3IJYB

Structure of s67-27 in complex with kdo(2.8)kdo
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
226
structure length
221
Chain Sequence
EVMLVESGGGLVQPGNSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDISPSYGVYYEGFAYWGQGTLVTVSAATTTAPSVYPLVPGGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
molecule keywords Immunoglobulin light chain (IGG3)
molecule tags Immune system
total genus 37
structure length 221
sequence length 226
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijyB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijyB01
4KRPB 1A3RL 1JHTA 4O2CA 3HE7D 2GY7B 5CD5C 1MREH 3QDGA 3V4UL 1NLDH 1VPOH 1DUZA 5IB5B 4J6RH 2XA3A 4YHPB 2QQNL 4I1NB 5D1ZA 1VGKA 1ZHLB 4EZMA 1L0QA 1U8JB 4ZUUB 4URTB 1VGEH 1T1ZA 2DDQH 4X5WA 3VE0A 4P3WA 3D5OF 3IDNB 4NM4H 5HHOE 5E0QA 3TIDA 4JVWA 2FX8H 3P4MB 3NMEA 3WDJA 3X3FL 1ZEAH 4WWKC 2VLRB 5EIIA 1XF3B 3I6GB 3MLYH 5M95B 1INEL 1T1WB 3WS3B 3HPLA 3N85H 4G3YH 4EDWL 1KJVB 3C5ZA 1YMMB 5E99L 3GKZA 5BRZD 5JW3L 3RWCB 4LSTH 5DD0L 2CK2A 3C60B 4X8JA 2LABA 3BE1H 2GFBA 3DGGB 1IAIM 4RWYH 4IRJB 3C5ZD 3UYPA 4XGZA 4V2CB 4QRPB 3OR6B 1A6TA 3NBNA 1AGCA 1TXKA 4LPUA 3SJVD 3ULVD 1T22A 4CDGC 1CCZA 1LO0H 4JGMA 1BIHA 5JA8B 2X4UB 2FYYA 2OZ4H 2X9WA 3MNZB 2X4SB 2B2XH 2IBGA 4MDIB 4WW1A 4MJIA 1SM3L 3IFNH 2Z8WC 4G6JH 3KYKH 4WI5A 2QR0A 2X70B 4PRPA 5E8OA 2F8OA 2XY1A 5L8JB 5T3ZE 1NCCL 3TN0C 1EEUA 4QRUA 4JR9L 2OXHA 3RNKB 4Y16A 3VRJB 3W9DB 4ELMB 5E6IC 4Q0XH 3EIFA 5ESQA 1T1XB 4PRPD 4QHMA 5AYQA 3EJZD 3QQNA 4PJAF 1H3PL 4P2OD 2VLLB 2YEZB 3KLAB 3DIFB 1IAIL 4ISVA 4NNPH 4NYLA 1E6JH 5ALBH 3BGMB 1HI6B 4G6FB 3M1BB 1FNAA 4Y1AA 2DQHL 2FJGA 5DT1H 1UH3A 2BVYA 1RUMH 4Y2DB 2BNRE 1NDGA 4H5SA 4DQOL 1QQDB 1HXYB 2B0SL 2NQCA 3HAEB 3KPMB 4Y1AD 1RPQA 3DBXA 4A2MA 2ADIA 5HYEA 3C5JB 3LN4A 1BF8A 4A6YA 1JGEA 1BFOB 2CUHA 3U46A 1KJ3L 3ULUH 1U2HA 4TSAL 3MRNA 4G6KH 4XP1L 1BZ7B 1CIUA 5K9JH 3PV6B 4JFFE 5E2UL 2FIKA 1BQHG 3MLZL 4ZYKB 1JE6A 1GOHA 4NQEE 1GC1C 2BXZA 4A6YL 4NRZB 4S0SD 5JPMA 2EYTA 1OAKL 5IV2B 3HNVH 1WCQA 2UY7A 5D5MA 1VADA 1QLFB 1S7TB 2YBRB 4UTAH 2C3XA 3V7MA 1LO3H 2ADGA 1J9CT 4NC0B 5MENE 3S3PA 2NCMA 4DVRH 2V2WB 2DQUH 3GGWB 3VWJA 4HWEH 2X4TB 4OD1L 5IW1A 1IMHC 3FKUS 5F8RC 1P2CA 4PJGE 1IC5H 1WZMA 1DANU 4PJBB 1ZVSA 3BPCA 4I0PA 1G7IB 4ENED 1DZBA 1NCNA 4ZFGL 3HUJF 3VWJD 3WJJC 5B39B 3L7FA 5KSBA 4C56B 1E4WH 4LEOB 4TUOB 2OJZL 1FL5B 1QBMH 3L6FB 1A7BA 4BQ6A 2HJFA 4N9GB 1G7JA 5HXMA 5SWSA 2NR6D 1U8KB 1LEGA 3HPJA 5C6WH 4UT9H 1ZHNB 5D2NE 3BZEA 2C7UB 1KLGA 3V5HB 1QRNA 2P47B 4KI5C 2E7LA 5BO1H 1KG0A 2D4FA 4FQ1L 4NZRH 3THMH 2IFGA 3GJEA 5SWSD 3VFVB 3UDWC 2R9HD 3VGDA 3OKDB 3P73A 4OZIA 2BFVL 3GMPB 4JPVH 1PX3A 2IPTL 4O02L 4OZFG 4PR5A 2W0FB 3HTLX 2DM4A 3U2SB 2V5TA 3O4LB 4Y8DC 3C8DA 1XH3A 4XHJC 1LEIA 5E95B 1T4KA 3BZDA 1SMOA 1DDHB 3MGOB 1XCTA 2VLRE 4KK5D 5ILTH 5F1OB 2HFGH 3MLRL 2IPUG 4KKAD 4OBSA 1OB1A 3S4SA 3VG9B 4XMKL 1YMME 4UDUA 4YDLB 5ID0B 1MJJA 4HG4J 3X13B 3MUHL 4HPYL 4EOWL 1YEGL 4I8DA 4GAJH 2V9RA 4KPHL 4OAWB 5HYSG 1Q9OA 2ARWA 3JTTA 4LSQL 3CFIC 3VA2C 1A6UH 3WKNA 5TGBA 3IFLL 3QXVA 4QRPE 3EDFA 3B9KB 4M3JA 1EAJA 2V9TA 3QEUB 4KDWA 3L5XH 4M7JH 3BIKA 4IS6A 4DVBB 1KF9B 2EYSB 2CIKA 1XR8A 5DRWB 1MJ7H 1I8MB 3BEVB 3PL6C 4P3DB 3RHWK 3QHTC 1INDH 1G0DA 4K3JL 5DJXA 3CZFB 4GS7B 1Q9LB 4NNXB 3FB5A 4KC3B 4OGZA 2W60A 5IIEB 3LAFA 3OJ2C 4JDVA 5EO9A 1Z9MA 1F13A 2FBJL 4UV4H 4Z7VA 3WFEH 4RIRB 3A67L 1Z9LA 5I30H 4PUBL 5I66A 2ZOLB 4ELME 1CGVA 1W0WB 3VH8A 2BZDA 1TVHA 2FX7L 3W0WA 5JOFB 4EDXA 3FQTB 3T3MF 3ARDC 3UTTD 1BOYA 1S7QB 4Y5YB 3AROA 5JXEA 2HVJA 1CVRA 5SX5H 2HTKD 3TZVC 1QSVA 1KN2H 2NY6D 4GXUN 3WCYA 4I9WD 4YHMH 4D0CB 1N8ZB 1GGBL 3L3DB 5DRZB 2Y4SA 5JXED 4WNQB 3NN8B 2DQEH 5KVEH 5I0ZA 3C6SB 3PABB 3RVVD 3UXFA 5DS8B 1G0XA 3FQRA 1IC4L 4WEBH 5E9DB 5BS0A 1FV1B 2R56L 4Y4FA 1NCTA 4FQQB 3BKML 4MAYD 1J1OL 2VL4A 4WDIA 1D6EA 4C57C 4F58L 2DQFA 5C2UB 1KTDB 3QDMD 1HWGB 3WDHA 4XPHL 5I1IL 3ZE0E 3AB0C 1YEEL 4AENB 5BS0D 1I1FA 4HFUH 4Y4FD 4KDTA 5C0IB 3FFCA 4LPXA 5CZVL 1I8LA 5J3HD 3QQ9D 1CU4L 5IJKA 3EDDA 