3IJYA

Structure of s67-27 in complex with kdo(2.8)kdo
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
b'IVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSNNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin light chain (IGG3)
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 215
sequence length 215
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijyA01
2DD8H 3IDJB 3IRPX 1KB5H 3O6FC 5C2UB 4HHAB 3S8WA 1AGCB 5ICZA 4IMKA 2R4RL 2WAHA 3EYQC 3R06B 3DVNA 1EEQA 2NY2B 4ZPTB 2EC9T 2HFFA 4M6AA 2WWKO 3TVMD 3I2CH 2E7LA 2CR3A 1F3RB 4X6DB 1YYMH 4F7PB 1FN4B 2C5DC 4PJCA 3QUKA 5IVOA 3BH8A 4JFEB 3UPRA 4PJEB 5CJ8A 1I8MB 5D7SH 4UUJB 2XQYG 4WEBH 5DEGA 1SVZA 4PS4L 5E4EC 5IBTH 2BNRA 3OPZL 3IDMB 1JZ4A 1NMAH 5E5MB 3OMZA 4NFBA 1RZJL 5DRNB 1UA6L 3PL6C 4P23B 3SGEI 1CZ8H 3QDMA 5B8CA 3LRSA 1A6ZB 1NSNH 2CRMA 4L4VA 1S5HA 4YJZL 5D6DC 4FXKA 3VXRD 3MLYH 3DWTA 1FDLL 3ZE0F 3J7HA 4XI5D 1MHEA 4XPHH 1ZKAA 7FABH 1BVKA 4OCLC 2PO6C 1TVHA 1FL5B 4LHUG 4UV4H 2VB5A 2HMID 3EJZC 2FLRT 3Q1SH 3FT3B 3Q0HA 4X8XA 2AEPL 3MZTA 4QRRA 1HXYB 2B1AH 2B2XH 1N7ML 5IHBA 2VLKB 2BY2A 4OGYH 4XPFL 3R8BB 4XMPH 2AS5M 4Q9CA 5HGHB 2CGRL 5I8KL 5T1KA 2BVOB 4CJ1A 4ENED 2BRQA 4L29A 4HS8L 3WEXA 4NSKB 1WITA 1K5NA 3BH9A 5E2VH 4U6VL 4P2QE 1A7PH 3DGGA 4MA1C 5EZLA 5LQBH 2ZPKH 3VFSB 3ZSTA 1YEGL 4JY5H 1A6TA 1U92B 2YD2A 1A1NB 1J05A 4XAWH 4WW2B 4X6DE 3NA9H 4EQ2A 4X5WB 3W9DA 2HT3D 5GGTL 4LRIC 1YY9D 3A0OA 4ZTPL 3L3JA 5H35B 2GT9A 2R23A 4NOBA 3EYUL 4N5EC 3PXHA 1UCBL 2E8ZA 4OIIH 4XNMB 2XWJA 2HH0H 5IW6A 4O02H 4MWFA 4P2RB 3ME0A 2HLAB 4P0DA 3C5ZC 3VD3A 3HMXL 4PGEA 3BPOB 3QIUD 1J1XH 3NCYP 1CS6A 5GS1C 43CAA 2Z93A 4DJMA 3TO2A 1OPGL 5CEZL 2ICEA 2H26B 4L3ED 2IFFH 3BYYA 5SX5H 1EERB 3LKSA 5SWSD 1NC2A 4R2GD 5TQ2L 4GG8B 1QACA 2I25N 1G6RL 4XHQA 4ZAKA 4JB9L 1YNKL 1C7TA 4HJJL 5KW9H 2AXFB 3QB7C 5SWQA 3ZE1F 3TF7C 2J8UA 4XX1G 4GBXD 4KXZH 3QUML 5HYJD 3MOAL 2QV2A 2F8XC 3BKMH 4K3GA 2JJTA 5IVXF 4UT6L 4FABL 2NY1D 1ZGLA 2NY4D 4N8VA 4IRZL 1T66D 4JHBA 1QSFD 3ALWA 3C60D 4XRCB 5LGHH 4LKCA 3L3DB 2PW1B 1D5BB 3EDDA 5FHAL 3QIWA 3P0YH 3EOYG 5I1LA 1N4XL 4H8WH 4JJHA 5CKAA 5JTWA 5ISZB 1DUYB 5FGCE 2XQBH 2GITA 3HNSH 3IDXH 3QI9A 4J8RA 2D31B 2RR3A 1GPOL 4N8PA 4NQDB 5FCUH 1UXWA 3MRLA 5EBWB 3SJVB 2CIKA 4N0YL 2D9QB 4NZTL 5FYJU 3VFWB 2NYYD 2QQQA 2W9EH 5A43C 4NWTH 3QXVA 1T89C 4FS0A 5JW4N 5JHDE 1T0NA 2AAVA 3PJSA 5E2UL 3LQMA 3L3OA 4JKPL 4L8DA 4EIZC 4LCIH 3SQOH 1FNSH 3U79A 5EU6A 3HE6C 5KSBA 5TFSL 4AG4H 2ATKB 3NTCL 5I0DA 4ERSH 4E5XB 1S8DA 5DEFA 5I18L 4L3CA 1BBJA 4LOUD 3QDJB 1HQRB 4RX4D 3GDBA 3MRJA 1MJJB 4RZCB 2IALB 3DMMB 5J3HC 4CGTA 3L3GB 4XBGB 5C07E 5JDSB 1QBML 2FX7L 4LLMB 1GHFH 4BSWB 4JZNB 3C6SB 1Q72L 2PTUA 3LKRA 4P48A 3RNKA 1RJYA 3LKNA 4LHJB 1EVUA 3HZYA 1ZLSH 3RY4A 3B3IA 2ZJSL 5D1QC 5F3HB 4ZNEA 1KIRB 4JR9H 4F37F 4HLZG 4LVOC 2WZPD 2OL3H 4UNUA 1UJ3B 3O6KL 1V8HA 1I7ZB 3QNYB 5KSVB 4LF3B 4GRWE 3MLPA 2XYCA 5L9DH 1HWGB 5TE4L 5HGBB 1J8HA 2Z92B 4OZFB 3BGFC 1SYVB 4N1HB 1Q1JH 3C8HA 4UILL 4X6EA 4AL8L 4HKJB 4XMKH 5GRWA 4NRZA 3G6AB 3BX7C 5B39B 3GI9L 3HB3D 1N0LA 1MVUA 2WK2A 3ARPA 5HGGS 3QQ3B 5AD0A 3KPPB 3RL1A 3RHWK 5I17A 1A0QL 5F1SA 3S34L 1P4LB 4B53A 3REVB 2RB8A 3EYSH 3NABH 1P4IL 2VH5H 43C9A 2OR7A 2AEWA 1BOYA 1UG9A 2YPVH 3VXQB 3ULUE 4LSVL 5BOZG 1TITA 3OJMB 4LSUL 4KZEH 3QDJE 3CDGB 3F58H 1MHPH 1B2WL 2PXYC 3HS0A 5IVZB 2VLRB 4JY6A 5DD6A 5DI8A 1MOEA 4JRXE 2VLJA 1WC7B 1IGTB 5H37H 2VAJA 2E7CA 2XKSA 4EDXB 1WICA 2OSLA 4ZFZB 3E8UL 4PRNA 3M1BB 1CVSC 5DJAB 1J88A 1P4BL 1U8OB 2BNRD 4NN7C 5KVEH 2EKJA 4M8QB 1F5WA 4GMSL 4LCYB 3NCFB 4XP5H 1JK8A 1H0DA 3D0LA 1ZHLB 3K8MA 3QDMD 4QNPE 3IF1A 3DECA 5ACZA 1F4XH 1GSMA 4P5TA 1NBZA 4JQXA 3VXUD 3GEWB 3LV3B 4JN2A 5FA4B 3PGCA 3ZTJG 3LH2L 2W0LA 1QRNA 2VZTA 3HAEH 4UIMA 1CGSH 2OJZL 5DJDB 4X7SL 4QRRD 2CDEB 4NNPH 3VXNA 1EJOH 2H2PC 3BWUC 3GUTA 5I71B 4X0KB 1JZ8A 3JWOH 3HE7C 4KMTL 5CGTA 5F7WC 3PNWA 5T1KD 1EEYA 1GGTA 3QQ4A 1DLHA 3WKMH 4X4ME 1TZGL 2P24A 4BH8B 3KWWA 4U3HA 4OZ4B 3IRZA 4U1GB 4YO0A 5HGAA 1LWRA 4MX7B 3FO2A 5E8NA 4ZDHA 4CDGC 3MV9A 1VGEL 1Y0LA 2V9TA 4LIQH 3BKCL 4R6UA 5J89A 3KPMB 1DBKL 4FQLH 3T0EA 5IB5A 2EXWD 5DJYA 3S36L 3X14B 1G7JB 1JPTH 1FH5L 1LK2B 1K2DA 2CIIA 2DQHL 1ROWA 4JVPA 1ONQA 3CDYA 2FJFA 5DMGC 2HN7A 1MCPL 3GRWA 3BUTA 3N1FC 2WINA 4M7KL 4BQ8A 2F53B 3QFDA 4K07A 4JPKL 4Y5VA 2CLRB 1CD0A 4Q2ZA 4FTVD 1I7TB 3RDTC 4K2UL 3VDBA 3C8KA 3DARA 4LGRB 5DFVC 2FBOJ 2MQ0A 2VIRA 5DYOB 1OQOA 1NAML 2GJ6E 4Y16B 5JOPD 4Q0XL 3D39D 4FQJL 3SE3A 5C0EB 1XCQA 3JV0A 2CKBL 2LAGB 4NQVA 4QHNA 1T5WA 3ARGC 2OMNA 3IS0X 1MUJB 3HC4L 5CUSH 3L5WB 4G8FA 1ORQB 3BP6B 5DD3L 3T3PE 5EFIA 2Y5TA 4O2FA 1IGJA 1NC2D 3BXNA 3VXOB 3HI1A 3BIKA 4HW6A 5KG9A 1ZGLM 3NCJL 2I26N 1D5MB 2EIZB 2EDKA 3MRFA 5I1EL 2YRZA 5CJOH 2Y1VA 3ZDXF 1ZVHA 4JZJB 1CIDA 2F54E 1H3UA 1QA9B 1OARH 3H9SA 4YUEH 2YSSA 1C5CH 4U6YB 5D7LB 5GS0D 5C09A 5DK3A 2BNQD 1VENA 3QIWD 4KROB 2E6JA 1PEZA 4YC2C 3T77B 5FOBA 1NAKL 3TBTB 5HYSA 1EHXA 3QI9D 2ARJQ 4NCC1 3WXVH 5MERA 3JVGC 1WZLA 3OKKA 4WV1A 3TPKA 2I9LA 5BS0A 5DJ8B 3MBEB 2C26A 4QRPA 1OHQA 2HYMA 1NJ9B 1YN6A 3V0WL 3O2WL 3FB6B 4JM2B 4WFHE 5CEXB 4IOIB 5K9OB 