3IJYA

Structure of s67-27 in complex with kdo(2.8)kdo
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
IVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSNNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Immunoglobulin light chain (IGG3)
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
molecule tags Immune system
total genus 46
structure length 215
sequence length 215
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijyA01
1A22B 1FH5L 4WEBL 1OY3B 1T1YB 2FO4A 4RDQF 4M4RA 5IHBA 4UINL 2B1HH 2Y6SC 3U0WL 3ILQC 3K4AA 1AO7D 1NCUA 1AGFB 4TUJA 3BKYL 3RUGB 1FG9C 4OCYH 1Y0LB 1D9KB 5HYJB 1IFHH 1WBZA 3I6GB 1WWWX 3QJHB 3CVHB 2ESVE 4TSBH 5I8OL 3P4OA 4U1SA 2OL3A 4MGXA 4TRPL 3VDCA 2VLJE 5JNYA 4JRYD 5C0DB 1T83C 4P4KD 3O45A 2XTLA 2DDQL 4M93B 2NZ9D 5MERB 1VFUA 3HC4L 3VXRA 4TNWK 2WP3T 1P69B 1H3XA 2R0LL 1JZ4A 5I8EA 5JO5B 4HUVB 3QHZL 3WJLA 1A6WH 2EDWA 2LU3A 3BE1L 2IBBA 3MODH 3GK8H 4PR5B 4NCC1 3O4OB 1TZIA 3RZCC 1WEJH 2AI0H 2ATPB 5EU5B 1A1OB 4KVCH 4IOSD 4MNHA 1PG7W 2P5WA 4PRDB 4NNPH 3NAAL 4PJ7B 4L8SA 1IAMA 3T65A 4NO5B 4P9MH 1SBSL 4QHNB 4U31A 2CRMA 3T3PF 4WTWA 4OZIB 5CCKL 3AMKA 3C5ZC 3BKJH 5HI3D 5TE6L 1KPRA 3I6KA 4GW5A 4GG6E 1QEWB 3V8CA 1RJCA 2DL2A 2VXSH 3EDKA 4OIAA 4FFYL 1H3UA 2R4RH 1JN6B 5HGHB 3QIBD 1P7KA 3TIEA 2IEPA 3ZE2E 3L3IA 5LG1A 5INDA 3QDGA 3F7YB 1HHHB 2PCPB 5BRZE 5BS0B 1UJTA 4EDXA 2F8XC 3MODL 4PD4J 1C08A 5D7LA 5HPMB 4XNQB 3NCYS 4DW2H 1C5CL 1WEJL 1LDPH 1B90A 4XNYL 3D39B 2FRGP 1ZHBA 5JHDD 2VITA 2PN5A 2R23B 4XMKL 2G5BA 4JDZB 1I9JH 4L3ED 3PV6B 5GRXG 1I7TB 1RUQH 5KSBA 3KPQB 1BEYL 4R0LA 4P3CH 5F70A 3FB7A 4JFED 5GSRA 3SDCD 3BKJL 5I18H 3TBVB 3O8XB 3MYJA 2E7CA 3VFOA 5K9OB 5IG7A 1G7IB 3TZVD 1S7SB 1MAJA 4GT7A 2OSLB 2UWEF 1A9BB 1RIUH 2PO6B 5HVHB 2R69L 4WY7L 2YZ8A 4YBLB 4JANB 1GOHA 2F9BT 4HPYH 3AROA 1GGYA 5T33L 4YK4C 3TO4B 1FFRA 3I9GH 2VLKD 3O3EA 3VRLF 2D0FA 5F1NA 3VFRB 3CMOH 4WV1A 1MIMH 1U8MB 4J1UA 1KNOB 1Y6KR 3MJ7B 4KRPD 4QOKD 4QKXB 3C9NA 1DBJL 1MQKL 3PWLA 4DW2L 5SV3A 3O3AB 3UMTA 4NQTA 4NRXB 5J1SC 4PJCE 4UU9A 3EUUA 3CFKB 3HNVH 4OD3L 4P4RB 3WUWA 4YO0B 3T09A 2Q7NA 5IKCA 4M8QA 5SX5H 5IMMB 2WW8A 3ZLQC 3QEUA 4OFYA 1TJHL 1ODAA 4LARH 4L4TA 4ODWB 1LEIA 3SKJL 1N6VA 2AJZA 4GRWH 2X4RA 4I0PD 3CFEB 4XVJH 3OKYA 5ISZD 5HYQB 4YX2H 4NQXA 4G8GB 3I9GL 2H32H 2WINA 4ZUUB 1CIDA 5DEFA 4PTTB 4DQOH 1WAAE 4U1NA 2QKIA 2VZSA 5T1LD 5E0QA 4HIEB 4YUEL 3BESR 5CBEB 3NMEA 1CLYL 3O6KH 1KPVB 4Y1AE 1YYLH 1S8DA 4WI8A 1KIQA 5FK9B 3FHQA 2DOCA 4CNIA 1V05A 1JHKL 5JW5B 1HYRC 3HNVL 1R0AL 1EDQA 1VFBA 2LQRA 5ADPH 3TVMC 4HJ0D 4DN3L 1AGCB 1RK1A 3SDDA 1NGWB 3I50L 3U7WH 4OIBA 1V8HA 1INQA 1A6AA 4LARL 4F9LC 3KPPA 4PJBA 5IQ9A 4TVPL 1I85A 5GS0D 3IXAB 3CFDA 4NP4H 1A6VL 1T7ZA 3V0WH 4LHUB 4HUUA 5KG9A 5I1AB 3CXDH 1EEZA 3QIWA 4O4YH 4KAQL 3QXUA 4D9QD 2JJVA 1PQZA 2H2PC 2EDEA 5C0CD 4DQOL 4FQJL 5HYSG 1WWCA 3VWJD 1TVDA 2DYPB 4X7TB 4BH8A 2BC4B 5JDSA 3UAJC 4G7VH 3MREA 2E7LC 4JO1L 4AEHH 1S7UA 4YDIL 4GH7B 3G6AB 2X4UA 2V9QA 1G7JA 1YJDH 4OCMC 2GAZB 1FHGA 3VD5A 1YYLL 2AQ1A 4Q6IB 1JNLH 1FG2A 4N5UA 1JNHB 2AEPH 2ED8A 2AERT 4XMPH 3KPSA 4Z0XA 1TJIH 3U9PL 5MEOA 2I9TA 1KULA 1YQVH 3O4LB 5ESQB 3H0TA 1QLEL 5DD5H 1MHCA 5L0QC 3BZEB 5D1ZA 1YN6A 1N2RA 5CGTA 2D7OA 4XVUD 1A7NL 1JK8A 4I0CC 5F3HB 1QSFD 4HIHB 4KUZH 4NRZB 1FNLA 4FZEH 3L3OB 4L3AA 4PGBB 5IUSA 1YY8A 5MHSE 2BX5A 4YJZL 2DICA 4M3KB 1F90H 1Q94A 4LSSH 4JJHA 1EFXB 3ARVA 4Z76B 4BUGA 4PGDA 5DRNA 3RPKA 1OSPL 2A73A 4OLUH 1J5OH 1NBZA 3RBGA 4G7VL 3C8HA 4AEHL 1KCUL 3DV4B 5HXMA 4MD4B 4RWYL 1MH5A 3RZWA 2VZOA 3EJZC 4JZJA 1BLNB 4MSWB 4WO4C 2Z31C 2B1AH 2AEPL 4XMPL 3VFTA 3DVIA 3SO3C 3WJJC 4WRLA 5D71L 3STLB 2YKLH 4KKBC 1FLRH 3LQZB 1BAFL 5JDJA 1L7TH 1H5BA 4KGJA 3CDFA 4WUUA 1YECH 1CD9B 5DLML 5FGRA 5GGRY 5BZWA 1R3JA 4NM4H 3L3GB 7FABH 3GUTA 2BSTB 5AYQA 3IS0X 3RUGA 2YRLA 4P23C 1Y0LA 2GCYB 4P5TC 1N59B 2ESVB 3I6GA 3H8NA 3IU3A 3QJHA 4ZOAA 4P99A 2VLJB 1F90L 4OGXH 2GYSA 5MEPA 4LSSL 1QFPA 3CMGA 4WWKB 1RZJC 4PB9L 1GAFL 4PGEB 3QNXA 5EIQA 4UNVA 1S9WB 1A0QH 5MERA 9CGTA 3BSZH 4NN7C 5F7YC 2YPLA 4M48H 1BGXL 3GBML 2WNGA 3CK0H 1JYNA 3LDBC 5I73B 4PR5A 2R2BA 5JOFA 2L4OA 5F1KC 4MJ2A 2MKWA 4LSTL 2AK4B 4POZD 3V5HA 5BJTA 5GRUL 1IMHC 2IH3B 3AAZA 2YD9A 2ATPA 2BHYA 2X7LA 3NPSB 3DX6B 5ELIA 2YKLL 3QDMD 1FLRL 1NMCC 3KXFA 1L7TL 3NCEB 4A6YL 4KFZC 4P2QE 5FYJU 4QRTB 1LD9B 1PKQB 1MHHA 5HI4C 3D18A 3HE7B 3CX2A 1RV6X 2WIIA 2HT3D 7FABL 2IAMD 3GMNB 5KVMC 1MVFA 5JR1L 4JB9H 3KWWB 3O11A 1JN6A 3QHFL 5LCVL 5JQ6H 3TBWB 5D7IF 5C6TL 2J8OA 4ISVA 1YEEL 4MA3B 3PHOB 4YHKL 1JPGB 4A2LA 4CL7A 4O2FB 2VO5A 3C2SA 5E2VH 1PEWA 3BSZL 1LEGB 4MB5A 1A21A 5GS0H 4X83A 5B4MC 1HHHA 4M48L 3HE6A 5GGQL 1PJ9A 5EN2A 4LLAA 3N06B 1FYTE 3FFCB 1EUTA 2D31B 1U8OA 2R9HD 5KW9H 1IGYA 3D39A 3TH4T 4ZTPH 3ARTA 3D0LA 5FYLH 3QWOA 2VQUA 4NO3A 1HZHL 5AUMA 4JG0L 2W0PA 5DK2A 1AH1A 3KPQA 5D1XD 2QADB 2G2RB 3TBVA 4L9DA 1U8PA 3UZEA 1KJMB 1G7IA 1A7PH 1C7SA 2JJSC 2OSLA 5FV1L 1MRCL 2PO6A 3REWB 1HE7A 3Q6FA 5KS9A 2C26A 4JANA 4PV8B 5EO1A 2A6IA 4EN3C 5HYFA 4PRHE 2DTMH 2DQIL 3ZL4L 3OTTA 4LGSB 1EVUA 2D7TL 5C0BD 3VFRA 1T04B 3KPRA 1U8MA 4N9GB 2ADFL 3MJ7A 4X7FC 3QUKB 