3R4DA 3SKUD 5CBEB 3MRLA 1H0DA 3TFKC 1NMCB 1JF1B 4XMPH 5J6HA 4P2RD 2NY4C 1DQMH 4O4YH 2R0WL 3QQ3A 4PJAB 5DWUL 1QLRB 2FNBA 5FOBB 1UZ6F 5ESVA 2WW8A 5D1XA 1NSNH 1K4CA 1YUHB 1U92A 3GIZH 2FATH 5I75C 4PJBE 3H2WA 1JNJA 1K5NA 1DQJA 4XVTH 5F88A 3ZKMC 3K1KC 3DYMA 4YC2B 3P0VL 4J3TA 4WI3A 4WEMB 4FG6C 3IAPA 2PTUA 1KPUB 1PYWB 5D1XD 4C56E 3IJSA 4HS3B 5JW4R 1SJHB 3CFKB 1WF5A 1F4YH 5CEXB 4ZTPH 2IADA 2QQLL 4E42B 1RFDH 4JZJA 1A6WL 5CIPH 1OAQH 2ICCA 4P49A 3T0EC 4IOFD 5CGMA 5LGJA 5IR1A 3UTOA 3CK0H 4QT5B 3OX8A 3LKSA 4XH2B 3QIUA 4PJEA 3FOLA 3ROLA 1GYAA 2AP2A 1D5ZB 4OKDA 2CGRL 4PJFF 3VFWA 5TH2B 2QADB 4KRNA 4OFYD 3WS6C 4WY7H 2R0LH 3DUUA 4K94H 1IBGL 1S7WB 4JPWL 1B0GA 1T2QH 3QIUD 4ZTOH 5I18H 2ZSWB 2JCCA 2QTEA 4OZ4A 3O4LE 4HKJB 2YXFA 4K7FB 4ONOA 5I8KL 3QA3A 4YHKH 3RL2A 3U9UB 2I07A 4GRLD 1AC0A 3LDBC 5HGHB 3DHJA 3WIIH 4U1NA 5E8DL 5ACZB 1A7OH 3F65A 1BVLB 1KIQB 2CH8A 5C0CA 4HMEA 3T3PF 5EZIL 4GXVH 3O3DA 3OZ9L 4TVPL 2VDML 3WNOA 2AJYH 3OR7B 1BVKA 1EO8L 4ERSH 4YX2H 1D6VH 1OF2B 1EMTH 2RBLA 3HUJB 4LVOC 3NFNA 1E4KA 1GVIA 3MRBA 3P9MB 1LQSR 2FD6H 3ZT5A 1PKQB 5CEZE 2OSLB 4GMTH 4JREB 1LEKB 1SQ2N 5ITBH 2A0LD 1H5BC 2VOTA 2SEBB 2DJSA 4KUZL 2W65A 1MJ8H 1YC7A 4JO1H 4Q6IA 2CMRH 1GSMA 1MWAA 1WFTA 5FYJD 5FYJL 3QCUL 4NFCA 2AK4D 2AJZA 4IMLA 4LARH 3VXSB 2EDLA 2XKNA 1A21A 3QUXA 3BO8B 3F7VA 4XP9L 3RVUC 3C5SB 1KUMA 4P4RB 4JY6A 1YNTA 3P4NB 3BJLA 4GBXA 5FO9A 2ZOKB 4LP5A 2OR7A 4LGSB 1KIRA 1IFHL 4OIIL 2JJSA 3H0TB 5CINL 5FDWB 4EN3C 3ZDYE 2GSGB 2XWBA 2NZ9D 5GGRB 1QFUL 5HPMA 4OLXL 1FAIL 4O51A 1U8MA 3NABH 3BT2L 1EHLH 3IDGB 2DBLH 2IBBA 4KKBC 3MCLH 1U8NB 2VN7A 3D2UA 1KCVL 1S5IL 5D8JL 1CFTA 2GAZB 3ZYZA 5T33L 1CI5A 3NAAL 5FYLE 1EJ6A 5I74C 4OUUA 3RL1B 5HGBA 2NY1C 2X1WL 3RWEA 5EUOF 4EUPG 4RDQG 4JANB 2ZJSL 4F7MB 1CICC 2XXCB 3ELAT 5C0GA 2OK0H 2VZTA 4Q9RL 2QLVB 3DI3B 4QXGH 3L5HA 4U6XB 1MH5B 4UIMA 3EUUA 1QG3A 1LP9F 5IWLC 4QF1B 1I3GL 4WI2A 3MLUL 3G04B 3QEHA 4Y19B 1NGQH 5E9DE 4NZTH 3MRCA 5HI5D 4M48L 1HNGA 1IAOB 4Y4HA 4ZUWB 2WNGA 1WLHA 2PO6A 1XCQA 3N06B 1GGIH 1R3JB 1W72B 4L4VA 2Q6WA 4QHKJ 5FOJA 3OB0K 5A16A 3CFCL 1ITBB 2CQVA 2VH5L 4RGMC 5I1LA 3FRUA 1LE9B 3T8XA 5EOCJ 3WL9A 4Y4HD 5DK2B 1CDBA 4X4ZA 2PO6D 4L4VD 4YFLI 4RSVA 5IQ7L 2X40A 3B4NA 2N7AA 1S5HA 4RZCA 2VDPL 3KHOA 1WK0A 3HZYB 4LLQA 4WENB 2I5YH 2A6KA 3BISA 4NM8L 5DRNB 4Z77B 3KPOA 4G9DB 4KQ4H 4U6VL 2ZUYA 4PJAE 1JPGB 4XTRC 2AK1L 3LS5H 4XWGL 3PXHA 3TO2A 2X05A 4WU7B 4L8BB 2QV2A 4JHBA 3CNKA 3RY6C 1T7ZA 1OAXH 3D69A 4YNYB 2HMID 1Q9KB 5CHNA 3MJ9H 1YMHA 2LE9A 2HVKB 3MRDB 4XNMB 2J5LB 4GRMA 5IM7B 3LSOB 4EI6B 3WHXB 4MYWB 4HS8H 1TENA 5I71B 1XGUB 4PJ7E 5F7DB 5C09A 3G5XB 4PJ8A 4ONHB 2CIIB 2VQ1A 3MC0A 3OKEA 3S96A 4M9OA 2G2RB 5C09D 4TQEL 4X7TB 5AUMA 4CU6A 1ULVA 1NEZG 4XNZC 4Z6AT 2QSQA 2ILLA 4GKOA 1S7XB 4QRRB 1PLGH 4OLYL 1QBAA 1DANT 1TJGH 2A6DA 2BCKA 3IRPX 1UJ3A 4WFHD 3WNMA 2HYMA 2C26A 5HGDB 4Z9KB 3DYPA 2FR4A 3P77A 4ZO9A 5C08B 5I15L 3LZFL 3VFGL 4HLJA 5IB3A 3U6RB 5C3LD 2WLYA 4OI8A 1I9RH 3W5NA 1Y0LA 1NGPH 1HHIA 5A2IH 1A6AA 4X6DF 2XI9A 3BKCH 3BPOB 1TJIL 1KTKE 3LN5B 5D7SH 2QSVA 4J6RL 5IROA 4WEUD 3HZMB 4HIHA 4CW1A 4NNYA 3HUJE 2BY3A 4HQQH 1VGEL 4C55A 2DDQL 1PKQE 4PTTB 5EBWB 2E27L 1U2CA 2DKSA 1K6QH 3QDJA 1FFPA 5GJTH 4X6CA 4M1CC 3KDMA 1FNGA 1HH6B 3RPIA 1PY9A 1TTFA 4G8IA 5DEFB 3FO1A 5MEQB 4NUGH 3IKKA 3QI9B 1X5AA 3QDJD 4LVEA 5IMMB 2EKSA 1DSFH 1E27B 4JFPA 1I7RA 2J88L 2VZVA 3WFDL 3GNMH 1KCSH 5HJ3A 4DW2H 2CLVB 4PJFB 3O3UN 1P7KA 2EC9T 1INQB 4OF5A 5KN5B 1A2YB 4LSUH 2IANB 5BV7H 4DKEH 1DL7H 2OZ4A 1JF5A 1WZ1L 1T3FB 4NQVA 3FB8A 1NCWL 1GPOL 5I1HL 4JM4H 3V4VL 5IGXH 3CUPB 4NFDA 2P4AB 3IAGC 1EAPA 3B8SA 1P4LA 2OZ4L 1K8IB 4XPAL 5IVNA 5F44A 2CR6A 5K9OA 1VDGA 3RBGA 3RDTD 3DHMA 3ARSA 4P2QB 5IJVA 3FOMB 1S7RB 1N5YL 3IFNL 5T1KA 3D87B 3H7BB 4G6JL 3MOBH 3VFNA 4HUKB 5H8DA 3TN0A 4NDMA 5JIPA 1MF2H 1TZHA 5D71H 2GW5A 5EZOH 3L3IB 4IIQB 2VYRE 5T1KD 1EA9C 1U8LA 1ORSA 1QSFA 1NPUA 4H25A 2X4QB 4ZNEE 4Y2OA 5GSRA 1KLUB 2NY0C 1ZGLM 4Y19E 3EYVA 2HJKA 1W0YT 4LLUB 5D1QC 4U05A 3BW9A 4OUOA 3RWHA 5JW4M 2A9ML 1IEAB 1QSFD 3BP6A 