2HTKD 3RTQB 1JE6A 1L9NA 2JK5B 5FUCC 1OQXA 4GRWF 1N26A 3PWPB 3T1WA 1CICD 4PLKC 2Y25A 3SOBL 1QFUH 1WSST 3VGHA 5JA8B 1SYSB 1UM5L 1HEZB 1D9KB 5EU6D 1LO5A 1SEBA 1YQVH 5DJ2A 5ENWB 5IW1B 3NFSH 2YXMA 1CDJA 4CVUA 4A6YH 1NCBL 4L4JA 2DLEA 1EBPA 1AGBA 1E4XL 3PWJB 1DVFD 5D1ZC 1CFNB 4GSDL 2QADB 2XQYK 4X7TA 1U8IA 3SHSA 2QQLL 2O5XH 5D1XC 4H5SA 2I24N 4NDMA 2OP4H 3ARQA 4J3UA 5DQJB 4ODWB 1MHHB 3MLZL 4RQQA 3KJ4B 4JO3L 4P59H 1NMBL 3JWDC 5E9DB 1H8SA 5JW4M 3VFUB 5JNYB 2YC1A 1EMTH 3HRZA 4XCCL 5CLTA 1KJ3L 3EGSA 5FKPA 1FZMB 2F8VA 2ZSVB 3STZA 2Z31B 1IGFH 5IHUL 2OZ4H 4WI8A 4P2OC 1A6WL 1P7QA 4Y5XB 4GRMA 2EIBA 4RWYL 1KJMA 4Y2DA 2IANB 1AFVL 3QCVH 1J5OH 4ZS7H 1NGPL 1J8HD 3WJJC 3NCYS 1UVQA 4LLUB 3GSNH 5J12B 4CN6A 5FM5O 3VE0B 3TJHD 4C56E 4U7SA 1REIA 2HLFD 3KDMA 2W1NA 5E99L 4NQXA 3RWHB 1IAIM 5BZWA 2VE6B 4QNPF 4R4FH 2WQ8A 1FBIH 5E0QA 4XPAH 2Z91A 1NGWA 4BFGA 3KVQA 4LCWE 4I0PA 3EDJA 3VGBA 1BFTA 5E08H 4WI4A 4YDVB 4NKDA 1IC7L 3IAPA 2BX5A 4H26B 4R9HA 3IJHB 2Q3ZA 5I66A 1Y18B 5DMIH 2NCMA 4YHMH 4QRUB 1OT1A 2DM4A 2F5AL 3QZWG 1IAOB 1BFVL 5EWIL 2VLJD 3FQRA 3RX7A 2H6PA 5DZOA 1DBML 1WZKA 4K7PH 2V2XB 1WTLA 3GMMB 5D7JA 3TM6A 1H3XA 1YMMD 2ZCHH 3NZHL 5DQDL 4R7NA 3FO0L 3ECBB 1J11A 3L5XH 1IEBA 4RFEA 4JQIL 2Y36H 3AREC 4Z7WE 5F1IA 4DTGL 4FZ8H 2ZUTA 2PR4L 3CFDB 3BN3B 3ZDZE 4Y4FA 1ZA3B 5L2KB 4P5TD 4F9LA 3PHOB 3QG6A 5IMKB 4LLVB 3UXFA 3KNBA 4HC1L 1R3KA 4LPTA 1CFVL 1QRND 2MJWA 5C8JB 5J56B 2P5WB 3RKPA 4OZIF 1J1PH 1QHPA 5FUCE 1ZSDB 4HT1L 4LQFH 3CFBB 3KLHD 2GQHA 4TSCH 4WUUB 3RWGB 4M5YL 5FYJH 5HHVL 2D9CA 2BZDA 5CBEA 4GW4A 4E9LA 1KNOB 3BUYB 4G9FB 4RFNC 3S5LB 3OKYA 5D2NA 1ZOXA 4ODBD 4P9HH 3S96A 4NJ9H 1GRWA 1AI1L 1XGRB 1LO4L 2JJSC 4GKZB 4K3DH 1CDBA 5DMYA 4QF1B 3MJ8A 1N2RB 4YXKH 2EKSB 2XFXB 4HGWB 3T3PF 4Z76B 3CVHA 2B4CL 3MV9D 4PJ7F 2ATPB 4XCYB 4J1UA 4YK4C 3MFFB 4HXBH 5EULV 3FQWB 3T0ED 3VMOA 2IFGA 3HPLB 3OKEA 1BX2B 1NCUA 5FA3B 4OM0H 4JPIA 2A38A 3LPFA 4TSBH 1FGNL 1G9NH 1P6AB 4WU7B 5T1MB 3GJFK 5I1AB 1EIBA 5I16A 4A2MA 5IROA 4D94A 3ULUL 3P73B 3BP5B 2IQAB 4UIKL 1L7IH 4WNQB 1UKTA 1NGQH 4ZD3H 3QNZB 2D4DA 1MH5A 4RRPA 3BPCA 1R0AH 3DHMA 1AO7E 1KCVL 1RFDH 1NKRA 3PGDB 3P4NB 5FO8A 4I0CC 1KBGH 3GMRB 4X9IA 1CXLA 4WU5B 1EO5A 3DIFA 3FN0H 2IADB 2WMPA 3BGMB 4MSWB 4MLSA 1KJ2B 3F7VA 1NC4A 3OKDB 2GTWB 1Q9OA 2EDEA 4NO2B 3UZVB 4U1LA 1T04B 2VQ1A 3VFRB 1N6QH 2HT4C 5IGXH 2JELL 4OZHB 3RZCA 3QEUB 4X80H 1ZT4B 4RDQG 4BJLA 1BREA 1Z9LA 1IKNC 2IH3B 3LB6D 4ELME 2APTA 3V4VH 1OAUH 4KTDH 2C3XA 3KPOB 3RHWF 4P2CG 3RGVB 1OD9A 4PJ9C 1ERNA 2CMRH 3AXLB 5C09D 1U95A 3ARDA 1XGUA 1JZ2A 3K74B 1GZPB 3DX8A 1H5BA 5CJQL 5DT1L 3MLRL 5SWZB 2FECL 1JGUL 2AJVH 4OV6F 1KB5B 1RJLB 4HJ0D 1JGEA 5CJ5A 1NLBH 4G8EA 5I1GH 4K8RC 3OHXB 1DN0B 5BS0D 2ICWB 1JVKA 4QRPD 4Z0XB 4HWNA 1PDKA 4ONFL 4W81A 3FQTB 1G7HB 4JG1H 5F7MC 4KI5E 4LASL 3P40A 1KSRA 4PJ5B 5IG7A 3FO9B 4ZS6C 2HFEB 2GK0A 5TGBA 4Y1AB 2DLTA 4OIBA 1QSEB 5DRXB 3LEXB 1DBBL 2HFGL 4FQXB 5CSZA 2ZCKH 1JNNL 4ODVL 4JREB 3ROLA 1I3UA 1H15A 2Z4QA 1J87A 5LXGL 4HBCL 4S2SA 5CSBA 2VAAA 3VWJB 3FCTB 3CZFA 4YBLC 2JJWA 3GK8L 4HIIB 3FRUA 5I30L 4L8CA 2GJJA 3EZJB 1CXIA 5FO7A 1JZ5A 5B4MC 5DURB 2MOVA 4NC2B 3UYRH 5EOQH 4JKKA 1IZJA 2CUHA 4PJGA 4PRAA 4PY8J 3VXME 2A1WL 3ZKMC 3T09A 3MNWA 3VI3E 1RUKL 5H2BA 1PJ9A 4N8VG 1OW0A 4HPOL 5EO9B 1HHHB 1ZANL 1FZJB 3OAUH 4TVPE 3N85H 4NO5B 1EHLH 1QNZL 1XGPA 3W0WD 2EE2A 4Z5RB 4HFUL 2ZOKB 5L0QC 1P7QD 3O3UN 2AGJL 4MA3A 4LLQB 4Y2DD 1C5DA 1FNFA 3SCMC 1LO3H 5IMMA 1SQ2N 5KSAC 2L7JA 3SO5A 4W68A 4Z7WF 5K9KA 2P48B 1JGDA 3L5IA 3SO3B 1Q0YL 1RVFH 3ZDZF 1QSEE 1A7OL 3HMWH 1DSFH 5CINH 1U8QB 4FQHB 3FFCE 4NYLB 5ADOL 1MCIA 3UTSE 3UJIH 4OB5L 4M93B 2X4QB 2Z8RA 1WIOA 4K3EH 1QP1A 4LVHB 1TLKA 4XX1E 4M48H 2FIKB 3B5HA 4FZEL 1X4ZA 5A2IH 4FFWC 2R2EA 4UV7L 3EJYD 5L8JB 2R1YA 3EDKA 3GGWB 3WNNA 3BO8B 4MNQD 3IKCA 2QSCL 4D9RD 3UTTA 1U91A 2R56H 4YXLH 3O2DL 1RZ7L 3BJLA 2ORBH 3O3AA 5D7JD 2VL5A 3G9VA 3X13A 3HN3A 2XWTB 5L88H 1PVHA 3EYVB 4DVBB 3ARFD 1INEL 5D71L 4U0RB 4MD5B 1NBYA 4FXLA 3QCTH 3ARSA 4TTGA 4M6MH 4MDJB 5JPMA 4GFTB 3BEVB 4HAFA 3T2PA 1B4JH 4Y4FD 5EBGA 1FG2B 3TN0B 3BP4B 3MNZA 4PY7B 3VGFA 1ZEAH 5T3ZE 8FABB 3MV7E 2VDRH 3QG7L 3T0XA 4RNRA 3TYFA 2YN3A 2BY3A 3ORJA 4QT5A 4QCIA 1CGUA 5FUZL 2ADFL 2D0GA 4OBSA 1G7IB 4Z95L 3GI8L 1I1FA 5DXWA 2C1PA 3H42L 3LZFH 4MVBD 5J6GA 2OJEB 1S7VA 1Z9SA 1TNMA 3L1OH 2WIIB 5E2JA 1DN2A 3RA7L 3RRQA 2UYLB 1AR1D 2LU7A 3DRQB 5JMOC 3ABZA 5JOFA 3MUY1 1I3GH 4LEOB 3CFCL 2NY3C 4IDJH 3IU4L 1PKQB 4FFYH 1QUNA 4Q6IB 5C08A 3AY4C 5BW7C 4S1SH 1NUGA 3UJTL 3SY0B 2X42A 3MV11 3JV5A 3U83A 3TV3L 2VLLB 2VZUA 3GSOA 4TQEH 4I48B 1JYNA 5E8DH 3E6FB 1UQSB 3MCLL 3RY5A 2WBJA 4IMLA 3P4MA 3TVMC 3ZYIA 5FO9B 5KSUA 1NFKA 2ZG3A 4L8BA 1I4FB 2BP3A 4XB8A 4P3WA 4U3XA 1WTGT 1K8DA 1XGTB 4OLEA 4KJPD 4EXPX 3FB8A 1PYWA 3WXWL 4P4KD 4ZFOB 1G7QA 1NDMA 3MJ9L 4HQQL 3BGAA 4ZXBA 4ELMF 3MRCB 3UBXG 1MREL 2YXFA 3O45B 4MZ2A 3QWQB 5BMFH 1QFPA 2DKMA 2MKLC 3GB7B 2GYSA 1MFAH 1TENA 1EFQA 4UT7H 3X3FH 3GBNH 3IJSB 4XI5C 1QD0A 1RV6X 3LS5L 3MRPB 4RMWA 4JLRA 4GG6A 3MYJB 4OAWA 3MJGX 2O5YH 3BKJH 3NCBB 4U1SA 1ZWIB 2GEEA 3QIBD 5E94A 1OOAA 1M4KA 4OD1L 2XN9B 3C2SA 