5DC4B 1U93A 3PWJA 3PL6B 3LKSB 4OQTL 5EULV 4HBCH 2APFA 3GNMH 3DGCR 1E4WH 4PJCB 5EC1B 1NCAL 5DK0B 2R2CA 3DX7B 4C57C 5T5NF 1JZ8A 2QQKH 2ZCKH 4ODUA 1TVHA 4H1LH 1CU4H 4NRXA 4G42B 1QRNB 2XN9B 5FYLL 3Q5TA 1X6LA 4KDVA 1F13A 3BEVA 1MLCB 3MJ6A 4XB8A 4RFNC 1LQSR 3GO1H 3O3UN 1N0XH 3MUHL 5DSCA 4JEGB 1N5YL 2EEDA 1L0YA 1QO3A 4M6NH 4ODWA 5CD5D 2K9UA 5FKAB 3HG1E 4YIQB 2HH0H 3DLQR 5KSUB 5A2IH 4OV5B 4G6JH 4S1DC 3GSOA 1GC1C 2BXZA 3H3PH 5EU6E 5KVGL 3NA4A 1BZ9A 2QHRH 4PJ5B 2GY5A 4HIEA 2BDNL 2R29L 1RUMH 4Y5XB 5KAQF 2ZUVA 5GS1B 2CPCA 3MLRH 4H5SA 5JTWA 3RVWD 1BD2D 4LLQA 4YDJB 3PGFL 3IDXH 1CDCA 4ZFZA 4GOSA 5EWIH 3ULUD 3OV6A 1A4JB 2ZCKL 4UILL 4UQ2B 4G6FB 4P46A 1IC4L 4LFHD 4YE4H 3WJLC 3ZYIA 1SY6H 3DMMB 5AZEH 4M1DH 1NDGB 5I0ZA 5AWNH 5T3XE 1ZMYA 2GTZB 1A14L 3GMRB 1OD9A 4JVPA 5GXBB 4JKWA 2VZVA 5J8OA 2LE9A 5FO8A 4JFDE 3VXOA 1TLKA 3C5JB 1G9EA 2A9NH 1GZPA 2KZWA 4L8SC 4OD2A 5I1AA 3TYGH 4DWHA 1QVOA 3MNZB 1ZKAA 1SJEB 3U4EB 4B7LA 2X4PA 1J0IA 4M61A 5IB4A 4WI4A 2P24A 4XP4H 4MCYB 4NIKB 2DYPA 2OMBA 4X7TA 5I1EH 2OZ4H 4K9EC 5IR1B 1MCPH 1VACB 3RDTA 4OLWL 3E3QE 2OQJB 4NC1C 3MLRL 2YEZB 4Y19E 4LKXB 4I3RH 4LAQH 2GAZA 2DWEA 5EWIL 5SWSE 2DI8A 3GSUB 3IJHA 1FNGA 2P8LB 3BZEA 1IC5H 3OXSB 2YD5A 1AE6L 3BKCH 5E9DD 4JG1H 4XCEB 1I1AA 3LSOB 3DO7B 4MAYC 3V0VB 1I1YB 4X80H 1RZ7H 3RWDA 3LOWA 1ETZB 4NJAH 5F3HA 1JHLH 3VXNA 3HZMB 2YC1B 4PGBA 4R3SA 4KK5C 1I9IH 4N8VB 2NY1B 2MQ0A 5GGSB 3EIFA 1DANT 1FVEA 2XKUA 4JJ5A 3TYGL 2VXQH 1F6FB 4I2XE 1P9MA 1QTYT 2ZSWB 1ZSDB 1C12A 4I9WE 1FC2D 4R0LC 1HH6A 4Z18A 3C5ZD 4G9FD 2HLAB 4FQHB 5L2KD 1MCNA 4IS6A 5I1EL 4P0DA 2OZ4L 4C56E 4NHUB 1EBPA 3ZTNL 2R1WA 3GM0A 4JFFE 3GRWH 2GJ6E 3DGGA 1DBML 4MD4A 2B4CH 3GJFB 2VWEE 1G6RA 4OLZH 4R96A 2FHCA 3MLYH 1BLNA 1LO3L 1INEL 4YXKH 1RHHA 1VEPA 1EHLL 1GHFH 1HN1A 2G75B 4OGYH 2NXZC 5L88L 3GHBL 3BP6A 1H3PH 1CFBA 1X5KA 3T0ED 3BKCL 3UJIH 4C55A 3TT1L 4BQBA 5DJ2B 1WTGT 4X80L 1AFVL 1HXYB 4CW1B 5I17B 2VC2L 4NJAL 2XI9A 1JHLL 3NFNA 5BMFH 3F7VA 4HKBB 1I9IL 3NIDE 1N59A 5IBTH 2ESVA 5HHPB 2A6KA 3QDJB 2XQBL 1W0WB 4HUXA 3KYNB 2VXQL 3GIZH 2NY6C 3OB8A 4DKEH 2EE6A 3QFJE 3T1FA 4WWKA 1RAMA 3LRSB 1G9ML 3JV6A 1K4CA 3CX5K 3BZ4A 4Z0BL 1S9WA 3RHWK 4H1LG 4X6DB 2WUCH 1OP3K 4BUHA 3GRWL 1UVQA 4WFGE 1UA6H 3KS0H 1I8LC 3C6LA 3CXHK 3LIZL 3MV9D 1CGWA 3HLAA 1GHFL 2BXYA 4OGYL 3JV0A 5SWQA 3UYRL 3HI6L 1KCSL 4HCRA 1H3PL 4HK0B 4Y7MA 3LEYH 4LCWE 5ANME 1MHPH 2D7NA 5TDPB 1KBGL 2X2YA 5HVFB 1XMWA 1XF2A 4KK9D 3MRBB 5C0FA 5DD0L 4AG4H 1UZ6F 3ULUH 3C5SB 1JHTB 2E6PA 4R2GB 4GG6A 3RWHB 3GMNA 3W11C 4BFIA 1MUJB 3KPLA 2AV1B 5IBTL 3S4SG 5GRVL 1KB9K 3FZUD 1S9XA 1NJ9B 3VGDA 1ORSB 1EAPB 1TQBC 1AY1L 1RI8A 3GIZL 2P44B 3LEXA 5DMGC 2HVJB 1OB1B 3DBXA 4NPYB 4JPIB 1NAML 2PW1A 5ICXA 4O2FA 5C0AD 1NC2B 4H25A 4PJGF 4QF1B 1BVLB 4NJ9L 4PREB 4S1RL 5BRZA 3VG0H 4PJ8A 1QSZA 2B0SH 1FYTB 3HZKB 1J7VR 4GBXA 3QIWC 4I77H 3CU1A 5FDWA 3FAWA 4I48A 2D31A 2BJMH 4YDVA 5CKGA 5IK3A 2LU7A 4UV7H 1X5YA 2F19L 4Y4KD 5GISH 4IRSD 3OKKB 2VZ1A 5HHOB 5T1MB 3ZT6A 1NUFA 2W0KA 1T0NB 2CRIA 1CL7H 4M6OH 3PNWA 1DN0A 2Z0BA 3ULUL 1QBBA 4GRWE 2FR4B 2V2WB 3ALPA 3QUZB 2G2RA 1BFSA 3LCYA 2KDGA 1AO7E 5D1ZC 2CQVA 2ICEB 4IIQC 3REWA 2Q3ZA 2EC9T 1D5MA 3RU8H 4GO6B 3ZDYF 2ZKHH 4PRHB 3IB4A 2CGRH 3U7AA 4Z7UB 4PJIF 4PJDF 2EKSB 1F6LL 4ETQA 3IAGC 2VH5H 4JRYE 1S7RA 1U8LA 5TE4L 3BP4A 1T4KB 4I77L 1H3TA 3NCJH 5D1QA 1K3IA 4EXKA 5E99H 1XH3B 4UV7L 3VGFA 4PJCA 4PFEA 5DK0A 3IDJB 1CQKA 4ZPVB 2IADA 3QDHA 5KVDH 5F7KC 1UQSB 4K71C 1GGCL 3SGEH 4M03A 4FQXB 2Z4QA 1MLCA 1T21B 3RQ3A 1CL7L 5IVXF 5I8KL 1BQSA 5KVEH 3HG1B 1EH9A 3RVVD 4Z6AT 4JPKL 1OL0A 5HD8D 3UEZA 2CDEB 5KSUA 5L8JB 4JM4L 2M1KA 2A74A 5J3HC 2CGRL 3OKMA 2OJZL 1JPSH 3LVEA 1WAAA 3DRQB 1AXSA 4PLKD 5DGQA 2XYCA 1GCFA 4OZHF 1D9KC 3KNBB 3RVTD 2LFGA 3WNLA 2Q8AH 4Y1AA 1LK2B 2I24N 1WV7T 1XGPB 4YDJA 1DLFH 2W65B 4YNYB 4X6FB 5E99L 3GMPA 4PD4K 1A4JA 3TWCH 4CVXA 2WWKT 4UQ2A 4KV5E 5EO0B 5DZOA 5C07A 4ZFOL 1HEZB 3VXSB 4P57A 3L5XH 4XVTH 1S7TB 3U7YL 3EJZD 1NGQH 5JOEA 4WO4D 3RBSA 5JHDE 2WBJD 4GQ9L 3O4OC 4RMRA 4Y5YA 4KGLA 2EZ0C 1RD6A 1SJHA 1X5IA 3FRPA 2XICA 4L3EE 3IFPA 3GMRA 2AJSL 3MLSH 4KKBD 4P3WA 4UDTA 1S7WA 4M5YL 2IF7A 3GJFK 5F1OB 3B5TA 1U3ZA 2FZ3B 4JFEE 2H8PA 1E4XI 4J3VA 3V5KB 3CU7A 1CFSA 1SJEA 1F3DH 3S7GA 2BOCB 4K3EL 3O3DB 4X7SL 3CVIH 1JYVA 4P5TD 4OM0H 3CIQA 4S1QL 3W5MA 4ODVH 1ZE3C 3L7EA 4Y19B 3V5DB 3DSNA 5D2LF 2YEZA 2VLKE 3ZMRA 4OF7A 4URTB 1DLFL 1XIWB 1S7QB 1S7XA 2NY3B 3KR3H 3LKPA 1WZLA 5T1KB 1NKOA 3VE0B 3MNVA 4QOKE 3X3FL 4QXTB 2IPUG 3QA3B 3L3HB 1EGJH 1XGTB 2P8LA 3MOAL 4MB3A 1QLFB 3OXSA 5E5MB 2JJUA 4UB0L 2NW3A 3S34L 2O5XL 3LSOA 3QISA 4XVTL 5E2UH 3V0VA 1EHNA 2Q3AA 4N5EC 2F54B 5CP7B 3WXVH 3ZYZA 4L29B 3PGDA 1FNEB 4ODBD 3HZMA 4KDTC 3MLSL 4N8VA 5C0RH 1NQBA 3ARBD 3F58L 2FIRT 4PRBB 1HQ4A 4RMWA 5FYJD 5FM4A 1LE5A 4I2XB 4RGNB 4EUPG 5ID0B 2ZJSH 1M1SA 3CZFB 5FF6A 1OOAA 4BKLB 3QQ9C 1VB9A 3NFPB 2ZSWA 3RKDC 3NA9L 2IALA 5DK3A 5ESVB 1QFWH 1A5FL 3PWPD 2HLAA 4FQHA 4U0QB 4YHPA 2B2XL 2D03H 1NSNL 3IJSB 2FHBA 5ISZE 1ZHKB 4OM0L 5GZOC 4ZUSB 4ODVL 4OSUL 5HVHC 5HYSB 2PO6C 2F5AH 3V8OA 3UZQA 3BDXA 3HUJA 4YBLC 4OGAD 3QEQD 3KR3L 2YPVL 3NZ8A 3B8YA 3FN9A 