5KSUB 5JLZB 1E6JL 3ARFC 4Z7UA 3IF1A 5C1MB 1J12A 2UVFA 3OKKA 3FT2A 2VC2H 1RMFL 5HHVH 4YHZL 5KJRL 4RGNC 4AQ1B 5CFHA 3D9AH 3JBG7 3IT8D 1KPVA 4DCQB 5C0FB 4GUPB 3LPGA 4MHHG 1OTUC 2MCPL 1RI8A 1XGQA 1M05A 4R9HA 5KAQG 1P7QB 5IVXA 4Q9QH 3OXRB 1NBZA 2XZCL 3LS4H 4FTVA 4QOKA 5D6CB 2MPAH 4S0TD 4APQA 4RRPA 3T3ME 4X4YB 4BH8A 5A2JH 1MAML 5I8EB 1ZGLA 3ULUD 3ULUL 4K23H 4Z5RA 4Z95L 1JGDA 2ATKB 4LASH 4PGCA 4XWOD 4LSSL 4PB0L 3H9YA 4FTVD 1MQKH 5FEBA 3GB7B 5EUOB 3A6CL 4APQD 1ND0B 4RGOL 4N0RA 1B4JH 4ZOBA 3TO4A 2K3TA 1KN4H 1DBAL 5DD6A 3U4EA 1LP9B 1JWSA 5INCB 5GRUL 5T1MA 4UINH 4MA8L 3TV3L 5DA0B 5L88H 2NTFA 1CG9A 3TO4D 3QULA 3VXUB 4HWEL 4N5EC 5JORB 1ZSDB 2Y07H 1BAFL 1N0XH 4HIXL 4OLWH 4QRTB 1IC5L 4KMTL 1R3KA 3D25B 5EUKA 3WJJA 2GJ6B 1MEXL 1L0XA 3G6JA 3UPCA 2F5BL 5IVZA 4U7SA 4LK4A 4TUKH 2C3VA 3KYMA 4QRRE 4LSVH 1UVQB 3IDMA 3LEVL 4N8CH 4PRIA 1A1NB 1UACH 4CMMB 7FABH 2EYRA 4MA1B 4LCUB 3V6ZA 4LPWA 3MNVB 5GS1B 1MSPA 3GSWB 4GG6F 4R97B 4PJDA 2I26N 8FABA 5MEOA 4YXKL 2DOCA 3JXAA 1R24A 4R2GB 4UT9L 4XCYA 3U4BL 1TPXC 4PRID 5EO0B 3MBEC 5ETUA 2QHRL 3NCYS 1UZ6E 3UDWA 5SX4I 4NZRL 1W72H 5CGYC 1NUDA 3QH3A 3EYOB 5C0AB 3S35H 4HMDA 5KSAA 5BXFA 1KIPA 4KI5D 4M7LT 3VGBA 5FM4A 3T1FB 1A14H 1OTSD 4J1UA 2P44B 3PDOA 5IESL 1F4XL 4I4WB 1I7UB 1F97A 4N0UA 1LO2L 3K2UL 5AZEH 3RI5K 3E8UL 4NO5A 5D96C 3O4OC 3GBNH 4FQLH 3FQNA 2VAJA 4OZGA 2DM3A 3PHQA 5KSAD 2CDGA 5B38G 2VZ3A 3GSRB 2EDKA 3W39B 3UPRA 3S4SG 5CJXA 1TCRB 4UOW1 5T5FH 5F3HB 1WT5C 2HN7A 2HLFC 3B9VA 3QIWB 1KCUH 1RJZA 3GMOB 2H9GA 4K71C 2NYYC 1QNZH 3V6OE 3AS0A 2I9TA 4W4NA 4LLAA 4AH2A 2HJLB 3MFFB 2AGJL 4LRIC 5KANG 5DLMH 4PJFE 4JHWH 3KJ6H 1CFSA 4GAJL 1QZ1A 1PFCA 2IANE 1A6UL 2ORBH 3VXMB 1B9ZA 3FN3A 4BFIA 4I2XE 1X5ZA 4ZUVB 1S3KL 5TDNB 4BA8A 4UU9B 2OP4H 1S7VB 4UTBL 3FHAA 3PL6A 1TQCC 3UJJL 3L5XL 3OSKA 3EHBC 3T3PE 3VGHA 1T7VA 4R8WL 1C16B 2CK0L 1OTTD 1ACZA 4X6DB 3RTQB 2DQIH 5IW3A 4YK4C 3ZTNH 4P2QE 1FYTB 5CUSH 4ORGA 2R1XA 3QIBD 3SQBA 4U2YA 4KJYA 1ODAA 4OB5H 4HKBB 3DRQA 4F37K 3VH8G 4UV4L 5IOPB 4D9LH 1IGML 1KYOJ 15C8H 1UYWL 4LCWA 4PP2A 1N59B 2D9CA 5L8LB 3GMNB 3HR5A 1FIEA 4U0RC 4GKNA 5EFIA 4X5XA 3BWAB 3P40A 5HI4C 2V2TB 1BM3L 5DVKA 1HCVA 4UNTA 2VUOA 3TZVA 3K74B 1FVEA 4LCWD 3NGBC 1ZANL 2EDHA 3GBML 2O93L 1KN2L 1VEMA 4G43A 5BVPH 1FZJA 1GAFH 5K9KB 1LK2A 1TJHH 1QO3B 3H9HA 3PDGA 5ICYB 1F4WL 5ISZB 3HE6A 3GRWA 4WCYL 4LPYA 3F7YA 3SKJH 4LSPL 4PJ5E 1M7IB 4WWID 2VMFA 1GOFA 1ZMYA 4Q7DA 3HE6D 4UQ3B 3GRWL 2QSTA 1CF8H 1XF2A 4RAVA 5EUOE 5DO2D 5I76A 1J05B 3O3BB 2P5WB 3WNLA 4HWBH 3IKCB 2AW2A 4GQ9H 3KGRA 1VEPA 2UWEF 5FYKH 1RZKH 1KTLB 3IRZA 2EXYC 3KAAA 3JV6A 4XXDA 2IAMC 1L0YA 1PJ9A 1DLFH 2JTDA 1LP9E 3S98A 3TBVA 4M03A 3X12B 5T3XH 1NH6A 3OAYK 1RU9H 5JXAH 1CL7I 1YEHH 2VERN 4XMPL 3O3AA 4L1DA 4PTUA 3V5KB 2ZUWA 1DQML 4IEFB 2AEIT 2YD2A 3OB8A 4ZO6A 1XEDA 3S3SA 5DZOA 1CL7L 3MV7D 4XNYH 3RUGA 1ZKAA 1NL0H 3LQMA 4MNGB 1NSNL 2NY4D 5DVLA 1Q1JH 2NXYD 3HI5L 2GJ6E 4ZPVB 1NCDL 1C08B 4MJ5B 1QFHA 5DSCB 5I1AA 1J1XH 5CIPA 2V7NA 5GXBB 2FZ3B 2B39A 5HHNA 5F6HJ 2VLKA 1I8IA 2OR8A 1JPFA 1VACA 1BD2A 3T04D 1FZOB 3GUTB 3FTGB 3NA9L 1TTUA 1F4YL 1QBLL 1NQBA 4ZTPL 3T77A 4DGIL 4FQCL 3VXTA 3MCG1 3O41B 4NRYA 5GGRY 3QXTA 1MCPL 1V7ML 1IC7L 3WHE1 3QEQA 3TP4A 1BD2D 4NRXA 1B88A 1BBDL 3IDJA 2R39A 5C0AE 4MJ6B 3B9EA 3BP5A 1ITCA 2ZKHH 2C3GA 2P42B 1I3RA 2NY2C 2WUBH 4OFKA 4HFWA 5E1HB 2AV1A 1RZFL 3JVGC 3TNNB 2R0LL 2X1XR 1AGFA 2XQBH 5FF6B 1GCFA 3PWJA 1NEUA 1KT2A 2CRMA 1C5DB 2NW2A 4Y2DD 3C2AH 4ZUTA 4YHKL 1Y18A 4M43H 4HGKC 3JV4A 3EOAB 5I1JH 4U3HA 2YA1A 1IGYA 3SQOL 1A7OL 1FVDA 1T7XA 3ARGB 4LF3B 5DFVC 2A77H 1A47A 4H1LB 5IFJA 2AJYL 4M6NL 2CKBA 4YBQC 3GJFH 2XWTA 3LKNB 1ZA3B 5KS9E 1XGTB 3NIDF 1RZ8A 4G9FA 2ARJA 4HS6B 4MQXC 4CKVX 1N64L 1L7IH 3OKOA 5TE6H 3BPNC 3N9GH 1G6RH 3HHRB 1UCBH 2CKBL 5LXGL 1H5BA 3VXME 1IM3A 3BGFC 4GMTL 5DFTA 1EPFA 5ITBL 5SWQA 3L3OA 5C0BA 4GG6B 5K59F 1U3HB 4U1KA 1TVBB 5F93C 1OP9A 4ONGH 5FV2A 4M7KH 3QO0B 4I77H 4FQJL 4JPIA 1L7TH 1WAAF 2X1OA 4JO1L 4HWNA 4J3VA 4MJ4A 4HKZB 1N4XH 4ESKA 3QNXB 2B20A 4X0KB 1AIFA 3QWOB 