3IJYA

Structure of s67-27 in complex with kdo(2.8)kdo
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
215
structure length
215
Chain Sequence
IVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSNNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Immunoglobulin light chain (IGG3)
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
total genus 46
structure length 215
sequence length 215
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijyA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijyA01
1U8PA 5I16B 2DLFL 5IVNA 3X17A 4M7LL 3L7EB 4WO4C 1ZWIB 4O4YH 1N6QH 4EI5B 4KI1A 3BE1L 4HXBH 1MHEA 1R0AL 5DC4B 1V05A 1R24A 4CJ0A 3S37L 2VDLH 1XGQA 4XRCB 3PWPA 4XX1G 2ARJA 3EOAA 1AHWA 1P53A 3L5JA 3K46A 3MBEB 3SE4A 5CGYD 4WEBL 1N3NB 4LFHD 5IMKB 1OTUC 2BRRL 1WF5A 1WFTA 4PJIE 1KJ3H 4M48H 4NN5B 5FCUL 1F02I 3BXNB 1J11A 3WDIA 3TBVA 1T2QH 1NFIB 3WFCL 3BPNC 2E6QA 5KSUB 1S9KC 3VI4E 3IDUA 2IADA 2AQ2A 3TBWB 3H9SD 5F93C 3GMQB 4MB4A 1AI1L 2PO6D 1MRCL 4JFQB 2EZ0D 4V2BA 4DZ8A 3QNZA 3OL2A 1ZHNB 3HFML 1NMCC 4PBVC 4WFFE 5DMJB 5DMYA 2NY1B 1ERNA 4GQ9H 4OAWB 4AT6A 1S5HA 3DGGA 1N59B 3HZMB 1PKOA 2AJVH 2E7HA 5GSRA 1NJ9A 2W0FA 1XR9B 2Y5EA 3PHQB 2EDJA 4L5FH 4BK4A 3UEZA 3ORJA 3H0TA 4LL9A 3U4BL 2GSGA 3HC4H 1RZIB 3C6LA 3VFVA 5GS0H 3FMGH 1SEQH 2EKSB 3A6BL 4WFHE 3QCTH 2P8PB 3P4LA 2VLJE 1K5NB 4MB5A 2XKUA 2PXYD 4PRHA 4LSDA 2D03H 4F7CB 3FAWA 1U3HD 3RBGA 4EIGB 1CT8B 3TYGH 3UC0L 5BRZE 1WEJH 1OAKL 3IDJB 4Y4KD 4YZFE 3ECBB 1H9VA 4C56B 4V1DA 2IFFL 1XF1A 1FCCA 4J4PA 2C7UB 3S9DB 1KLFA 4OGYL 2NZ9D 4PY7B 2GK0A 3H7BB 3JTSB 3PWJB 5JO5B 1MRDH 4I2XE 1XF4B 1K2DA 4LF3A 1GGBH 3RUGB 4Y5VC 4NO2B 2P8MB 3ARWA 4L9LC 3WSQH 4XCYA 4TSAH 3STZB 1CR9H 4X9GA 1WCQA 2DQDL 4Z0XA 2X7LB 2I9TB 3LHPL 2R1XB 2ATPA 1E27A 3ZT7A 2F8VA 1KCLA 1H8NA 1MIMH 4NO0A 4H25A 4X6BB 1IEAA 1ZGLB 3BKCL 5E8EB 2Y06L 1CQKA 4U31A 2X4OB 1H3TA 4K9EH 4KUZH 5DEFB 2DS4A 1VEPA 3NACH 3RTQD 1DBML 4BZ1L 4OTXH 2J2ZA 4LLYA 2IBGA 3MA7B 4ZPVB 4KH2A 3KHOA 3O4OC 3DX9A 2VDKH 4IJ3B 2FR4B 2WW8A 1ZMYA 1QRNA 5IG7B 4F7PB 3BDBA 4LCIH 4B7IA 1NLDH 3VWJD 5EWIH 6CGTA 1WWAX 4MB3A 3KPPB 4HS8L 1Q9KB 3OKOA 3W9EA 4FFYL 5DVMA 1HSBB 5IQ9A 3U9PL 3BWUC 4I48A 1JWSB 3HPLB 5GGVY 3WFBH 4HS3B 5H37H 1LO2H 5KSBA 1FNAA 2CRMA 1S9XB 1LDPH 1MSPA 3ARBD 3WYRA 4FTVD 4TVPH 4HXAL 5BZDB 4BH8A 4ODTH 1IT9L 1WITA 4F8QA 1AKJB 4HKJB 2E8YA 5AUMA 5FGRA 3JV4A 2AABL 2APWA 3CPLB 4JY6B 1MFCL 5C0BE 4S2SB 3BISA 2HWZL 3P77A 4N8VG 5TE4H 2DMKA 5EZJB 3S8WA 4M43L 3MFFB 1GVIA 1EEZA 2X2YA 2XWTB 3A6CL 4HQQH 5C9JB 5T3ZD 3GRWL 3H9SA 3TLRA 2AJYL 3GJFB 2UWEE 1A6WH 2PO6A 3KPRE 1RVFL 1XGTA 4LEXH 5A43C 3CLEL 2Z91A 1IGIH 5E08L 2X6MA 5TFSL 2ZUWA 3F7VB 4JDVB 4LQFL 4M4RA 3TGXA 4TVPE 4QHLA 5FAAA 1GOGA 5CLTA 4PJGB 5IMLB 4Y4FD 3LAFA 1I9JH 2AEWA 3BAEH 4Q9QH 4FQQB 4P59L 4MAUH 3LCYA 4Q2ZB 3V0AC 1OTSC 4LSQL 4R90H 1NGXB 5IVXA 2YD3A 3CVHA 4L3CA 3SDXB 2LQRA 1T1WB 1UEMA 4AYFA 3DSFH 3FO0L 4PTUA 4YNYB 4W68A 2UYLA 4I3RH 5J3HD 2YOCA 3O2VL 3LKOB 3GUTA 2PXYA 5C09B 2O61A 1U3HA 4QHKJ 5ID1A 2AI0H 4YXLL 2QSVA 1T1ZB 2IANE 5EBWA 3C8KB 4Z0BL 1IZKA 2LU7A 2YA2A 1KYOJ 2PYEE 3WXWH 1OT2A 3HZKA 3W39B 1VACB 3ZYZA 1FNLA 3T2PA 3EHBC 3FOMB 4GW1A 2Y4SA 3DX8B 2JB6B 4HWNA 4ELMB 3VDAA 3TJHC 4QXTA 3QA3B 4LAQH 4BJLA 1KT2A 5BZWA 1GSMA 3MRKA 3RIAF 4WO4B 1KELL 3TZVD 3E8UL 5CBEA 1TMCB 2BNRE 2NW2A 1PDKA 4TUKL 1MEXH 4LSPH 3MRPB 3MV7D 2R0LL 3BVNB 1H0DA 5IBTH 2G2RA 5SX4I 3RTQA 3M8OL 4I9WE 4YDKL 4HBQA 3OJDA 3MLSL 5C08E 3PGCB 2Q8AL 3HAEB 5BJTB 3QEUA 1QBLH 4HWZA 5DC9B 1N8ZA 2XFXA 4Z7NF 3L9RA 4HFUH 4PJEE 3QFJE 5IJVA 3SQBA 5DK2B 2X4TA 1I3VA 1RUKH 3SQOL 3BPNB 3VWJA 4BZYA 5HHXL 5GGRB 5CGTA 4HX1B 2YD8A 2G75B 1KIRB 43C9B 3EYSH 5BVJA 3T04D 1FG2B 3CCHA 3D1MC 3SDDB 4LSRL 4LNRB 4HKXB 3C5JB 1TPXB 4I1NB 3VFNA 4OGXL 3ARBA 4FTVA 1YY9D 4NRZB 3KLDA 5EOCJ 1LP9E 5EA0L 3PG2A 5C6TL 4PV8B 2JJTC 4Z5RA 1WBYB 3PWNA 2ICWB 4K3EL 2D31B 3TIEB 1YQ2A 3HCVA 4QRUB 4CNIA 4MA7H 5K9OB 3NAAL 4UMGA 3FCTB 5ACLA 1ULVA 4J2XA 2GTZB 1B0RB 3QQ3B 5C6PB 4HH9B 2QADD 3QDJE 2AXJA 1CICC 1OW0A 5J6HA 3NN8A 3HG1D 2HFGH 4RZCB 1FRGL 4AM0A 1S5IL 2Y7QB 3HR5A 1N7MH 4JCLA 2FHBA 1QSED 4LPUA 5J12C 3QUZC 5AD0A 3OKLA 1A1OB 4ETQB 3NFPB 2E9IA 1BQHG 3BH8A 2MCPL 2YK1H 5E2TH 3C2AL 3G9VA 3IT8D 4A2LA 3HNTH 5IEHB 3RDTA 4HUMB 3KWWA 3J7HA 3LV3B 5IOPB 4GT7A 1GIGL 4JFFB 3VRLF 1DBKL 4L8SC 1KB5A 2J6EH 1MJ7L 4YDLC 3DUSB 1MI5A 2ZPKL 4RMQA 3PNWB 3WKMH 4S1QL 1GGCH 1XR8B 2C3WA 4L9LB 5FDWB 5E6YA 2BRQA 2CQVA 4QHUA 1AGDB 5GGRY 3EGSA 4W6YB 1OB1A 4N8PA 1G7PB 5EH1A 1YQVL 4F37K 3BP5B 2YRZA 4HHAA 5EN2A 2LAGB 3L7FB 3CJJA 3FQNB 1BJ1H 5L2KB 4FFVC 4KQ4H 1FNSL 3DBXB 43CAA 2WUBL 2EC8A 1NUDA 1CDGA 1XF2A 2QHRL 5I1DA 3V52L 5I1EH 4OLYH 4HLZG 4PJFF 2YMXH 1HKLH 3O4OB 4PJ7E 5D7LD 3MRMA 3FB5B 2BSRA 1IL1B 4KRPD 4Z95L 4U1IB 3BKML 4M6NH 4LCWA 5A2LH 3MCKA 5FYJU 4JKPH 1P7QB 3X3GL 3HZYB 3VDCA 2Y6SD 1TZIB 1MFBH 5FYLL 4KJQD 5A3IC 1LE9A 3TZVA 1PX3A 4LKXA 1BAFH 4XWGL 1GRWA 1EEYB 2P5WD 1ZSDB 4R4NC 3ZTNH 1Q1JL 1U8JA 2CUMA 4X7SH 5DDHB 4QXGH 3KJ6H 4ONFL 3E1F1 3CFKB 1R5WA 4KZEH 4OCWH 1EEQA 3MROB 3MLYH 3MRRB 1DSFH 3LN5B 4C59B 5E1HB 4PB0L 4YHPB 3T0DA 3TBSA 