4MZ2A 3MCLH 2VAJA 3MR9B 1EGJL 1FPTL 4HZLB 5I2IB 3OJVC 4QRSA 1VFAB 5E2UL 1CS6A 3RWJA 3QZWG 4U6HB 4CW1A 5I17A 4R7DA 3W0WD 3OG6B 4OT1H 4EOWL 2PYEA 1RUPL 5FGSA 3MJ9L 4IRZH 5CEYA 4HKBA 5EDXA 1HI6A 3MV11 4KMQA 1CXKA 1G1YA 3O6FD 5F89B 1JRHL 4KROD 3WS3A 5EO9B 3QFJB 3VWKA 1EEQA 5K9KB 1I7ZA 1JGDB 3MYZA 4O02H 4MD5B 1UEMA 3DUUB 5KSVA 1DQMH 3V9FA 5EBGA 4ZO9A 5IFAH 4GRLB 4GXUM 2V7HA 4D9QE 2R1YB 5C0CE 4MCZA 3P9LA 3ZKMC 1AR2A 3ZSSA 3QI9A 1FL3A 4Y4FB 3IKKA 5DJZB 4TULL 4X0KA 3UXFA 4GUPA 4PJEE 1NGXA 4AEEA 4P2QA 3V6OC 2DLTA 4Z7VF 5DJXB 1NCWL 3MRBA 4KZDH 2V17H 1LP9F 4KXZI 1N0LA 3JWOC 1ACYH 4HC1A 3DUSB 4DTGH 2DBJA 4HWBA 8CGTA 4K3DH 1OTTC 4NQEB 1FVDB 4ZUVB 5E2WH 1QSFE 3TBSA 3ZE0E 1ORSA 3FFDA 1EAPA 3D3VB 1FL5B 1P1ZB 3W9EB 1P4IH 5J1TC 1XCQA 4NPYA 5ETUB 5F1IA 5EZJB 3ZHDA 4NZUH 1RU9H 1DQML 3PABB 3QXWA 1PGRB 3ORJA 4G6AD 2VABB 1D6VL 1QFWM 1BVLA 4PREA 3BP5B 4LASH 3D69B 1CLOH 4DGVL 3L6FA 4OCXL 4D8PB 1FYTA 4JY5L 3DWTA 1N5AA 4S1DD 3NGBB 1FORL 3F7RA 3PWVA 3BKMH 4MAUH 1OPGH 3QEHB 5E4EC 3OKKA 4JN1L 3P77B 1NANH 5GQBA 3KS0J 2CDGB 1IGML 3VRIB 3V6FA 12E8H 2NY0B 4F3FB 4OUUB 3IDMA 1PZUB 1YY9D 3BEWB 1Q1JL 4Q6IC 1CICB 2YMXL 4YHYB 5CEXA 3IDIB 4K3DL 4NKOB 2V2WA 3HZYB 5IV2A 1S5HA 2X1PA 4H8WC 3QNYB 4XBEL 1J87A 1FV1B 4OFKA 3WHE0 3BIKA 3OSKA 1P4IL 4PRHA 1R6VA 1R5IB 1F11B 4NZUL 1RU9L 2UY7A 1XZ0B 1MJ7H 1I1FB 3QPXL 4NKIL 1YMHA 1IGFL 3TCLB 2WQRA 1CLOL 3C2AH 4KTDH 3KHOA 5FYJH 3N0PB 1HXMB 1P9MC 2IG2L 1T4KA 5EBWA 1D5BA 3BXNA 3BQUB 3BKML 1A2YB 3TPUA 4YHNB 4HFUL 5J6GB 2EIZA 5F9OL 3IAQA 3P30H 2X4TB 1AJ7L 4U6TA 1GVIA 2EEAA 4PRAA 5B39G 3SDAA 5FHAH 3N1MC 2HFFA 1UWXK 3QDME 1ZA3B 5H94A 3ZDZE 2I26N 3HR5B 4UAOB 5IB5B 5KTEH 5I16A 4Y4HB 1HHJB 5CP3A 1T5WB 4DOHE 3MXVH 4PRNB 3GEWB 2HTLD 1F4YH 2ZOKB 2AJ3A 1NFDF 4PG9B 4PG2A 5EU6A 1ERNA 1NAKH 2FECL 5C70A 4KK5D 1MJ7L 2AJUL 5I1DB 1QKZH 3DV6B 2R8SL 4IDJH 3QJFA 3MV01 4FOMA 3QUMA 2Z93B 2FGZA 4NWTL 1C16B 1QLRA 1K3ZA 1Q0YL 4PRPD 4WWKC 3K8LA 4OM1H 3WD5H 1IE5A 3T0XA 1TZHB 3HN3A 2NY5C 1B3JA 1KJ2L 2X5PA 5FA3B 1U8JB 3F12A 3QXAA 3ARDA 4GJTB 1HEZA 1DFBH 4LLYA 5FHAL 1KN2H 4OI8A 3DVNB 4HIXH 1FN4A 5I73C 1OF2A 1YMMB 2RJMA 3G6JB 5CHNA 3DPBA 2VOTA 4HX1A 1R3LA 4K3GA 5DVLA 3TGXA 1XF1A 4JFDA 1MI5D 5DJ0B 4XB7A 4JFEB 2NY7L 3MXVL 3BPOB 4ZD3H 2FZ3A 4YDKH 1AP2A 3FCTA 1DLHB 3V5KA 1DE4B 5D8JL 4M6AA 1QFOA 5D6CB 5LQBH 4JO3L 5IQ7H 4BQCA 2X4QB 1QKZL 4WI5A 2XKNB 4F9PC 1KTDA 4HHAA 4NN6C 2VLKB 4JY4B 2F5BL 4Y19A 3CFBB 5IB2A 3BRDA 1T3FB 3NACH 3FOMA 4LU5L 1CFTB 5SWSA 4MXVF 3SEPA 5C0BE 4AZ8A 4QOKB 4A6YB 1IAIH 5IMKB 1AGBA 3T77B 5T1KA 4X4MA 3WFZA 4QXTA 3OBAA 1WC7B 5ENWA 3NCYP 4YEEA 4X7CC 1U3JA 4XCYA 5E5MA 2VDKH 4PBWD 1CCZA 2NXYD 5DDHB 3KPTA 5EU3A 3UJTH 5ICZA 5JLZB 3FONA 4XI5C 1T20B 4J4PA 4WNQA 3IKCB 3VFWA 3ARGD 4QRUB 2OXHA 1IGTB 1DQQA 1VADA 4PRBA 4QEGA 1JGUH 4NUGH 4BSJA 1NGPL 4U7KA 4I2XA 3GKZA 5MEND 4YDKL 3CZFA 2F53B 2E5EA 1WIPA 3MLUH 4BKLA 4TOYH 1N3NB 4OIIL 1MCWW 3ZTJH 2SEBB 2QADC 1SMAA 4I0PB 3TNNA 4C56A 4G6KL 4JFFA 4JQIL 4DZBB 2GJ6A 2O5ZH 4JHWH 2F74B 2WMPA 3DI3B 1YNLH 4F8TA 4U6VL 4S0SD 1AGDA 4JGUA 5I19H 2WSKA 3FQTA 4H88H 1IAIL 1I3GL 3VGGA 4Z77A 3OKLB 4RFEB 1T2XA 1BD2E 3B9KB 1JIBA 4IMLB 5I2IA 4QTHA 4QRQA 4C4KO 4WJ5A 3D9AH 3ULUE 1PVHA 3H9SD 3PL6C 3LS5H 2H1PH 3UO1L 4U6HA 43C9B 4F7MB 5D1QC 1L7IH 4CGTA 1L0XA 2XPGB 4PJAE 4DGIL 4HWZB 1V7NL 4RAUB 3IRZA 4E9LA 1JZ2A 1JI2A 4Q7DA 4RRPA 1U8HB 5C7XH 1BF2A 1UYWH 1Q9WA 3QFJA 5K9KA 2IFFL 5BZDA 1JGDA 3QUXA 3V0AC 4YHLL 5CJQL 3LN5B 4KKAC 4X9GA 4E41D 5CILH 4GRLA 5C0CB 1XGRA 5IM7B 4LSDA 4YHZL 3MLPA 3FN3A 4APQB 5DMIL 1HOCB 3BT2L 4MA8L 4QGTA 1IKFH 3FQUB 1XR8A 3QWQB 2YRZA 4ZUTA 5A2FA 4NFBA 2ADJB 1I4FA 4G8EA 4HGKC 3L5HA 3JTTA 4MJIA 5DJZA 3BUTA 1IAIM 4LCWA 4AM0B 5ANMA 4Z7WF 2QR0A 1BJ1H 2JCCF 4DZ8A 4LEXH 5FGBA 3GMQA 5E6IA 3EDFA 4Y5XC 3K4DA 5GS1C 5DJXA 2H1PL 2E6QA 4ZXBB 3EJJX 3A67H 1INDL 2HFEA 3CUPA 4MMXC 3BDBA 3DUSA 2DQJH 5E9DE 4Z7QF 4OCRH 4GAGH 2W07A 4NKMB 3DMMC 3QO1A 5ALCL 5B21A 2CKBH 1UYWL 1YQ2A 1EXUA 3G5YA 3O6ML 4KJWD 4Y5YC 5FDYA 3PABA 1FSKB 1YZZA 5CILL 4UT7L 1I75A 3HI1B 3SCMD 3V4PL 1ND0B 1CR9H 3VGEA 3LN4B 4R26H 4KU1A 3I02B 5TE7L 4H1LB 4NHCH 4YXLH 4G9FE 5L2KE 4L4VD 4XAKD 1IKFL 4TUOA 5IFHL 2VN4A 4E5XB 2IQ9H 5EU4B 3CLFL 3RJQB 3ZKXC 4S1SL 4ERSL 1RIVH 4LPYA 1LO5A 3QEHA 5DQ9B 3P77A 4HPOH 1D9KD 5HYJD 2E27H 4A2MA 2WBKA 2Y9RT 5FB8B 3LH2H 2Y1VA 2FIKB 4GW4A 2GSIA 4CU7A 3QG7H 1A7OH 4OUUA 4X98A 3MLWH 2JJWA 3C09B 4X5WA 2JB6B 4JKPL 3BEWA 4LSUH 2WWMD 4Q9RH 3T0EE 2DQJL 3MRJA 3ZYOA 1AO7A 4I3GA 4OCRL 5HI5C 3KAAA 4OFDA 1TCRA 2OM5A 5ID1A 2H32A 1RJLB 2CKBL 2XFXA 2YBRA 1H3VA 4PP2B 4AEFA 3S4SB 3CDCA 4TYUA 4XP9L 4DFHA 1KCRL 3KPNA 3FQXB 4UTBH 4M43L 4GXVL 4JRYA 1I8IB 2Z8WC 2D9CA 4P4KA 2NY1C 1FFNB 1UM6H 4LDEB 4YXLL 5CBAA 4Z8FH 3VW3H 2VL4A 3JWDL 4GKNA 4LLWB 1F00I 2IQ9L 1M4KA 3BIAX 3U0TB 4P2OB 3FO2B 2HN7A 5IBLD 1RIVL 1A2YA 4HPOL 4NN5B 4NZRH 2E27L 1A7QH 2J1KA 4NZTL 3MV9E 5I0DA 1A7OL 3MLWL 2HG5A 3QDMB 4KI5F 4IHOA 3PG2A 3WE6B 4Q9RL 3MC0A 1ZANH 2X09A 5J4MA 1ZA3A 4I8DA 4X7EC 2UVFA 4Y2DD 3L1OH 5J11B 3RL1A 5BS0D 2XA8H 1T5WA 1PEZA 5BCAA 4QWWC 5H37G 1R3IH 5ITFA 2XZCH 2E7MA 3Q3GB 1KSRA 3GSQB 