1WBYB 5EULV 1A4KB 4X6DE 4G8GB 1I85C 1HHJB 1W0VB 4MCYA 2KPNA 1FYTE 4XVSH 5BZDA 1JNHA 3TBTA 1IGTA 3HS0A 4EN3A 4WW2F 4HH8A 3WE6B 1D5IL 5E7FA 2IGFH 5BCAA 1MRCH 1UT9A 1V3KA 3E1F1 1WBZA 4ZAKB 3ARVA 3NABL 4F9LC 3IJHB 5I1CL 1GGUA 2I24N 4CU7A 4TSCH 1HKLH 3GBLA 4Y4KA 4NP4L 4TOYL 5FGBC 1VKXA 1Y6NR 1RJYA 2X2YA 1CE6A 1M7XA 3CH1A 4DZBB 4D2NA 2APBA 4N0FB 1RUKH 1OQOA 3MBXH 4EQ3A 2YUXA 4Z0BL 4FZEH 1EHNA 4Y4KD 3U7YH 4ZS6D 4P23C 1J88A 2Q76B 5IWLA 3FRPA 2L7JA 5ISZE 1P84K 2YPLD 4GAYA 4OD3H 3BHBA 4O58H 1FO0B 4M62H 5GS2H 1U58A 5CJQL 2DKUA 4FNLH 1NGQL 1XGYL 4IRSC 4G8EB 5I6XB 1JVKA 4P9HH 5DZLA 1SBSH 5E8NB 3S5LA 1RZIA 1A9EA 4JO3H 1CXLA 4MNQB 4X6FB 3MFGB 1AE6H 3PWPB 4HLZG 5D2LA 4XRCB 3INUL 4OZHE 3X3GL 1R3LA 2AJSH 5AWNL 2P5WE 1VCAA 3DETD 2C4FT 1PGRB 2I25N 1OARH 1R0AL 1TITA 4I3SH 3ECBB 3T08A 5CSZB 3ZL4L 3U9PH 3ARBB 4LPVA 3GHEH 4OZFB 4HIEB 2XG5A 1HWHB 4OCXH 1ZLUK 3M8OL 4D8PA 3MJ9A 4KQ4L 2BOBB 3MYJB 1U3ZA 2DD8H 4PG2C 2PCPA 3RY6A 1D9KC 4KAQH 2KL6A 2AJ3B 3KPSA 3VWKB 2J8UE 3LN9A 4NN5C 3U30C 3IU3B 4WRLA 1QLEH 1QOKA 3HG1A 2R29H 3SE3C 3KPPA 2WK2A 3MJ9L 3HB3D 4HBQA 4JN1H 1VFUA 3TT1L 1S8DB 5E8EA 3ZTJG 3WO4B 3GEWB 1XMWA 3MLXH 1CDIA 2LU4A 5DD3H 4HS8L 4R96B 1ADQH 2F5AH 3HFML 2F58L 3ZZ1A 3QG6A 5CAYB 2GJJA 2R1YB 2E8YA 1VERA 2JIXB 1XR9A 3BQUB 2HFFA 3TBYA 4UIKH 4XBGA 3X14A 1EEYB 3FAXA 4TNVK 4NUJA 1AI1H 4KKLC 1F90L 3Q5YA 3V0WH 1KEGL 1IQWH 1U6AH 3U82B 1DEEB 1GGTA 3NTCL 3FONA 3BXNB 1FJ1A 2YN3A 2GT9A 2PW2A 2MCG1 4JZOB 1K85A 4DGYH 3L3HA 4NHUB 5DUMH 1PLGL 3MRIB 4W70A 2UWEB 2Y1VA 2P5EA 1NGWA 3QUMH 4JLRA 1LGVA 4HXAH 4NKDA 3U48A 4JAMA 3RWGB 3NZ8B 2L0DA 2J4WH 2GITB 1J8HD 1I9RL 3ZKSD 2ZCLH 2P5ED 3VXQA 3OJDA 1TIUA 4AYFA 1NFKA 2VKXA 4LKXA 5HBBA 3EOYG 3PWVB 3BZ4B 2W0PA 3EAKA 3MRMB 5D70H 4ODXB 1MHHB 2D03H 5D7SL 3SPVB 4P5TB 5DJ6A 4MQTB 2C5DC 5C0JA 3T65B 3WXWL 2ADJB 1CQYA 1I1RA 3NCMA 5HHMB 5L2KD 3SDYL 1K6QL 3LB6D 4YO0A 2MKWA 4KRPC 5GJTL 1HQ4A 5C7XH 4AIZA 5J1TC 5D7KE 3O6MH 4GG6E 1TMCB 5E5MB 4FQ2H 4NUGL 4YDJB 1BJ1J 4JFED 4W6WB 4AIOA 1FORH 1HDMB 3MJGX 4GJTB 5EORL 4Z0XB 4Z76B 2FEDD 3WFCH 3P11H 3LQAH 1DSFL 3QHFL 5F6IC 3JWOC 5F96H 4G8GE 5AYUL 1XGPA 4MQ7B 5ACLA 3HZVA 5FUCE 3RAJH 2ITDB 3RWJA 2VSDA 4M1DL 2HT4C 1M4KA 4LSUL 4P46B 4YXLH 2FH8A 1F02I 1KBGH 4LFHD 3O6FB 4LCIL 2PR4H 2WBJB 4JM4L 5F1NA 3PJSB 1CS6A 3GI9L 3C60C 3D1MC 2IQ9L 2DWEB 1MI5B 3V7AG 4L8CB 1DJSA 1UXSB 2QKIB 4P59H 1UB6B 2IH3B 5F89A 2JELL 4RAUB 1Z9OA 1MCRA 1NANH 3KYAA 1A7PH 5IKCA 3TESA 3RVWC 3MOBL 3W82A 3GK8L 1QYGH 4RFEA 3UTPE 4FP8H 5IQ9B 1MF2L 5KW9L 1P4IH 1X6LA 3EYSL 4WJ5B 4P9MH 5E4EC 1JUFB 4QHLA 4H88H 3MNWA 1DVFB 5FYJU 1YA5A 3WYRA 4G7VH 1ZK9A 4OT1H 3SGDH 2X9XA 3MJ8A 3QRGH 2F54D 3GSOA 2E7MA 3ARFA 3MV9B 4YR6B 5BMFH 3VXPA 3UBXA 1AR2A 4MNQE 1A7RH 3DX8A 2OR9H 3BYYA 2DQCH 3PWPE 4YPJA 5HHVL 2VC2L 4JFYB 3RWFA 1BX2B 3ULVF 1BLNA 3D9AL 3BI9X 3UBXI 4WW2B 1T5XB 1MCSA 4XC1L 1S7UA 4AZ8A 4MD5A 4RGND 1I9JL 3QAZB 4L5FH 4MB4A 4UQ2A 1A1MB 1R5IA 4Q9QL 3ES6A 1HHHA 1X44A 5IK3A 4PREA 3BAEL 2EIZA 3B2VH 2H6PA 3OWEA 4KVCL 4OGXH 3VXSD 4JN2B 2NZIA 2C3WA 3NCCB 5ANMB 4LASL 3MGTA 3MV8A 3Q3GB 4N8VA 1MQKL 3MUGB 1F6AA 3SE9L 1YPZA 3H3PH 3ETBF 4YDVB 1T89C 1N7ML 4P4KB 1SEQH 1UWGH 5IMKB 2AI0L 3QJHA 1KN4L 3T4AB 1O5DT 3MV8D 2OX5A 4MWFB 5LAXA 4OFPA 4NOBA 4PY8J 4OI9A 3K7UA 3UYRL 2DLIA 2Y5EA 2J8OA 1F58H 4YGVA 3R1GH 3QZWA 3GSQA 4IRZL 2UZXB 3WD5L 2DL2A 3OGCA 3M17A 5HI3C 1N0XL 4YWGL 4OF6A 5JZ7C 1FL6B 1ZV5A 4QYOA 5I19H 1EIBA 3FT4B 5JDJA 5I1EH 1C5CH 3RZCA 4OFVA 4JFQB 1ORQA 4MB3A 3LEYL 4OI7A 1WC7A 4LSVL 5IB4A 3O3EB 4ODTH 5AG9A 3M45A 3F62A 4P5MA 2UWEE 1FZKA 2DQJL 2HFTA 5JW4Q 7FABL 4RMVA 2IH1B 3BMWA 3U1SH 5DR5H 1XIWC 3RZCD 2DM7A 3OHXA 3LKRB 1JGVL 1UKTA 3MRHA 1F8TH 1BREA 4GLRH 4NHCL 5J0BA 5MEPB 4PJIA 2PYED 1YQVH 4NN6B 3RVTD 2V5MA 1HSAB 3S35L 3VD5A 5CMAA 1O0VA 2EDDA 2XNAA 3U0PA 2V2XB 4HH9B 2K7PA 3RHWF 5DMKB 5CGYD 1OAUL 3GMRB 3S88L 2Y36H 4WUUB 2BXYA 4R90H 1IKNC 3FO9A 1I1AD 4OV5B 2R23B 5E94A 1KCRL 5HHME 1GRWA 5D5MF 4EUPB 4X6EA 1WT5A 1LE5A 3JTSA 1I4FB 4OZFH 1Z0NA 5E1AA 1BJ8A 3K0WA 4LRNL 1YEJH 