5IB1B 4FQLL 3GSNA 3KPOB 4HWBL 4H26A 4MAYC 4ONGL 1WK0A 2B4CH 2JKXA 3DWTA 3N9GH 4X9IA 2JCCF 3U7AA 3EYQC 3IRPX 3VXNB 1B4RA 3RVXC 3KVQA 1NEZB 3CFEA 1UGNA 1BM3H 3LN4A 5FB8B 4U49A 5E03A 2HLFC 2C5DC 1W8OA 1X5YA 4ONHA 2MFNA 2OL3L 1JPTH 5CZVH 2BVUA 1FZJA 2M8XA 3GGWA 4MVBC 3PQYD 2FWOA 2V2TA 4JPWL 3HG1A 5BXFB 2NX5B 4O2FA 3KPLA 1QSEA 1ZHKB 2IQAA 3QIWB 1YEIH 1IBGL 5DMGC 3FQTA 3NFSH 3SKMA 1T4KB 4GBXC 1F13A 3HI6L 1FV1A 3BDYL 3RPKA 4A2MA 2R29H 1MCBA 4MSWB 2MOVA 3QCUH 1AXSB 3TPUB 4MA3A 4TTGA 1BHGA 3FFDA 5DK0A 4AIZB 5C07E 3VWKB 2V5YA 2JELH 2AK4B 3QIUC 2VNCA 2H9GA 5T3XE 4FQJL 2Z93B 2P43B 1FP5A 3P0YH 4HIJB 4LMQI 4NQEE 1N64H 4R4BA 4YQXL 3RFZC 2MHAB 4RGOH 5JW5A 2EEAA 4M62L 5ALCL 5SWSB 4Y16D 3A67L 2R2EA 1BQLH 3GK8H 4MNHB 2E9BA 2X4QA 4G8IB 4OZHA 1U2CA 1N6VA 3MBXH 1TVBA 4MJ6B 5JIPA 4HAGA 3VXMD 3TA3C 2XWJA 5FM4A 1JYXA 5L9DH 3D0VA 2X40A 3IDGA 2CRIA 5CZXC 4JZNA 5D7LA 1A6VH 4X4XB 3CH8A 1XGUB 5F7HA 2D2OA 1YEDB 3WS3B 4O5LL 3DOSA 4U6YB 4QYOA 4N5UA 1CFQB 2AW2A 4DKFL 1QP1A 3MMEB 5E1AA 2Q7YB 1U8OB 2EE9A 4ZOAA 2F74A 5DZOA 5JIIA 4XHJC 5JORB 2C4XA 4UQ2A 4UNUA 2P5WA 4WTWA 1AJ7L 3GI8H 3BIBX 3JWDL 5CEZH 4GS7C 4CVWA 5F9JA 3RWJA 3KR3H 5JXEC 5I1CH 3QO1B 5HYIA 3KDMA 1OSPL 4FQXC 2D4DA 3TV3L 2F53D 1F4WH 1PD6A 1INQB 4HUXB 3BD3A 5DA0B 3AFLA 4EDWH 2WAHA 4O51B 5FHBH 4XVJH 5GS2D 2Q6WA 1CICB 3WNNA 3M1BB 3EYOB 4WW1A 1SY6A 2H1PH 1WIPA 2VLRD 3U2SA 3W2DH 5D7SL 3QO0A 5J12B 3F5WA 4D8PB 1JGEB 1WC7B 1YEGL 3QUZB 1IM3A 3BIKA 2YEZA 2VABB 3QULB 3PJSA 5D8JL 4JO1H 4NZRH 3NIFE 5E94B 4RAUB 4X6DB 4Z7UB 2AJZB 5EORH 1QO3B 5CEZE 4WHTA 3F8UB 1DVFA 3MV8B 1YEEL 4X7TA 3KXFD 1A3LH 1JWMA 2W60A 3VRJB 5TPWH 1IM9D 2W65A 4IHOA 4WFHD 4YDLB 3IU4H 4N5ED 1HQRB 3LD8C 4NHUB 1KTKE 4ODSL 4JZJA 3PQYA 1FJ1B 4I5BA 5F7DB 4O02L 3P11H 3QUXC 4NYLA 1FH5L 4M9PA 2GJ6E 5D70L 1AGBB 5BRZD 25C8L 2CMRL 5J56B 1NUGA 2ADIB 2KKQA 2ZCLL 4GAGH 3E3QC 2P44B 3GKWL 4J1UB 2VE6B 2ZCHH 3VE0B 2H32A 5FO8A 3HMWL 4LSTL 1K4CA 4JG0L 4LU5H 5GRWA 3MLVL 2CK2A 2D3VA 4WCYL 2MQCA 3EOTL 4OB5H 4WI5A 1A6UH 2YN5A 1BMGA 2DJSA 1I75A 3HC0A 4QEGA 1GZQB 4P3CH 1BX2A 2A2QT 4LDEB 5FYKH 5GS0D 1QQDA 1S7WA 3QEHB 5F21B 4I3SL 1FFPB 5D2LE 4ODVH 1B0GA 3L3DB 3HMXL 3S36X 4NKDB 2XTJE 2VN4A 5F96L 3MRLB 2RBLA 3QHZH 1FL3A 3LKQA 4K3DL 5I8OL 1ETZA 4PR5A 4QRTB 5JDSB 4J8RB 2DI8A 4X7CC 5D5MF 4PJBA 1I1FB 4MLIA 1S7RA 3ULVC 5ISZB 1UCBL 3KYMA 4Y16A 1D6EB 3NCEB 2NY5C 4X6CB 2PTTB 2I25N 1A14L 1U3YA 1WVZA 4KK9C 5I1AB 4MXQD 4ELKB 4Q0XL 3VXMA 1S7TA 4I0PC 4U7SA 1ZA6B 4QY8A 3BEWB 1C5CH 5CCKL 1A4KA 3P40A 3OKEB 4P3DB 3WNOA 4NWUH 4YFLF 1NFDB 1NPUA 1I3RA 5FYKE 2JK5A 1JPSL 1J18A 4H8WC 2E27L 5DI8A 3EDDA 3SOBH 4MAYB 1OF2B 3NABL 1PY4A 4ERSH 1XCQB 1UFUA 5EC2A 4JLRB 1LILA 3GFUA 4F2MA 2NNAA 2CLZA 3MV9B 1ITCA 4JN1L 5F7UA 4YHZH 5DVLA 4PJ9C 1YEHL 5GS1A 3X11A 4N0CC 4F7MA 2A77H 4MMZC 4POYA 1MCHA 2HLAB 4JFXA 2RQ8A 1MLCB 4OFVA 1HE7A 3AS3A 4WV1C 4KRLB 4IRSB 4KKBC 3BW9A 3E6HA 4LASH 1DJSA 15C8L 5FXCH 2FATH 4WNQA 2F53A 1M05A 3VFRA 1SEBB 1XGRB 2VIRA 2XZZA 3AS1A 1Q9OB 1UKTA 5DURB 3PGFH 1C5BH 1PLGH 4LFHG 1BZ7A 2VLRA 3O6KH 3P4MB 2IPUG 2YBRA 1QFUL 1A0QH 4PGZA 2F58L 3LB6C 3TN0D 1D5ZB 1FAIL 1E4JA 4NKOA 4Q9RH 1A7RL 2GUOA 5C1MB 4KY1H 4R2GD 2VZOA 4HUWA 4X6EA 3TO4D 3LKSA 5DFVD 4UIMB 2Z35B 1JF1A 1MELA 5JOEA 3DO7A 3KXFA 4M5YH 4JRXD 5FHAL 3F7QA 1IM9A 3X3FH 1NH6A 1HXMA 1TQCC 2HKHL 3GBNH 4W81A 1MQKH 4ACPA 4MJ2A 3GHBH 3SE3A 4BFBD 2IAMD 5KVDH 3CSYB 1UVQA 4ZFGL 3MOBH 3QPQC 4EBQL 5BS0B 4PUBH 5DGRA 4CL7A 5BRZA 3I6GB 1HH9A 3RVVD 4XPBL 3RZWA 2PYED 4X8JA 3C09B 1U8NB 1EH9A 4U1KB 1UKSA 3WXVH 1G6RA 4XP1L 1EHLH 3UTTB 3SE4C 4XWOD 3DRTA 2ZNXA 2XYCA 4I2XA 3P0VH 2GQHA 4XNUL 1J8HB 4TSCL 5IW6A 4F57H 5D71H 3S88H 1MHCA 2UZIL 5T3ZL 4FABH 1S7QB 3MUZ1 4ENEC 5B8CC 1BQHB 3KPQA 1CCZA 1GPOL 4ZFOA 3DV6B 2BNRD 4UDUB 4RFOH 3BSZH 5DJYB 4UI2A 4YAQB 2P8LB 2B1AL 4X5XB 1Q0YL 1ZEAH 1JGUH 3ZDZF 4I9WD 5C08D 1MNUH 3OGCB 3L3KA 4K71B 2OTUA 5DT1H 1A2YA 4Z7WA 1F97A 3IETB 4E41B 4DOHB 1IC4H 2HRPL 1KB5L 3B2VH 1S7XB 4NQDB 3B2UC 3FT2B 4GS7B 3QFJD 1FZOA 3QNYA 3K3QA 5EUOA 3RY5A 4YHOH 2EIZB 4L3EA 5E5MA 5IR1A 3WKNA 4FQXB 1BLNA 5D1QD 1CD1A 3QHTC 2I60H 1JHKH 5KAQG 2PETA 3C6LC 1G7HB 2ZOKA 3TVMA 3MXWH 1OAYH 2VC2H 2H2SD 3VFWA 3ZDXE 3SJVE 3QUYD 5DO2D 3BQUC 5DS8B 3NCFB 1WTGT 4XP6H 1D9KC 3LQAH 2AEQL 4JFYA 1I7TB 3IDXL 5ID0A 1BVLB 1FDLL 2DWEB 3EFFB 2NTSP 4JHWL 2VDRH 2Q3ZA 1JPFB 4GW4A 2K3TA 3WFEH 5J1SC 2HAZA 1NAMH 1S9VA 2X4RB 2DQGL 3RQ3A 5HDQL 1OCWL 3QDJD 1T83C 4YBLB 4BUGA 2R0ZH 5EOQL 4P23C 8FABB 1HHIB 5ALBH 1YEJL 5C0NC 1ZANH 2GSIB 3LD8B 1FLTX 4AL8H 3WD5H 3QUXB 4KRNA 4XHQA 2RCSH 3IB4A 5I8KH 3FRUA 4KDWA 3EW3B 3QPXH 4MQTB 4PGDB 2XRAH 3KPSE 4S1RH 4DCQA 6FABH 3SCMB 1CTNA 3G6JA 3TO2B 3TN0A 4WI4A 1LO3L 4UQ3A 3GIZH 3OG4B 2N1KA 4KVNL 4G5ZL 1MFAH 3CDYA 3RA7L 2BY1A 3ZKSD 4YX2H 3T2OA 1P2CA 4OLWL 1FZMB 3BGFC 2WBJD 3GMOB 3GSNL 3TO4A 1M7IA 4HCRA 1HH6A 1ND0B 3MOAL 4EVNB 1J0KA 5I1HH 2FZ3B 2A74A 4G9FB 5GZNC 2FIKA 4JRXA 4NNPH 1BWWA 2NY7L 4IOIA 5JUEH 4M93C 3JWOL 1DLHA 1PKQA 1QNZL 1CF8L 1EA9C 1MWAB 3UO1L 1CDCA 5TQ0L 4HV8B 1EFXD 1CQYA 1CFVL 1KTLA 2VLME 1ACYL 3A6OA 1UJ3B 3UYRH 4OJFH 3KYNB 4Q58C 1IVLA 2YPKB 1FVEB 