5ILTH 2BY1A 1G9NH 4DK3A 1Q9LA 3LPGA 3G04B 1T1XB 4PJFB 2CUMA 2AJYH 4YFEA 3QIBA 1YC8A 4KZEH 3OKOB 1DL7L 1UM6L 1RSFA 4OUOA 4WHTB 3GHEL 3F8UB 3NCCB 1MCEA 3VW3L 3P2TA 3I85A 1WLHA 5C0AE 4WHDA 3EDDA 4M62H 1UCTA 4YC2B 4HGWB 4C54A 5FEBA 2X10A 2FJGB 4NNYB 3MOQA 3O8XD 2DLIA 5I15L 5GZOD 1UJ3B 5KAQG 2JELL 4K8RC 1U8JA 2GI7A 2VMFA 3VRLE 1KYOJ 2ZUXA 5FXCH 2ARJQ 2YSSA 3VD7A 2Q8BH 1WFUA 3AM8A 3UBXG 5JHDA 4L8BB 2V5RA 3DVNA 3KPMB 3P73B 4JVWA 3T8XA 1Z5LB 2X70B 1UZ8B 1T22B 3TO4D 1PFCA 2JKXA 1BQHA 1XF5B 4L3EA 1MRDH 2HYMA 4HXAH 2YD4A 3DYMA 4K94H 5JW3H 1X7QB 4HXBH 1K9TA 4JFEA 3IAPA 4HMCA 3RA7H 3SDCA 3DI2B 5E70A 3SKMA 2Z35A 3GSNH 2XZCL 3TZVA 4ZFFB 3CSYB 5DRXA 3PQYB 3RVXC 5KSBF 1QA9B 4R2GC 2AJYL 2RR3A 4MNGE 3I84A 1A6TB 5EUKB 2VDPH 2XKNA 4C58B 3EO9H 4NWUL 2VLKA 2JIXB 4OZFG 5CZVH 3ELAT 4PJHF 1Y18A 1TENA 3WS6C 4GG8A 1ZXQA 5D7SH 1T0MB 1RY7B 2X1OA 4QOKA 4JFQA 5AYUH 2BOBA 2RIKA 5AAWA 1HHKB 5F6IB 1IGCH 1CGSL 3LD8C 3QQ3B 1IGJB 1D5XB 4MDJB 1VEOA 5BO1H 1BZ7B 4QXGH 4EI6B 1WVZA 1U3HB 4P9HH 4G8GD 5DS8A 4CN6A 4KQ3H 4WTZA 1KTRL 1MRDL 4JQVA 4HXAL 4ZOCA 2CUHA 4K94L 5JW3L 3S35H 4FXGB 2HFGL 1IGTA 3Q5YA 1NAMB 4W6XB 3NOIA 3WFCL 3CVHH 4WUKH 3IXTB 3DURB 3GSNL 5EFIA 2FDBP 3LN9A 2BY3A 1N3NA 3N9GL 2SEBA 4X6CE 2YRPA 3HPJA 2N7BA 2OP4L 4I0PA 3O2WH 5ISZA 3Q0HA 1OTTD 1UWGL 3QUZC 3STZB 2VDPL 3VXQA 5IESH 4ESKA 1MREH 5C71A 5LGHH 1U91A 5CZVL 1EJOH 3OB0K 1J10A 3CFCL 5DD1H 2CO7B 4XXCA 4JRXA 5FCUL 2Q1EA 4NZDA 5CSBA 2XWTA 4AENA 1L4IA 3CC5A 5T1LA 1AD9B 4H0IA 2IJ0C 1A1NA 2ZUUA 5AYUL 4WI7A 1YEGL 1IGCL 2OXGA 1JWUA 1H3GA 4IMLA 1D5IL 4D0CA 5DMKB 1RZKL 4LHUD 5HTSA 2ZUSA 1HWHB 4I18B 5IF0B 3U6RB 1Q8MA 3SN6N 4KQ3L 4XPGL 4OKVB 1ZT4B 4WW2A 3NTCH 4LHJB 5T1DL 4HWZA 3PUCA 3SE4C 1QR1B 2DKMA 3P0VH 3L5WA 3QCUH 3SDAC 4FQXC 1L9MA 3GIVA 2O5YL 2MOVA 4ZYKB 3DETC 3MGTB 4ZS6D 5FUOH 3HAEG 4O9HL 4N0RA 4IEFB 3O2WL 5DJDB 1X4YA 5C92A 3O4LD 4Q9QH 5CEZL 2MHAB 4CRPA 4OV6F 1M6OB 1MREL 5C0CA 5LGHL 3MRLB 1FLTX 4PJBF 3EO0B 3VWJA 2VB5A 1F2QA 1HOCA 5GGUA 2FLRT 3VH8A 4PG2C 5F8RC 4BZ2H 2N7AA 1PLGL 2YD8A 1WCBB 4XPBH 1EMTH 3VMPA 1U92B 3FN0L 4PJEA 5F7NC 4LMQE 3ESUF 4QYOA 4N0FA 3WO3B 1XGQA 4JFPB 1ZTXH 2HTKC 5F3BA 3LKNA 2YK1H 3GI9H 5ERWB 4DVRL 2EYSA 1X6NA 5E08L 3QZWB 5MEQB 4LBEB 4M7LH 3GMOB 1QSFA 3MZTA 4X6EB 3P0VL 2F58H 1A9EB 1GYAA 1NBVL 2OBGA 2RFXB 5DVOA 5C1MB 5EU7E 3VXUB 5CKAA 5DWUH 2I9LA 2ZOLB 3WHXB 3HB3C 2HKFL 2R39A 4NUJA 1L6XA 5FYJE 1HINH 4DUXA 3HI1A 2Q20A 2W0FB 3QSKB 4AEIL 5L2KB 5HHQA 3LN4A 3G9VA 5B38G 3Q48A 3PWPE 1CFNB 2YD7A 4HH9B 4AYFA 4ZFOB 1T2QH 4E5XA 5EU4A 5I8CB 2RCSL 3TV3L 3ULVF 1ZHNB 4CMHB 2R0WL 4XNXL 4OBRA 5FA4A 4KJPD 2Y4SA 1I8KB 5I1KH 1M7DA 5IJVA 2XZQL 3P11H 5C0GA 1MWAH 3E3QC 3QEQE 3KPOB 3O2VL 2BSSA 3SDXF 3L95B 3CNKA 5L2JA 2YK1L 4QT5A 3T0EB 3GI9L 3WLBB 2VXUL 3QXTA 1IQDB 1VGEH 2NY3C 5D7JB 4OFVA 4WU5B 1IM3B 25C8L 2EIBA 2QBWA 2VISB 1HCVA 4UOW0 6FABH 5HGGS 1N6QH 1RURH 4BZ1L 3W0WE 5GGTH 2ED9A 2FJHB 4PS4H 4RFOH 5B8CB 3M17B 1P7QB 1A7RH 2AEQL 5DWUL 2DB8A 2AK4D 3LKQB 3VCLB 4JO4H 3FQRB 1B0WA 3EGSA 1X5LA 3LHPH 1DEDA 2DLFH 5GJTH 1I8IA 2A9ML 4UT9H 1FJ1B 4FFWC 1BQUA 5A16B 4RGNC 1ZA6B 1UACH 3QEGL 4FNLH 4LLWA 3UYPA 3IYLW 3P4NB 3MNWA 1XF4B 3FO1A 1T2QL 1RJZB 3HE7D 4EDWH 4F7TB 3U0TA 1SY6A 3H9ZA 3SY0B 4PGZA 5D7IE 1ZK9A 3WIHH 3VRJB 4WFFD 3MV9B 2W1NA 3Q6GH 3LV3B 1KIPA 3RY5A 2V6HA 3EFDL 2VWEC 1LILA 3BOVA 1NLDH 2XRAL 3RNQB 3OJDB 3QDMA 4ZUWB 5D4QA 4LPXA 2C3XA 5F96H 1PBYA 1G7LA 4PS4L 4RFOL 4YR6B 1JUFB 1A7RL 1CFQB 2IAMA 2NYYC 3FFCD 3ZE1E 2OZ4A 1J0KA 1CXEA 3GKWH 4ELME 1S9VA 4JO4L 5DQJB 1MAMH 3FOLB 2Q76B 4P2RB 1T1XA 4FFVC 5LBSL 1ZV5A 2A83B 1E27A 4LSPL 3HFML 2J3SA 5GRVK 2UWEB 4WHTA 5C0AB 1GGUA 2IMNA 3DX8A 1OAXH 2IH1A 4FQ1L 4EDWL 2NY2D 1YPZF 1GPOL 5TDOB 4JFOB 3WIHL 2NR6D 3V95A 3PIQA 1UJ3A 3S96B 2COQA 1A3RL 4L3CB 5GIRA 3GMMA 3Q6GL 4GRLC 1G84A 1LDSA 4F37K 3S88H 1HKLH 4PLJC 1IL1A 5DJ8A 3FTGB 1NLDL 2XNAA 5GRYA 2Y36L 2X70A 4NNXA 3V52H 2BVPB 2A77H 1T22A 2HP4A 3P9WB 1UM4L 4ZOBA 4OF6A 1A4KA 4LOUC 2XWBB 5EIIB 2APBA 1BQLH 5F96L 1KB5L 1YEKH 2J4WH 5GRJH 3MRHB 3W9DA 1HILB 5D1XA 1OM3L 2WUBL 4W4OA 1KFAL 5FGBC 1QSED 5IMLA 3LMJL 3PL6D 3OR7B 1IGIL 1U8IA 4Y5VB 3OKNB 2ERJB 5D6DA 3CSYA 2AEIT 3GRWA 1EK3A 5EORH 2K7QA 3V2AR 1OAKH 3B3IB 1CL7I 2IPUK 1QRND 1Q38A 2FX8H 3FT3B 2XN9D 1ZT1B 5DT1H 4CDGC 2DQFA 2Q7YB 4O5LH 2DM3A 3S8WA 4RGOH 1IILE 2VXVH 5C0BA 4WEMB 2J6EL 1OAXL 4TTDC 2AXFB 1CE1H 5GS3A 1UM5H 5KS9F 2V2XA 1VERA 3BYTA 2FEEL 4OB5L 2CR6A 2VIRB 1KPUB 5L6YL 3V7AG 4MDJA 3S88L 1HKLL 2WV3A 5KZCD 3TJEL 5DMYA 4LLDA 4X6BB 3NGBC 4K2UL 3QB7C 4YQXL 4ZMAT 4OLYL 5DJYB 1NLBL 2R0ZH 3HZVB 1FZJB 3QRFM 1MSPA 4PJ5D 4S10A 4FXLA 2EIDA 5TF1L 3TJHC 2CDFA 5J1AB 1Q9OB 4HD9A 2NY0C 4PGCB 5T3ZD 2NQCA 3IXTA 3DURA 2NMSA 5DUPL 4MWFB 4I5BA 1IARB 1B6DA 3SGEI 1PY9A 3HCVB 2PUQT 3B43A 3K7UA 4AQ1B 1OAKL 4YHYC 3SJVD 4LSRL 1WTLA 3M07A 1FAKT 5TH2B 3STZA 3HI5L 1DQTA 1MJJA 1W72A 4Y16B 2R56H 3S98A 3TO2A 5CD3A 4R7NB 4RGOL 3E1F1 1E6OL 3S36H 1ONQB 1P2CA 5HGDB 5HHMD 5DEGB 3OAUH 4QGYA 3WCYA 1O0VA 1JBJA 5DJCB 1BD2A 4ZNEE 4WHYH 2MNUA 4LF3B 1A8JH 1U8KA 2YS4A 4PRPE 3H42H 2N4IA 3X3GL 2Y7QB 3QULA 3A0OA 1FL6B 1E28A 