4LBEA 3QNZA 2JLLA 2J1KA 4CVXB 3CMOL 1QNZL 7CGTA 3MOAL 4FQHB 4H0IA 1OP3H 3BYTA 2EC8A 4LRIA 3VFTB 1FVCB 3F5WB 3KLHC 1C12A 2ED9A 5GRYA 3BN9D 4K3HA 2UYLB 5DQDH 3CLEL 5IEKA 4QRSA 3TT3H 5I16A 3CSBA 1UA6L 5JQ6H 1QVOA 3PQYA 4CGTA 1BJMA 3RIAK 3VG9C 4X5LA 3DSNA 4RFNB 2AERT 3AVEA 4YDLC 1D5BA 2BSRB 4NQXB 3HNSL 4PBXA 2VDLL 2KZWA 5DHVA 4XAKE 3FN0H 4LLVB 2XFXB 4IDJL 3PQYD 1MI5E 4V1DB 4ZOAA 1QFOA 4P3CH 2VDOL 4NC2B 5F7UA 3B9KC 2DQIL 3FO2B 4QHUB 3EHBD 5KTEH 3MGAA 5D7LB 5F9DC 5CUSL 3NIDE 2AJVH 1T20B 3H9SB 4P57B 4NBZB 1A9BB 4OB5L 2L7UA 4F7EA 4OLVH 1RULL 3DX6A 4HWZA 4PJ9B 3GDBA 4K8RH 4WI9A 4I48B 3ZYJA 1F4HA 4GS7C 4M6MH 3L3KB 5C08D 5K59E 5HTSA 3JWDC 4NPYB 4ELKA 3QFDB 4PJCA 4HJJH 3HI6L 4GW1A 4X4XB 3LKPA 3WFZA 3GSNH 2NX5A 3F12B 4PRNB 3MV9E 2Q8BH 3LD8C 5HI4D 4Z8FL 1RURH 2NXZC 5ITFB 4J3WA 3AY4A 4S1RH 5GGVY 4JVPA 1KCKA 4H0HB 2WINB 5CCKL 1P5VA 2YC1B 4S2SA 2XTJB 4Y5YC 1TJHL 3CFEA 1HHGA 4NQSB 4C58B 5IB1A 5E2TH 4RBPK 4R26L 4ETQA 2XKUA 3VXRB 3MPCA 5DQ9A 2P46B 5HVFB 3HE7B 3MRFA 4UNUA 2XZAL 3B9AA 1BZ9A 5C07A 1VFBA 4L8DB 4HWBA 2O5YH 4LVHC 2DQTH 1MAKA 2VISB 5DJ2B 3VD7A 1HSBA 3QFJA 5IMOA 2LTQB 1CF8L 5ANME 3PHOA 4O2CB 5DYOA 1S9WA 4O2EA 4XCCH 1DUZB 4HF5L 2VWEE 1MIML 5C07D 4X7FC 4X80L 4QXUH 4HWBL 4F57L 3I6LD 1MHPH 2IAMA 1T1ZB 1NC4A 5FYKD 2IMNA 4X5WB 5I8OH 2B4CC 1RZKL 4PRBA 4Z7VF 3VE0B 4GW4B 1ZTXH 2YOCA 3D3VA 3TIDB 1SY6A 2R0KH 4ALAH 1DLFL 5BRZB 5T3XD 1U42A 3VRIA 5T3XL 3C9NA 5JXAL 3S9DB 1YEHL 5C6TL 4KQ3H 2JB6A 2DMKA 1Q9WA 2IAMD 3C6LD 3W2DH 4CJ1A 1NC4D 1SYVA 4ZXBA 1RIHL 3HPLB 1B0RA 3D3VD 3QG7H 1F11A 1SY6L 3C5ZB 4OM1H 1IL1A 2ZZUT 1O7SA 2AEQL 5EPMA 1FRGL 2BX5A 4C83A 1FN4A 2BVQB 5F70A 1NMCC 5I2IA 4X8JB 2FGWL 3DMMA 4ZXBD 5F9JA 2GFBB 3EOBA 5BVJA 1UQSA 4MGXA 5K93A 1CTOA 4ODUA 3IDXH 1JGUH 1AGCB 2OTWA 3GKWH 2ZNWA 3TCLA 3LIZH 3DMMD 2F19L 3KWWB 5IHUH 4YC2C 4U1GB 4ZS7H 5HYFA 2ERJB 5DUPH 2VB5A 4YHLL 4U1MB 1MRFH 1RK1A 4CVZB 4BQBA 4WW1B 3JVGA 4MJIB 4YE4H 2NLJA 2WUBL 1D5MB 2QR0B 4PRPB 4WUUE 1OCWH 4ODHL 1FL3A 4OLUH 5E8OB 1XF5A 4GQPH 5EZLB 1AD9A 4QRUB 3GJFA 3DPBA 4M43L 3RA7H 2QADC 5ESQB 4PG9A 1PEWA 5TPWH 3T0XA 4TYUA 1FE8H 1WITA 4G8FB 1CDYA 1UWXK 4KZDH 5E6YA 4MB5A 4JRWA 1G6RA 1AHWB 2GCYA 2OTUA 3MA9H 1NUFA 4LVNB 25C8H 4U49A 4NYLB 2KZ1B 2VLMD 1DBBL 3B5TA 1WIUA 2P24A 5KVDH 4LQFL 1CE1H 2YPKB 4I5BA 1AXSB 1EO5A 5TE6L 2M8XA 4KVNH 1AP2A 4LHUA 4Y1AB 2FJGB 3H7LA 2VNCA 1G6RL 4Y89A 1UCBL 3AMKA 4JKPL 4N0CD 4OCRL 3MACH 4PD4K 3RP1A 3K81A 1RJLA 4H5SB 4K9EC 1ZT1B 4LHUD 4XAWH 5IHZA 4C4KT 4I77L 3DBXB 3MREB 3QXDA 5HHOA 2PTTA 2ADIB 3VCLB 3VXUD 3CX5K 1TDQA 4V1DE 2AV7A 4RA0C 3LN4B 4A6YB 4JREC 3WIHA 1ZA6A 1KB9J 4YH6A 1CD1A 3MRNB 1NJ9A 4PJEF 4XVSL 5D7LE 1PG7L 3H9SE 4GSDL 2VXTL 2FHFA 1CLOH 1P1ZA 3AU1B 3T0VA 3WIHL 1VADB 2WUCH 2YR3A 1TVDA 3SDXA 4EIGB 4KHXH 5IW6A 5EU4A 2FWOA 1F3DH 4WU5A 2G5BA 2ADGB 1OD7A 4OGYL 5ADPL 4PGBA 1BFVH 1C8PA 5FGBA 1L9NA 3RIFK 3TF7C 3VWJB 2QEJA 4TSCL 1WEJH 1HKLL 32C2A 5IW1B 1DFBH 3S34L 3NCFB 3S37X 1P2CB 3L1OH 5T1LD 3P30H 5EOTA 1ZVSB 3BPCB 4PYHA 1JNLH 3MXWH 3K3QA 1LD9A 4FZEL 3K46A 5ESAA 4BKLB 3U7YL 2BVTA 1N6UA 2XTJE 3L7FB 3EW3B 3LRGA 3PP3H 4KMQA 4EUPH 2EICA 3CVHA 3VXOA 4OD3L 3TA3A 2HJFB 4IRSA 5GS2D 3VXRE 1WBXB 1G7JB 3ZKNC 1NFDA 3O9WA 5SWSB 1LEGB 5IBTH 3BZEB 3I84A 3GMLA 3TYGH 4YHOL 1FGVH 1KLGB 3BKJH 2BHUA 1SBSL 3QO1A 1IZJA 3BEWA 3TA3D 3CVHL 4H26A 4IRSD 4U1LA 4JO3L 1V3MA 3PP4H 3ZE1F 3GJEB 3O9WD 1AE6L 3WN5A 5L9DH 3P73B 4HUNB 2DQDL 3GJFK 4ZD3H 3W9EB 43C9A 1ETZA 2AKRA 4PR5B 4DAGH 4NO2A 4I3RL 2H45A 1CGYA 3OG4B 3EYUH 3LH2H 3X17A 3IU4H 2C1PA 1JHLH 1T4KB 3U9PL 4D3CH 5BRZE 4JQXC 2Y7QB 1XCTB 3QUKA 2APFA 4PG2A 3MMEA 4NJAH 3LQZA 1D9KA 3L5WA 4WUKH 5IBLC 4XVJH 4ZOEA 3S4SB 1AQDB 3RTQD 4KAQL 4UDUB 3SE3A 3V79C 1MJJB 2X10A 3ILQD 4JQVA 2BDNH 5F9WB 4UBDD 1QLEL 2YMXL 2DICA 2R29L 4MD4A 4B0MM 2O5ZL 3IB4A 4G7YL 3SJVE 3ULVE 2DTMH 1FSKB 3JTTB 1CTNA 4JO4H 1JPSH 5DD3L 5TGBB 1F5WA 4BUGA 2F5AL 1BQLH 2GQHA 4FHBD 2HTLC 4LSDA 2BMKA 2HKFL 4UIKL 4XVUD 3KJ4C 2J5LC 3BIKB 3BX7C 3QT2A 4IS6B 1XR8B 3KPNB 4OF8A 3TPUA 3V0WL 3QUMA 2EH8L 