2PYEA 3P9WB 5LAXA 1CG9B 5D7IE 4ZNCD 4NCC1 2VXVH 2SEBA 4QHNA 1F3JA 4CVZA 4G8GD 3WL9A 2QTEA 2EDQA 4P9HL 5B3JF 3PP3K 5IVZB 1ZV5A 4RFEB 4XAWH 5T1LB 1QKZL 3WEXB 1RURL 3ROOA 1AY1H 5JR1L 4I0PB 1IC7L 2IPTH 4LLAA 3SDXE 5DTFB 4DN4H 1RPQA 1J1OH 1FVCA 1IARB 3GSXB 3T0VA 5E8NB 3RNQB 1NCWH 3CFDB 4PGJA 3GM0A 3Q6FB 2BOBA 2DQFA 3VXRB 3G08A 3HNSL 3NIDE 3Q2CA 2R69H 4X4ME 2DTML 3IFPB 4OZGF 3WDHA 4MNGA 4L8CB 2D7OA 2ZCKL 4XI5D 5IJKC 1FNHA 4JRYD 2VB5A 1U0QA 4WW2A 2XQBH 1IRAY 4WDIA 1W72A 3F7RA 2XNAB 4I8DA 4FQ1L 1KN2L 4UILL 3U0TA 5E0QA 4ELME 2G9HA 4DW2H 5L6YL 3G6AB 4QHMB 2IALA 3C8DA 3QDMD 3MXVL 3D3VB 5HHOD 1LD9A 4XZUA 3BGAA 2F54B 4D9LH 1HK6A 3BMWA 3SDYL 1ZS8B 2BSTB 3QUYA 3BZFA 1CIUA 2PXYC 1J7VR 1S7VA 3RIFF 2XG5A 1S7SA 3ARPA 4KK8C 2GKIA 3O2DA 2LVEA 4OCSL 3GSRA 5F3HB 5TE7L 3VXSE 4Y4KC 5CWSB 5EU3B 4ODWB 5DGQA 2J8UA 1ZXQA 2K7QA 5ILTL 2ZSWB 2C4FU 3PWVB 3O9WC 4TQEH 3MGAA 1A6PA 3EZJB 3QDJA 2BVQA 4YHMH 4GUPA 3T8XB 4PJCE 3E6FA 1U8PB 4I4WA 5EFIA 4NT6B 2AJ3A 1TQCB 4YE4H 3JSSA 5GRJL 1DEEB 4K7PH 3HUJA 1QUNA 4OIIH 2FJGB 3EYVB 5D1XC 1XCTB 1YMME 1F2XK 1MHEB 3WS6A 4RX4D 2WWKO 3ZL4L 3R1GH 1I7ZA 2X5PA 4GLRI 1XGQB 2QR0B 5IP4A 5JA8B 4JE4B 4LSSH 1OLZA 1KN4L 1NGZA 1Q9LB 5DD0H 5EO9A 5C0RL 1I9RL 4DVBB 3PXHA 5C07D 4M00A 2WBJA 2DDQL 4KVCH 2DM7A 1NC4D 2AEPH 3T3MF 1FPTH 1SY6L 4TPRH 2NXYD 3CFCH 4PB9H 4M1GL 3VD4A 1QBML 3TBVB 4NQED 1TJIH 3VWJC 4FFWC 4M8VA 1MCEA 5B8CB 4GJTB 1UA6H 1JZ2A 5DRWA 2CXKA 2HRLA 3KYAA 1VCAA 1EFXA 3U36B 5DD3L 3QJHA 2VOTA 1YZZA 3RU8L 4DZ8B 3U48A 5F8RC 5CEYB 5F1IB 3BOVA 2W9EH 5J11C 3B5TA 3TIDA 4G7YL 2ICWI 2A9MH 1X6NA 5KVEL 1LE5B 4WI8A 4G8GA 2AJSL 4PRNA 4AT6B 4PJ7A 4XBEH 1T0PB 4WI7A 4JFFE 4GG6F 1NJ9B 2J6EA 2W0FB 4P2OD 4QT5A 4G6FD 4QRSA 4PRAB 4LGRB 1UWXK 4N1HB 4E0RA 3H0TB 4Y19E 1OW0C 2GSGB 4J3WA 3C6LB 3VFVB 5CKGA 4LIQH 3W0WD 5CD5D 1W8NA 3MJ7B 3IDNB 3RP1A 3BQUB 5FA4A 1EBAA 3MLXL 4KJPC 4DGYH 4KZDL 3KAAA 1UM5H 5BVPH 2YUWA 4JGMA 2AK1H 1D9KB 1CGVA 1Z5LB 3BWAA 5M95B 4U1MA 5L2KE 4YHKH 5E24E 3L5XH 5D6DC 5F9AC 4L8DA 1KXTB 2EH7H 4V1DB 1F5WA 2BXYA 2DQHL 2O26U 4JRYA 3WFDH 4WUUD 1HINH 4Y4FC 2GK0B 2O5ZH 4JFZL 4XMPH 5D2NE 5JW4Q 3ESUF 1K2DB 4K94L 4LF3B 3HNVH 3KLSA 5HJ3B 4G43A 3ALPA 1OTTD 3QXWA 5KANI 2BP3A 4XCYB 4P23B 3QDMA 5EZIH 5HHOA 1IC5H 2VDNH 4FXKB 3FRPA 1B9ZA 4HDIA 4NO3B 4X9BA 1F58H 4AG4L 2PR4L 3UTPE 4P48A 5DUPL 1E27B 5J3HC 5HGDA 1JGDA 4HF5L 2AGJL 3FN0H 1JF5A 5HHVL 1IEAB 2E9WA 3WIIH 2XZCL 3GHEH 3V4VL 5CEZD 4PJAA 5HDOA 3MUGA 4LHQB 1A6AA 3UMTA 2BVEA 2CDFA 1MCWW 3UJTH 4HUKB 1JN6B 1F3RB 1DDHA 3BGFB 5A40E 3DX9B 4KDTA 4YC2C 4CW1B 1R3KA 4EDXA 2VSDA 3DJ9A 3TBYA 1QRNB 5BOZG 1GGTA 3LY6A 1Y18A 1AGFA 2HH0H 3KG5A 1BFTA 5F6HJ 4P2CG 5EZOH 4OFPA 3OKOB 1CL7H 3SE9H 4HLJA 3QXTA 3ZKNC 5IQ9B 4PJIF 3I02A 4U1LA 4I48B 2VAJA 2PUQT 4YIQA 1D5IH 35C8L 3MLZH 4PP1D 1U3ZA 1LK2B 5KSBB 1ONQA 3BHBA 4MDIA 4UUJA 5FO7A 3VI4F 1K6QL 3S35X 1FFRA 2LE9A 4YFEA 4NC1C 5T33H 4QRQA 5AUMB 3JV4B 3AB0C 4PS4L 1RD6A 1BBDH 4NKQB 1NC4A 2XTJD 3ARYA 3MLTA 2XICA 3X13A 3UP1A 3P77B 2J88L 1RZGA 4NQEA 3QEQE 4HKZB 1AQKL 4PJHA 1DLFH 3MZGB 3TNMB 5MP6L 1G7JA 4AEEA 4JDTL 4XP5L 1ZLUK 3V4PL 3LEXA 2Z92A 3H9SB 3GO1H 5LWYL 3HZVA 3U7YH 4LPCA 3JV6A 1XGTB 1OAUH 3MACH 5DSCA 2Z31D 2Z91B 3MV11 3U7WL 5ESQB 3SDAC 5EO0A 3HN3A 4MA8L 2B2XL 4EXKA 1A3RH 4QHLB 4HJGB 5A2IH 2OX5A 5D5MB 1AE6H 1EERB 1JPGA 4P2OA 4HIIA 4EQ2A 1WV7T 3Q48A 2GFBA 3O6FD 2AK4E 2Y25A 4LARH 1RSFA 4PRIE 4YZFF 5IVXB 1CDHA 4NGHL 3CVHB 4TSBH 1N2RA 4L3CB 4XC1L 2DLFH 1PYWA 4I77L 2FBOJ 3LOWA 3W0WA 4PTUB 1CL7I 3MJGX 3DX7A 4TUOA 4QTIL 4JFPB 1G6RL 3TH4T 3GUTB 2PXYB 5I0ZA 5SWSE 3BE1H 4P5TC 3VXOB 3K8MA 1Z0NA 4RWHA 2EE2A 1U3HB 4LVOB 1RIVL 1R0AH 4DUXA 5ID1B 4NSKB 3S37H 4I18A 1OARL 2XQYG 4Y4KB 2DJUA 3WIHA 2APXA 4WUUA 2OP4L 4WEBH 1INDL 4GW1B 1S9YA 1ED3B 4ZFOL 2BRRH 1U9KA 3T4YA 2EIEA 2CRYA 4GKOA 1ES0A 5FCUH 5LJYH 1NDMA 1T80A 3WFCH 1KT2B 4KU1A 5BZWB 1WEJL 4XTRD 3MRKB 5ITFA 2PCPA 1S7UB 5IF0A 1TZHB 3ZE2E 1AI1H 1MRCH 4ORZC 3OGOE 1H0DB 5E8DL 2G2RB 3BRFA 1WBZA 5CEXB 3RTQB 1X4YA 3OJDB 3RX7A 2NLJA 2LABA 3QEUB 2APBA 1N8ZB 4X5LA 3CFJB 3EAKA 3L9RB 4KUCD 1WZMA 1OD9A 1MIML 2DD8L 3GSOA 3M17A 4KRPC 2EE6A 5DMKA 1IFHL 2Q76B 2X4TB 4HJJL 3VWJB 2EDHA 3U4BH 4GXVL 2HFTA 4U1GB 2HKFL 4KUZL 5F7YC 3OJVC 1WUNT 1DBAH 4KJQC 3A6BH 5I15L 4Y2DC 4ZDHB 3SO3B 5TH2A 5AEAA 4H0IA 3CCHB 4JY5L 4KTYA 2J4WH 1NGQH 1XFPA 2VDKL 3ULUL 2QLVB 3VFNB 3ARBB 3LH2L 4NNXA 4WI3A 3OG6B 3UC0H 3D39D 1FNGA 1OAKH 3SE8L 3PXJA 3MRDA 5BW7A 3GZKA 1EIBA 2UWEF 3PWNB 2IFFH 4JVPA 5AYQA 3HCVB 5AAWA 4CNIB 4OGYH 4NDMB 1QSFE 1MREL 4BK5A 4GAJL 1ITBB 4X7FC 1LO2L 3MRCB 1WAAF 5J6HB 3NN8B 3H3KA 5JOPD 3HR5B 2NZIA 3P4NA 5JHLL 1OT1A 2DQDH 4MCYA 3LRSB 1UT9A 2CUHA 2Z31A 3BKCH 2V5SA 3LS5L 1JTOA 3BH8B 2Y06H 4HCRL 4M1CD 4Q74A 4QHKI 5JHDD 4KROC 3BUTA 4ZO7A 3BYTA 1LNUA 5HTSA 3S35L 4BZ1H 1YN7A 3KWWB 1A22B 4D9QE 2MJWA 4Y4FB 3CU7A 1KB5B 3U9UA 2A1WH 3SJVD 3IU3A 1KSRA 1KF9B 3DRQB 1WWBX 3V6OA 5ACZA 4CMHC 4YHNA 1KUMA 3MRGA 2BNQE 1F4YL 3HE7D 4QHUB 2X1QA 3CZFB 2BVPA 4ISVA 4W4NA 4W4OC 3KPTA 1UH4A 4HS8H 3EGSB 1OB1B 3I50L 4JZOB 4FFYH 2ITCA 3U9PH 3DROB 5ISZE 4HHAB 5EN2B 1TVHB 2VERN 4Y5YA 4D3CL 2ZUTA 