4KJWD 4LPVA 3I3BA 4XWOD 3SDXA 4G8GE 3CX5K 2OL3B 3IU3B 4KQ3H 5BO1H 4KI5F 4BFIB 3A6CL 3G9AB 4PJBA 3QDHA 1U8NA 3KR3H 3G08B 1PKQE 4QKXB 4XNXL 2B8OT 3BHBA 4KHTH 1RHHB 2Y5EA 4YDJB 4CMMA 4NQCE 3RZCD 2MFNA 3PWNB 1QPXA 3FOMA 3STBA 3U1SL 1CDIA 1UEYA 1JN6B 5D5ME 3O2VH 1IAKB 5GGTA 1TMCB 4RCAA 2BC4B 4RAUA 3QXTA 5I1JH 3I50L 3ARDD 3U7WH 3L7FB 2CLVB 2HT3C 3ZYZA 2FYYA 5KBNC 5KN5B 1YY9C 2FJGA 3F62A 3MODH 3T1FA 3ULVH 5DQ9B 4CW1A 2GW5A 3I84A 2NZ9D 4Z7VA 2R0WL 4MJ2A 3HZMB 3GMPB 2I9TB 1OGAE 2O5ZL 5C0AE 3V5KB 3VI3F 1SEQL 3DV4A 3KYOB 1AJ7L 2APXA 3HMXA 3HNTH 3TPUA 2KUTA 5TQ0L 4ISVB 3KPLB 1RUPL 4X6BB 5C0GB 5BVJB 2NY6B 3QIUC 4I2XB 5AAWA 1FNGA 5F9OL 4P3DB 1UM4L 3VW3L 3MUZ1 1XF5B 2NXZC 4KKNA 1OGTA 2R2CA 3RAJH 1BBDL 1BD2D 4V2BA 3WFCL 1A22B 2N4IA 1G6RA 3JXAA 3FN3A 2XN9E 3AB0C 2X4OB 2EECA 1QG3A 4HXAL 3O8XB 3S4SB 5D4QA 4R2GC 4P2YA 5EB9A 2YRPA 4NT6A 1TQCC 3NN8B 3AC0A 1JHLH 3O3EA 4LFHD 4NO0A 5JUEH 1AGEB 4PBXA 2AJXL 4DKDC 3MRDA 4UTAH 4AM0B 4IDLA 1YPZB 3SE8L 3I02B 4GBXC 2ZUSA 3HAEB 4NO3A 2NY1C 1F2XK 1RMFH 5JR1L 1T66C 2RQ8A 1MFEH 3C60C 4BZYA 4J23A 2GHWB 3GIZL 4OF0A 1MLBA 4K9EL 1HHGA 1ZHBA 2EIEA 1G7PA 4YHZH 5KOVC 4R3SA 3NVQA 1VFAB 2XZCH 4CADB 4QEGA 5DK2A 1K6QL 3CCHB 2ZOLB 1A9EA 3D48R 3OKLB 5IF0A 2GSGB 3LEVH 4H88L 2NYYC 1T7ZA 5BV7H 4OLWH 4TULL 1MJUH 3CU7A 3ARYA 2Y07L 5BVPL 5L6YL 3GJFH 3L3IA 4WTXA 3B9DA 1KELH 2IWGA 2UVEA 4J2XA 4YXHH 3ES6A 3NFPA 3FQXA 2R0KL 3FB5B 4HG4J 5EU4A 4NQSA 4R4ND 5IBUB 3TWCL 3VG0H 1QO3A 2RBLA 3MNVA 4G6KL 1A3RL 1LILA 1JZ6A 2IBBA 2K3TA 4Q97A 3QUYC 1F4WH 2NTFB 3CFKA 1B4RA 1A47A 5GGVH 1XEDA 3MA9L 4V2CB 5C0BD 1S9XA 5F7EH 4NUGL 4OLXH 3FONB 2E6PA 2NY4B 2VXSL 3UTTD 5C9JB 4PFEA 3WFHB 5JHLL 1B6DA 3P9MB 1KIQA 4J4PD 1GJIA 3H7BA 2OQJB 2FRGP 1BEYL 4QRQA 1KJ2L 1CXHA 3KHQA 3LN4A 1DQML 4PUBH 2DL2A 2QQKL 1IKFH 2CSPA 3N0PB 5EU5B 4NGHH 1X5ZA 5K93A 3GSUB 5DHVH 2LVEA 3QJFB 4QTIH 1JHTA 5DUML 4XP9H 3H3KA 1ZT1A 4Y4HB 1T4KB 3GHEH 1NCCL 3IDNB 3BAEL 4JHAH 1WT5A 5J1TC 5HDQH 2JB5H 1QLRA 1EZVX 4FG6D 1JTOA 4QHKI 3O6MH 3BDYH 4L3EE 4CU7A 4M61A 5EU3A 4BSVA 3RWEA 4Q58C 1OTSD 4E42A 5EC2B 1EEZB 1MPAH 4CRPA 1MF2H 1DFBL 5SWSE 1KB5L 3GMQB 3BWAB 2OR9H 4RGMB 1VADB 3OWEA 5C08D 4PRDB 1U58B 2P42B 1M71B 3MV01 5F7FA 5HVWA 2FWOA 1U3HA 2X1OA 1U8HA 5HYJE 5FOJA 4XP4H 4Y4KD 1DEDA 5D7SL 4WEBL 3W82A 1QSFE 5MI0C 5KVDH 1RJCA 2CO7B 5IBTL 4PPTA 5HI3D 1JI1A 1NMAL 2UWEE 5FDWB 3GSRA 4ZXBD 4OT1H 4YHNB 1M7IA 1NEZB 1CZ8L 4A6YB 5D5MF 4I18C 1C08A 1FIEA 1NSNL 4HFWA 4PJHA 4LSTH 1VEOA 2AJSH 2EYSA 3MLYL 4WJ5B 4EUPA 2M26A 2DN7A 2WLZA 4XPHL 1CR9H 5ETUA 7FABL 1ND0A 1VEPA 4UV4L 4Z0BH 2X1XR 3Q1SL 2HFTA 1DEEA 2K1MA 1HSBB 2B1AL 2B2XL 4HF5H 4U1MB 1SJHA 4X7DC 4PJXE 1Q94B 3QXDA 4OGYL 4XMPL 1A14H 2XWBA 3ZTJH 2VITB 2QQNH 1G7MB 3V6ZA 3DTXA 1V7NH 5E2VL 5E1HB 4I3RL 3QYCA 1A7PL 2R2BA 4FQQA 1F4AA 4LSDA 4HK3J 5ACMA 5ICZB 5I1HH 5LQBL 2ZPKL 3DVNB 2FZ3B 3GSNB 4JY5L 2EZ0D 4G80A 4JAMA 1MCFA 2Z35B 3MSPA 1P7HL 4Q74A 4XAWL 3NIFE 1FZOB 3NA9L 5CD3A 3QUKB 3BH8B 1KEMH 3UPRB 4GRLA 2FBJH 3MBXH 3LS4H 4JCLA 1IC1A 1X5KA 2QSVA 2EXWC 5F9JA 1FFOA 3CSYA 1Z5LA 3V6BR 1GVIA 4AJ0A 2BSSA 3O11B 4FQ1H 4OIIL 1L0QA 1S9WA 1FIGH 2DLIA 1ZLUK 1JF1B 3LQZB 5B8CB 4O02L 2P4AB 1IMHC 2Q86B 4WI9A 1NAMA 3P4OA 4L4VB 4FXKB 4UNTA 2GFBA 2DAVA 2Q7NA 5B3JE 1J1XL 1GGIH 1MHEB 3BISA 1CXKA 1BVKB 4GKNA 3TLRA 4Y5YA 5CEZD 4R26H 3OJDA 1A02N 3EYOB 3HCVA 2ADIB 3IETB 1P9MC 2IFFL 3KYKH 4LGPB 1BAFH 3MREA 3D1MC 5E6IA 1CG9A 3P3YA 4LSQH 5GGUA 3VRJA 2DIBA 4L29B 5CHNB 5GIRB 3WEXB 5KW9L 3QUZC 1MCCA 3BH9B 1TQBC 3DGGB 2I5YH 1XCTB 5B38G 1OVZA 3ZHKA 1TDQA 3BKML 4ODUA 5C1MB 4JFDB 5EN2A 3HZVA 3GIVA 1RIVH 5DFTA 1GC1C 5LGHL 2JJTC 4PJCE 3P0YL 3W9DB 2FL5A 4KKLD 3SKMA 5GS0C 4H8WL 1AXIB 2YUVA 2H3NA 2GT9B 5D9SA 2XQBL 2X1PA 3HNSL 3IDXL 2OK0H 4YHYB 4OQTA 2O26U 2BNRE 3G5ZA 4IJ3B 5FCUL 1J1OH 1AGCA 3QI9C 5DVKA 5D8JH 4JJ5B 4ZPTA 4TNVF 1ZMYA 2V7HB 4LQ1A 3QDME 4MWFB 2W9EL 1FVEA 5HI5D 1I9IH 5FYLH 1FN4A 1E28A 3B6SB 4JFEA 4MQXC 4CBPA 1KF9B 4PJEA 1I8MA 5HYEA 3CSBA 4HGMA 1L7TH 4HSQA 4UUJA 2Z93B 2VR4A 1DQTA 3QO0B 2RFXB 2HTKC 2M8XA 2LU4A 3QPXH 3ARBB 4LCIL 4EDWH 1F00I 4QRRE 3SQOL 5E5MA 1FNSL 4ZFOL 1CICC 5DRNA 4AG4L 4P23A 2NY5H 3OG4B 1A6ZA 4OFKA 4ZAKB 3TBYB 3SKNB 4AT6B 5C3TA 3ZKXB 5IKCA 5AEAA 1H3WM 2J8UB 2FR4A 3K46A 2DQDH 1FL5A 1DVFC 3WE6B 1LD9B 1GHFL 4LFHG 1LK3H 3BD5A 1UB6B 3FHAA 4WENB 1ZGLB 3U46A 3MXVH 4C55A 4OM1H 3I6LD 3QUXC 2VLKA 3NACH 4LKCB 3U82B 4TUJB 3QIWB 4KDVA 5GGSB 5I1LB 1ZLSL 3H3PH 1FV1B 5HGHA 5F21B 1TPXB 5IMLA 2XT1B 5GZOD 2GITB 4G9DA 4MD4A 1CL7H 3DVFA 2H2SD 2D7PA 2VN4A 1UXWB 3S37L 3MRLB 5L9DL 1IQDB 2CIKB 4M1CD 1JJUA 4FTVE 2JJVA 1U92A 5D7IF 4L9LC 4XMKL 4WW2A 4M03A 2UWEF 4JFYA 4PV9A 4X5WA 5JOPE 5IVNA 3D39E 2VDOH 2V2TA 1OLLA 1T1YB 3IDYB 3TJHC 2R4SH 1WWBX 2HLFC 1SBBA 4ZOCA 4TNWF 1MLCB 3V7AE 4L8DB 4DVRH 3EYSL 3NABL 2VH5L 2Q8AH 4JHZA 2YPVL 5DEFB 2XTJD 4P2RA 5DHYB 1RSFA 3LQAC 4KZEL 3DLQR 5HHNB 3F58L 5GHWH 3SGKA 4PJXF 5EC1A 1GGYA 1MHPL 4S11A 4KJQD 4MB4A 3ZT7A 1U3HD 4BQBA 2J8UE 3TP4A 3B2UD 4POZD 2HJFA 1Q9WB 1MFNA 5HDBE 3WIIH 3LKRB 3FL7A 3QDGB 3RNKB 1H3PH 2BNQE 4ZOAA 3HZYB 4GG8A 1E0OB 3TH3T 5F96H 3W9EB 