3GSUA 2H32H 3QXAA 6FABH 5DJXB 2ZCKL 1M6OA 1J86A 3WUWA 3PWUA 4P2YA 4KKLD 3FB5B 2VRAA 3RWDA 1MFEL 5FA4A 4XP6L 4YFLF 5DJ8A 4JDVB 4GKZA 4JG1H 4PJGA 2R2EA 4OQTH 4PRPE 5ICZA 4Z7VB 3QUML 4HXAL 3ZSSA 1CLYH 4JRXA 1NKOA 5I66B 2PUQT 1I1CA 1B0WA 1TVHB 4L1HA 5L8KB 2NY6B 4EDXB 2QQNH 1HZHL 3R8QA 5E7BA 4JRXD 2HVJB 4HBCL 1T0MA 4W81A 5D70L 2D03L 3KLSA 1PY4A 1VA9A 2DYPA 4Y1AE 1INEH 2L4OA 3LKOA 1KACB 3IDYB 2AQ3A 3SCMD 1OGAA 3NZHL 3S36H 4K7PY 5J1AB 1NCAH 5IB5A 4X83A 4EDWH 2HG5A 3M07A 3BPOC 5E99H 5ENWA 3O6ML 4BH7A 1JZ8A 5JW3H 5J13C 4ZUUA 3MLVH 1EO7A 4JM2A 4MZ2A 2WM0A 4FQ2L 1N6QH 2Z35B 1KELH 1OGAD 3FQRB 3IDNA 4JJ5A 5BS0B 4Y4FB 2Q3ZA 4XI5D 4CADB 3LQAL 2VLRA 2Y6SC 4WDIB 1D6EB 2DQFB 4JM2D 5TDOA 1AH1A 3WS3A 3H3BC 2OJEA 3K4DA 5C0DA 4PYGA 3QI9C 1YMMA 4P2RB 1G9NC 3JWOL 2IBZY 3RWCA 3C08H 3FFCB 2WWKT 3V6OC 4AM0A 1Q0XH 5IT2H 3C60A 2PR4L 1DLHA 3MRLB 1H0DB 3EKCA 1KJ2A 4KROD 5CILL 5DMYA 3PIQA 4PS4L 3FHQA 3AAZA 1NANI 1CBVH 3QQ3B 3B3IB 5GZNC 4P59L 1JGLL 4WI6A 4X7SL 5D1XB 1LO5A 4IMKC 1KJ2L 1K4CB 3IFOA 3LRHA 4LIQE 1A7PL 1U92B 5B4MD 4JR9H 1K5NB 3KNBA 1DQJB 1MVUA 3MRRB 3TJHD 1UJTA 1QYGL 2X4SA 3FQUA 2DJ4A 3MV11 3T2QA 4FP8L 4AJ0A 4F7TA 5M94B 5DI8A 3SGDI 3IJSB 4WHYH 1IAIH 4H88L 4HX1A 5HHQB 1T66D 4X6CF 5CP3A 2IADB 4JZJB 4OT1L 4CN6A 1QEWA 1HEZA 2ZUVA 5SWSE 4PY7A 4OCWL 5EU5A 3SKNB 2DQHH 4LHJB 4ELMA 1TETH 5LGJB 4IIQC 5IR1B 5J12B 3QIUB 4PJEB 3FOLB 1UKQA 3RGVD 2OR9L 2DQCL 2M26A 3VFWB 4EIZC 4GRLB 2B0SH 1MVFA 4KK9C 5LGHL 1UXWA 2MQCA 3DUUB 1J1PL 2NW3A 4OZ4B 4UNVA 1UM5L 2ESVA 1I7TB 4BZ1H 2I07B 4QXWA 1E6OH 3RZWA 4XP1H 4U1NB 3RNQB 4M7LL 3B2VL 2YD1A 4PRHA 3MLZH 2VJXA 3B2UC 2FHCA 1OAKH 2ESVD 3VW3H 3QPXL 3BMVA 3WDIA 3KHQA 1T89A 2Z4QB 5CGTA 1S9VA 4PRHD 3C5JA 3H3PL 5E4IA 3OXSA 4U1HA 1BFOA 4WO4A 1GZPA 3NFNB 3NOIA 3MRBB 4JGUA 5E5RB 4TRPH 4OSUL 3SGJC 3QZWG 4JFDA 2BRQA 1G7MB 4QEGA 2NY3D 2AK4B 4ZYKA 2ZP0T 4I0CC 1JCKA 4WO4D 4NRZA 5IV2A 4PRAA 3RI5F 1C7SA 2W65B 5EC1A 5IG7A 4Q6IB 1MWAB 1GZQA 2YBRA 3CFJA 2ATPA 2AJZB 4XZUA 4NZDA 4IMLB 3UJIH 2AS5M 2EDTA 2PYFA 2XKNB 3R06A 2OJZH 3RVXD 3F7VB 5I1EL 1C5CL 4Z7UF 4JY6B 5GGTA 3ZHDA 2X89D 3LEXA 2YUZA 3RY4A 1KIRB 1RD6A 3NH7H 3SKOB 1XIWA 5C0RH 4PJBA 3RWIA 4Z7VE 3UTTE 3VFMB 3UJTH 1PEZA 2XWBB 3LKQA 1FNHA 3ULUF 4FQ1H 5B39A 5DC9B 5GGTL 5IVXF 4O51B 1U8MB 1F8TL 4X98A 6CGTA 1UH2A 4AQOA 1X4ZA 4I9WE 3IETB 2JJVA 3L6FA 5DVMA 2IPTH 4O02H 3UPAA 3DECA 4N9GA 3FQWB 3KPLA 2ZSVA 1CFTB 4MA1C 5KSVA 5GS1C 5F1SA 5ID1A 4R97C 1X5YA 2C7UA 2MTPA 5HGBB 5HYQA 3F8UB 4Q9CA 4R2GC 3RWEB 5DMGD 4J4PA 1HH9A 4KK6D 4OCLC 4YDKL 4X9FA 2Y36L 3MLRH 5DMIH 3I9GL 1U3YA 2UZIL 1JZ3A 3OKDA 3ZDZF 3TH3T 4PGJA 4UIMB 2ZNXA 4XMKH 3ARBD 4RMQA 4J4PD 3QDME 3QEHB 4F37F 4U7MA 3JV5A 4S1DD 3K4AA 5TF0A 3TBSA 4EOWH 2YRZA 3FZUC 5BS0E 1YEGH 3IDIA 3MRCB 3CMGA 4KPHH 4UZGA 1EERB 4LSQH 4Y4HB 4UT6L 3MGOA 2PO6B 1XCQB 4HV8A 4L4VB 2Q6WB 5A16B 4C59B 5F7NC 3B6SA 5I1LB 3G6JF 3FRUB 3TT3L 1EFQA 3T8XB 3WL9B 4XC3L 1HILB 4P2RE 4XNXL 2DRUA 3P0YL 4MX7B 2XACC 3OPZH 4Q6YA 1Z5LA 4K3JH 4RZCB 3MRJA 4KJPD 4OAWA 3VFUA 5JQHC 2D9QB 1KXTB 4LLQB 5BQ7A 1NUGA 2AXGB 4ZFFA 4FFVC 3QUYA 4KI5F 4IM8A 2HT3C 2VXSH 3B9KA 1MPAH 3KPOB 3VFOA 4P3CL 2GSIA 2FBJH 4WVRA 3QEUA 5DK0A 2W59A 3WUZA 4G42B 4KTYA 3QWRA 4GFTB 5CEZL 1YYML 5TQ2H 4PUBH 5DUBB 3QUYD 3D69B 4NWUH 2HRPH 5CHNB 1FZMA 1YMHB 2ICWA 3BP7B 4G80A 2YD5A 4GRMB 1Q9LA 4K8RD 4KGLA 3TC9A 3GSNA 4OZGF 3QWRD 2ICWI 5C09B 4M6ML 3TIEA 4XXCC 3EDJA 4LMQI 4KZEL 2VQ1B 1KV3A 3OKEB 3MJ7A 1EHAA 1K3ZA 4LKCA 3GSNL 4HKXA 2ZOLA 3QRFM 1SHMA 3BDXA 3JWDL 4R4ND 1BHGA 3DOSA 2Q8BL 5JOFA 1RURL 2GHWB 4PJEE 5B21A 4Y5YA 2D0GA 4H8WC 3WXVL 5JIKA 2NXZD 1Q0YH 1IC4H 3HC0A 2R56H 2A6DB 5E2TL 2BCKB 2V6HA 2ZUSA 1UJ3B 1J1OH 2D7MA 4HJGA 1NBQA 5EWIH 4D0CA 1N8ZA 1B2WL 1P4BH 3RBSA 2K7QA 2Q8AH 5CZKA 1UZ8B 4Y5XA 4WNQA 4XPHH 3NCJH 5IB3B 4O5LL 1CZ8L 5FYLL 1SJXA 2O5YL 2DQTL 1HHIB 4F33A 3QR2A 5CZVH 1A6AB 5CLWA 1CU4H 4PP1C 2G75A 2ZUQB 4HK0A 5DS8A 2X1PA 3T09A 1D3CA 1OP3K 4FZ8H 4HIHB 4CW1B 4Y5VB 3NFSL 4NNYB 5F7LB 5AEAA 4OLEA 1MELA 1KTDA 1KJMA 5EO1A 2IPUK 1WSST 