1BZQK 2VJXA 4X6CE 4XNQB 4M5ZL 1KACB 1I1YA 3SGKA 3JXAA 5IGXL 1XF2B 3RI5F 5I1DB 4ZOCA 1IT9H 1XZ0A 1DQLL 4ALAL 2NY2D 3DLQR 3MRMB 1GYAA 1NFDE 2BSRB 5I6XC 2AABH 1MCJA 1MFCH 3NTCL 3MCKB 5JPNA 1TITA 1BP3B 2HWZH 2GK2A 3KPSD 4M43H 5E2VL 1LE9B 3A6CH 3TZVB 1FG9C 2X09A 3GRWH 2FX7L 4PJEF 5MEQA 4LKXB 2AJYH 3BYYA 1MJJA 4Y16C 2BVTA 2V7HA 2VDML 2EDDA 4LOUC 1RVFH 5KS9A 3MV7B 1W72L 3CLEH 3Q5TA 1U8JB 4LCCA 5E08H 1IEHA 1OP3K 5TFSH 4MNQE 5IB5A 4LQFH 3ES6B 3N50A 5FUCC 1R5WB 4IRJD 4XCCL 2KL6A 3CDGB 3AB0B 4Q6YA 5AG9A 4CADA 3DYOA 4FRWA 5EBMA 4P59H 3RHWF 3TBSB 3IKCB 1LP9F 3UPAA 4LRNL 2NMSA 4ZAKD 4KMTL 5TDPA 1E4XL 2GAZA 2CIIA 3FFCE 3O2DL 3QDHA 1B3JA 3FO0H 4OZGA 2FEDD 4OLVL 1T22A 1P1ZA 5HYJE 3O2VH 5GS1C 3QJFB 5BO1L 3T2NL 1AC0A 3MRFA 1IKFL 1RZFL 1U95A 1MFEL 2I07A 4OZFH 2WQRA 4YXLH 2EKJA 2VL5A 3D39A 4LCYA 2D7MA 4Z0BH 4XCEB 4XPAL 2BJMH 3TESA 2WM0A 5E00A 1A7BA 4XGZA 1FYHB 1MCRA 3H8NA 4A6YB 4OZ4A 4FOMA 4JM2D 1HDMA 2QADB 2DL2A 2FWOB 5HYQA 3O3EB 3HG1B 2V5TA 5CP3H 4TTDD 4LHUD 1OHQA 3NFNA 4I13B 3F6IA 3SGEH 3RY6C 4O2FB 5CSZA 1HHHB 3KPLB 1QSEB 3VD3A 1AIFA 1KELH 2W9LA 3E8UH 2IQAB 4JKMA 4DTGL 1ZA3A 1MUJB 5H35A 3T65A 4WRLA 4MXWH 3UTTE 2YSSA 4KJWD 3T0ED 4N9GB 4DGIL 5JHDA 2O5XL 1QVOB 1NBVL 1FV1B 5IK3A 4QTHB 4F9PA 4WHCA 1J8HE 3WUWB 3M8OH 1M7DA 4YDKH 3MLSH 2D0GA 1MCLA 1QPXA 1RUPL 2Q8AH 2DWDA 4MA3B 3TFKD 4N90D 1RAMA 1Q72L 1UB6A 2ARJQ 3FFDB 1FYTD 1J05B 5DK0B 2XWBA 3FL7A 5LXGL 3SJVA 2DQEL 3LQZB 4N5EC 2F15A 4JDZB 4X4YA 4POZD 3BFOA 5GSVA 4BKLA 1GGYA 3SQOH 3HE7A 3ZYJA 5HHXH 4R4BB 3VXSD 1SJEB 1ROWA 2HJKA 2R2EB 1V7NL 1AD0B 2XTLA 4LSRH 4E41E 2RJMA 1VFAA 1IILE 2WLZA 4OZHB 4HGWA 4OGXH 2YWZA 3EOYG 5EA0H 5C7XH 5C6TH 4ZS7L 4B7LA 2I5YL 1QD0A 5F1NA 3IDGB 4K3EH 1SJHA 4JZNB 5GS0C 5D7LB 3NAAH 5FCSH 3BP6A 4M7JL 3EO9L 3WNPA 4TNWK 4KRPB 2NCMA 3EYFA 1YMMD 4D94A 4NPYB 1QLEL 3KPSA 1ZLVK 2L7UA 3VFGL 1FRGH 5MEOB 2EO9A 1AO7E 3MO1A 4QYOB 4Y2DB 5E1AB 3ZKXC 3DPBA 2HFFA 4ZO8A 3PABA 4HH8A 3RVUC 2F74B 4X8XA 3QQNA 5F7FA 2YPLA 3KLHC 4UQ2B 2P5WB 1I4FB 3WFZA 1H5BA 2MCPH 2QQLL 2MTPA 1F4XL 5F9JB 1G1CA 4TOYL 5T1MA 3MUJA 3C2AH 3VGBA 3VFOA 3KDMB 2NY6D 1FNEA 2FSEB 1GIGH 1DBKH 2DAVA 2NXZD 3CFBA 4E9LA 1MJ7H 2ZPKH 1BAFL 3C08L 2Q6WB 5DJCA 4S1QH 1EO5A 4GRMA 1OQXA 5ICYA 3U2SB 4ZUSB 4X7SL 3NIGE 3QO0B 2VQUA 5D7IA 5H2BB 1V7ML 2EH8L 3KJ6L 4K9EC 1T89A 1RJZA 3F5WB 3ZZ1A 2ZKHL 5MEPB 2M2DA 1IM3B 3BIKB 2YEZB 4Y0GA 4ZG1A 3MLYL 3PJSB 1N4XL 1YQVH 1U6AL 4P2QD 1NCDL 3BD4A 1A7QL 3JWNC 4MJIE 4PJXA 3EBAA 5D7KE 1FNSH 2YUZA 2WUBH 1YYML 1CE6B 4I3GA 4Y8DC 4Y19D 2QHRH 4L4TD 3V52H 2ERJC 4YUEL 2V2WB 4X7TB 4Z7VE 3MRJB 2XQYK 5JPMA 2NQCA 3STBA 5HPOA 1G7LA 2W65B 1D5XA 3BRDA 3WJLA 4ZYKA 4KKCD 4Z95H 4CMHB 3BKMH 2E7LA 2H2PC 4NYLB 1I1AC 3X3GH 3FO2A 4GMTH 4LHUA 1LWRA 1H3GA 4OFYD 1OL0A 5FYLH 4S10A 3TN0C 4U05A 2W07A 1X3DA 5CZVL 4UU9B 4XWGH 1TCMA 5HHNA 1MCKA 3T0EA 2CIKA 1G6VK 1Q1JH 3MREA 4L9DA 3HC0B 3TO4C 5DFVC 5SWZA 1UEYA 4ONFH 3MNVA 2Z0BA 4YR6A 4R7NA 4ZXBA 1AXIB 1H3WM 2Y5TB 3UTPD 1FYTA 5CBAB 3QAZC 3QRGL 4PB0H 2HN7A 1PAMA 4RA3A 1A5FL 2JTDA 2R2BA 1NCCL 1T2JA 2PW1A 2P7TA 4FQLH 3S96A 2IAMC 4HWBH 3LKQB 1AGEA 1MLBA 4ONGH 1U91A 1ETZB 4LPXA 1C8PA 4PR5B 1JVKA 4PGBB 3VXRE 3VXSA 2FX9L 3AS0A 3RVVC 5DJ2B 1AC6A 4PJBB 1MCOL 5FYLE 3KYMB 4Y16B 1D6VL 5E70A 3RBSA 1L7IL 4JM4L 4S1SL 1CS6A 2GY7B 1V3JA 2FJHA 2X4SB 4XWOC 4U6XA 4X5WA 3MRBA 5I1GL 2DIJA 2H45A 3HS0A 1QFWH 3I2CL 1IAIL 1MAJA 1MVUA 3VXMB 1LEGA 3EKCA 3IS1X 3PP3H 2VUOA 4OZIF 5LGHL 4P4KD 1A4KB 2OL3H 1I3RB 1PGRB 2JK5B 5HVHB 1T1XA 4RGOL 4S1DD 1QEWB 5EU4A 5DI8B 1YMMA 1TNNA 4JPWH 3GM8A 3VG9C 3C60A 2NNAB 2CLZB 5E5RB 4P0DA 3VGGA 2GCYA 1BFVL 1XF5B 3DTXA 4HIEA 3WIHL 3SGJC 4XBPA 5GS1B 4PLOB 1P9MA 3X11B 3O2WL 4F7MB 4OD3H 1IBGH 4Z78A 4PJIB 3RVWD 4HEME 5IBLD 3BDYH 2ORBL 5K33A 5LGJB 4F8TA 3PWLA 3WBDA 1ZT7A 3OMZA 3BW9B 3E6HB 3NIFF 1JYVA 2XZAH 5D1QC 1RK1A 2F53B 3VFRB 2WSKA 2VIRB 2EDBA 4ZTOH 2DQCL 3NZHL 5I8EB 2H2SC 1BJ1J 4LKCB 2WP3T 3RL2B 1BZ7B 4FQJH 4BFIB 1MJ8L 4M6ML 2VYRE 1Z2KA 1VESA 4YQXH 1OP5H 3FHAA 4G9DB 3PWPE 5M7QA 4M62H 5ALCH 4NKOB 3CZJA 3A67H 3ILQD 4P2QA 2GUOB 1U8QA 1NDGA 4BFEA 1H3XA 3LKSB 4LPYA 4Y19A 2DICA 3UYOD 4L4TA 5GGSB 1A9BB 1IM9B 3BPOC 1HXMB 4R7DA 3U0WH 4GW5B 5TDNA 2VLJB 4NQVA 5DF0A 1UWEL 2DI9A 2NY3D 2FO4A 2ICEA 3GIVB 3SBWC 3GKZA 1XAUA 1UVQB 2Y9RT 3K8KA 1DANT 4JQXA 4OFYA 5TE6L 3ZT6A 2FJFA 3W11C 2DRUA 3KYKL 4O5LH 5BRZB 4F7TA 5BV7L 5GRUL 4DKFH 4KMQA 4JQIL 5D2LF 4X8JB 3DO3A 2JF1A 3JZ7A 1U93A 1WJ3A 5E8OA 1G6RB 1E4WL 4ZQKA 3STLB 3MTRA 1AJ7H 3DRTB 1V3MA 1K8IA 4I2XB 3JWDH 5B38G 2FX8L 1SYVB 2HG5B 2VISA 4U33A 1MHCB 4QCIA 1OSPH 3FKUS 3TV3H 1JNNL 3VG0L 1GHFL 4PG9A 3BEVA 3KPQB 4ZFOB 4MYWB 4PBXA 5KTEL 2KBGA 3OR6A 3R0NA 3FQWA 5J4MA 2XN9E 2F5AL 5F44A 4PRHE 2VTFA 2FLBT 2QQNL 5D7SH 3S97C 4Z76B 1T66D 1UENA 5F88A 3ZKXB 5J89A 5A2JH 3AU1B 3L3KB 1YEGH 4P2RD 1R3IL 1A2YB 2Q86B 4HT1L 1IJ9A 5D8JH 1R5VB 1N5YL 1PZ5A 3LRGA 1SJXA 5GQBA 5IMOB 4NFBA 1PW3A 1BOGB 1F42A 3K1DA 5I1IL 1FZOB 3LMJL 3QNYB 3NA9L 4APQC 3FT3A 5J9PA 1CVSC 1YEEH 5E5MB 4RQQB 5IR1B 3QG7L 5GGSY 5LQBL 2ZOKB 1UWXH 4JAMA 1XF3A 5DJDA 3VXQA 4YK4B 5HGGS 4YDIL 3VFWB 1S3KL 3KJ4B 3BKYL 4H20L 