3ZKND 5KVEL 3THMH 1SJXA 3VFMA 4XP5L 4XCFL 4IIQA 2D3VA 2AXFA 4HS8H 3NIFF 4YFEA 1IGMH 5EZOH 4EQ3A 1F4XL 1AKJA 5IWLC 3UPCA 1D6VH 5KVFH 4IM8A 4P5TC 4X6EB 4YDKH 1NH6A 4OGZA 5CWSB 2JCCA 1D5BA 1L6XA 1CGSL 1MVUB 1GXEA 2HKHH 2ICWJ 4NNPL 5D96C 1EJOL 3N06B 1DL7H 3SDCA 2COQA 3RL1B 5FM4A 3JWOL 5GGQH 4G6JH 5I17B 3KLHC 4NQDA 2WLYA 5B3JF 1FYHB 5EBWA 3SJVA 5EU6E 4HKZA 4NN6C 3WKML 3PQYD 43C9B 5KSBE 5BXFA 3VFWA 3LD8B 4N8CH 1FQ9C 4D9QD 4YC2B 3MGAA 2DTMH 4G6ML 4MB5A 1YECH 1UH4A 1JF6A 5D93B 1V5JA 3LPWA 3HS0B 1TCRA 4WDIB 3NOIA 5DI8B 5IQ7H 4LIQL 4FQLL 4W6WB 1EUTA 3LIZH 4GRLD 4AMKH 1JPTL 5MEND 1BVZA 1E27B 3P77A 3T0EC 3MLSH 2OSLB 4DFHA 3HLAB 4PRNB 3UEZA 5TQ2H 2X10A 3DUSA 4ZNEE 1CQKA 1BF2A 1JK8B 2CQVA 1HQRA 1H0DB 2CD0A 5C3LD 1MJJA 4PJCF 3N1PC 3IF1B 4RZCA 5ACZB 2IALA 3H0TB 4XBGA 1R24B 1NBZB 4X6CA 3BDBA 3FFDA 1J8HE 3HUJA 3PWVB 3DI2B 4JN2B 4QXUH 1QRNB 1HKFA 3P0VH 5CUSL 4JRYB 2W9DH 3OKMA 4RGNC 4UIMB 4APQB 3VXNB 3GUTB 5E6ID 3VXSA 2EEBA 5J0BA 2YR3A 3TT1H 3PNWB 1BF8A 1UJ3A 4OF8A 1I7ZA 3QNYA 5KSVA 4U6XA 1EEYB 2ZCLH 3QQ4B 1DLHB 5HGBA 3QRGH 2Z92A 4OZFA 1SYVA 3VCLA 5CJOL 1KOAA 1OARL 4YUEL 3G6AA 3MMEA 5B39A 4PJIB 4YO0B 1ACZA 1C5CL 3GSVB 3FO2B 3MRRB 5E8NB 3MV9B 3HPJB 5F97E 3KPPA 1X6LA 25C8H 3TIDA 2VLJE 5IB5B 5DJYB 4BQ6A 4QHLB 4XPTH 1MFCL 2HVJB 4OCXH 3IFPA 1P4LA 2DQTH 2CIIB 4RDQF 1UCTA 5TFSH 1CL7I 3WXVL 3O4LB 2HN7B 2B0SH 2WINB 4GAJH 5HHPB 1DZBA 3CDGA 3RP1A 2NY2D 3MUJA 4WV1C 5AZ2H 3C8KB 1OP5K 1X4YA 3AROA 3MOBH 2VIRB 3NFNA 3FQUB 1F42A 1Z6JT 4JFED 3T08A 2GKIA 4ZNCD 4MXQD 1G9MH 2WSKA 3Q6GH 1T5WB 1QRNE 1T5XA 2GSIA 5DJAA 2A77L 1U8OA 2WQRA 5HHQB 1QFUL 4RIRB 3K80A 3BT2H 2AV1A 4XVTL 5EFIB 4O2FB 1IGJB 1YQVL 4RMRA 3P11H 4P23D 1V3LA 1ZHLA 4KRPB 1HE7A 3HI1B 3NFSL 5IT2H 4A6YL 1T2QH 4M6NH 1YJDC 2L4OA 1LO0H 3LV3A 1FCGA 3MRFB 5FA4A 3UO1H 1XIWA 5F1KC 2P5EB 3IFNH 3H9SB 1WK0A 2OP4L 5DJDA 2H9GA 3MV9E 2CDEA 4NFCA 1UB5B 4IRSC 2VLKD 5C09B 5CBAA 4P59L 4YDLB 4X0KA 3T0EE 2AXGB 3OR6A 1EMTL 5HGDB 1IGFL 1BHGA 5HYSB 3CDFA 2OZ4L 3GSWB 2J8UF 1W8NA 4DUWA 3I6KB 3G6DH 2CRZA 4CMHB 3OKKB 1DP0A 3QCVL 1J5OL 2HKFH 5E56A 2I9LB 4OZ4A 4PRIA 5HDBF 1GOFA 2CUMA 4MX7A 4QRPB 1SJEA 3GSNL 4Y2DC 2JKXA 1V7MH 1YN6B 1IL1B 3WN5B 3KPMA 3BZDA 4HIJB 3X14A 5F1NA 1LK2A 3CAFA 4R4FL 5J11C 1FBIL 1KFAH 4XPAL 5SV3A 1KTKE 5C71A 2ED7A 2K7QA 1LO5B 1SEBB 2CLRA 3KS0H 3L95B 1D6EA 5E08L 1GAFL 1I7TA 5E2TH 1T6WA 3PP4H 4P2RD 2FIRT 3U4AA 1JBJA 1ETZA 5DMIL 2E8YA 2ZG2A 4YHML 4EUPH 4KZDH 3K2UH 4X7TB 1U8IB 1VFUA 2IMNA 3EJYC 4UDUA 1CVRA 4ZUTA 4PR5B 3BIBX 1QFWH 3L5WA 5F8QC 5KSBF 4PJDA 4K7PL 1X5YA 1HH6A 3B2VH 2EC8A 3PDOB 2ZCHL 4RQQB 4Y0GA 5C09E 1NBVH 3MJ6A 3IS1X 1M6OA 2YC1B 5E00B 3HRZB 1WCQA 3ALXA 3L5XL 5FKPB 3WV0A 2Y36L 3STZB 1MCOH 2O93L 4NZRH 4FZ8L 5DD1H 3ARFC 3MUHL 1P7QB 2W60B 4R0LB 4GRMB 2J7LA 1AKJD 1KJMB 4PB0H 5EOCH 4J12A 3MGTB 4JO4H 5BS0E 5E6YA 3DV6B 4QRPE 4Y4FC 1UVQB 4U6YA 5D7LA 4B7IA 1BVLA 3DYMA 1KPRA 1J1PL 4V1DA 1L4IA 4U2YA 1WFUA 2GK2A 3KDMB 5T1LB 3T77A 5GGRA 4LQFL 5ISZD 5BZWB 4P46B 5E1AB 3TBTA 4TSCL 2L7UA 4MVBC 5FYJL 4OZGB 4B0MM 2DMBA 1FAKT 4NQDD 1MCPH 5DTFB 1WLHA 2FO4A 4OUOA 3SJVD 3C6LA 4I0PB 4NJ9L 3MBEA 4K2UH 5D2NC 5DMKB 4K3DL 4PGZA 5HTSA 4YXKL 5BV7B 4JM2A 1NGXB 3CXDH 1YNLH 2DICA 3BSZL 2X44D 3CX2A 3GJFB 3HR5B 4HXBL 4IOIA 5CEXA 5K9OA 5F89A 4HULB 2JK5A 3SDAB 3TT3H 3GMOA 1P5UA 3FQRB 3MRKA 2EDXA 2H6PB 4OCYH 1UJTA 4URTB 1NMCB 3AAZB 1SYSA 4R97B 4DKFL 4OM0L 3A67H 5CILH 4TSBL 1G9NL 3CLEH 3QAZB 3MJ9A 5GRUH 5EOTA 1CGVA 4R7NB 1FL3B 3U48A 4OFYD 1UYWH 4G42B 5I8EB 4P4KC 4MMXC 5CZVH 4RFEB 3NPSC 1J0JA 3AS0A 3QDJD 4LSPH 4Y89A 1CFTA 3W0WE 1L7IL 5MEPB 3DMMD 3GHBH 1NGQL 5MP6H 4OD3H 4ZD3L 3JTSB 1R0AL 2J5LC 1RFDL 5DQJA 1R3KB 1KBGL 4PTTB 5A3ID 3AS1A 4NCDA 1R3JB 3FN0L 1OD7A 1DDHB 1FZMA 4OLUH 2Z31A 1KV3A 3VXSD 1UADC 3D87B 3QIBC 5CBEB 4GW4B 4YBQD 4KJWC 4OQTH 4XWOC 2A6DA 1N6QL 3CK0H 4JVWA 1MCRA 5ALBH 4RAHA 5ID1A 2NLJB 3S96B 3LMJH 5IGXL 5I74C 1CN4A 4X80L 2R0ZH 2NY0C 5F8RC 3VE0A 2BRRH 3V4VL 3RZCC 1OAUL 2AP2A 4KTDL 4MNHB 4J1UB 3MRNA 5IM7A 2VE6A 3BRDA 4XBEH 1QTYT 4MNQE 2BXZA 2LU3A 5TF0A 2E9IA 2OYPA 4D9RE 3QEQA 3OKEB 4NBYB 1MI5B 2X09A 4YIQB 4O51A 2ZNXA 2AJVL 5F1OB 1H5BC 5I16B 1NLBL 4H26A 1S7RA 5I1GL 3IJHA 3VFVA 5IFAL 3GBMH 4QRUA 3NGBB 3BQUA 4F15C 2FCBA 4C58B 3G6JE 2VLRD 1IAOA 4JG1L 1MSPA 1MH5B 3U7AA 3BPCB 3GNMH 4OKDA 2V2XA 3GMMA 5FO8B 5M7QA 1Z0NA 3DIFB 2ZCKL 5AAMA 3C09C 3MLXH 2BNUB 4DZ8B 5ACLA 2EXYD 1YC8A 3F7VB 3GO1H 4YZFE 5K9QG 1NC4B 1EZVY 3CFDA 7CGTA 1S7SB 4FRWA 2VQ1B 5D2NE 5IMKA 4GMTH 4LLVA 3IJYB 3U0PA 3UYRL 1ZXQA 3FO1A 3OXSA 5KS9B 4OGAC 2VJXA 2WV3A 3JUZA 2P5WA 4AEHH 5C8JA 1DUZB 3RQ3A 3ETBF 5IB3B 3MJ7B 3M8OH 1O5DT 1U95B 3ARDB 5HPMA 3RWGA 4WUUA 1T7WA 3OAUL 3CXHJ 1NFDA 3N85L 1KNOA 1EHLL 4G9FA 1ZLVK 5DZNA 3S5LA 2VR5A 4HUWA 4BZ1H 3BPLB 1KXVC 2EO9A 1XGRA 1JGEB 1UZ8A 4GKZA 3VD5A 1RZKC 4QF1A 4G8EB 4LPUA 5EZIH 1N2RA 5J4MA 2EKSA 2XFXA 4HGWA 4ZFGH 3KLAA 1LO3L 4XCYA 3CVIH 4N68A 3LDBB 5C92A 3FQWA 5F9AC 3V0AC 2NY7H 1DBMH 4PJAE 3HPLA 5EH1A 2YN5A 2GK0B 5FA3A 5TGBB 1RVFL 1UM6H 4WU7A 4JGUA 3HMWL 1DSFL 5I1AA 1J9CT 2Y72A 4F80A 3RPKA 4NKQB 3SDDB 3ROLB 2F53D 5M94B 