3STZB 2R0WH 5DWUH 1QSEA 5FYJE 3O2WL 3QDJB 1UC6A 1FFPB 2AK4E 4KUCD 4KKCD 1I9EA 4X6CB 1FNGB 1NCBH 3RPIB 3FO1B 2B4CL 4HW6A 3QEGH 3TVMA 3W2DL 3VXRD 2LU3A 5FAAA 3P0VH 1QSED 3BSZH 2J3SA 4L9LA 4DTGH 1ZHKA 2EKSB 4MMXC 4JFPB 3IXAA 3Q2CA 1I7RB 5HJ3B 3HC3L 4N0YL 3TVMD 2RFXA 1CFQA 5DD5H 1QLRA 2QQLH 2G5RA 1P7KB 4Q97A 2X6MA 1FFRA 1V05A 2F53A 4E9LA 3MOQA 5B8CC 5C92A 1JGUL 1AFVL 1DVFD 3RDTB 5AD0A 2AEPL 3GKWL 4JDZA 3ARUA 2F53D 1EAPB 4PJ7A 4ODVL 1SJHA 2WWMD 5K9OB 4E42A 4NCDA 4NFBA 4JPWH 5C2BL 5IJVB 1U8OA 5IUSA 1H3XA 5T1KB 3BPLB 1JWMB 5GQBA 5K9QG 1X5GA 3UZVB 4OCYL 1QFWM 5E8DH 1CLCA 4HAFA 1CQKA 4LCCC 5JNYA 3ZT7A 3CSYB 4NDMB 1MLBA 4WFFD 2P8LA 2RIKA 4OLUL 4TULL 3DV4A 3QBTB 5HDBE 4FXKB 5EZIH 1D5ZA 3OZ9H 4TVPH 2VDMH 2DLTA 5DJZA 3MQIA 1QSFB 2YD6A 2GUOB 4H25B 4XCNA 1OSPH 4L3ED 1JNNL 5GSRB 3TYFA 5TPWL 5HDOA 1FE8L 3EYVB 2HJKB 5D7JC 4KZDL 4K7FA 2F9BT 3BW9B 3RWHB 1H8OA 25C8L 1NGZB 4PBWD 3BP6B 3PNWA 3RUGF 4L4VE 2XKSA 4Z7UB 3IF1B 3OKKB 1G9MC 3FT2B 1YJDC 1CD9B 5E2WL 3ARGC 3OR7A 1KPVB 1UWEL 2Y5TB 5FYJH 3QCUH 5GRVL 3S3JA 3ZYOA 2WV3A 1XGQB 3QP3A 2YK1H 5IB2A 3P9MA 5IVXB 1NBZB 4FTVB 3B9DA 5H94A 4OD2B 4APQB 5E24E 4BH8B 3EFDL 4K9EL 1K4DB 4OIIH 4FQPA 2VZ1A 2SEBA 4Z5RB 5E8PA 4M9PA 2R2HA 4PGCB 1U3HC 4LGRB 1QFUH 2BRRL 1ZE3C 2Y25A 1KFAH 5I73B 1FAIH 2H2SD 3JUZA 1CLOL 3TO4B 1B6UA 4FFZL 3U4EB 3P4NA 2WUCL 5C09E 4J8RB 1JWSB 3ZDXF 2D7OA 1N2RB 5FUCC 2C4XA 5T1MB 2VN4A 4KHXL 3NAAH 3MODH 1A3LL 5DK3A 4TN9A 3I6KB 5F71A 5FDWA 1BFVL 2NTFB 4NN7C 1OOAA 1CG9B 1UCTA 3QULB 2ZJSH 1YEKH 1WEJL 4YUEL 4RQQB 1DFBL 2BSED 2IPKA 4OF3A 1RZJC 1R3KB 4LP4A 1R3HB 4WFHE 3Q5TA 4ZAKC 3UO1L 3IVKA 3G6JB 2KQNA 3V9FA 1I3GH 1T5WB 4TVSa 5IVZB 3ZKQD 3MLUH 1JNLL 5CZXD 2YXMA 2C3VB 1T04B 3KYMB 3EYFA 4ZOCA 3IDMB 5IF0A 4PRIB 3O81A 4U31A 2FSEA 3V4PL 2EYRB 4JANA 3V6ZB 1EX0A 1CGSH 1UM4L 3CFCH 8FABB 5MEOB 4XCYB 4FRWA 4E41A 5ETUB 2F74A 5CD3A 2APWA 1A6VL 2MKLC 3U79A 3CDCA 4KH2A 4QF1A 3TBWA 3OGOE 3TJEH 3UYOD 3QH3B 5DJAA 5IQ7H 5KSAB 1WFOA 5BXFB 1KIPB 5J06A 2VDPH 4TNVF 2XIDA 4ZD3L 5K33A 4E41D 4M5YL 3PDOB 4OGAC 4ZUWA 1R3JA 4N0UB 5I6XC 4NO5B 4RX4D 4U6VH 5DGQA 4OZGB 4HLZH 2AK1H 3PHQB 3QDJE 2CDGB 4XWGH 1JHLL 3S37L 4X6CE 5DK2A 5GRVK 4Z78A 4BZ2H 2CUMA 1C7TA 3CFBA 5CWSA 4WUKL 2VTFA 3DX9A 2H9GB 3MR9A 3HZYA 3FN9A 4AH2B 5KZCD 1M71A 2H2PD 2HFEA 4NQCD 1J0KA 3PDDA 4G9DA 1MHEB 4X6BA 5JO5A 4FFYL 5LG1A 2A6JA 4ACPA 1J0ZA 3D0LA 4WU7A 1URLA 4MVBD 1T2JA 4BFIB 2VDRH 4TQEH 3VWKC 3WLWC 2H32A 4X9GA 3ZTJH 2HVKA 4KK8C 2UV3A 3LSOA 4D0BA 4EI6A 3QIBB 5F7DA 3V0VA 4BFBD 4AT6A 2NY5C 4D9RD 1NEZA 2EZ0D 4MLSA 4NCC1 4GO6B 1JYXA 2D2OA 3BQUC 2P49B 5I15H 2E8ZA 3ARYA 1T0NB 2G2RA 5D2LF 3VFGH 3DO7A 5GISL 4KJYB 5ELIA 4JG1L 3BWUC 4C54A 1M7DA 2XA8L 4LCWB 4PP2B 4OM0H 1VESA 3BVNA 3HR5B 4UOW0 2B5IB 1QSFE 4QRRA 1TJIH 2CO6B 4GKNB 3GIVB 3PP3K 5EFIB 4X5XB 3QQ4A 1SVCP 2M2DA 3PWNA 1QR1A 1HQRA 1PVHA 1GIGL 2E27H 1CFBA 2Q1EA 3D0VA 3QDGD 3GM8A 2DAVA 1U0QA 4G43B 1JV5A 1JZ7A 1X4YA 5D1ZD 4NSKB 1LK2B 4WI7A 2DB8A 3H9HB 3S36L 1NCAL 1RUQL 3HE6B 4F9PA 5GHWH 3F7YB 3ULUE 2J88H 4JFXA 4OF7A 3WFDH 3MLVL 1CDUA 5IVXE 1X4XA 4P5TC 2LFGA 4PTTA 1IGFL 4FTVE 3SDAC 4KY1H 1N6QL 4PRDA 3ZO0A 1KELL 1H3GA 3QYCA 1XGRA 3ZSTA 2CKNA 5DEFA 4U3XA 1WZ1H 1XF2B 3VJ6A 4NT6B 5DF0A 1NCWH 1GPOH 2ED7A 5I1HH 1MCWW 4RAVB 3V4VH 3WMSA 2Z31A 5I76B 4R4BA 1LK3L 5MERA 4LU5L 3C08L 4XPAH 1Q0XL 3EFFB 3ZDZE 5IT2L 4XXDB 3MV7B 3K8LA 1INQA 2NY4B 5D72L 1A2YA 2IANA 1N5YH 2Z31D 3V2AR 2NXYB 3EOTL 5D9SA 3O3AB 4NO0A 4PTUB 4I2XA 4PLJD 4S1SH 4LOUC 4P46C 1CBVL 1DCLA 1UGNA 3MRKB 3O6FC 4QXTA 2WBJC 3RUGB 5F97E 4AL8H 3ARWA 1OAZL 4MJID 2HKHL 4NO0D 3G6JE 2Y06H 5I1AB 5CIPB 4K7PX 2E6JA 2X9YA 1IAII 5HHNB 3FOMA 4PRIE 1JPFB 1VACB 1BD2B 3LHPH 2V7HB 1ZVYA 4KXZI 2A9MH 4Y16D 4M5ZH 4XP5L 1OVZA 3T77B 1RZ7H 4YQXH 3MZTA 5EU3A 3VXTB 3SGKC 1IT9L 4KI5E 1RMFH 4YHZH 5C0NC 5KJRH 4NRYB 3QEQB 3HLAA 3AREA 4NRXB 4OJFH 1TETL 4D0DA 5CKGA 4BSVA 3IDJB 1F3JA 2MCPH 5FUOL 4LLUA 3BP5B 3MX0A 3UCRA 1I3RB 2IBZX 4FQXA 2XZCH 4HFWB 5CKAA 2Q86A 2AV1B 1JMXA 3ARED 3C8HA 4N0UE 1AGFB 3PWJB 1KT2B 