4O02H 1EO8L 2Q8BL 3CXDL 3K4ZA 5D70H 4G6AD 4Y88A 3RWIA 5CILL 4JFYB 5AZEL 1JRHI 25C8H 2CMRH 5F3BB 5HHPA 2ZCLH 1C08B 3GKWH 1I7UA 4GW4B 3HMWH 4LSTH 4JG0H 1SM3L 2OSLA 1JUFA 4WCYH 3EOTH 1S9VB 5FK9B 1QSFD 2F8XC 3NCYS 4NP4L 3UX9B 2MPAL 2ERJB 2VXTH 1EHNA 5AWNL 3WIFA 2DLGA 1DR9A 3D18A 2BSSA 2EEDA 2JIXD 5FA3A 3QP3A 3OF6D 4I3SH 2UWEB 4YGAB 4J12A 4JQVA 3HMXH 3U82B 2HVJA 2D9QB 3P9MA 4EJ1C 3OSKA 3AY4C 1I1AB 4OF5A 5F96H 3DVIA 3B3IA 2UV3A 4K3DH 5I8OH 4PG2A 4OT1L 4N0UA 4B41A 3QISA 3TN0B 1KG0B 4UQ3B 1UCBH 1YY8A 5J8OA 4D9QD 2OXGA 4AENB 4R2GB 1P2CB 3BPCA 5FECA 1A14H 1NCTA 3TO4B 3PDOA 2YA0A 1M7IB 1HH6B 4RMSA 1Z9SA 4E42A 1UM6L 2OMBA 4Q0XH 4WU5A 2BNQD 2GTWA 4B53A 2A74B 2FBJL 1P84J 1I8IA 1KLUA 5BCAA 4IOIB 3P0GB 5CCKH 3DV4A 2B4CC 3QAZB 1DLHB 4M7LT 5DD6B 3DSNA 1JPSH 5DEZA 2E27H 1CU4L 5I17A 4JEGB 1DQDL 2IAMB 3NABH 4MS8C 3QYCA 5F9DC 2OLDA 1KTLB 2ITDA 1JTTA 4JN1H 2PYEB 4PRPA 4KQ3L 2H3NB 2COQA 2SEBB 1YEHH 5EBLA 3ETBF 5E6IA 2OTPA 1X5KA 3WL9B 1MFDL 4WGVB 4JJ5A 4O00A 1MQKL 2YC1A 5I74B 2ENYA 3GMPA 2ENSA 3ROOB 2YD1A 4RGNE 4NO5A 2NXYC 5IVXE 2FEEL 3HC3L 15C8H 2X42A 4WY7L 4UINL 1FVCB 3IAQA 3LZFL 4OFIA 2B39A 4OBRA 2BNRB 1YPZE 1GZPA 4L4VA 1EHLL 3QI9D 3R4DA 3VG9B 3DXAD 2BOBB 2D0FA 3OQ3B 1ZLUH 2DQFB 4DKAA 3V0VB 1QFUH 2QEJA 2CR6A 5F1SA 5HGBB 2F58H 5C08B 5KVMC 1RZKL 5F7LB 1A7OL 4G8EA 4P2RA 1FAIH 4PRBA 2A6KA 2DL9A 3ZDXF 4OIBA 4QF1A 3IVKA 2ADJA 4XVTL 5JIKA 1JCKA 1A7RH 2VLKE 3AROA 4G8FA 3ZMRA 3QFJB 4WDIB 5DMIL 3M07A 2ZP0T 3BSZL 3U0TB 2QBWA 2EDFA 3FFCD 5D1QB 2G9HB 1KLGA 2AJXL 4LRIA 2IALB 4Q6IC 3QBTB 1LD9B 4XZUB 4YXHL 1OAXL 2HKHH 5CD5C 3VGHA 7CGTA 1EXUA 3QUYB 5EZLA 4ZUVA 4ZFGH 4PV9A 1O7SA 4EBQH 1L7TH 1S7SB 5FYJD 1RHHA 3M45A 3FO9A 4YBQD 1H3PL 3GSRB 4XPBH 4YHOL 2GITA 2AP2A 3SDCD 2J8UB 1CGSL 4K7PX 4RCAA 2X4UA 4XP1H 4HFWA 4ZUUB 3HRZA 5IHZA 1CTOA 2VC2L 4OLZH 4UT9L 1SBSL 3QDJB 2BVQB 1IAIM 4XNUH 4TSCH 1UM4L 3E6FB 3FONA 4KXZI 4I4WB 1YNKL 3OKYA 5EFIB 2JIXA 2CO6B 2AJ3B 2V9RA 5T3ZH 1OGTA 2DJ4A 2A0LD 3OF6A 1F11A 4HS6A 4MJ4A 3BT2L 2FECI 3I6LD 1GPOH 4NBXB 2R4RL 2DLEA 4JPVL 4GH7B 4NHCL 1I7ZB 1Q0YH 4ZFZA 1VPOL 4PJDA 1DFBL 4FTVE 3BUYB 3ARGD 4YDJB 1BBJA 1NGWA 1I8LA 2VQ1A 2HRPH 1KB5H 4PGEA 2HTKD 1YYLL 1AQDA 3OAUL 5GGUB 3WD5L 4XP4L 4AL8L 5ITBL 4IIQC 1P4BL 3BIAX 2BNQA 4QO1A 4XMKL 2XRAL 2E6PA 3VGFA 1UYWL 1AR1D 1T7ZA 4OLUL 3LKNB 4JFED 5T3ZE 1FGNL 3QJHB 4PJ5D 3MR9A 3SDXF 2QJDA 5FKPA 1JK8A 2R0WL 2QKIA 2AEQH 5IB2A 1FO0A 3IDXH 3NZ8B 1FDLH 4JHWH 4MA1C 4G8GB 4PJ7B 5I75C 4LVHC 2N4IA 1YJDL 2A38A 3MRQA 2DQGH 3MJ9A 4QT5B 3NIDF 4P57B 2XTJC 5HDQH 1MI5E 1OCWH 4QRSB 4NCDA 4OCLC 1W0YT 3HI5L 1T20B 4LLMA 5E2UL 2ZG1A 1K9TA 4MD0A 4CBPA 1ZE3C 4XVUD 2HT4C 5EOQH 5DVKA 3S6CA 1RIHL 5JLZA 3MNWA 4FS0A 2A9NL 1YEJH 2XPGB 1ZHLA 1BEYL 3CD4A 1AD9A 1D3CA 1HWGB 1AFVL 3QI9A 5FA4B 1P7KA 3DXAA 4L8BA 4ELMF 5C0AD 4NN6C 4RSVA 2HVKA 1TTUA 1BREA 3RVTD 1LO3H 4L8DB 3EO0A 3MGTA 4U4BA 3UZVB 2EXYD 4KVNH 4G5ZH 3ILPB 2DMBA 3RA7H 3HI1A 3F7YA 4PJ8D 4OLWH 3RWFB 3EDFA 3DUUA 3GSNH 3CMOL 3O6FC 1VFBA 5DQ9A 3BP7A 4LCWE 4FQCL 4XH2A 5CKAA 2Z8VC 3S7GA 3QDMB 5F7EL 2NY7H 3F65A 5HHOB 5CJXA 3AC0A 4HDIB 3JWOH 4XNYL 1IGYA 1OPGL 1QNZH 3S34L 1Y6MR 1CF8H 3QXVA 4M3KB 3UO1H 2ESVD 5J6GA 3PL6C 4MJID 4M02A 5EBGA 2IH1A 1CFVH 1ACYH 4UOW0 4PJAB 5IM7B 3MUHL 3MUGB 1BVKA 1A6AB 1U58A 4MD4B 1A47A 3HE6D 1TNMA 3PUCA 3J8F7 2EDTA 1VGEL 1V8HA 1UZ8A 3UJJL 1I8KA 1DDHB 3GI9L 4P9HH 3UTSD 4EDXB 3TBYB 4R0LA 4FNLL 1QKZH 2OCFD 4GMSL 4M6AA 5CJ5A 1RURH 1AGFB 5JR1H 5J06A 4MD5A 4Y5XA 1VGKA 1IC7H 5CUSL 5IV2A 4Y1AE 5JOFA 5HHQB 2FD6L 2IBZX 3UROR 1XIWD 1EK3A 1L4IA 1IAOA 4X9HA 1A4JB 4X98B 3QXAA 2YKLL 3BHBB 4MDIB 1FGVL 5FO7B 4OZFA 2AAVA 3HNSH 1WFOA 2DTMH 3ARGA 4LHUG 1YN6B 3BO8A 3MFGB 1OP3H 2ZCKH 2YHGA 4QRQB 5C07B 3ARED 3LIZL 5JMOC 2AV7A 4RMRA 5EO1A 1NC4B 4N0FA 1QLFA 4FQ1H 1P84K 2NXYB 1KN2H 3X13B 2WWKT 4UILH 4WFGE 4NQEB 3IFOA 3IF1A 4PJHB 5L6YH 3VA2C 5JW3L 2PW2B 3MXVH 4G80B 1G7JB 2X1OA 4JFEA 3C5ZD 3RWGA 1QSEE 3UAJD 4POUB 3HZVB 3JUYA 1EEUA 3IFLL 4PJ5A 1JMXA 4XNXL 4X6FA 3G04B 3O3DB 4W6XB 3V7AG 4OCSH 2ZOLA 5TE7H 1CD0A 3P30L 4F15C 3W82A 5I0DA 4HIXL 3B43A 3GSQA 2EICA 5ICXA 5ILTH 5GISL 4HIIB 3FB7A 2GFBB 4G6FB 1UXWA 5FGBA 2D0HA 2EYTA 5E9DA 5IW3A 5AZ2L 3S37X 2Z9TA 3DI3B 3P2TA 4Q6IB 4FMFA 3R8BB 1WZKA 2YUXA 1CGXA 4PFEA 3X14A 4TUOB 5T5NF 5B38B 3PGDA 2X9YA 3P73A 4HUUB 4YGVA 3OXSB 5CD3B 5C0AA 3ZL4H 4M1CC 5E4IA 4OZHE 3CX5K 3B8SA 2NW3A 2R23A 4NJAL 1KIQA 1VADA 5BQ7A 2LV4A 3IDIB 1KN4H 3V6BR 2E5EA 4NNYA 2NR6D 5C0RH 1K85A 3UZEA 2KH2B 1RMFL 4PJ8A 1S9YB 2DDQH 4KKLD 1CLCA 1KFAL 5D7LE 2GJZB 2OJEA 4R96A 3H3BC 3T4YB 1WWWX 1SY6H 1MQ8A 5IROC 4M1GH 1QBMH 3BI9X 3HE7C 5AYUL 5F6HI 4NN7C 2DLHA 5ITFB 4LLUA 2PCPB 3L3GA 4R26L 2ESVA 4YEEA 5IF0B 5KVGL 4LBEA 3AGVA 2HFEA 1F4HA 3D2UD 2Y36H 1K4DB 4OF6A 1HINL 5C0DA 4MJIA 5DD3H 2IPKB 3RU8H 4U0RC 5I9QC 1WBZB 4G7YH 1F3DJ 4MDJA 5KVEH 3HE6A 2V17L 4HC1L 2A6JA 2AJSH 3TYFB 3AAZA 3UTSA 3HLAB 2VAAB 1Z3GH 3KLAA 1CLZL 3M17B 1MFNA 4NUGL 2GJ6B 5DJAA 2CO7B 1A6TA 4OFKA 1TTGA 4MQXC 2NPLX 5IB3A 1BF2A 3LQAC 4YXKL 5TH2B 2H32H 4NZDA 1ZLVH 3LDBC 1XIWA 5DWUL 2AXGA 2FL5A 3V6ZB 1P4IH 3MLXH 4XPHL 1IGCH 3UPRA 1IEBA 1NL0L 