1H15B 3BP5A 1JMZA 2IQAA 2Z4QB 4CNIB 1IE5A 4K3EL 4K71B 1KLGA 1HXMB 2PR4H 2YUWA 4GKOA 1H9VA 4M48L 2MCG1 3RUGA 4PBVC 4B50A 4X6FA 5A2JH 2LVCA 3QNZA 3FRUB 3IFOA 3VGDA 1BWMA 2E7MA 3PGDA 3P4NA 4K94C 4OI8A 4PRAB 4PJGB 1P7KB 4YXLL 3S88H 3DURB 4KRNA 2EDHA 2IADA 3QPQC 3FRPA 2ORBL 2QHRH 4HWZA 4HZLA 1JL8A 4J3OC 3V4PH 3OKDA 5L88L 3C8DA 1EFXA 1NBQA 4J4PC 1P6FA 1TCMA 4UI2A 1T04A 1XGPB 3QCTL 3VGAB 3UTZB 5E70A 4M6ML 2DMKA 5IFJA 4LLDA 4OZHA 4NNYA 1B4JL 3ILPA 4MA3B 2WP3O 1C5DB 2RHEA 3QFJB 1ZEAL 2IH3A 1I1YB 5IEKB 2X7LB 1MWAA 5D7LD 3RGVA 3AXLA 5ANMA 3UBXI 3DX7A 2ILLA 4QOKB 4KROD 2AV7A 3LZFL 1JGDB 4JDZB 1T22A 3CSGA 3E2HC 5SWZA 4MS8C 1FGNH 3FMGH 4F7TA 5M95B 1KB5A 1OP5H 4FG6C 4M02A 1BD2E 1I3GL 5F6IC 4IDJL 1OTSC 5J6HB 4LHQB 4FFYL 1X5HA 4S1SL 4KY1H 3MBED 4JO1H 2QR0A 4Z0XA 3FQTA 3SPVB 1G7HA 4QLRA 5I73B 5E8DL 5DO2D 3WMSA 2R2EB 4JM2D 4CVXA 2CDGA 1LEKB 3E1F1 2R1YB 3MYZA 3FO9A 2CDFA 1T7XA 1I3VA 4Y1AA 2C1OA 1UC6A 3IKCB 1QQDB 4PJGE 3UTTB 1U91B 3LEXA 3PWPD 4N9GA 2FEEL 4FQXA 4Y4KC 5E8PB 5EZJB 2VL5B 4FFZH 4KKAC 5C9KA 3RVTC 4YHOH 3V6OC 5D7KD 5HI3C 3STLA 2W0KA 4PRBB 3VWJA 1HINL 1RZJC 4PYGA 4ZXBC 1NBYB 3B9VA 4HIIA 1LEIA 5HJ3A 2NXZB 2WBWB 2QLVB 4Z7UB 5JPMB 4WCYH 1MFAL 2QADD 4UT7L 3PIQA 1JZ7A 3X3FL 3GBNL 3O3BB 4GAGH 2APBA 3MNZB 5EUKB 4UDTB 2WIMA 1HILB 3F12A 4JFPA 2B1HH 3PDDA 4M4RA 4LDLB 2EH8H 4L8SC 5F9WB 2O5YL 5E9DD 1I1FB 1MNUH 1FZJA 2C1PB 2WUCH 3NIGE 1WFNA 1S7VB 4NO5A 3BVNB 2Z31D 2IC2A 3UAJC 3G6JF 1F2QA 2WWKT 2ZOKA 4KQ3L 4IEFB 5BO1L 4NBZB 2A2QT 4NP4H 5JOFB 4XBPA 2IAND 1CFQA 1CLYH 3KR3L 5I6XC 3WIHA 5C08B 4KHTL 1Y6MR 4XP1H 2IGFH 1ACYH 5D72H 1LE5A 4GJTB 3GSOB 2V5RA 5FYKH 5CFHA 4P5MA 2DJUA 4I4WA 2EZ0C 3O2VL 2WBJB 4IMLB 4YZFF 3P4MB 4WUKH 3S98A 5C0BE 5I1JL 5KSUB 5CP3A 3MO1A 2FGWH 2VDNH 3U7WL 5GQBA 1U8QA 3UTTE 4FQHA 4Z8FH 3QEQD 4NYLA 3MODL 1PW3A 3ULVL 1FJ1A 1IM9A 1Q0XH 3L5HA 5DGQA 1I8LC 4PB9H 3FB8B 3QHFL 1PYWB 2DWDB 3HG1A 2X4QA 4DZBA 1G7QB 3BIAX 1K3ZA 3I6GA 3D9AH 1S7TB 3HNTL 2MMXA 3BQUD 5I76B 4RMSA 4OI7A 1MCEA 3BO8A 3OKNA 1SY6A 4BQ9A 1JNJA 1F3DH 2BVYA 3MUGB 4GG6B 1T3FB 4ODSH 2YD9A 3PGFH 5E4IA 3RAJL 1GOGA 4U1SB 5DD0H 4GLRI 3TA3B 3ZHLA 4MD5A 3SDXB 2UZYB 3VRIB 3VMPA 2CH8A 4MNGA 4MDJA 5FUOH 4M7LH 3MRIB 5IK3B 5L2KD 4PJAF 1U8NB 1JHLL 3QHTC 1FORH 4UU9B 4PY7A 5IJVA 4XZUB 5C08E 4C4KO 5JUEL 4UTAL 3S35H 1BOGA 3KXFA 1QBLH 2E9WA 2P5WD 3GM0A 1G7IA 2HJLB 4EEEA 3VDCA 1DANU 1RMFL 2OJEA 4RAUB 4PD4J 1MFEL 4WWKA 2WIIA 3DXAB 4WUUD 2UYLA 4KKLC 2FYYB 1HHKB 3TO4B 2EO1A 1JCKA 4YHZL 3DRQA 2FJGB 4G9FD 1NLDH 1UWXK 4LEOA 2PYEA 4CW1B 2XZCL 1X44A 2AJ3A 3P9LA 1S7QB 5TE7H 2LAAA 3SY0A 4TUKH 2DLGA 4KTYA 2VLLA 4FN0A 3DV4B 5HYQB 3E6FA 1UQSA 3LEVL 5ESQA 3OXRA 4OLWL 5BV7L 2VSCA 1MJUL 3RVXD 5HI5C 5FO9A 3RVWD 5JLZA 1KCKA 1QR1A 2OXGA 4GS7C 5I1DA 1KELL 2AK4A 1XGTA 4JM4H 4YXHL 3IGAA 2NXYB 4S1DD 4GG6E 4ZFOA 1DR9A 1OGTB 4UINH 5GJTH 4JRWA 3VG0L 3OGOE 1RK1A 5FKAA 1YZZA 3SDXE 1NPUA 4UQ3A 3MRCA 1F4WL 3DPBA 1BIIB 1WWCA 5FCSH 3GB7A 4PRHA 4Q9RH 4PJBE 5AUMB 4X99A 4NHUA 3V8OA 4ODXA 5GGVL 3N1GC 4NO0B 5KANG 3VMNA 3MRDB 3H9ZA 1PSKL 3I75A 5F7EL 5ICYA 3MRPA 4M1DH 1ES0A 4OLXL 2EE6A 4NO3B 2QKIB 5GJSH 1N6UA 3RL2B 3NCMA 1KEGH 1ZWIA 3H42H 3REWB 5K33A 5IJKA 5L8LB 4WHYH 1MQ8A 4HMCA 1EFXD 3IU3A 1HHGB 1MRFH 4RISH 4BFIA 4R3SB 5IP4A 4PUBL 5A2LH 3IU4H 5DK2B 1IKFL 4Z7VE 2H2SC 5CMAA 4NGHL 1PG7H 4YDJA 2WM0A 4UMGA 2LABA 1A9EB 5CZXD 4N0UA 4QTIL 5IF0B 4FFVD 4M1CC 1J0IA 4F2MB 2IG2H 4XP9L 3OB0K 4W4OA 3MCLH 5F9DC 5FEBA 3GJEA 1IAKA 1ZVYA 4HX1A 4JCMA 1EXUA 3GHEL 3RGVD 1DCLA 3L7FA 3P2TA 4JHAL 5CEZE 5HDQL 3WNLA 2JB5L 5KN5A 2E27H 3FQXB 5DQ9A 3O6ML 3BDYL 5SWZD 3WXWH 2D03H 5EU4B 3MJ9H 1MPAL 1MF2L 4NQSB 1QO3B 2QL1A 2R29H 3MNVB 2OR9L 4S10A 1S9YB 1WBXB 1QLFA 4XXCC 1XF4A 5DJ6B 2FHFA 2XTJC 3CFKB 5ESAB 2IAMB 2LTQB 3FAXA 3KPLA 4KVCH 5CJXA 3NIGF 4X6BA 1QVOB 4M8VA 5C0GA 4ZOEA 4I2XA 4PJ5D 4KJQC 3Q2CA 2J88H 1MAJA 1U3HC 4XP4L 1S9XB 4Y1AD 1FSKB 3B2UC 4POZC 3CUPA 2ZUQB 1DBAH 4FQXD 5KVDL 2D2OA 4Q9BA 3V7MA 3VXTA 3O81A 4LVNB 4QRQB 5EG6C 4OT1L 1KPVA 3ZKNC 3VWJD 4PLNC 4N5UA 3TCXA 4LSTL 5BQ7A 1GYAA 2AJSL 1FL6A 1AGEA 4UT9H 5DURD 2CXGA 5BRZA 4AM0A 4F33A 1I1AA 1CR9L 2YPLA 1KT2A 1JHTB 3F5WA 3HAEA 2BSED 1TXKA 2M2DA 4Z0BL 2P8MA 2P7TA 1ZLVH 3B5GA 1AC0A 4PTUB 3O9WC 1FHGA 4HF5L 4TUOB 2M1KA 3MLVL 4OF6A 1A14L 1VFBB 5DRWB 5IHZA 2QQNL 5DLMH 5EDXA 1VFAA 5JXEA 4M61B 5EU3B 3RWEB 4NQUA 1V7NL 3SGEH 1FYTA 2ZOLA 3HZKB 3OKLA 1BM3H 2GSGA 3RIAF 5I1HL 1JFQH 4YAQB 2J1KA 5ELIA 3O6FA 1BLNB 2X1WL 1U8HB 1JPSH 4GUPB 4U6TA 1KEML 1VCAA 2FBJL 3MBXL 3LS4L 1OAYH 3IXTB 3FB5A 2GI7A 2Y4SA 3I6LE 2X9XA 5J13C 4OF7A 4MJ4A 1IM9D 4G43A 5IFHH 2UY6A 3HG1D 3DUUA 4FQ1L 4XPBL 4NFDA 3GSRB 4YDIH 3MRGA 1FIGL 1ORSA 3PWLA 5AZEH 2ARJA 4HFWB 3BD4A 2C4XA 2YWYA 4PJHB 4MD0B 4QHKJ 3RX8A 4KJYB 5HHMB 4EUPB 2XXCB 3FB7B 1WEJH 1GGIL 3J8F7 5ECJE 4E41A 2FD6H 3OF6A 1DQQB 4R26L 5EO1B 5C9JA 3NIDF 2KQMA 5D6DA 3P9MA 3KYKL 4Y5YC 5TPWH 1GGBH 1JUFA 2OQJA 1BAFL 2HP4A 2PO6A 1P84K 1NCDH 4AIOA 2X05A 4K9EH 4LSQL 4CKVX 2VYRE 1FVCA 4ZUWA 1PG7W 3DTXB 1S9VA 4IRJC 5FDYA 4ONHB 3TN0D 2I5YL 5E24E 1WF5A 3TH2T 2X4RA 4U6HA 4Y4HA 3F65A 1I75A 2RIKA 