4Y8AA 5IF0A 1JPST 3M45A 5I6XC 1MHEB 4PJAA 1DDHB 4QXWA 5HGBB 3DVGA 1QSVA 4G7YH 3UJJH 4R4NC 4AT6A 3W5NA 1Q0XL 5H2BA 5T5FH 2WBJB 4XC3H 5AG9A 5DRZA 2J8UE 1AQKH 4KY1L 4HLZH 3UP1A 1KLFA 5EZIL 3CH1B 1MCIA 3MGTA 1MI5E 2ZWLT 4I4WA 3RX8A 1C1EL 3GBNL 1FZOB 5SX4I 1KACB 2ZPKH 3SHSA 3DARA 3X11B 3EYOA 3QBTB 4KPHH 5HI5D 4Y4HC 2IBZX 3HS0A 4OAWB 5GGVY 5K93A 4JHAL 2Q86B 1GGIH 4DKAA 2R56L 5HI3C 4CMMA 1IAOB 3EO0A 4OD1L 4U6YA 1H9VA 4NKDB 4RMQA 1KEGL 3T04D 4NZJA 3C8DA 3OAUL 3OKDB 1N6UA 3VXTB 1U92A 1T83A 1YJDC 4M5ZL 1CGTA 1RVFH 3S97C 2NY1D 4JAMB 2AW2A 3H42L 4HKJA 3ROOB 1NMBH 1FO0H 1MCQA 4OTXH 1TETH 1K4DA 5ERWA 3EYVB 5E9DA 1FIGH 3S5LG 3FQNB 3T0AA 4G7YL 1RFDH 3D25A 5K59E 2UZIL 1JF1B 3RZCA 4XC3L 1LNUB 3F65A 2ADGA 1B88A 4O00A 2IFGA 3AM8C 3KHQA 3BH9B 2RFXA 1UWEH 4X8JA 4MXWH 1QBML 1FNSH 3QAZB 3FRUA 4ZPTA 2OTWA 5CS7A 4M7KH 4DKFL 5MENE 4E42B 4N0YH 4RMUA 1HK6A 2W0FA 3C5ZA 4G9FA 1GGIL 1TVBB 4GMTH 4QWWD 3SDCC 5L2KA 1K8DA 1KJ2B 3STBA 5E6YA 5DYOA 4U1KB 1MFCH 3KJ6L 3QPQD 2BMKB 2PW2A 1CK0L 4XNUH 1CD8A 1R5VB 5IVZA 2CLRA 1B0RA 3F6LA 1RVFL 2W9DL 5FO9B 1JGLL 3QDJD 3H9HA 3UTZA 3IGAA 3CAFA 1FO0L 4ZS7L 1OAQH 3RIAF 2YWZA 3T0EA 2YUWA 4KRPC 1CG9A 1FIGL 3NZHH 2DMCA 3QWRD 4P5MB 1EO8H 1RFDL 1IM3A 2FYYA 1KLGA 4KTEH 2VISA 3H9SE 3V7MA 4JM2F 4HWEH 3IVKA 3ZKQD 4AMKH 4KI5D 4NRYB 5HDQL 3Q5OA 2AP2A 4U1MB 1UWEL 3H7BB 3M17A 3HPLB 1KC5L 3QG6A 1NGYB 3LKQA 3O6FB 3VD4A 2V5MA 4KROB 5IEHB 2KQMA 1IZJA 5LXGH 1JTOA 3X13B 4N0YL 1FJ1A 4GMTL 5EUOE 1CE6A 5A16A 2P8MA 3WN5B 1PG7H 2HKHH 5C8JA 5T3ZH 3A6CH 4JDVA 4E41E 2EYRB 3OKEA 2BVOB 5D7IB 3RVXD 1RJZA 4G43B 4F7TA 4I0PC 5E8OA 2A6JB 2FBJL 1FE8H 3MV9A 1OSZA 3LV3A 1QFUH 2FB4H 1E4JA 3QH3B 1HQRA 3L3KA 4FTVB 3ROLB 3L9RA 1OAQL 4XXCC 1HIMH 4O58L 4Z78B 3NZHL 3O2DL 3CJJA 4XCCL 1NC2D 5AEAA 1IAKA 2P5EB 4JGMA 3WIIH 4KTEL 1YEIH 4ZQKA 1PSKH 2QTEA 2Y5EA 2YPKA 4IRJD 4YXHH 3OR6B 4RIRA 2FSEB 3MLZL 3GBLA 3MACH 4J8RA 3X12A 5I1GL 1DVFB 4LGPB 5HDBF 3MRIB 4HJ0C 5DQJA 3QCTH 3LS4L 2XTJB 2Q76A 3FOLA 5HHOD 1FRGH 1OGTB 3UPRA 1Z9MA 1FFPB 2F15A 2HVKB 1WBYB 4LCYB 3WSQH 2VXTH 3MROB 4GG6F 5C0AA 5I9QB 4GRMB 2CRZA 2DJSA 5FECB 5GS0C 1FFOB 3BN9D 1DUYB 2GUOB 5GHWH 1ITBB 2VYRE 4U7SA 1WF5A 1RJYA 2VLLA 3JXAA 4PLOB 3QUZD 4PJIE 4L4VE 2W0LA 4XAKE 3MMEB 3RWIB 4RZCB 1QFUL 2FB4L 2CLZA 4Y4KA 4IRSA 3BPNB 1BM3L 4HS8L 3VWJC 4UUJB 5TFSH 1OW0A 1HIML 3WKMH 3QXDA 4OJFH 3U46A 5HYJE 5GGSY 2PNDA 5EBMB 3FT2B 4NO2B 4ZNCD 5JIPA 2N1KA 3W81A 1I1RA 2XG4A 3QRGH 2H26B 4WI9A 1HILA 1PSKL 3EYSH 3PHQA 2AQ2A 3D2UB 2DD8H 4Y5VA 3OKNA 4XWGL 4JZNB 4LMQI 1NUNB 2R2EA 4U1HB 1KEML 1XGUB 4MNGA 1KLUB 4XVUC 1CDHA 4XRCB 3FT3A 3MRCA 4P5KA 1JP5A 3F5WB 2FJFA 2BVEA 1DQJB 1MIEH 4ORZC 3GJFH 1IEAA 5IOPA 5GPRA 1FQ9C 5TQ2H 4R90H 5GHWL 4J3XA 1TPXB 2I25N 1TMCB 2Z91B 3PJSB 4QO1A 4ZTOH 4XNMA 1I8MB 5BV7L 1DANU 1XR9B 4OZIE 4M1GL 3WL9B 4ACPA 4NYLA 3W39B 4CKVX 5TFSL 4QRPD 4UDUB 4JPVL 4XAWH 2DQCH 1JFQH 4UIMB 1S78D 4LEOB 3UBXB 1HYSC 2DQUL 4LKCA 1CXLA 3B83A 3BP7B 3EYUL 2VTFA 4RAVA 3AREB 3QRGL 3BGMB 4P3DA 1BBJA 5J9PA 2OK0L 3TN0B 5J1AA 2HTKD 4LVOB 4JFZH 3CDGB 4MDIA 1SYSA 4X6CA 2BVQB 3C09C 4OLVH 4K7PH 4UV4H 3HMXL 4WCYH 4PJ9B 3DSFH 3I3DA 4LCUB 4HT1H 1IEBA 5BS0E 3HCVA 3OX8A 1IT9H 4YHOH 2ENYA 4HKXB 3VXSD 3QNZB 1MJUL 2VAAA 5TGBA 1FGNL 5B22A 1E4XH 1KIRA 5CMAA 1N7MH 2IPKA 3HB3D 4OZFB 4R90L 5FHBH 3VFUA 1W0YT 3HC0B 4BH7A 5C0JA 2Y5TB 4CN1A 1KCLA 1MCBA 2BNRD 1WAAF 3EJYD 2Y7QA 4LLVB 3INUH 4LLMB 4XAWL 1SM3H 1KYOK 1MHEA 4HJGA 4L9LB 1GC1L 5DVNA 1MLBB 1V3JA 2BFVH 2CKBB 2IMMA 3ES6B 4WO4A 4NN5C 2WBJA 2Z31A 4DEPC 1XCTB 4R4BB 3OMZA 5IHZA 3E8UL 4ODXB 1HH9B 1YDPA 3WJJA 1AIFA 2OL3L 3RGHA 1XIWD 2YA1A 3KLHC 1IBGL 2V7NB 5ICYA 4XNZB 1MVUA 1FZOA 1IT9L 3X11A 1UB5A 1DSFH 2VDMH 4HV8A 3V4VH 2P4AB 5JIHA 3MRNA 2HT3C 4JREB 5EBLA 2Y06H 4DN4L 3PP4H 4PJXF 2F54D 4P5TA 1N7ML 4FA8A 3GMLB 4UBDC 5FHBL 4M7JH 2AGJH 4QHMB 1YUHB 1RMFH 4JCLA 1SQ2N 5TF0A 3JTSB 1DJSA 2NTFB 3OF6D 3RTQB 2ICWA 3IJYA 3RWCB 3AS1A 1PYWA 3ECBB 4RGND 5E8PB 4NC0B 1BREA 3MBEB 2KH2B 3P0YH 3ULVD 3M8OH 2O61B 3INUL 3OHXB 3P40A 4M02A 4HIIA 4GW1B 1UXSB 5KBNC 4YC2C 3EYVA 1AI1L 1D5ZB 1WK0A 2XY1A 3MX0A 2GITB 2BFVL 1FNFA 3MGAA 3IDGB 3WYRA 4IJ3C 1UJ3C 2DM7A 4O2EB 1IAII 5C2UB 2R9HC 4K9EL 2X4OB 4G8GE 2HRPH 4DAGH 3ARBA 1EZVX 5ACZB 3TIDB 5J12B 2DL9A 4J3WA 1R3HB 2QJDA 2L7JA 3V6OE 4JE4B 2O93L 1TTFA 5DFTA 4BELD 1S9KC 1X5AA 2NX5D 2BCKB 3C08L 5CZXC 3V4VL 1PAMA 3RIFF 5EA0L 3C60B 1TFHA 4LVHC 3PWPA 1G9MC 4J3UA 2Y06L 4K7FA 1HNGA 3MGOB 4D9LH 3AFLA 5IWLA 3MRPB 4U1KA 3U9UA 3WFEH 2AK1H 1E4KA 4LNRB 4M7JL 2Z92A 1QQDA 2B4CC 5GZND 3MFGB 1RMFL 1R5VA 2Z8VC 3QEQA 1SVZA 4QRRB 1A7BA 3BH8A 5HY9A 2WANA 2ID5A 3S3PA 2AQ3A 2VDOH 1MFDL 1H8SA 3QQ4B 1I9EA 1TZGL 4P5MA 2GEEA 3HUJF 4MQXD 2I60L 1M7IB 4P59H 1ES0B 5F6IC 3W0WA 3G5ZA 4NRYA 3VFNA 3G6DL 2HRPL 5AD0B 4HFWB 5E1AB 5TQ0L 5FV2A 3SGKA 4DAGL 3HPLA 4Z7VE 1BVKB 1NGYA 4GAYA 4TUKH 1NCDL 1U3HC 5FCSH 5C08B 3O6FA 3ZKSD 4Y4FD 3RWFB 3ARFB 1OGAD 3C6SB 1MFBH 5IEHA 2FEDC 2YD2A 4WGWB 4NT6A 4OZ4A 3IFNL 2OI9B 5D2NB 1H8NA 2IQAB 1J8HB 2EDXA 3UPCA 1FH5H 2G5RA 2KPNA 1LO2H 1CT8B 4WEBH 1NCBH 1QG3A 2MCPL 1Z3GL 3O4LE 2YXMA 5D7IA 3UBXI 4S2SA 