4MZ3A 4NNXB 5MI0C 1FNGB 5BV7B 3SPVB 3B9EA 4CU7A 3SGDI 1G7QA 5I75B 4IRJC 3H3PL 4LVHB 2DQHH 1BFOA 3AREA 1KB9K 3G5ZA 2XTJB 4JFZH 5ADPL 5HY9A 4G7VH 4K94H 3UJIL 2XN9D 1I9EA 3PQYE 4PRHD 4ZAKC 1SVCP 1A6ZB 5MENE 5T5NG 1K8DB 1MCWM 3L7EA 3UTQB 3DURA 1CGWA 1HYSD 4AG4H 2FEDC 4MCYB 3C5ZA 2PR4H 5DUPH 4HF5H 2AGJH 2YZ8A 1Q8MA 5HHVH 2Z31B 4NN6B 2XZCH 5K9JL 3V4VH 4N0RA 4JKLA 4K8RD 3MBEA 1YN7B 1E4KA 1MY7A 1AKJD 5IMKA 4XPFL 3BZDA 4NBYB 1ZT1A 4J3VA 1WZ1L 4XXCC 2X89D 3BZEA 3AM8C 3BXNA 3O6FB 5EOTA 3VFTB 4JM2C 4NO0D 5ACZB 4YHNB 5KSUA 3MRGB 1MHHB 4EZMA 3VD9A 1FL6B 2XY1A 4ISVB 12E8L 1A3RL 4BYHA 4PJBE 3GMQA 2ITCB 4JFQA 35C8H 2GIYA 4OCRL 3ABZA 3VD5A 3OKKA 2R2CA 4LSVL 5I19L 4LSUL 1OM3L 4KJWC 3QIBD 4BH7A 1K6QH 4U3XA 3B9KD 1RJLA 3NGBC 3RRQA 5C0JB 3VXME 5FUCE 1N59A 4KK5D 4R4FL 3RIFK 5B39A 3O11A 3ZE2F 4NZTL 1T21A 2OL3A 4CN6A 1U8LA 2YPVL 5CJQL 5INCA 5GS2H 4PS4H 4LVEA 5JPNB 2FH8A 4POZC 1YUHB 2J88H 2IC2A 2PKDA 5IUSA 2EKSA 4JPIB 2NY0D 1AQKH 2P46B 4KDVA 2P8PA 5MP6H 2UVFA 4JDTH 4XP5H 3V4PH 1NANI 5MEQB 1MJJB 2X1WL 3D2UA 4F7CA 3FTGB 5LWYH 2WWMC 5IFHL 1CT8A 3WLBB 3U7WH 4HIHA 2XI9A 5IB5B 3WLWC 4C56A 2NTFA 2VR4A 2B2XH 3QZWA 1B2WL 4MA8H 2C7UA 3LKPA 4BUHA 2CDGA 2F53E 1NC2D 4X6DF 5JO5A 3U4AA 4LK4A 3F12A 5DXWA 4CADB 5EBMB 4Z7UF 3RUGA 3T09A 1KCVL 2P8MA 1YNTA 4JFOA 1NMAL 3SDDC 1MCCA 3STZA 2GAZB 4NGHH 3MRHA 2VLRE 4XC1H 1TPXC 2R1XA 4I77H 5EIIA 5JW4R 4UTAL 3O3AB 1IKNC 1T22B 1NCBL 2H41A 3MCG1 4QTIH 4X6BA 1G6RH 4CU8A 1QLRA 4UTBH 1WWCA 2VDPL 4ZNEE 5F9OL 1RK0A 1RIVH 2JJUA 4OV5B 3D39B 1OARH 4RGND 5DRXA 4F15B 3IJYA 2WZPD 1EX0A 2FDBP 4ZPVA 5HHME 2NY6C 3KXFE 3T0BA 1ZVSA 2IJ0C 2DMCA 1DBAL 2OP4H 2NXZC 4XGZB 1INDH 4F7PA 2AEIT 1QR1A 1TETL 1U36A 4OZ4B 1JGLL 1HDMB 2J4WL 2XN9A 3H9HA 1NGQL 3H7LA 1HEZB 5HYQB 4PLKC 5GGTL 3KPPA 1MCFA 3VH8G 5C2BL 3GMRA 1INEL 1JWSA 1KCUL 1ZA3B 2VLKD 5H35B 1M6OA 3T65B 3DVGA 2QQQA 5BZDA 2UZXB 3KS0J 5E8DH 1C7TA 5IK3B 4HWEL 4WWKC 4JREB 1AKJA 1FL5A 5CHNB 3TBTB 1IQDA 5KG9B 4X6CF 1UB6B 1HHJB 1QFHA 3CPLA 4JY6A 2XXMB 1KBGL 2X89A 3V7MA 3R06A 2LU4A 4YPGA 3SJVB 4DZBA 2DD8H 1JWUB 4X4YB 1NSNL 5EZJA 5GSVB 1IFHH 3MFFA 3RX8A 3HE7B 3O4LD 4HJJH 4IOFC 4XCFL 4NJ9L 2XWTA 4GXVH 2HKFH 2VMFA 4NN7B 4RWYL 1FO0L 1NFDF 3GJFA 5I15H 4PPTA 1N5AB 5EU5A 3RAJL 1DQML 1H15B 4Z7WE 1AGCA 3IGAA 5FKAB 2HJKB 4JY5H 1EFQA 1SMOA 2EDKA 3ULUH 3MJ9L 4U0RB 2A1WL 4JDVA 4RISL 5I9QB 5D2NC 3QIBA 3NMEA 3LH2H 3B9KA 1F8TL 2XV6B 1V3LA 5EUOE 3SE8H 2X41A 3DYMA 4PJGA 5F1NB 5IMLA 4L3EE 3O45B 4ZO9A 2BDNL 2P42B 1SJHB 4Q7DA 2NY2B 4WU7A 4RDQG 2BSED 5L2JA 3EYFB 1I3UA 1MREH 4GAJH 1HN1A 2FCBA 5JIHA 4MGXA 3KPSB 1IC1A 3TNNA 2IBBA 2KQNA 5DUML 4H8WH 3MO1B 5JHLH 2OK0L 2HFFB 3LDBB 4EEEA 2FGWL 3CLFL 3P4OA 1G9ML 2Z4QB 5DQDL 1MCNA 3RWEB 1NAMB 3O6LL 1H5BB 3C8KA 3LS5H 2V5MA 4HCRH 4KK6C 3ULUE 5MI0B 5D72L 5T1MB 4CUCA 5I30L 1FLRL 3VFOB 3AUVA 3S35H 1C1EL 3W39A 1OGAD 3C87A 3HR6A 4IRJB 1WGOA 3SY0A 4P4KC 1XH3A 1NC2A 2F8OA 5T3XL 4DVRL 3CFBB 1A7NL 3L5WB 3PIQA 1YNLL 2O5YL 4S1DC 1J12A 1QSZA 4KHXL 5DJCB 1X6LA 2VQTA 3HMXA 4ZAKB 4WENB 3QA3A 3CGTA 1L6XA 3MLRL 5HYFA 2HT2D 5FYJL 1F4YH 1X9QA 3NPSC 4WO4A 1CDIA 5D7IB 1RJZB 3G6JE 1IAKB 3I50H 3RDTD 9CGTA 4F80A 3QT2A 4MHHG 3MRPA 1KJVA 3BVNA 1LEIA 4D3CH 3WHXA 3IXAA 4M5ZH 3O8XD 4UT6L 1ZHBA 1MI5D 3RVWC 3PGCA 4CN1A 5IBLC 5IGXH 5BJTA 5HVWA 4JRXE 1MPAL 4WI2A 1DQLH 1G7LB 4ALAH 1D5XB 1UQSA 1YPZA 1PKQE 3MQIA 4ZYKB 1NBYB 1X5GA 4JM2B 3QIWC 4YLQT 1FVDA 2V2XA 3NTCH 5A1AA 1CE1L 5GGRA 2WIIB 1WT5A 2AERT 2G75A 5IHUH 4JGUA 3BMVA 4GKSA 5E2VH 5ACMA 5GRYA 4K7FB 1FG2A 2W9DL 1T0MB 2FX7H 2BJML 4LNRA 4HKXA 2EDNA 2VLKA 2GYSA 2VDMH 5HHNB 1BPVA 3OR7A 3T0EB 1W72H 2VITB 3VWKC 3NGBB 4PV8A 4UAOC 4LCWD 3MNVB 4QRUA 4R7NB 4QRRD 2R1WB 1MF2L 2GTZA 4XCCH 1FYTB 3QQ3A 4HH9A 2ZJSL 4F33A 2HN7B 5SX5K 2IEPA 2PW1B 2P7TB 3S96B 4LRNH 4MXWL 2IQ9L 4KMTH 3O4LA 1E4XH 1U91B 5DLML 1JGVL 4K2UL 3RZCD 3O2DH 3VXSB 5FF6B 4OLVH 1S8DA 1CLYH 4ETQA 3NFPA 3EJZD 4EN3D 4MNGE 4S0TD 5BO1H 2FJHB 3T2NH 1IKFH 1RZFH 3EFDL 4J3UA 1MFEH 2X9XA 4AMKL 5IEHA 3HS0B 4UT7L 4PJCB 1GAFL 4UV7L 1LEGB 4XPAH 1IQWL 4OF8A 5I8CA 4Y1AD 3EHBD 5HPMB 1TDQA 4MWFA 4Y5VA 4ODHL 5EU4B 4JB9L 1RY7B 3HPJB 1YMMB 1WFUA 4CGTA 5EDXA 5E6ZA 1VFMA 3CAFA 4L1DA 5SWQB 4UIKL 5KW9L 4C83A 2B20A 4S0SD 3ULSA 4HD9A 1T66C 5C7XL 2GCYB 2DM2A 3EZ8A 4FXLA 4EUPA 2YUVA 4U6VL 4HIEB 4XBPB 3T77B 3INUL 4DTGH 4QRPE 1LO0L 5TDOA 1UCTA 2J8UE 2R8SL 5T1KD 2G5RA 4Z78B 4FHBD 4DGIH 2O5XH 3ALXA 3JV5A 1NBVH 3PF2A 4ZUWA 4WFGD 4PLJC 3I75A 3UXFA 3PWLB 1OGAA 1ZT7B 2NY6B 2VH5L 1RUPH 1RK1B 4OZFG 3O41B 3TM6A 1IL1A 2NXZB 1Q72H 1TJHL 1LHZA 5LXGH 3HUJE 2DQEH 1P7QA 3QFDB 5LBSL 1LO5B 2ZUVA 2Q87A 5FIEA 1SBBA 2BMKA 4G6AC 1KJ2H 4U6HA 3QDAA 1TVDA 5JQHC 4J7RA 3ESVF 3DUHA 4P2QB 1V7NH 4P5MA 1NDGB 1J9CT 3O8XA 4G42A 5DDHA 1BD2D 5D96C 1ZOXA 2AQ1A 1OQOA 4WWKB 4Y19B 1T7YA 4X99A 3ULVF 1KPVA 4L4TB 4ZS7H 2I5YH 3VU2A 2APVA 1KV3A 4BQ8A 4Z77B 1GC1L 5ETUB 5TDNB 4NQVB 3KPOA 4M7JH 3EO9H 4GKNA 2FO4B 1W2KT 4ZUTA 1EZVX 1BOYA 1QLEH 1FORL 3C2SA 3VFGH 2FJFB 4GRWH 2OTWB 1BGXL 4M8QA 4MCZA 4F7TB 4JFDD 1MCDA 1PBYA 5EIVA 5F97E 4G8GE 1HOCB 4WI6A 4ZQKB 1IGML 5LGKA 5D2NB 3N1GC 1K8IB 1PQZA 2QSQA 