4UZGA 2XIDA 1RIVL 5JPNB 3T8XA 3TNNB 5CKGA 2R2HA 5CD3B 2OM5A 1J0YA 4GRLB 4WWKD 4QHUB 5C0DA 3U6RB 4PJBF 5EC2A 4DCQB 2OK0L 5E7FA 5F9JB 1FFOB 1J1OL 1Z5LB 1A3RH 2BSSB 3OX8A 5D8JL 1U58A 3IKKA 3E6HA 1S9WB 2DDQH 1M71A 4KDTA 1NAMB 4PJHE 3CC5B 2NY2C 3IAQA 1I9IL 5FYLL 4TN9A 4NM8H 2GFBB 1L7TL 4XHJD 3VJ6A 4GKNB 2MPAH 5C86A 3C5ZA 3GMLB 4MXQC 3HCVB 1XR9A 5JHLH 4Z7VF 4AZ8A 2R9HD 3QPXL 4XNYH 4EDWL 3TNMB 3CFJA 3MREB 5E6IB 4DK3A 1NEZA 1J8KA 3F6LA 4A6YA 1S7UA 2LFGA 2NY5L 5GGUB 1CGTA 5C7XH 4P23C 4WJ5A 1BGXH 2E9BA 4MGXA 4PRHD 3AS2A 1IGYA 4D9QE 3CDCA 3V52H 2DQDL 3UTQA 4ODUB 2X4TA 3LSOA 2A6JA 1LK3L 3TJEH 3HZVB 1IC4H 4NHCH 2EE9A 1MWAH 3JSSA 3MXVL 1HSBA 1NCCH 4OM1L 4LL9A 1FP5A 3NACL 2Z0BA 4U1MA 4CVZB 4ZFFB 4HH8A 4N0FA 3H3PL 2VITA 1FVDB 5MENE 1G7MA 3VD9A 2OZ4A 4OKVA 1YC7A 4QRSA 4FQ2H 1CL7L 1DFBH 1EDQA 3G5ZB 2VABB 1IGIH 2FZ3A 3GSNA 1KN4H 3TYGH 2ITCA 2Z35A 3DO3A 4EI5B 1FVEB 1OLZA 1NCNA 1JF5A 4PG9A 2B5IB 4XAKD 1FZOA 4LSSH 1E28B 2VDOL 1SMAA 1Z3GH 3O0RH 4Y8AA 2R4SL 4XB7A 2CR6A 2OTUA 5HBBA 1T89A 1TNNA 3VFPA 4DVRL 3O11A 2W65B 5HDLA 2Q8AL 1JF1A 1UGNA 3LQZA 4WI2A 2Q86A 3IT8D 5GHWL 3LRGA 3HE6A 5IKCB 2JF1A 4HKXB 2D7OA 3VH8A 4M7ZB 2OX5A 5HXMA 3ZZ1A 1X6NA 2FR4B 2NY6D 2YA2A 3BPOC 3MC0A 4EN3B 3EYOA 3HRPA 2ADIA 3VI4E 4JZOA 3IETA 3U46B 1NDGA 3WIIL 4HUMB 1H3PL 4PGDA 4R90H 3KYAA 1OTUC 4GH7B 2ERJB 1NQBA 5F96L 1PLGH 1QPPA 3UDWA 3O8XD 3THML 5IMLB 4FMKA 2YWZA 1YEEH 4MD4B 4G9DB 5CHNA 5GIRA 5LG1A 1IGML 5EZOL 4I3RH 2L0DA 3BEWA 5D1QA 1XCTA 1D6VL 5KVFL 3LCYA 3WIHH 4EBQH 4OGXH 4GQ9H 4JFDA 5DWUH 5BRZD 3WL9A 1I1AD 4OZIA 3OJVC 1BPVA 4YDKL 4NKOB 1ZE3C 3LHPH 4PV9B 4JFYB 4G7VH 4F9PA 4JFEE 2V2TB 2HKHL 4PJEE 4BKLB 2GJ6A 2YOCA 1B90A 1DL7L 4N1CA 5CP3H 1E4KC 4LAQH 5GGQL 4G6JL 3PABB 3KLDA 1WBZB 2WNGA 5JXED 5JOEA 2IPUG 2AJUL 3KPNA 4JJ5A 3NCEB 3GMNB 4X8JB 4N8CL 1FYTD 2V7HA 1UKQA 5FHBL 3EHBD 2DTML 4PJ7A 1YECL 4LCCB 3B6SA 5EC1B 2XRAH 3MRQA 3O6FD 1G9EA 5IQ7L 3PV7A 2Y06H 5DMJB 1NANH 1SY6H 3EYQD 3LIZL 2X4SA 4AMKL 3QO0A 2RFXA 2HJFB 1KLFA 3ARBA 2PXYA 1BFSA 3MLSL 2VLKE 1C12A 1B0WA 4KUZH 5GZND 4ALAH 3WD5H 5HSFA 3TBYA 3VFMB 5T3XL 1FFRA 1R3HA 3DVGB 4IIQB 1R6VA 4OSUH 3SKNA 4KK5D 4AT6A 4TOYH 4JE4B 3ULUC 4HMDA 3MV8A 1IJ9A 3VFTB 1AKJB 2R39A 4K3HA 3DMMC 3WE6A 1LD9A 5FECA 4E41D 1UB6A 4QXUL 4H0HB 3OF6D 2G75A 4MJIB 2JCCB 1W72L 3P0VL 3VA6A 4TUJA 2W9DL 5GGSA 4AQOA 5EBMA 1FV1A 2ZWLT 4HJGB 4ONOA 1MVFA 5A3IC 4H1LA 3SDCB 2KQNA 1FLRH 1T7YA 3TT1L 2PYFA 3EKCA 3EJZD 1INQA 2H32A 4LLYB 4XP6H 1Y6NR 5ILTH 1IQDA 2ZCLL 3OB0H 2KBGA 2CO6B 4HKZB 4YBQC 3QRGL 1HCFX 1UJ3C 5ID0A 5BXFB 4YX2H 3HE7A 2F8OA 1AR2A 4P2RE 1BIHA 4MAYB 4Z6AT 3IFLH 4RAVB 3WLBA 2A73B 4Y4HD 3EIFA 2JTDA 1AY1H 1TCRB 4WGVB 1T1YA 25C8L 5AYQA 3KPRA 4XPTL 4OCXL 1MLCA 2CK2A 3P77B 1CD8A 2DQTL 3AS3A 5F70A 3TBVA 3CH1B 5JW5A 2B0SL 3DUSB 5DHYA 4GAJL 5HHNA 5F93C 1MHCB 5KVMC 3SE4A 5AZ2L 3FHQA 3MOBL 1AHWB 3DX9A 1ZHNB 3BPNB 4X6CB 3FFDB 3HUJB 3RDTA 1Q9WA 1G9ML 3RIFF 1AC6A 1T1WB 3Q6GL 3QDGA 5JXAL 1G0XA 2JCCE 3M07A 4L9DA 2GCYA 3OKMB 1RAMA 3BRFA 2WUBH 3W9EA 2OBGA 1JPFA 5HDOA 5ISZE 3BT2L 2G5BB 1KN2H 2FX9L 3MTRA 3VD7A 5DDHA 4C56A 2BSRA 1EO8H 1T1XA 3VXSB 3P11L 4CUCA 4NQDE 5IT2L 3S37H 1T2QL 1MCKA 4U6XB 4M6NL 1U3YA 3SJVE 1LO0L 4FQPA 1U3ZA 3VCLB 1F4YH 4LCWA 1HNGA 1PGRB 2VISB 3O4OB 3UO1L 3NZ8A 3IFNL 1XAUA 5CWSA 3WKNA 3BN9D 3MMEB 2H1PH 1B0GB 4JANB 1ULVA 3V2AR 1J12A 2VR9A 3TIDB 5L7XH 3UJJH 1R5VA 3IFPB 1AD0A 5I71C 1T2XA 3FQNA 1WWAX 3AUVA 3G6DL 2V5MA 5AG9A 3MLTB 3VI4F 5E2WH 2HKFL 1MY7A 1WZ1H 4M3JA 1UZ6E 1S7WA 4PRPA 5JQ6H 1ZA6A 4WDIA 1V7ML 3NFNB 3ZE2E 3JVGA 4U1GC 4WEUD 4LU5H 3U2SA 4X6CE 1XF3B 5MEQB 2IQ9H 2EDQA 1E27A 1F58H 2GUOA 1T5XB 3HLAA 3D3VA 5EIQA 2GSIB 1CWVA 1KFAL 4OBRA 1WFTA 4ZO9A 2AV1B 4XCFH 1A5FL 3VXSE 2KPNA 2QSQA 4X4XB 1CD1A 4X6DF 5E2TL 3RNQA 3PP4L 3V4UL 1V3JA 3CH8A 3H0TA 4L4VD 2EEDA 4C83B 1RI8A 4PJEF 1R24A 1H3GA 3HE6D 1CLZH 3PWVA 4KZDL 5IB1B 2YHGA 1W8OA 4Y16C 5GSVB 1XIWB 3K2UL 4HS3B 1LDSA 1NANI 2BVQA 4JRYA 4KMQA 1XT5A 1QFWL 4APQA 1YEDA 3B2VL 2H9GB 1AE6L 1IILE 3FT2B 4GOSA 5J06A 5CBAB 1L0YA 1NBVL 1LP9B 3VFOA 3WHXB 1YY8B 3PF2A 2EC9U 3OR6B 4XGZA 1E6JH 4XXDA 5D1XA 5IIEA 2J5LB 1YMHA 4PP2B 2GAZA 4M1GH 1MCOL 3KG5A 4NZRL 1HI6B 2I07A 3U9UB 5DD1L 5HVHB 3U9PH 5D1QD 2VZSA 4PB0L 2VSDA 4G6MH 5EOCL 3WHE0 2OI9B 4JO4L 5GRVL 4PRIB 4PJIA 4JFDD 3GSVA 4JZJC 1SJEB 3MRRA 2DQFB 4DAGH 3HPJA 4P2OA 5DJ0B 1J10A 2VLRE 1OCWH 2E9JA 2AW2A 1IT9H 4QHLA 5F1NB 2R1WB 2HVJA 5B38B 4QO1A 5TH2B 2DIJA 4H20H 4KROC 5FYJD 1JWMB 3OGCB 4JY4A 5LBSH 3O4LA 4JFOB 2KZ1B 4DEPB 4NC0B 1T7VA 2X9WA 5HHPA 2AQ3A 1D6EB 1IC5H 4WW2F 2VDLH 1R3IH 5FFLA 4ZO6A 5E8EA 4IHOA 3MBEC 3FQUA 1ETZB 3K1KC 4BH7A 2P47B 4E0RA 3CXDL 5GS3A 1YNLL 3OR7A 2H8PB 5DO2C 4JM2C 1VA9A 5CIPA 3TT3L 4UDUB 4ZUTB 1CDHA 4NCC2 4BZ2H 1CI5A 5H37G 4HAGA 4OCYL 5T5NF 1A6UH 4PJDB 4KWUA 4DN3H 3RTQC 5HHQA 3ARBD 1HH6B 5FGBC 4LMQE 4RIRA 2Q76B 2PXYD 3A67L 5CILL 3CLEL 5GRUL 1M6OB 1D9KC 1UYWL 4ZAKD 5CZVL 4LSPL 1QHOA 4YGAB 3WFDH 3S4SG 2FO1A 1JPGB 5EUOB 3MV8D 3GHBL 1MJ8H 5MP6L 4OD3L 3AM8A 2QSTA 2P5EA 3NPZB 4PGBA 3CFEB 2QADC 3CSPA 1CT8B 1UB5A 1BVLB 3TBSB 1KPRB 4V1DB 4BA8A 3TESA 