 4S1QH 4XBGA 5FOJA 5GGRB 2PW1A 2AJXH 4XZUB 5C0BB 4G8EA 4EVNA 3QDMA 3RNQA 2R0WL 3V6FB 5SWZB 3I6LD 3MA7B 2P8PB 3QUZA 3O9WA 1KYOJ 3CSPA 2GYSA 3DSFL 3KXFA 1MJUL 1AHWC 1G7QB 5I1GL 1K8DA 4ELMF 5TDOA 4F9LA 3B5HA 3ZDZE 3SDDD 2OL3L 5MEPB 4I0PD 5HHPA 3I6LE 3RDTD 4OF8A 5DD6B 2Q87A 5ACLA 1U8JB 5AYUH 4NO0A 5CJ5A 4MMXC 1HXYA 5D2NC 4JKMA 4CVUA 5CD3B 2J6EL 2CLRA 5JDJA 4ISVA 3ZTJG 1BAFL 1OHQA 2IQ9H 4AMKL 4PFEA 2F74A 5B22A 2A38A 1T89A 4YK4C 1JWUA 4TOYL 4D9RE 4TQEL 5FUCC 1FO0B 1MCHA 1BQSA 2X4QB 4LF3B 5GXBB 3FOMA 1R24A 4OCLC 4YIQB 5B8CA 5BMFH 4RSVA 3MRHA 3MXVL 4XXDA 2GJZA 4WHDA 4F33B 5IQ7L 3U4EB 4ZS7L 3MXWH 3TBTB 3CMOH 1NEZA 3IKCB 4PPTA 4KKLD 5FM5O 3WCYA 3BKJH 3V5DB 3JUZA 5LGHL 4Q9BA 4HXAL 3CDYA 1QVOB 3U48A 3P4OA 4IMKA 5H35B 3WD5H 5TE4H 3BP5B 4QOKB 4GKOA 1JGEA 1BZQK 2C26A 1NC2B 3RY5A 3SDAD 3SCMC 5LAXA 1UFUA 4Q9RL 2W91A 3FB8A 4FQHA 2OL3B 3RZWA 1IC4L 1WISA 2I60L 2NY4B 1DVFD 1QBLH 1NMBL 1DL7L 3KYOB 3PWPA 1TETH 3OB0K 5FFLA 4YC2B 4G8GB 2EXYD 4N0YH 3BDYH 1OSZA 1K6QH 3MFFA 5DT1H 4LPWA 1VFAA 1A7OL 3G08A 3NCEB 1AKJD 1IM9A 4Y16C 2IPTL 4BH7A 4HJJH 5IB3A 2DI9A 5F88A 4JFFA 3BRFA 4FXLA 4NT6B 1E4KA 1H3GA 2A6IB 3WFCL 4G43B 2BK8A 2E9BA 5K9JL 3UYPA 4I18A 2OXHA 2X70B 3UTSD 3PV6A 2GTWA 2F58L 1N8ZA 2XKNA 3W0WB 4OFPA 3T04D 3B3IA 2XA8L 5FUOH 1NGXA 4KU1A 5FHBH 1GGCL 4WW2C 5FGRA 1LP9F 5DK0A 5KTEL 1K4CA 3OAYH 5HGAA 4CGTA 2P5WB 4ETQA 1FL5B 4M62H 2MWCA 1LEGA 2R56L 3MCKB 1L9MA 2EDBA 2UZYB 2ZKHH 1HH6A 3EZJB 5L2KD 1OAZL 1OD7A 3C8KB 3ORJA 1OAKH 4GRLA 3FN0L 4Z77A 4I2XE 1Z0NA 4P9HL 2M8XA 3O3DA 4ZUWB 5T5FH 2H8PB 4IRSA 3ZKMD 4ZS6D 2Y9RT 4JFEE 4X5WB 2DIAA 2UYLB 5EBLA 5IUSA 3PWNA 3K80A 3VI4F 4JCMA 4MAYA 3BKCL 3LQZA 5L2KE 1W0VA 3K3QA 3MJ7A 4PRIE 2W1NA 4HF5L 3J8F7 3V6ZA 3CMGA 3N1FC 4K3EH 1HSAB 3LKSB 3KPNB 5JW3H 4NGHH 1BBJB 1F4AA 3MROB 2YPVH 4D0CA 1CTOA 1DZBA 1NUNB 4N0CC 4W68A 4G7VL 4HC1A 3SO3C 4ZUSA 3L1OL 3K7UA 3MRLB 1ZT1A 3EOYG 1A1MB 1FYHB 3DTXA 2X4RB 3Q1SL 5FM8A 4I4WA 4EZMA 4N1HB 1VENA 2OMNA 1N4XH 3LH2H 4AENB 1QO3A 2HFEB 4ZFZA 4WO4A 4I3SH 4LLMB 2SEBA 2PO6C 4MAUL 1MLCA 3RKPA 1J0HA 1XGYL 5LGKA 1CK0L 1N64H 3QXDB 2X1XR 1EX0A 1U6AL 3SKUD 4H1LB 4KQ3H 3CU1A 4OZIF 1J0YA 5DJ0B 4H5SB 1FFOB 1I8KA 4PGZA 3MRDB 5JPMA 4ONGH 4X9GA 1K85A 4OD3H 2IG2H 3MRJB 5KANI 4YR6B 1OAYH 4OCWH 2DQFB 1TITA 1CGSH 2XPGA 5GSRA 2C1OA 4OCSH 1Y6NR 4M6OL 3EO9H 1PG7L 1A4KA 4LGRB 1HNGA 3MA9L 3WNMA 2NYYC 4P5TA 2ARJB 3QCUH 3O6LH 2C3VB 2GFBB 3G6JA 4MJ6A 1RZJC 4X7FC 3RWIA 2C3HA 5CIPH 1KB9K 4FOMA 4G6JL 2YKLH 3F7PC 5DVKA 3EW3B 5EFIA 5EULV 1T03L 2UWEB 3QDJA 5ESQA 5J6HB 2PF6A 1JZ2A 1UH3A 3HC0B 3UTTD 4M1CD 4MJID 4Z0BH 4JG0L 1XF2B 3V8CA 5JHDD 1UWEH 1E6JL 4J4PC 3B9KC 4P2CG 2D7OA 5CSZA 2IC2A 1MREL 4LU5H 4OFYA 1U91B 3T08A 3KYAA 3UMTA 3VXUA 3NIGF 3PHOB 3UTTE 4OLWH 2UY7A 1OWRM 3D3VD 4QT5A 5EUOB 3AREB 4X5XB 3FO9A 4Z7NE 5JHDE 4RZCB