4WIQA 2QQLH 3D69B 1F4XH 4TOYH 5CLWA 2H8PB 2VISB 4GMTL 4OQTA 4QRRA 1KGCE 4AEHL 4QLRA 4PG9B 5JQ6L 4K7PY 2V7NA 3RI5K 3X12A 4AH2A 3C08H 5JW4M 3GSVA 3OR6B 3FQWB 5BXFA 3DX6B 2NX5A 3GBML 3RZCA 2OI9C 3U30C 5F88B 1ZHKA 1V7MH 2EH8H 4GRWE 4KKAC 2ZKHH 1U8MB 4M6OL 4EN3A 1N4XH 4NOBA 1U6AH 3ZDYE 1T4KA 4JRYE 1NCDH 1A7QH 4JANB 3LKRA 5IW1A 5IT2L 1RZJL 5ERWB 1YYMH 2CSPA 4Y1AA 4HWUA 2CJUL 3O81A 4YUEH 3W81A 4P4KB 3QDME 5HHOE 4JAMB 3IDMA 1XF3B 5DJDB 3VXQB 3GNMH 2CLRB 2Z93A 2ZUSA 4AIOA 1JZ4A 2IF7A 1S9WA 3NPSB 4IMKC 1KULA 1KNOB 1QFWL 3RWIB 3VRIB 2FRGP 1KEML 1J0HA 4AQ1B 3RHWK 1DVFD 3DI2B 4PJAE 5CJ8A 4IRSC 1I7UB 1RUAL 3MOQA 1FIEA 2X4NA 5T1KA 1SMAA 3ISWA 1JUFB 4YBHA 4B5EA 2OS7A 5F7KC 3EO1B 2P5EE 1T0NA 3QXUA 4IEFB 5MEND 3BD5A 3GJEA 3QEQB 3WIFB 3CK0L 2I9LA 2BSSB 4X4XA 5FA3B 5GGVL 5D1ZD 1WLHA 3NA4A 3QRGH 1A5FH 2R9HC 4OD3L 1NCCH 3P9MB 5ANMA 5C71A 3VW3L 4KJYA 3MV9D 4X0KB 4Z8FL 2ADFL 3CMGA 1MOEA 4N0UB 3ET9F 3EYQD 2FX9H 4NZUL 3QG6B 4YBQC 3CH1B 3RVXD 1CFSB 1MCOH 4OUUA 2XZAL 1YY8B 3SDCC 1R3LB 1D6VH 1FN4B 1KC5L 1L7IH 4JM4H 4S1SH 1S78C 3MX0A 5F70A 3BPCB 5FECB 1BD2A 4ZTOL 4UAOB 3QO1A 5I1GH 4PRIB 1NKOA 4CVXB 3I2CH 1IAIH 4R0LC 4E42B 2DQUL 4WU5B 2GTWB 3NCJL 3FB8B 1I8IB 1KLUB 2B1HL 5LGHH 4FMKA 1E28A 3DV4B 4PJHE 5F8QC 4I0KA 4DKEL 2A0LC 5C70A 1CICA 2NY3B 1WQVT 5DD5L 3C09C 3S5LA 2YD2A 1K3ZA 2AJUL 4AJ0A 2ITDB 1JGEA 3QNXA 1WC7A 5IHBA 1U2HA 4LLDB 5D9SA 1EDQA 1BFVH 1YMHA 5DMGD 3WIHH 1Z0MA 4JFDA 5EBLB 5KVFL 4PIRF 1C12A 3O2WH 5DFTA 4GBXD 4RAVB 5IHLB 4JJ5B 3U0WL 1QO3A 2YC1B 5LKNA 2OZ4L 3VH8B 2OR8A 3GMPB 4WTZA 2ORBH 1DUZA 2FB4L 3L3HB 4UB0L 2F5BL 3FHQA 4L8SA 5DHYB 3VRJA 2QSTA 4BELD 2VKWA 3G5YA 3QIUD 1AR1C 3W0WE 3ARDD 2KZ1B 1FJ1A 4K71C 5B39G 5I18L 2DQCH 3NZHH 4MXVE 5BS0D 1F2QA 1CK0L 2W92A 1MJ8H 1L9NA 4J1UA 3LN9A 4K8RL 4M6MH 5DK3A 5FYKU 3JTTA 3VE0A 4P2RB 4DN3L 4PRBB 1QFOA 4ODUA 3IVKB 3E2HB 4QF1B 5CMAB 4HULB 5H94A 3WJJC 2IBZY 4ZMAT 5DHVA 4WUUE 1KPRB 4NQXA 1QOKA 2E9JA 3DHMA 4WJ5A 5ABDE 3TA3D 1PEWA 4Q9CA 2CR3A 3U6RA 1TCRA 3UDWA 5CZXD 3IJHA 3O3BA 4Z9KB 4XVUC 3UTZA 4AIXA 1MIEL 1FFNA 5JXAL 3L3DA 3QZWG 3RWCA 3ARUA 1UWEH 4F7EA 1EXUB 5EZLB 4NUJB 5FDYA 1DBBL 2VWEE 4DQOL 4J8RA 5TE6H 2HT3D 1I1FA 1DP0A 3KYKH 1RHHB 3JVGC 3FO9B 4GRLD 5GRUH 5BV7H 1TJGL 4XHJD 4YBLC 4JQIH 4WFED 5HHMD 5DJ8A 1T1YA 4NQDD 2EXYC 2X4UB 1E4WH 2C3GA 5KSBF 4HFWB 4OF3A 1QSFB 3EJYD 5D96B 3HRZB 4ELKA 3G5XB 4PJ8C 3FQXA 3VFPA 2FX8H 1NKRA 5DEGA 3VXTB 1MCQA 5MENA 4NKMB 3BEWA 2HJLA 1CZ8L 3D5OF 2XKNB 3QWOB 2JIXB 5D1ZA 1OGTB 3SCMC 1JNNH 1UZ6E 3VG0H 3OPZL 1GHFH 2MKLC 4HS6B 4MAYA 4RIRA 3V8CA 1XCQA 5KTEH 3ZE0E 2HJFB 4N8VB 3MLUL 3MV9A 2F5AH 4NBZB 2QQNH 3VFUA 3K0WA 1EMTL 2VXTL 3IYLW 2EEBA 1ZLSL 4D9RD 1R3IH 3QEGL 4HT1H 1BBJB 1NGWB 2VXQL 3HE6C 2BZDA 1UG9A 2P48B 2VQ1B 1N5YH 2IMNA 4PGEB 1CI5A 1AQDB 3GSWA 3OB0K 4DK6A 1C16B 3O3UN 5I1IH 3LMJH 2BNQB 3NA9H 1UC6A 4X80H 3QG7H 5D6CA 1UJ3C 2EYRB 1SJVA 5C3TA 5LQBH 1I85A 3TT1L 4O2CB 3T2QA 2DOCA 4YDIH 1CFTA 1S3KH 3BKYH 4O9HL 4H20H 5IVXF 1EO8H 4XB8A 2Q8BH 2OI9B 3CXDH 2K7PA 3U30B 5FKPB 1D5ZA 2MQ3A 3WFHB 5CILH 5AZEH 5GXBB 1DL7L 2JJSC 3GMLA 1II4E 3VCLB 4L3ED 2LVCA 4U1NA 1PG7X 1FC2D 2BERA 4GBXA 1SM3H 3O6ML 1J8KA 4QKXB 3AREC 3TVMD 4UIMA 2Z35A 3MRQB 4NP4H 4UDTA 3V6OE 2MPAH 3D0LB 5AWNH 5E4EB 3QIUA 1DQJA 3ARDA 1DQQB 5JZ7C 3E0GA 1BIIA 4PD4J 3CSYA 5FGSA 3PV6B 3VGAC 3QI9B 4N8CL 3DXAB 4L8BB 3T1FB 5BS0A 4HJ0C 1CGYA 1MRFL 3ULUD 4MNQB 2HVKB 1D5MA 4OT1H 4UBDD 3LQMA 1FCGA 2F19L 3CC5B 4R3SB 2R0KL 5CSGA 3QUKB 3DETC 3HI1B 3TWCH 3F7YB 5EU7E 3HHRB 5GIRA 4WVRA 3GBLA 3TA3A 3CSBA 5KAQF 3UBXA 4DJMA 5DQ9B 3BP7B 4PY8J 1UM6H 4Z7QE 3FFCB 4XH2B 3CDFA 2YD4A 2FBJH 2EE3A 1X7QA 5ESAA 2QQKL 1BQHA 5FOBA 3DV6A 5HYJB 4UDUA 4HZLB 5DJYA 2G60L 3CUPB 1CU4H 5B3JE 1DQDH 1MAKA 2P8LA 5J6GB 4ZNEA 2EC9T 1A1MA 4FQPA 5KS9E 1RUML 4PJ9D 4HEPG 3PV7A 4GRLA 1QG3A 4N0CD 1BVKB 4KQ3H 3SDCB 1Y6NR 4L29A 4NQDA 1MFDH 1I8KB 2BCKA 1VDGA 5K9KB 1I8MB 2QSCL 4R0LB 4KKBD 1U8HA 2EIZA 1F00I 3ZTJH 3T3PF 3VFMA 4FQXA 4C4KT 3OX8A 1NCAL 4MD5B 1L7TL 1EVUA 5IV2B 3HC3H 1CXFA 1NBQA 4WY7H 4OZGE 2A6IA 4UINH 3BESR 3LZFH 4C57C 3IJSA 3L3OA 2R39A 5DS8A 4QNPE 1HKFA 1UACL 1AHWC 1IAOB 4BQ6A 1E6JL 3QXAB 1IGTA 3OAYK 3LB6D 4OLZL 4OZFB 1QFWM 3K7UA 2RIKA 2DWEA 2D7NA 3D39E 1RZKH 1YDPB 1A7OH 3ARGB 5TJWK 3BO8B 4MMXC 3AS2A 2VZ1A 4XVTH 3V8OA 4FG6D 1VFOA 2LU3A 2CKBA 2AV7B 2EDYA 4M61B 5EO1B 4N0FB 5DMIH 5BMFL 1KXQE 3MUY1 1Q94A 2IFGA 3IFOB 8FABA 2AJXH 5JOPE 1RZ7L 4YXHH 2DTSA 1OAXH 2YRLA 3QPQD 3OB8A 3KPNB 4GFTB 1GH7A 2VZUA 3Q5OA 2MCG1 3TO2A 2OXHA 4YHLL 2EDLA 5JHDE 2B5IC 4D0BA 4NFDA 2ZOLB 2AVGA 1H3PH 4NQUA 1RZ8B 3WMSA 5ICZB 1FZMA 1CGSH 3GSQB 4H5SB 5ICXB 4GKZB 1ND0A 3ARFD 3FB7B 5HDBE 4UT9H 4IMLB 1SBSH 4NM4L 4G9FA 4U1JA 2BC4A 1UM4H 3NOIA 5EUKA 1AO7B 4HK3J 1DN0A 1YNKH 1IGFL 1XEDA 4GXUM 1HYSC 3MNZA 3X14B 4HV8A 3BT2H 4QRPD 3PGDB 2VRAA 3QDGD 1Q9WA 1L0XA 4J4PC 3P73B 2R4RH 1AH1A 1DE4A 4JPVH 5C0AB 2IG2L 3KYNA 4J3SA 2YPKA 3T3ME 4NHCH 5FV2A 2NW3B 1NUNB 3JWDC 1J0YA 1J0IA 1VPOH 1DFBH 2R23B 5KANG 1L0YA 4OQTL 1VADB 3OJ2C 3B2UD 4NNYB 1PG7L 1LEKB 5IVZA 4RNRA 4RFEA 4EUPG 4PJ8B 4ZFFB 1YYLH 3OAUH 4XP4H 2OJEB 4R96B 3MA9L 3H42L 