4HWBA 2AXGA 4U2ZA 1XF2A 1MFCH 4HUKB 5GGRB 3KJ4C 1TVBA 5HGDA 3WIFA 2N7BA 2OS7A 3RVUC 3FAWA 3NH7L 4OLUL 3QDAA 5C6TH 3DO7A 3OQ3B 3GSWA 5TDOA 5SX4I 1X5GA 3I6KA 4KRMB 2Z31C 2R0LH 4OQTL 3T0DA 2FO4B 3C6LB 2F53E 3CK0L 2H2PD 5ALBL 2X4PA 2QEJA 3LMJL 4Y5XC 1G6VK 3HI6H 2JCCF 2VLMD 3G04B 3HE7D 3EAKA 2Q3AA 2R0ZL 5K9QI 4KH2A 4TTDD 1IL1A 3SE9H 3WN5A 1T0MA 2BRRL 2NW3A 4LAJH 2FATH 5J12C 4HIJA 2A83B 4MA8H 3EFDH 4JFHD 4GRWH 2JJSA 2KH2B 3O3DA 4XBEL 5F89B 4MA7H 3KPRD 3GMOB 2A77H 3K7UA 3MRKB 4DWHA 4JN1H 1TJGH 4PJDE 4HIHB 3ALPA 3TIEB 4XVTH 5F7KC 3RWCA 3VXMA 5EOTB 3QQ9D 3L95A 1G1YA 3HA0A 5T33H 1EHNA 4QYOB 4U7MA 5IBUG 5F7LB 1ADQH 2JIXB 2BVEA 1CFTB 3GBML 3V5DA 5DMGD 3ULSB 4D3CH 1F3JA 3Q48A 3EZ8A 4PR5A 2BXYA 3GNML 1YEIH 3RDTD 4PY8I 1MIMH 1A4JA 5I75B 5D7LE 4PJFA 3PDOA 3QDGD 5EIIA 5C0IA 3ULUF 5LWYH 4WIQA 5E00A 1RUQH 1XFPA 3MLXL 1UZ6F 3G5VB 3PXJA 2MSPA 1T21B 3GO1L 3ZE2F 4OCWH 2D4FA 2W60A 1U93B 4R0LA 1T2JA 2A6DB 3JWNC 2NX5B 3MGTA 5ID1B 4F7MA 2XZQH 4GMTL 4NQEB 1I85A 3DV6A 5HHXH 4I8DA 2AKRA 3H6JA 3UTPD 1A7RH 1KGCD 3BZFB 1WZMA 5C0JA 5L2JA 4AEHL 1K9TA 3FOLA 2XZAH 5T1LA 5LGJB 1PFCA 4I13B 3MRNB 5IM7B 3M8OL 4P46A 5E1AA 3SGDI 1N5AB 4OZGA 3PWPE 5DTFA 3QEQB 2W59A 1JNHA 3P0GB 4LNRA 3DHJA 4O51B 4PJ9A 4BZ1L 5E8OB 1GAFH 1P53A 5D7KE 5FF6B 5DMKA 1U8LA 1S7RB 5I9QB 3WO4B 1PQZB 5EZIL 3B9KB 3VFVB 1F6FB 1S7XA 2A9NH 4ZFGL 3T0BA 4HK0A 4PRPD 1NGXA 2RCSH 3BQUB 4ZYKA 2EDNA 3CVIL 4Z78A 3GJFA 3HR5A 1GZQB 4DK6A 3SDAA 3MOQA 2NY7L 2E7BA 5F6HJ 3RVWC 3AAZA 1FO0A 1UM6L 3D3VD 4JFFB 3QHZH 2HTLD 1FL3A 5E9DE 3ILQD 4WTZG 4G8IA 4S1DC 4G42A 5I8EA 2VRAA 4UBDC 4Z7OE 5MEPA 5FGRA 2IANE 3JTSA 2ESVA 4LBEA 3ZSSA 4JKLA 1YEFH 3GSQA 3U0PB 4KI5C 3FO1B 2DRUA 3OXSB 4PTTA 2BVUA 4JRYD 2X40A 3RU8H 3S88L 1R3JA 1KULA 32C2B 1SMOA 3ZYJA 4APQD 4XVUD 3UYOD 1U8KA 2QHRL 1DDHA 3PUCA 5JO5B 5HPMB 3V4PL 1QZ1A 1CTOA 2V5SA 5D1XD 1A6VH 3AFLA 3PP3K 1NFDB 5F7UA 4Y8DC 3QEQE 1YNTA 4MXVE 3VRLE 4HUWB 1HOCB 3L9RB 2NLJA 1AIFB 3GZKA 3HC3L 5DHVA 2YD8A 1YYLH 1UZ8B 1GIGH 4ZTOH 2JLLA 5IBLD 1PX3A 4QXTB 3ZT6A 3KLAB 4MNHA 3KS0J 5CD5D 3BSZH 1T6VN 4FFVC 4G6AD 3SBWA 2P45B 1KJVA 2YD3A 5KVGH 4JDVA 2PN5A 3RGVC 3QBTB 2DBLH 1RURH 3SCMA 4DKFH 1MI5A 2XNAB 3FZUC 4YIQA 5KSAA 2F15A 4G3YH 3FMGL 5IV2B 3O4LD 5CGYD 4NZDA 1KCRH 1WQVT 3U0TA 4S0TD 4PG2C 2V5YA 2FX8H 4KY1L 3U7YH 4JO1L 1KLGB 3JZ7A 2UZXB 3WS3B 3RUGB 4DW2H 4X6FB 1JYXA 5L2KE 2D0FA 3OKOA 3HFMH 4FXGA 3IFOB 1S5IH 4EI6B 3BZEB 3A6BH 1WVZA 3BZ4A 2P5WE 3WDHA 5EOCJ 12E8H 4K23L 3UP1A 2HG5A 2BNUA 4HWZB 4DZ8A 4FFZL 4HZLB 5EORH 4M43H 4FQXC 4H1LH 5D5MA 4WUUE 4YHOL 4JREC 3MGOB 4KRPD 1N59B 1EFXB 2VUYA 5CEYA 1S7SA 4G9FE 2H32H 5TF1H 4MCZB 5E5RB 2KKQA 3VWJC 5IFJB 4LLDB 1V3KA 3IJYA 1BFOA 4WCYL 4NNYB 4R4BA 4JKWA 3ILPB 1EBAA 2P5ED 4GAGL 4YHPB 4EIGB 3H9SD 5KS9A 3MCG1 1DUZA 5EPMA 2B1HL 5IB3A 1E6OH 1MWAB 3Q6FB 3MJ7A 2EH8L 4XCNA 5C0AA 5ANMB 3DX7B 3SEPA 1MNUL 2AV7B 3G5XB 5KAQG 2WUCL 2PW2A 1T22B 1A6AA 4F7TB 1AXTH 4P9MH 4NP4L 5EIVA 2BOCA 1RZIB 4RBPK 1CLYL 4XTRD 5IFAH 2DMCA 2XZZA 3UTOA 2A0LD 4J6RH 1EHAA 2QR0B 4XP1L 2IGFL 1L9MA 3VWKC 1ACYL 5D72L 4K7FA 1OF2B 5FYKL 3TEUA 2PF6A 3KYNA 4CVXB 2CDGB 4W6YB 5BW7A 4WUKL 2CDFB 2EDTA 4N0RA 2C1OB 2FGWL 2VDNL 4NKIH 4PJ8B 3D85B 3SO3C 4Z8FL 2ZSWB 4N9GB 3ULVD 3SDDA 1Q0XL 4WI5A 4PB9L 4P4RA 3V7AG 4CNIA 3Q3GB 1KTDB 4OTXH 3STLB 1I7UB 1HXMA 3LKQA 1RUMH 4M93C 2FSEA 4JM2F 2P8PA 1OTTD 5FB8A 1BZ7B 4YWGH 3D9AL 1LEIB 5HJ3B 4LVHC 5C6PB 4OZHE 4LPCA 1RUAH 2FECI 4ZUVA 3PIQB 3MA7B 4S1QH 1P7KA 4F57H 3DURA 2FB4H 1EJ6A 3F12B 4JFPB 4KDWA 1LGVA 3AGVA 4YFDB 4C59B 1X7QB 3DGCR 5ANME 4ODSL 3PGFL 3VXRA 4ETQB 2C3GA 5ITBH 4GKSA 5DD0L 4PLOB 3S3PA 4MJ6B 5SWZE 3UTZA 1JHKH 2DJ4A 4QRTB 4U0RC 5FUOL 1KENH 4M7LL 1U2HA 4XBPB 3MRMA 2P44B 4YNYB 1CFQB 1FORL 3U30B 4AENB 3QFJA 3L7EA 1I1YA 3S35L 1M05A 3OAYK 2F5BL 5D70L 3TN0C 5IEKA 2X7LA 1LE5B 3D2UB 1YEJL 1VB9A 1QBLL 4HWUA 5F7DB 4QOKA 1IZKA 3DBXB 4P5MB 2EYTA 4I4WB 5T1LD 4PJ5E 5JW4R 4JDZA 4OCNC 4P46D 3JTTA 4Z7OF 4Y1AE 3MO1B 5KANI 4H8WC 1V3MA 1S9KC 2NMSA 4QGTA 1NGZB 2KL6A 1DLFH 1IM9B 1FJ1B 1NLDL 2IH1B 4P57B 4WGWB 4I0PD 1JRHH 3WYRA 5J6HA 3V5HB 3F8UB 4U1IA 3HG1B 1SBSH 4DZBB 5TE7L 1VGKA 2QTEA 2Z8WC 4TUKL 1R3LB 3SPVA 4LMQI 4Q6IC 2ZUYA 4BUHA 3I6GB 3TZVB 3MCKA 1LEKA 5ALCL 4DFIA 4WVRA 3EJJX 3SDAD 3OKNB 1QQDA 4B5EA 4MXVF 3VRLF 3DSFH 4JM4L 5E8PA 1EAPA 4WY7H 5J9PA 4XHJC 1VACB 5EZJA 2OTWB 4KMLB 1A7QH 2V7NB 4UINL 1H3VA 2R9HC 5GJTL 1FAIH 4O58H 4NJAH 4PRBA 2ENYA 2YZ1A 4XNZB 3CU1A 2CPCA 3U4EA 3ESVF 3MXWH 3QP3A 2VXVH 4WHTB 4MNGB 1KB9K 1ODAA 4Z7UA 3D25A 4ORGA 3JWDH 4Q9RL 5FK9B 3WDIA 2P49B 3O3BA 2ESVD 1J18A 4L4TB 1UKSA 1FFQA 5EUKA 3HR6A 5IJVB 5SWSA 1W0WB 3JV4A 4UDTA 1FC2D 1HILA 1BOGB 2YEZA 3KXFB 4M1DL 5IOPA 5E03A 2J12B 1VHPA 5GJSL 2DIAA 1RK0B 3CZJA 3SQBA 1TVDA 1KEGL 4PP1D 3WNOA 3K81A 5B4MD 4WWKB 3BVNA 4O00A 4GBXA 4LEXH 3MZGB 2FHBA 4HUNB 1MRFL 3QT2A 4RISL 5KZCB 2LQRA 3ZKMD 1GCFA 2PYEB 5A2KH 3RWFA 1QSFA 2AJ3B 3HG1E 3P9LB 5D7IA 1OWRM 1PG7L 3WS6C 3BMVA 2IG2L 3DX6A 2ZKHH 3K1DA 4TNVK 2K7PA 5ESQB 3OXRB 4H0IA 3PHSA 1HQ4B 4W4OC 1QEWA 5JLZB 1QR1B 1F90H 4D2NA 5I1DB 5LVEA 5CIPH 4BFEA 4FOMA 2O61B 2AK4B 2A9MH 