1KF9B 5D70L 2MJWA 4JRWA 3QUYB 4U2YA 1W8NA 4YDLB 3U0WH 1AGEB 2A6JA 4NQED 3ZT7A 1U95B 3SPVB 4PJGB 3REVB 4ZSOB 2ICCA 2HJLB 5HBBA 3RX7A 5DJ6B 3BKYH 3DX9B 3T4AA 4X7DC 5CLWA 3D3VD 2DKUA 2QSCL 1VKXB 2X1XR 2VDOL 4QHLA 4XPHL 1EO7A 3OGCB 1X5ZA 5I8OH 3ABZA 3GSNB 4JHBA 3A6BH 2EICA 1NPUA 5IIEA 3BW9A 5D9SB 1IC7L 2DDQH 3VGAC 3ULUC 3BO8B 4PV9B 1DUZA 4G8IB 4I18C 3VXPB 4DCQA 4ELMA 4U49A 4TUKL 4XGZB 3WEXB 2YN3A 1NEZB 4NQSB 5AZ2H 1S3KL 4XZUB 1P7HL 2P7TB 2FCBA 1H0DB 3B2VH 4CVZB 2HVKA 3RGVB 4EBQH 2NZIA 2NY0D 3GJEB 4TVPD 1LO2L 1NCBL 5FECA 3SCMB 3KYMB 3FO9A 5EZOH 15C8H 2GUOA 3NAAH 5A40E 2GK0B 4XBGB 1CICD 1I7UA 35C8L 1AD0B 3UTQA 4PJIB 4L4VB 1HHGA 1MCFA 3UX9B 3G08A 1SBSH 4MVBD 4DVBB 4JR9H 4U7MA 4IM8A 5CCKH 3SKOA 32C2B 4RZCA 5TE6H 3NABL 3EOYG 1FZMB 4UUJA 1ZLVH 1JYWA 1X5JA 1A6PA 1PZ5B 4FFYH 1U58B 4BSVA 2FX7L 5JPNA 3A6BL 3FT2A 2VDLL 4AJ0A 3L3JB 2EE9A 1NDMA 4M7ZB 2R1XB 3MRKB 5HGAB 3SBWA 3CFIC 5EZLB 3DVFA 3ULVH 5B3JF 1G0YR 1IKNC 4YBQD 5ACLA 2EDTA 3WNKA 2BNUA 4JZNA 4LVNB 5AZ2L 3BQUD 4X4XB 3OAZH 4QY8B 4R4ND 5D5ME 1JZ3A 3MUJA 1GIGH 2VZUA 4PY7B 1C5CH 3B2VL 2XXCB 5F9JA 4CU6A 3RWEA 3SE3A 1G7HA 4XNYH 2AK4E 4EBQL 2BVYA 3DRTB 3ZHLA 5BQ7A 4XMKH 1DQJA 2OJEB 2XACC 5EZOL 15C8L 2BSRB 1ZLWK 4QHKI 1YNTA 4X9HA 3MV7D 4F15B 5EC2A 1BEYH 2Z91A 4Y4HD 1R24B 3O41B 4JR9L 1A6ZB 1PKQE 4OZHB 1XR9A 4RBPK 1ZLSL 1ZEAH 1S7VB 2WM0A 4NOFA 4RMVA 4EIZC 1U3YA 2EH8L 4HBQA 4RQQB 3BVNB 4HS6B 5C0IB 4WW1B 1KJ3L 2R69H 4WFFE 2NLJB 4WY7H 1RUAH 5H8DA 3BDYL 5I1CL 4OI7A 4HJJL 4CMHC 1F2XK 4G80B 2PTVA 3U30C 2E9JA 5T33H 1NBYA 3N1FC 1V3LA 3RY6C 1ADQH 3P0GB 4QCIB 4Y8DC 2J7LA 1K8IA 1KCVH 3CDGA 3ULVL 1MF2L 4Y2DB 4D9RD 5I1JL 5E4IA 4MX7A 2BVQA 3T0EC 4LCUA 4MAYA 1DBJH 1MQKH 1GIGL 4MHHG 3U0PB 1MJ8L 3FFCE 4HKXA 4MMZC 4N0CC 2HJKB 3WUWG 4NQCB 4OFPA 3QNZA 3UTPD 2A1WL 4FP8H 3ZO0A 1ZGLB 3CDYA 4OD3H 5B8CC 4WU7B 2GFBA 5INCA 1YMMD 2J88L 3U2SB 1N64L 3AY4A 4U1JB 1I7RB 4ZNEA 3V6ZA 1J12A 4HK3N 2GIYA 3RWGB 2VKXA 5E8EA 1TJHH 4PRPA 3WFDL 1B0GB 1ZEAL 4XPAH 3MJ8B 1YYML 5FGCB 3SKJH 5D2LB 1CD1B 1AKJD 4LLMA 5I66A 1RUAL 1ZVHA 3EOBA 1C5DA 1MLBA 1RK0B 2CKBA 3AXLB 1BECA 3ZDXE 3ES6A 2J8UA 4XMLL 1ADQL 4R4BA 4CVWA 3RDTD 1I9RH 4PP1D 4JN2B 1KCVL 3U83A 2Q6WA 1MI5A 4GFTB 3DO3A 3MOBL 4YUEH 3QFDA 1CLYH 3MUGA 1NGZA 4KK9C 1QSEE 2J2ZA 4M8VA 3EDEA 1Z0MA 4JQXA 4LIQL 1WBXB 3WMSA 1KGCD 3MRRB 3FMGL 5IW6B 1ZT7A 3SKUD 2VUOA 4FP8L 1EA9C 1I1AD 1JV5A 1JHKH 1JMZA 4U2ZA 3RNKA 4F57L 1R0AH 2XWJA 3H9YA 3QO0B 1MWAB 1QRNE 2XN9E 3FZUC 4DN3H 4JKLA 5L7XL 2OTPA 2H2SD 3I50H 2BRRL 4QHMA 3RPIA 2X9XA 3I75A 2DJ4A 5DA0B 3U4BL 5IT2L 1G0DA 3ARPA 2DIJA 3JTSA 4XPAL 4RA0C 3ULSA 2F53D 4TVPH 4XBPB 1A6VH 3OHXA 1H8OA 3DYOA 3TPKA 4F33A 1F6AB 1I8LA 4RNRB 2VQ1B 1ED3A 3AB0B 1KELL 4KAQH 3RY4A 3IDNB 1URLA 1I9RL 4Y4KC 4FQJH 2Z8RA 4IRSC 1QP1A 3ARGA 1OW0C 1A3LL 3EHBD 2FWOA 1M71B 5DR5L 3VI3F 1NFKA 5C3TA 5ACZA 4JO1H 3TIDA 4EZMA 4PJ5E 1R3HA 4JM2D 3E6HB 4JLRB 4U6XA 3FB8A 3K1KC 4MD0B 4YDIH 5MENA 1ZS8A 1AXIB 2W9EL 1VENA 2BHUA 3D85B 5T3ZE 2UUDK 4YPGB 3U36B 3B9KD 4YZFE 4CAGA 2GSGA 1X4XA 1QYGL 3U9PH 1CXFA 1QLEH 3SJVE 4ONHB 4Y5VC 5TDNB 2ERJC 3MRPA 1CDYA 2G9HB 1DBBL 1MNUL 1BIIA 5JMRA 4X4YA 1A7NH 1MCLA 5HYEA 2AV7A 4RWHA 3O6LL 3KDMB 1CZ8H 3BJ91 4Y2OA 1K6QH 2HA1A 1GGTA 3B6SB 4F58H 1HSBA 4L5FL 4AH2A 4CADA 1J05B 5HHME 4U1IB 4MA1B 1FVCB 3D0VB 2I5YL 5LAXA 3MA7B 1XF3B 3I6LD 5CJOL 4QHUB 2KKQA 5DUBB 4NBZB 4R8WH 3H9SA 2EDFA 5I1HL 3MSPA 1ES0A 1EEYA 3JV4B 3S5LB 1TQCB 2AXGA 2X41A 4ZOEA 3DHJA 43CAA 3FB6B 1OSPH 4BK4A 5FM8A 4APQD 4OI9A 1UT9A 4Z7VB 4EXPX 4FQ2H 5FFLA 5E1AA 1DEEB 5FYLD 3IETB 1KCUH 1LP9B 3Q1SL 4RWYH 5J7CC 2PTTA 3VFMB 1D6EA 4G9DB 5F7MC 5DGRA 5EUOA 2FHFA 3NIDF 1WISA 4Z7QE 4KUCD 1H15A 2IQAA 4E41A 3DYPA 3P4MB 5D71H 1T1WA 3G5VA 4MB4A 1SEBB 4YHIB 3O9WD 4ZXBD 3RVVC 1BAFH 4IIQA 5E8DL 2C3VA 4GAFB 1T7YA 4XTRC 5HD8C 1IM9B 5HHVL 5ESAB 4BYHA 5DLMH 1CZ8L 1K6QL 2EH7L 3JUYA 3M1BB 4F58L 5I75C 3EFFB 1UB6A 2OYPA 1KT2A 3EYFA 4Y16C 4LP4A 4PLKC 3L3DB 5DFVD 1I3RB 2B7DT 2EECA 3RVTC 2QLVB 1U8NB 3QIUD 3OGCA 4R8WL 2VDQL 5BXFB 4H0GA 4PB9H 4NCDA 4WDIB 5D9SA 1GAFH 4PUBL 4HIJB 4PJ8D 4V1DD 3VI4E 4FQ2L 1RUKL 4YGVA 5L9DL 3BO8A 5SWZB 4FABL 3MA9L 2ZP0T 1P4LA 1BGXH 3GBMH 1HYSD 2EYTA 4W81A 4MA7H 1VFOA 1NEZA 4NQSA 3VMNA 1Q72L 4LSTH 5DF0A 2WBJC 5GRUH 4CVZA 1QPXA 4NO0B 3MRDB 4NM8L 5K9JL 1T1YA 5LWYH 1CDBA 3SCMA 4A6YH 3BGFC 3JWOL 4N68A 4M7LT 2A38A 4HAGA 2R2HB 4L4VA 4UNUA 5I30L 5IGXH 1YNKL 4XP1L 4HK3J 1BF8A 1AGFA 2CLVB 3MRQB 3LRHA 2I07B 5F7FA 5JORB 2NNAB 1D9KA 3AS2A 5HYJA 1FZMA 2WZPD 2IPTL 3D48R 1UENA 5JR1H 2QV2A 1LMKA 2ZZUT 3HC3L 3QHFH 4KK6D 3CVHA 5LCVH 3QDJE 1GL4B 5TJWK 2VE6B 3L3JA 3MRMB 5C0DA 5C6TH 1BOGB 1YEEH 4YHKH 1VGKB 4U3CA 4UNTA 1U0QA 3MRKA 1X5FA 3VFGL 5HGAA 5E00B 1FZKB 4X6DE 5D5MB 1DQDH 5JO5A 4HDIB 4HUVA 4P2OD 3TVMB 5GGQH 4MA7L 4PRID 4KI5E 5DQDH 2AKRB 3CGTA 4GRWF 4UTAL 5C9JB 5EU5A 1A1OA 5EU7C 2VZ3A 3KLHD 5LWYL 3ARBC 4MJ6B 1NFDB 4PRDA 4PJ7A 1HZHH 2DQTH 3WDHA 4PTUB 4JG0H 5IGXL 3A6OA 4NO5A 3OGOE 4QHNA 5ITBL 1F3JB 4OZIA 3CPLB 4JVUA 2NPLX 5IWLC 1QEWA 3BVNA 3ARWA 4UBDD 5FO7B 2JF1A 3WXWL 1E4KC 8FABB 1MRCH 1T03H 4JCMA 2NLJA 3WNPA 1T1ZB 4G80A 