5CAYB 5ITBH 1P4BH 1JZ8A 5C0FA 1MAML 5GJTL 4XMKH 5DRNB 1HXYA 1P4LA 5E8NA 1UYWH 4PJFA 4LLUB 4OLUH 3L3GB 2ESVB 3WE6A 4LBEB 1FGNH 4QGYA 2HFEB 1F6LL 1D9KD 1PSKH 4MJIB 2YPLE 3VFSA 5IMMA 1T7VA 4PJ9A 3WO4C 2Q20A 2R0WH 1R3HA 3ARXA 3QIBC 4HUVA 5FFLA 2X44D 3B9KC 4Z7VB 4IDJL 1JFQL 4MDJB 3HE6B 4HGKC 4KK5C 2A6JB 2EDRA 4ODXB 1G0YR 5J57B 1ODAA 3AAZB 3UTSB 1HHKA 1REIA 2B0SL 4WV1A 1W0WA 1YJDH 5TGBB 3RWDA 3KLAB 5C0CE 5DJAB 3REWB 3G6AA 4P23D 3HI5H 1A6TB 3VA6A 3N1MC 5E2UH 2ICES 2NY0C 2XACC 4NRYB 1RIHH 2P24A 3C9NA 1HNGA 2L4OA 2ADGB 2MKWA 2A9NH 5C9KA 2X1PA 1BEYH 1XIWB 2AXGB 3CXHK 5F72S 1ZAGA 1AFVH 1VHPA 2CRZA 2YR3A 5CGYC 3UPRB 5JTWA 1IEBB 5DJ0A 4PJXE 4ODWA 3V5DA 1T2XA 2BOCB 1KGCD 1DEDA 2JCCA 1G7QB 1F3DH 3PP4L 3PWVA 3AREB 2BXZA 3G5ZB 4QXUL 2LTQB 3BGMA 5HY9B 2ZZUT 3CMOH 2PO6C 2OBGA 4FQCH 5DYOA 4NT6A 2EZ0C 3RPIA 4MQ7B 1GGIL 1DEEA 4LHJB 4P5KB 5F7EH 3DURB 4P46D 2R4SL 2X9WA 3C5ZB 2FJGA 4XNYH 3EYVA 1OPGH 3S34H 1XCTA 3VGAB 1TQBB 3TCLA 4N68A 2Q3AA 2QR0A 3T0EE 4ZODA 2RFXB 4RGNC 1Q9LA 3Q6GL 1HSAB 5T5FL 5SWZE 4F3FA 1YEKL 3D9AL 4DVBA 1OAQL 2DBLL 3VD7A 2W1NA 3NCCB 4N90E 1VGEH 5CINL 3UJJH 1ZT1B 2DQIL 3KPMA 1WFNA 3GI9H 1FYTE 1CBVL 3ARFA 2AQ3A 3BZEB 4OZHF 5EOTB 4FNLH 3FAXA 4GMSH 1OP5K 1EUUA 3V7AE 5F7WC 3PWUA 1U3HC 4LVOC 5CUSH 5B8CA 4LEOA 1D5BA 4PD4K 5IEKA 4CU6A 1WT5C 1Z9OA 4QRPA 2FD6H 3U36A 1ADQA 2DBJA 3VXPA 3QDGA 3OKKB 5CEYA 5F1IA 4Z18A 2YKLH 3WN5A 4GAFB 2NZ9C 3Q3GA 3T1WA 1FGVH 4BH7B 1X4XA 2P5ED 2FIRT 4W6WB 1LE5A 1RJLB 3VI3F 4AK1A 2WUCL 5FM5O 3ZSSA 5B39B 3O11B 3ZE1E 1T21B 2OL3B 5J0BA 4XMLL 1U8LB 3LIZH 5INCB 4PRAA 4KMLB 1DANU 3WCYA 3F7PC 4K3JL 3GMMA 5SX5H 2V9QA 1R24B 4LDLB 2XZQL 5JW3H 3V5KA 3MJ7A 1ZT4A 3IDNA 3PWPB 3RTQC 3BQUA 4YHYC 2ARJB 3EOAB 1AHWB 4G6JL 2UZYB 1DN2A 2RR3A 3D2UB 1D9KA 4KK8D 1Z5LA 3W9DA 3RL1A 1EVTC 3IFLH 4XNXH 1SYSA 3VMOA 4HIHB 5JDJA 2EDEA 5I2IA 2ZUQC 2NTFB 3QZWB 2B7DT 3P30H 3LKPB 4KTEL 4U1GC 4HIXH 1RU9L 3O9WD 3OWEA 2CDGB 2VDQH 3FOLA 4R8WL 1T83A 3F12B 5HJ3A 5GISH 1GOHA 3SO3C 2IADB 1YNTB 4JFOB 3REVA 2Y36L 4P23A 3GJFK 5HGHA 5DJXA 3V5HA 1JV5A 5AZ2H 3MRHB 4FXKA 3QNZB 4NO3A 3BPLB 3ARBC 5EIIB 5KJRL 1KJ2A 3ARZA 5D1XD 3V6FA 1ZGLP 3I9GL 3MLWL 5F1KC 1S5HB 3DGGB 1QLRB 5GSRB 4P2QE 2C3VA 1RK0B 2FHFA 2JB5L 4U6TA 1Z3GL 2B5IB 4TNWF 5EOCL 3S5LG 5MHSE 1G0XA 1HCFX 5DRXB 3IJYB 4HMCA 4NJAH 1JN6A 4L4TE 3TPKA 1G9NC 4ZTPL 4HK3N 1ZVSB 4CW1A 1XGYL 3PE9A 3QUMA 1RMFH 1QR1B 2VN7A 1KFAH 5GRXG 1P4IL 4XBGA 3H9HB 1IGCL 1OVZA 2XN9B 4PP2A 4PRHB 5I1KL 4FFWD 2R15A 4HPOL 5CP7A 3FQUA 2DLTA 2HT2C 4XPGL 5AYUH 5B3NA 4P46A 2H6PA 4WTZG 1NGYA 3FZUD 3GMRB 4YPJA 1H8SA 5I66A 1LK2A 1EJOL 4R26H 3RDTC 2WBKA 5KVGH 1V5JA 1M6OB 5T1DL 1A3QA 3DVGB 5DJ6A 1EBPA 4NQSA 3O8XC 1QTYT 4G7VL 3IRZA 5CS7A 4JFHD 5HBBA 3H2WA 4PJBF 1X5IA 3I85A 1FL5B 2YA1A 2PYFA 4JY4A 2V17H 2FYYA 4HC1H 3IXTA 4JJHA 1IQDB 5K9QG 4Z0XB 3RKDD 2QHLA 4LIQE 2ATPB 4NRXA 4NQTA 3R06B 4YPGB 1PJ9A 4DZBB 4NO0B 4NUGH 1CLZH 4H25B 4HKZA 1QYGL 4J3TA 3TNMA 4FZ8H 4LLWA 3Q5YA 2CXGA 1H8OA 4KJPD 4YXKH 1T6WA 4ZS6D 5EU5B 4UV4L 5DWUH 7FABL 5EC1A 1AGCB 3IGAB 1X5LA 4LLYB 4E5XA 4TRPL 5ESQA 4XPHH 4U2YA 5C3LD 1F90L 5SX4H 1N0XL 3WO4B 1NL0H 3DIFA 3QIBB 3S3JA 2P5EA 1EGJL 1T5WA 1IGJA 3B9KB 1WAAE 5IJKA 3KS0H 4HJGA 5E99L 1PX4A 5D5MA 3OKNA 1J1PL 4KTDL 3H3PH 4WU7B 2EXWD 3W9EB 2C1PA 3TZVC 1R3JA 5F9WC 4XP9L 3K1KC 5ADPH 5L2JB 2BNUA 3UJIH 4AZ8A 3TNNB 4XVSL 2NY0B 3RZCC 3AVEA 3SKNA 4BH8B 1OSZA 4N1CA 4JFPA 4X9FA 4NQCD 3VXOA 3P4OB 3EJZC 4EN3C 3B83A 4NSKA 3MV01 1TFHA 4YWGL 1JHTA 3W5NA 4Y4KA 5K9JH 2K9UA 1EZVY 4P49A 4BM7A 1NAKL 2DIBA 3O9WA 1EEZB 3SY0B 1ED3A 1XH3B 1NC2B 4XPFH 3WO3B 1L6ZA 4JO4H 4XPTL 1WZ1H 3PIQB 3RY4A 3JWOC 4PGCA 1T03L 2PO6B 5HI4D 3ZKND 3I84A 2V5RA 1YY9C 2GHWB 1S7UA 5D1XA 4N0UE 3GDBA 1UKQA 12E8H 1TZHA 1EO7A 4OSUL 4HGMA 5B22A 4OCRH 4OCMC 2AXFA 1KJVB 1QA9A 1X44A 1LEIB 3WHXB 4LSVH 5I19H 5CEXA 4LSUH 3IXAB 3RGHA 4P9HC 1ZHBB 1OM3H 5J1AA 4RGNB 2QADC 4OUOA 4IS6A 3IKKA 1KXVC 4R4FH 2VXUL 3CFJA 3V4UL 4PREA 4NZTH 3AXLA 2UYLB 1UQSB 1YPZB 2YPVH 5CJQH 2Q76A 2VLLA 4UTBL 1FVDB 2V2XB 5I1LA 2O61B 3UYPA 2ARWA 1X5HA 4ZDHA 5EBWB 3EYUL 4GKSB 5HYSA 3G5VA 1KIPA 4PRPE 2XA3A 2XKSA 2VLKB 3HZKB 2MWCA 3SDAD 2CKBL 1PEZA 5IFHH 4LDOB 1NMCB 3OR7B 4OGAD 3ZKQD 2ID5A 4JN2A 3MRIA 4N0YL 1IAMA 1B2WH 1I3GL 4QXTB 4JG1L 4Z7WF 5IFJA 4NDMA 5GJSL 5BOPA 1QR4A 4F33B 5CBEB 3MRCA 1KCVH 2NW2B 1NMAH 1OAZL 5MERA 3IS0X 4L4VE 5EUOF 4PLNC 4DWHA 4ZOEA 3N1QC 3O4LB 1SQ2N 3OBAA 4OBSA 1KTDA 3UBXG 4YHYB 1HZHL 4UTAH 3LRSA 1NCBH 1S8DB 4P5TD 4P2RE 3MGOA 4HWZB 4LVNC 2XFXB 3BH9A 2VDPH 5D6DA 4DGVL 5F9OH 1J87A 3PDDA 1VKXA 4WHYG 2ZUQB 5IJVB 3EOBA 4XAKE 5I8CB 3L5IA 4D0DA 4Y4FA 2Y6SC 1MWAL 1PY9A 2GW5A 1EAPA 4PBWD 3CSGA 4MJ5A 4MWFB 1JNHA 2BVYA 4Y5VB 1X5FA 3DRQA 5BVJB 3ULUF 4LQ1A 1TETH 4NM8L 2CK0L 1JGLH 4HW6A 2CH8A 3T4AA 3MZTA 5F7NC 5GGTH 3CZFA 1ZLWK 3ULVL 1B90A 2JLLA 4C83B 4FTVB 5C2BH 3ULSB 2NY5L 4JZOA 1VFUA 2P49B 5GHWL 1KEGL 3DROA 1INEH 4EUPB 5KZCD 1JHLL 4HKBA 3S4SA 1TVHA 4NQCA 4Z5RB 1KCUH 4XNQA 5TDOB 2PF6A 5GZOD 5IFAL 2BFVL 5CIPA 4ZUWB 1KPUA 3G6JF 2QL1A 4HWEH 4YO0A 1ACZA 3I75B 5LCVL 1OGAB 3UDWC 4AM0B 1JTPA 4H8WL 4L1HA 1MHPL 3MJ8A 1B6DA