2BY0A 3JBG7 3U4BH 3IGAB 1MI5D 2E27L 1MCSA 2HT2D 2D03L 2DWDA 3LEYH 2Y6SD 2HRLA 2R29L 1HINH 3KLSA 1KC5H 1RK1B 5FKAB 4UQ3B 1S7TA 4MNGE 5I76A 4J3VA 1X3DA 4PRHB 4KVCL 4YGVA 3EFFA 2HRPH 4X99B 4NHUB 4ODXB 1RHFA 5J57B 4KK9D 3I75B 2J88L 2XI9A 3QUYA 5ICYB 2NY6C 1ES0B 3MUGA 1T3FA 3RY6A 2HMIC 1DBAL 1OM3H 3ZT5A 3QZWA 2YD5A 5TDPA 4HWBH 4UOW0 3TA3A 1YA5A 4XNQB 5GRJL 1D3CA 4KKBD 1NC4D 1U42A 3VRIA 4HUXA 2EDBA 3O8XC 3MRIA 5IK3A 4ENEC 1WFOA 4UU9A 2V9RA 1U8PB 4XZUA 4JPWH 5CMAB 4C57C 4UT9L 4U4BA 4N0UB 3Q5YA 1JWSB 2HJLA 1RU9H 3IB4A 3IXAA 1XGYH 3GJEB 4HX1B 1EXUB 2NW2A 3RWIA 1OAKH 1W0VA 3DXAA 4NPYB 5HI4D 1HHKA 4NN5B 3TO4A 1P1ZB 3LKPA 3SKJH 3VDAA 3B5TA 5DLML 2VTFA 4OZHF 3QHFH 3HC0A 1CBVL 1N8ZA 1S7QA 4TNWK 5LJYH 5I8CA 1I9RH 3AVEA 3LN5A 1BM3L 4JQVC 1YEKH 1QLFB 5DJZA 1JFQL 5HYQA 4UAOB 1XF4B 3EHBC 4TVPH 2VDMH 4PRHE 1HKLH 2NY3D 1JPSL 3DROB 5GPRA 2CXKA 5DK0A 1XGQA 2CUIA 4P2QB 4I0KA 4DUXA 2VKWA 1OAYL 4JKMA 2UY7A 4R8WL 3CUPB 1T83C 1PEWA 1TETH 3SDDD 5IFHL 5GXBB 1JRHI 3VXTB 4KQ4H 5GZNC 1KLUA 2X9YA 4YDIL 1PX4A 3K8LA 1BIIA 1KPVB 5AZEL 5LCVH 3NA4A 4KK5C 5AUMA 3CXHK 3LAFA 5BQ7B 1FL6B 4CDHA 4ELKA 1A2YB 1WEJL 4M7JH 5INDA 4F33B 5BRZB 1I1AB 2FD6L 2YPLB 4I18A 1KT2B 4N0UE 3F5WB 1W72A 2QKIA 3PP3H 3RL2A 4XAKE 5BOPA 3QH3B 5C0RH 2P8MB 3QWRA 2P7TB 1DQJB 4HKBA 3REWA 2NY4C 5TPWL 1GGBL 5DR5H 3T65B 1IGCH 1KCUH 1X5JA 2V6HA 3QEHA 4WO4B 3VXUA 3DYOA 1NCDL 1BQLH 5IHZB 1ZLWK 1A7BA 1HIMH 4Z77A 1OAXH 2YBRA 2C3HA 5HYSG 5DJXB 4AEIH 1N0XH 1FYTB 2DM2A 3QFJD 4F2MA 1A3QA 5BCAA 4JFXA 4CN4A 3O6FB 1SVCP 4RFOH 4QOKD 4Y4HC 4K8RH 2RJMA 3OL2A 1D5IH 4I2XE 5DS8B 2J2ZA 3FJTA 2VDPH 4D8PB 3OSKA 1FO0H 4JG0H 4YHKH 5DZLA 5D2LA 5T3ZH 3KYMA 4O9HH 3DI3B 3F6IA 1QKZH 3BW9B 4G43B 3LKOB 1IRAY 4KTEL 1S9YA 1BMGA 1WBXA 3DUUB 1TTUA 1F3DJ 3MRGB 2DDQL 1ORSB 5DJ6A 4RGMC 5ESAA 3PWLB 4HCRA 5E4EB 2IAMA 4LOUC 2ARJB 4MHHG 5FGCB 5FYLD 1QVOA 4KDTC 1G0YR 2ADGA 4NM8L 1PSKH 4E41B 3PL6B 5BRZE 1H3TA 1YPZE 2YPLE 2MPAL 4FTVA 4ACPA 4TRPH 4DN4H 4XNYL 1JUFB 4M9OA 3FTGB 1KIUA 3BOVA 2PO6B 1BQHB 3D39A 5JHDB 1P9MA 3MLUH 1FVCB 1A64A 4ZUWB 5C7XL 1OAZH 2NXZD 1BGXL 1CE1H 2W92A 1S9VB 1OP9A 4ZO8A 3WCYA 1FYTE 4YEFA 4HLZH 4YBHA 3V52L 3QULB 4UQ2B 3EO1A 2X4RB 4U6HB 4KFZC 5B3NA 4MAUH 2YS4A 3QUZA 4OCRH 3C9NA 3TJEL 1IC4L 4NHCL 4PTUA 1MWAL 3BN9C 4LIQE 3T8XB 3K8KA 4TUOA 3HB3C 4MA1B 1MRCH 2R2HB 2UUDK 1FLTX 1VFBA 5DRWA 4IS6B 5C07B 4RBPH 4ESKA 5C0DB 4FQ2L 1IGIL 3HZKA 2BJMH 1UENA 2BNQA 3OX8B 5ITFB 3E6HB 4YAQA 1KN4L 1OT2A 3TYGL 4IMKC 3EOTH 1BLNA 4KAQH 4LSSL 1JWUB 2OXHA 4GUPA 5GS2H 4PLJD 2WBJD 1MEXH 5EO0B 1UFUA 1NUNB 2E7LC 1MIEH 3ARRA 4GRWB 1X5XA 4E41E 1Z3GL 4F8QA 3O0RL 1CFSA 3CFIC 3IXTA 3VJ6B 4FA8A 3EDFA 3C5ZB 1CGWA 1XR9B 4BYHA 1GGUA 5GS1B 3CFJB 2XACC 1EA9C 2J8HA 4OLZH 1S7UB 3ZKSD 2DI8A 5AYUH 2VQUA 5IR1B 2H45A 4MD0A 5AWNH 3ZDXE 5B8CC 4KJYA 5KJRH 4HUVB 1CICA 3FB7A 1S78D 1IGYB 3D0VA 3RJQB 2APFA 1DQQA 3R0NA 1ZK9A 5EO1A 3UTQB 2X4TB 3LSOB 2A6JB 3QUYD 3VG9C 3UZQA 2BOBB 1INDH 1I9JH 2ICWI 4R90L 3MLVH 5F71A 4N0FB 4NOFA 1DVFA 1A7NH 3ARZA 5F88B 2N1KA 3TA3D 5I1IH 1PLGL 4X98A 1HYSD 5CLWA 3LN9A 4JRXB 1U6AH 2X4UB 1YEEL 4OKVB 5SV4A 3QUXA 2VXQH 4I3GA 4QRSB 3OAYH 3UDWC 4ONHA 1CU4H 3UCRA 1P2CB 4G5ZH 1T20A 3ZTNH 3WIHL 1JYVA 4EBQL 4OGXL 4GQ9L 3UC0H 5DWUL 1GGCH 3V79C 2ITCB 4XWGH 3RVVD 4OLYH 5JPNA 3LHPL 4PG9B 3TNNA 3T4YA 4G7VL 4LDOB 3HI5H 1V05A 2ZUXA 2DLHA 4G7YH 1A3LH 4F9PC 3DXAD 4L9LA 4QHUA 3U6RA 3QO1A 3IVKA 4LAQL 4DCQA 3TO4D 2XOTA 1CGYA 2OTUB 3KPSA 3VFPB 4YHYC 4XPBH 4IJ3C 1ZTXH 4P9HC 2VXTH 3CC5A 4OV5A 3PWUB 3HE6B 5HVGB 5F44A 4NWUH 2XRAL 3VH8B 4BUGA 2Y06L 3U36A 1SY6L 3SGJA 1HHJA 3GMLA 1VERA 2NXYD 4RRPG 4JZOB 4JHWH 4BFBD 1NDGB 4I77H 1FG9C 3KAAA 3B9EA 4PGDB 3TNMA 4KUZL 3R8QA 4ALAL 3ARBC 4B41A 1G9NC 3WD5L 3NMEA 3W11D 5T3XD 4HPYH 3BKYH 4OSUL 4TOYL 4PD4K 3EO9H 4MQSB 4ZAKC 2GIYA 2MWCA 3GFUA 1FRGH 3ZKXC 1YMMA 3CGTA 3BEWB 5D1QB 3TGXA 5HY9A 1BJ1H 4NO0D 2QJDA 5DUBA 4LVOB 5TE6H 3F7PC 3WL9B 4OZIB 4U1NA 3UBXA 3UX9B 4CVZA 4WFFD 3PDGA 5IWLA 4ZFFA 3QWRD 4ZUUB 3BGFB 1FVDA 2GJ6B 2Y9RT 3QIWC 1RIHH 5F7HA 4O4YH 3HKFA 1JGLH 1TPXC 1FLRL 4HZAA 1IM3A 3ARUA 2VABA 1CXEA 4XP6L 4W4NA 5ILTL 2HJKA 1YPZF 4FQCL 3S36X 3KPNB 1N3NA 5INCA 5A16A 4YX2L 1IAMA 1B88A 2BHYA 4EI5A 5I19H 2NQCA 4L4VE 4HIEA 4PJ7B 3IFLL 1U36A 1MQKH 3QNXA 1EX0A 4GT7A 3MRQB 1NEUA 4X5XB 1AY1L 1T03H 4TTDC 5EU7C 2X4SB 3IDYC 5TDNA 3IYLW 2F54B 5FV1L 2PXYB 4KXZI 2W65A 2YD6A 1C12B 3X12A 4GW5A 2XKUA 4M5ZH 3QQ9C 1R3HB 3CPLA 1M1SA 4KI1A 3N50A 4HKXA 35C8H 2IAMD 3MV8B 4NN7B 3OZ9H 5IUSA 3SE4C 1FE8H 2A74B 1I8KA 4EN3A 3DNKA 5FECB 4JFDE 4OZIE 1DBJH 5J7CC 4HLJA 5T1DH 2G75B 2SEBA 2JB6A 5EBMB 2X5PA 3VD4A 2WUBL 1MCBA 3DSNA 3CLFH 1KN2L 2YMXH 4H1LB 1CK0H 4L5FH 1EO8L 5FYJE 1U9KA 3BP7A 1KIPB 2VXUH 1CDYA 2PYFB 4PREB 1INQB 2H32B 3M45A 4ZPVB 4YHLH 1UACH 1YDPA 1T80A 2ZZUT 5ID0B 4LRNH 1F4YL 3WUWB 3ZL4H 1E4WH 1ZS8B 3HE7B 3K0WA 4NUJA 4NKOA 4PJ7E 3GKZA 4HUUA 4X83A 1MCHA 2H1PL 3C08H 3WLBB 1WJ3A 3AMKA 3GBLA 3QUZD 5HYFA 4BKLA 2J6EA 4QXGH 4PIRF 2HVKB 5CZKA 3KPRB 5L7XL 3UJJL 2OTPA 3PABA 1WBZA 3VGGA 1C5BH 2EDJA 6CGTA 2YZ8A 3TBVB 3GMNA 4X8JA 5JW5B 5GGVY 4CJ0A 1FNHA