4OGAC 5HGHA 2ICES 4CUCA 1J9CT 2DQIH 3ZL4H 3TF7C 2J8HA 2D7TH 5IFJB 2D7PA 3F7YA 2ZCHH 2BK8A 4LVEA 4Y2DA 1YEHL 2ADFH 1DQDL 2PCPA 5BS0A 4L4JA 1ZLUH 4XNQA 5DQDL 4OQTH 3U0PA 3KYOB 4ORGB 1KXQE 2UYLB 1NCCL 5C07D 1NCAH 4KDTA 1Z2KA 3P9MB 4IOIB 2R23A 4G5ZH 5BVJB 3SGKC 1OCWH 5HHOE 1G6RL 4JDZA 2VR9A 2FATL 2ARJB 2DQTL 3O6FC 3PV6A 2CD0A 4KROC 1FO0B 1I7TA 5CZXD 2A6DB 1JMXA 3IRPX 5HSFA 2NY2B 1S9YB 1JWMB 1A64A 2FGWL 1KXTB 1N5YH 3O8XA 3WN5C 5K9OA 1A6UH 1S7SA 1CD1A 2C7UB 2CJUL 1A9BA 3PQYD 4PJHE 1T03L 1X4ZA 3OB0H 3BWUC 4DFIA 4MQ7B 3AS3A 1UXWB 1FGVH 3AXLA 5D72H 3UTTD 3TO4A 5KVGH 4KV5F 4JZOB 3MO1B 2JIXD 2QQNH 4Z7UE 2FEEI 4AIZB 2A0LD 2AJXL 2ZCHL 5EOTB 1KNOA 1FBIH 2BDNH 2R29H 1QSEB 4AY0A 3OPZL 2V5YA 5IVOA 3FT4B 3PGFH 3O3AA 5GJSL 3SOBL 1Y6NR 3UC0L 3UDWA 1J1PH 2QQLH 3I2CL 3MRRA 5DO2D 5A2LH 2HT2D 4UILH 3LKRB 4K23L 3CFKA 4G5ZL 4P4RA 5GSVB 1OCWL 4NDMB 1IC4H 1FAIL 1U2HA 1U3HD 4YO0A 5IW1B 1MWAA 1DVFC 1VSCA 2VLRB 2FEDD 1UEYA 5IMMA 2XTJC 3CFJB 2B20A 1A14H 2HLFC 1GGBL 3PE9A 4FMKA 3WLWD 1Z9OA 5JW4Q 1U9KA 1ZWIB 4G6AC 1A6UL 3LQAL 5I9QC 3IFLL 1KTLB 2ITCB 5GGTA 3EW3B 5IB3B 4B50A 1RZGB 3CFEA 4KVNL 5HYQA 2C5DC 5JA9A 1FGVL 5KZCB 5D72L 4NSKB 4GAJL 2CH8A 2EE2A 4G8GA 4QRPE 1CF8L 4I13B 2QQNL 3IDNA 4ZUUA 5E56A 5C0ND 3N1QC 4G3YH 4ONFH 4PTTA 2AABL 4UQ3B 4LHQB 4EI5B 3V6OA 1FBIL 3JBG7 4OLWH 5CBEA 3G5XB 3MQIA 2CUIA 4XP5L 1B4JL 3GSRB 1KPVA 5CLTA 1J1PL 1YY9C 5FK9A 2QQLL 3O3BB 3SJVB 3WUZA 3SBWC 1Q9KB 4KKLD 4LP5A 5JW5A 5DEZA 5EOCL 1AE6H 5JPMB 5GGVL 2G9HA 2WWKO 2PYED 1ORQB 4V2CB 2DQHH 5DHVB 1AGCA 1CXIA 3VXSE 3MXWL 5CIPB 1NGWA 2FL5B 1MRFH 3VFPB 3SE3C 1NKRA 5HHMB 4FXKB 3S9DB 3PP3K 4TPRL 2GJZB 4H26B 4I0KA 1KCKA 1FVCA 2YWYA 3IXAA 3WV0A 2ZUYA 1AHWB 1ZOXA 1EHXA 5F21B 2HWZL 3KG5A 4LHUA 2BNRE 3D87B 4ZAKB 3L7FB 1TPXC 2VJXA 3LZFH 3TLRA 4Z7WB 4KK8D 3HTLX 3VA2C 2JCCB 2NW2B 4ONFL 2VR5A 4G3YL 4Z7VA 4ODSH 2BC4A 3ZTNH 4HAFA 5FUZH 2GTWB 4Z7NF 1DBMH 3NFSH 3QI9D 3G6AA 5IHUL 3VFMA 1G7MB 4N90D 4TQEH 3AREC 4Q6IA 4WW2F 1LO3H 1INEH 3ARZA 5B3NA 1EHLH 4F7PB 1JNHA 4LVOC 3O4LA 4TNVF 5ESQA 4M1CD 5L88H 3GHBH 5BV7B 4YHIA 1MEXL 1BWMA 3TT1H 3WIFB 2DQHL 4PYHA 1AFVH 2HTLC 5JUEH 2VC2H 3R06B 1MRFL 2F54E 4HIHA 4NRZA 5I1IL 3RRQA 3M1BA 3L3OA 1N8ZB 5C09B 1F8TL 3VXUD 3PGCB 1I3RA 3F6IA 1U8NA 2XQBH 5CUSL 3AY4C 4RGNE 1G7PB 3VG9B 2L0DA 3LZFL 2OTUB 3ULVE 1J1XH 2XT1B 1T80A 1EFXA 4Z76A 3OAYH 1G9MH 2AJVL 1ACZA 4Z0BH 4PJEF 2DWDB 2I27N 2C4XA 3ME0A 3CCHB 4ODSL 5KSAD 3EOTL 2P49B 5FUZL 3SDXE 2E8ZA 2EXWD 3DV4A 3NFSL 3BFOA 4L9LC 5HVGB 1CI5A 3RI5F 4KJYB 4TQEL 3LIZH 4MSWA 4RFNB 1CTNA 4PPTA 5IEKB 1JI1A 3UYRH 4EVNB 1QUNA 3HI6H 1KCSH 3MCG1 4G6MH 2NX5E 3STLA 3ZE0F 5C3LD 3MV8D 4KMTL 3LQZA 4BQ6A 1LO0H 1KBGH 2X4SB 4D3CL 5D7JD 3VXMD 4LPWA 1LHZA 5JUEL 3HHRB 5DD0H 1V3MA 2XV6B 4JQXC 2DAVA 2RQ8A 4N0CD 4JREC 4ONGH 2I07A 4TUJB 4Q2ZB 3L3GA 4LRNL 2BSTA 1P7QD 5E03A 2GCYA 3HNSH 1BBDH 4JHZA 3B9DA 2VLJA 1AY1H 2DRUA 2PYFB 3P4OB 4U1SB 2OL3B 2RB8A 1BWWA 5JNYB 1J1XL 1NAMH 3O45B 1RPQA 5E7FA 3RTQC 1MFAH 1VGKA 4PGEA 4NKQB 4NJ9H 4S1RH 3TFKC 3AGVA 5D5MA 2NY4B 1NMAH 3SE9L 1DR9A 1DZBA 2NXYC 1TZIB 2AK4A 2IH3A 2F19H 3BPLB 2QL1A 1OGAE 4G6ML 3ARGC 4MNHB 3DX6A 2P5WB 3EKCA 1LO0L 2E9BA 5J12C 4L8SB 2DQEL 4QRTA 1LD9A 1PKQA 3HE7A 3C60C 2ILLA 3R1GL 2EDRA 1IRAY 4ONGL 5F6HJ 4D2NA 4PB0L 1KPRB 4F9PA 3I6KB 5F44A 2DTSA 1TIUA 3HNSL 4NQEE 3LEVH 1BBDL 3KWWA 1WSST 3T4YB 2W9LA 4FQQB 3MUY1 4P2RD 1RZFH 3TBWA 1YPZE 4KHXL 1OTSD 3D3VE 4MA3A 3PHOA 4KQ4L 3SKNB 1JPGA 1MFAL 3S37X 3L3IB 1LEGA 1OQXA 5IFJA 3QDGB 1MELA 3BMVA 3N85L 2R0KH 1NMAL 4IRJB 4EDXB 4EUPH 5TE4H 5D7LB 1C08B 4ODHH 3FFCA 3RP1A 3KYOA 4F8QA 2C9AA 1G9NC 2ZUTA 3P9MA 4JO2H 2VITB 2DS4A 1GGCH 3U48A 2YUZA 3ARFC 1FYHB 1KV3A 1FO0A 4CJ0A 5DA4A 2A6DA 4TVPE 5I8KH 4R0LB 1R3KB 1JNNH 3I3EA 5GSRB 5D2NC 1HWGB 3GDBA 3VFOB 5IG7B 5LKNA 1KJMA 4PJHB 2C1OB 4LSVL 3LEVL 1T66D 3LY6A 4JPKH 5F7EH 1JPTL 1RZFL 4JM4H 1UC6A 2JB5L 4YDLC 4PV8A 4MQ7A 2DBLL 2OJZH 3LPFA 3K2MC 4JZOA 3O3EB 1EX0A 4K94C 2O26U 4KDWA 1T04A 4WV1B 5F88B 4N9GA 2R0KL 3QUKA 2KZ1B 3C9NB 1QSEA 2XKSA 2Y23A 3PL6A 3LKSA 3PWLB 4ODHL 4KWUA 4GMSL 1LWRA 4K8RL 5EC1A 3DX7A 3NIGF 3P3YA 4DKDC 1RULL 1EV2E 4UU9B 3AUVA 4G42A 4JO2L 4J2XA 1QRNA 5C6WH 3OQ3B 3WUWB 2XN9A 1BX2B 3GM8A 1M05B 1T7XA 5IKCB 1CGUA 4M8QB 1KJVB 3U7YH 4QNPE 2NY6B 3QEUB 3FRPG 4GQ9H 1JNNL 1W8OA 3BD4A 2X4NB 4KJWC 4OGZA 3RGVC 3TT3L 2AJSH 4YPJA 1ZWIA 3MV7E 4FQLL 4L4TB 1LEIB 3UTSD 5FKAA 4M5YH 3SCMC 1KTLA 2AJZB 4YIQA 4H0HB 4XTRD 5F7EL 4HC1L 1RZGA 3NCBB 2BERA 2X4RB 4HWBL 4LK4A 4QRPB 4NQXB 4OV5A 3GI8L 4P9HC 4PGJA 4EJ1C 5CINH 4K3EH 4Y16D 4X7SH 2OS7A 3EZ8A 1CXHA 4U1NB 5KVFL 4UQ3A 1F58L 1MPAH 4S1QH 4PJ5A 1VESA 4Y5XA 4Q74A 1O5DT 5GS1A 3Q2CA 3FQWB 3BZDA 1SEQL 3ISWA 4XPFL 3WFBH 1CFVH 2QSVA 4WFED 4XPTL 4D9RE 4ENEC 1CTOA 1S8DB 4M7ZC 5C2BL 2WWMC 4M93C 3X3FH 3SJVA 4XT1C 1XEDA 3MOAH 1VFBB 1J1OL 3RAJH 4UB0H 3S34H 4LVNC 2O5XH 3DMMA 4U1GB 5SX4H 2XZZA 1RK1B 3SDDB 3UTPE 1NDGA 3AMLA 4QXUH 2JLLA 4N8VG 4XP6H 5EOCJ 1GJIA 1YMME 2GTZA 4TSAL 3G6JE 1TTUA 1F4WL 1A6AB 2GJZA 3KPPB 4PJBB 5IQ9B 3CFDB 3F58H 2BNRB 2G60L 3G9AB 1OAYL 3C5JA 3DIFB 4HUUB 4F15C 1EEZB 1CYGA 3MNZA 3U4EA 3NA9H 1U41A 3QCVH 4RX4D 5CINL 1PQZB 1A5FH 2B2XH 1VA9A 5IBLC 2NW2A 1NSNH 5CJ8A 4LL9A 4MCYA 4N9OB 1MPAL 2DM4A 4OSUH 5JDSB 4BJLA 5IR1A 3MREB 1VACA 2OQJA 1S7UB 3WFBL 4LKXA 1CFVL 3WNOA 4MJID 2X4UB 1G7JB 4F7CB 2ATKB 4PJAF 2MKLC 4X9BA 2YPVH 1YEFH 1FG2B 3GSUA 2JJTA 3KPSB 4Z0XB 5MEOB 3H7LA 2I9TB 3H0TB 4Y2DC 1FPTH 1MHCB 1AR1C 3TYFB 3RAJL 3WO4B 1KGCE 1N2RB 1OAZL 4XCEA 3DO7A 1I1YA 2YOCA 4Z9KB 2H6PB 1JK8B 1ETZA 4QXUL 1AC0A 4EOWH 4XP6L 1RUPH 2YR3A 3MJ9H 2YC1A 1N8ZA 2HT4D 2MPAH 1J8KA 3IU4H 1YY8B 3U79A 5GGSA 2GT9B 3K1DA 1JRHH 3N1PC 4ZO6A 4PBXA 2F53E 1ZSDA 2OTUA 3BMWA 3U1SL 3QCVL 4PGDB 5DRNB 2A73B 3O8XC 4BFEA 1NBZB 3BN3B 4M6ML 3SDXB 4NHUA 4HQQL 1V3KA 4KKNA 5DUML 4MXQC 4UIKL 1MH5B 3GJFA 4JZJB 5EOQH 3TO4C 1YEFL 3PF2A 4CJ1A 4KHTL 2NX5B 2G75A 4TULH 3VFTB 1QZ1A 2VLMD 3QUML 4EVNA 1OAUL 1DTUA 2XZAL 3IFOB 2E9IA 1MQ8A 2FX9L 2X4SA 5A1AA 5DJ2A 1OTUD 1H5BB 1NCWH 1HXYA 5EB9A 1NCNA 3ZKND 2B8OT 4WUUB 3UDWC 1OT2A 5BZWB 1R3JB 3HNTH 4Q2ZA 1QNZL 3GUTB 2MPAL 3IU4L 3D5OF 2VSDA 4XWOC 5T3XL 4GS7B 5HHPA 3KJ4B 3IU3B 2GW5A 3QDJA 1W0WA 1EUUA 3KYNA 2PYFA 4KKCD 5MEPB 1ZVYA 1JTPA 2PF6A 1CQYA 2OLDA 3JVGA 3I6LE 4MHHI 3LRSA 2CMRL 3QWRA 3QNXB 3ZHKA 2LV4A 1D6VH 4HZAA 4X6DA 5CJXC 1WT5C 2BVUA 1NFIB 4DGVH 4OCXH 2FBOJ 2HFTA 2YPLB 2EDYA 4NCC2 1MCJA 4JY5H 4BK5A 5JOFB 1S5IL 2R2BB 2Q87A 4BFBD 5KN5B 1CDJA 1FORH 3AB0C 5EOQL 4NOBA 5FYLE 3V5HB 5BJTB 4Q9BA 1OGAB 3AAZB 4JN1H 4FTVD 4JDTH 2X7LB 3T3ME 4HK0A 5DHYB 1IGMH 1MCCA 3KXFB 5TDPA 2HAZA 4U0RB 2P5ED 2B1HL 5HDBE 1MHHB 3D18B 2YD6A 1Q1JH 2YMXH 2WIIB 3C5SA 1JHTA 3HNTL 3RWHA 4OCYL 4M3JA 1IFHL 1MUJA 2AV1A 1DVFD 4XBEH 4WIQA 2GY7B 1T2JA 1NJ9A 3O11B 3T4YA 1WCQA 1YPZB 4FQQA 4TSBL 1NBQA 2XTJD 3S37H 3WS6A 2X40A 2HVJA 1OB1A 4ISVB 4JPIA 2HLFD 3SKNA 1NC2A 3N50A 3QPXH 3BJLA 4MA1C 4NKIH 1IGFH 4QF1A 1EVTC 4R97B 2B5IB 3HE6B 4IRJA 2X05A 1A6WL 5EN2B 3HZKA 3UROR 4V1DE 3GK8L 2IG2H 1T0PB 1OARH 1TQCC 1U8OB 2AI0L 1IGYB 4HFUH 5F9OH 4DJMA 4JDTL 5HHOA 4KVCL 5T1MA 4Z7OF 2EO1A 1AJ7H 3IS1X 3D0LB 5ALBH 1T0NA 4NNPL 3QWOB 4NO3B 1MAKA 2CKNA 5AUMB 2EE3A 5DK2B 3ETBF 4ZG1A 4P9ML 2CRYA 4ZS6C 1R3KA 4RCAA 2FR4A 3D2UD 3QUZA 1U8PB 5ECJE 4PJHA 2C1OA 5JW4M 2VXSL 2ICEA 2R4RL 1V7MH 3NIFF 3Q6FB 4FG6C 3S37L 5KS9B 5EO1B 3NBNA 2A6IB 4CVUA 4Z7UA 2LTQB 4OLEA 2EKSA 2AJUH 1NC4D 2R8SH 3KPRB 2M8XA 5F88A 4F80A 1U93B 3PWJB 4NWTH 1EJ6A 4HS3B 1Q0YH 3F7QA 1G1CA 1OARL 3RJDA 1XH3A 1TXKA 2P43B 1LDPL 1A1MB 3IDJA 4PRIE 4ODUB 1TVHB 1KJ2H 2YZ1A 4ZPVA 3SE4A 3EDJA 1UQSA 5ALBL 1BX2A 1UH3A 1M05A 1I9JL 1TJGH 3K80A 4FQXA 1KJVA 1RUQL 1T21A 2C4FU 3BEVB 3ARED 5I1LB 3RVUC 4P3CL 3TN0D 2X4NA 5DSCB 3MV7B 5I18L 1QO3B 3HG1A 4PJ9D 4U05A 2NY7H 2DLEA 1RIUL 1V7ML 3B9AA 4BQ8A 2CDEA 5JW4N 1JZ7A 5D8JH 4QRPA 4HPYL 4PY8J 3GSOB 4JO3H 5DFWH 3DRQA 4M00A 2MTPA 4KJPC 1BZ9B 4PJFE 4FZ8H 3CMOL 2PR4H 4JRXD 3KNBA 1ZLVK 4NQUA 1MIML 2F5BH 3THMH 5F9WB 3NCMA 2E3VA 3FQWA 4H5SB 2X44D 1LK2A 4LU5H 1XGPA 4LLQB 1DBKH 5F7UA 1MCOH 2W65A 4ZFZB 4YNYA 4X6FA 1JGVH 1U36A 5KOMC 1VPOH 4XX1G 2DQGH 5EO0A 4V2BA 4P46B 3P4LA 3VXSA 1UFUA 5C07E 1TJGL 1UADC 3OAZK 1S7TA 4X6CF 2EKJA 2ED7A 2QSQA 1OVZA 3NPSC 4U3XA 1QOKA 5FO8B 3VXOB 2BNRA 4PJXE 1NGPH 3NCFB 1GZPB 3DIFA 4OD2B 4XVJL 1AKJB 1QR4A 4OIIH 4YX2L 1QVOB 3HE7C 2Z9TA 2X4PB 3J7HA 4M61B 2BOCA 5IB4B 5KOVC 2P24B 3O3DA 3PQYE 1CDGA 2WAHA 5E4EB 5JA8B 4G6KH 4FZ8L 1BIHA 4JQIH 2PR4L 5JXEC 3BGAA 3THML 3V5DA 3RDTB 3UTTE 4OFIA 4WWID 4U6VH 4RMSA 1DBKL 5F1SA 1MCOL 1XIWA 3O6KL 1S7QA 2ATKA 4F7CA 3RTQD 2DWEB 1I3GH 1JGVL 3VE0A 1VPOL 2P1YA 5F71A 2DQGL 3MBED 3TFKD 3IJHB 1A02N 1FNGB 3QA3A 3L3HA 1XGTA 2FNBA 1QLFA 5ADPL 3TYFA 5KJRH 1I1AB 3FKUS 1WJ3A 3BAEH 2F54A 3UO1H 5CP7A 3RWDB 2H6PA 3U7WL 4KRNA 3BWAB 3FB5B 4L29A 1FNEA 3VXNB 4MLIA 4DGIH 4RRPG 2CXGA 1V7NH 4R3SB 4NP4L 3OF6A 3V0WL 1LK3H 5ID0A 2GT9A 1FVEB 4JJ5B 3CXDL 3NFPA 2IFFH 3C60D 4LRIC 1C12B 4YAQB 4YHLH 5CJQH 1HH6B 2NY2C 4O4YL 5ESVA 2IBGA 3R8BB 3HRZB 2NR6C 3IJSA 4IS6B 1ZHKA 5DZNA 3SDXA 4HGMA 4ZUSA 2YXFA 2R1WB 4AIXA 4J3OC 4YHZH 5HYSA 3DGGB 5H37H 5DMIH 3BT2H 4MA8H 1OQOA 4GLRH 1G6RB 1YJDL 4QRRD 4R96B 5BW7A 3HUJE 3EOAB 4JM2B 1XT5A 1JNLL 5DD6B 1RHHB 3NVQA 2NX5A 1TJIL 3EO1B 3MR9A 1YQVL 4GKZB 5DD5L 3BP6B 4HZLA 1OLLA 5J0BA 3IFOA 5KJRL 1VFAA 3B9VA 2NTSP 3BHBB 3BAEL 4YGAB 1INDH 3IF1B 3K8KA 2YN5A 4KUZL 3NFNB 3F7VB 4FZEL 3WHE1 2PYEE 2BNQD 2WIMA 1ADQA 2Z8SA 1LK3L 2A6KB 5C08D 1FCGA 5F89A 3ARFD 5M94B 5ALCH 4HUXB 5EO9A 4MD5A 3O6MH 3T1FB 3DUUA 2VRAA 3JV6B 1J8HD 1K4CB 3BZ4B 3PWUB 4OLUL 3TBTB 4UT7H 1J5OL 5HPOA 3V4PH 1NFIA 3TCXA 4BA8A 5IROA 5TE7H 2R1YA 3QUYD 1UVQB 5IB1B 3GSVB 5IFHH 1JL8A 3C6LB 3CLFH 5KN5A 4S1SH 3U82B 5JXAH 2B1AL 4ERSH 3BUYB 3HLAB 4NQDD 4Y4FA 1OGAA 5LVEA 4POUB 3MLXH 5SWQB 1F4AA 4EI5C 2EDQA 4OZFH 1T6WA 5DHYA 4N90E 4JKMA 4OZGF 2OX5A 1XF2B 5C0FB 4KRLB 4NBYB 4FQCH 3O9WB 1YECL 4JKPH 1IVLA 4NM4L 4TSCH 3X14B 4GG6B 2EDOA 4M9PA 4NQEA 1FVDA 4ZUVA 4BFIB 3KPLB 4NN6B 1S9XB 1YPZA 3D3VA 1FL5A 3LEXB 4OGXL 1P1ZA 3W9EA 1ZLWH 3FHAA 2PXYD 3VXUE 3DBXB 5ETUA 4XP9H 3RGVD 5EZJA 1KCRH 3QIUB 4UMGA 2PW1B 1P53A 5ICXB 1A0QL 2VABA 4H25B 4M43H 4GXVH 4MS8C 4WI6A 5BRZB 1TNMA 3BP5A 3D69A 4RBPH 1AHWC 1H3WM 2ITDB