4YBLB 1MAMH 2NW2B 4OZGE 4MAUL 1S78C 3LDBB 3NIFF 4MHHI 3CFDA 1WCBA 4Z95H 4ZUTB 1Y18B 4BZ1L 4FQXD 4LSSH 1E6OL 4JQIH 4PB0H 4DCQA 4JJHA 3HAEG 1BF2A 1S9XA 1OHQA 2FB4H 3A6CH 1AR1D 1IGYB 4WW2C 2WIMA 1FVDB 4RGOH 3CDGA 4NJ9L 1F6FB 4PJ5A 1P7QA 4KV5F 5IFJB 3VW3L 3ULSA 1ZT7B 2XWTB 3QAZC 1DBAH 4XCFL 3DO3A 1E4XI 3B2UD 3MRGB 1VEOA 2ARJB 5GRUH 4U7KA 1GC1H 2VAAA 3GI8H 2C1OA 4MA8H 3TV3H 3OKOB 1ZAGA 1J8KA 3SGJA 1E4XL 4QY8A 1HYSC 1IGJA 4TRPL 1IM3B 3Q5OA 4J3XA 1BAFH 4JCMA 4HIXH 5SWQB 3L3OB 1N6VA 5EG6C 4KMTH 2B1AL 2VWEC 4U1KB 2OM5A 1MEXH 3WHE0 3CC5B 4JPIB 2F5BH 4P4KC 1WWBX 1KNOA 5INCA 2XWJA 3LEVH 4LSRL 5L2JB 5GRJL 2RB8A 1AIFB 3UJIL 1BEYL 4MCYB 3QCTL 5BZDB 2LAGB 1JNHB 5HVHB 4I0PD 1OLLA 3U0TB 2Q7YA 5JORA 5GSVA 4F15B 3HS0B 4YXKH 4Y7MA 3U4BH 3CIQA 4KJQD 4QRTA 5B39G 3NH7L 5C0RL 2GJ6A 2QHRH 2JB5H 3A6BH 3UJTL 5INDB 2VDKL 4LCWE 2NY7H 1UVQA 4RCAA 1IGCL 1WBZB 3ABZA 2EXWC 4U1JB 3RIAF 5SX4H 1S7SA 4QTHA 1F4XH 1QRND 5GS1A 5IESH 3DNKA 3K2UH 1LO2H 1MCIA 5HHPA 2W91A 5GIRA 5I74B 4BELD 4Y4KB 3E8UH 4YBHA 1IEBA 1VKXB 3FFDA 4J3SA 3LMJL 3EO9H 1RJYB 2YPLB 4YFDB 3CH1B 5DRXA 1YPZF 2KKQA 4NN6C 5C0AA 4MXQC 5B38A 5DMIL 5GS0C 2BVOA 1A6PA 2EC9U 1EZVY 3NPZB 4GAYB 5DDHA 2RGSA 4YZFF 3L9RA 4MS8D 3B8YA 4ONFH 2AGJH 1U58B 4HWUA 2MMXA 3QCVL 5BJTA 2PXYA 2JJUA 3W39A 3S5LB 3OAYH 1RZGA 1RZIB 1PBYA 4RGMB 4K3EL 2YKLL 2NPLX 3CDFA 3FZUD 1S3KH 2BOCA 5D2LB 2ZPKL 5KANI 1R3LB 4UTBH 5FM5O 5I8CA 1A8JH 2PXYD 3UJJH 3WV0A 5H35A 2GJZA 5KS9A 3WEXA 5IBUB 3ZKXB 3OPZL 4UUJB 4CVUA 4R8WH 3LRSA 3MV7E 2CK0H 3ZHLA 2IG2H 1J0HA 4POZC 4D8PB 3QHZL 1FAKT 2VXSL 1MPAL 3X11B 4PJIF 4JFZL 4DZ8A 1Z3GL 3G9AB 4X99A 3ALWA 5J11C 2PCPB 2BSTA 1IGMH 4W6YB 5CP7A 3RUGE 1UYWH 2VR5A 5JHDA 5TQ2L 4UT7L 4NWUL 3HG1B 1LVEA 2HRPL 1ZLWH 1UG9A 2CSPA 4LL9A 4G6AC 1IAMA 1BFSA 5J9PA 1BM3H 1KXQE 4XXCA 2HT2C 1BD2E 5JHDD 1ZANH 1BBJA 1EBPA 3QG6B 4HUXB 4LLWA 3GBMH 3BOVA 4I3GA 1XR9B 3W0WD 1YY9C 2HFFB 1MRDL 3TBYB 3X14B 1SJEA 4NUJB 4PJ9C 1FDLH 3MO1B 2ICEA 3UC0L 1F4WH 1JJUA 2BY2A 3W11D 4WCYH 1LO4L 3EDKA 1VB9A 4YGAB 4XT1C 4LSPH 2XT1B 5A2FA 1KGCD 1X5HA 3RRQA 1IARB 2GT9B 2PW2B 2IMMA 3NCYP 1N0LA 1Q0YL 5FO8A 1J8HB 2A83A 2P5EB 3KR3H 2EIDA 3EYQC 4NKDB 3TEUA 4H8WL 3GRWH 5EWIL 3D18A 1P4BL 3VI4F 3ZDXE 2P43B 5ECJE 4TTDC 1QO3A 2Q8AL 5ICYA 1Q8MA 3NCJL 3SDDA 5ISZA 4RFOL 3VMOA 1K9TA 2H3NA 2XTJC 4LNRB 4LKXB 5DTFA 5B3JF 2D0FA 1EJOL 5L2KB 4L3CB 3HE7C 1YZZA 5DD1L 1A4JB 4XB7A 3SDDD 2CJUH 2EDRA 4FZ8L 5DJ6B 2VUYA 5C0JB 3FFCD 1T03L 2BHZA 3SBWC 4JFEB 5F1IB 4OZHA 1CL7H 2HAZA 3KPQA 5E00A 1CD0A 1NCBL 2A2QT 3HI5H 1NCDH 3QEGL 1XF4A 4PJCF 5J6GA 3BSZL 5BV7B 4LQ1A 3X12A 4DTGL 2B7DT 1QPXA 5E08L 3V5DA 3V5KA 3NA9H 1QBLH 3HZVB 5L6YH 5DD5L 4DGIH 4FQCH 1OW0C 3JUYA 5B8CA 2X4NA 2J8UA 4XPTL 1MCPH 1V7MH 1IC7H 4Y8AA 4POYA 3C5ZC 5LBSL 1BVZA 4EKXA 3G6AB 1BBDH 5GJSH 5F1NB 4IJ3C 4TNWK 3QNYA 3ULVC 4MCZA 1OWWA 3DVNB 3HRZB 4DEPB 1RZFH 4Q2ZB 3FTGA 4OLZL 4MA7H 5F89B 2YPLE 4LCCA 1UB5A 3SDCA 4FABH 4U1GC 3UTZA 1JRHL 1YNKH 2ERJC 3SQOH 4R7DB 3QPQD 1XFPA 1D5XA 2I27N 1P6FA 2F54B 4EBQH 4TVPD 4PGEB 1CT8B 4NO3B 4M6NH 3EJYD 4NC1E 4QHLB 3MRPB 3MNWB 3SDCD 5D7JA 1OSPL 4WHTA 2XN9A 3MJ8B 5D93B 1F6LL 4PGZA 1N64H 1OP5K 1OT1A 5C0CD 3GSOB 4B5EA 4O9HL 4P2OC 2CKBH 1EK3A 5LXGH 1ZLUH 3VXPB 5CEYB 4RGNB 3UBXB 1YN7A 2XN9D 3DX8B 3ARGA 3ZT6A 3A6OA 3RIFF 1A6ZB 4F80A 3RWFB 3O8XA 3BKYL 1BOGA 4FQJH 1AHWC 4LVNC 3DURB 1S7UB 4XX1E 1TZGH 2YK1L 1YJDL 4MD5B 5KBNC 4LCYA 1GGCL 4UQ2B 1HHHB 1SJVA 5IK3B 3O8XD 4PREB 2QSCL 2EIZB 1JZ5A 2H6PB 5IP4A 1ZS8A 5FB8A 1TQBB 2Q3AA 1B90A 4JFHD 3KS0H 1D5IH 3QUXD 1X5FA 4JO2L 3DI2B 3MV8B 4N8VB 3OKLA 4IHOA 4RMRA 2IALA 2VSCA 4DGVL 1KFAL 4HKZA 1YPZB 3HG1E 1UM6L 4GBXD 3C2SA 5I1KL 3K8MA 3QWOA 4B41A 1JHKH 4G8GA 5I1CH 4LLYB 1ES0A 4H20L 4HUUA 4NP4H 4WGWB 4TOYH 1CFNA 1EEZA 3T0WA 2J6EH 1AC6A 4KDVA 5LGKA 2ITCA 1NLBL 3MODL 4NKQB 1N5AB 4YGVB 3QZWB 2XY2A 3OGCB 4Z0BH 3UAJD 2X4RA 3M17B 4QCIA 1YEKL 3D2UD 1TTGA 4QYOB 2X41A 4WIQA 2DI8A 3JWNC 3BRFA 1JYNA 4HJ0D 3RZCB 4FFWD 1ORQB 3V95A 4ENEC 5CJQH 1RZJL 1XGYH 1YDPA 3VWJC 4RWHA 1J8HE 1HE7A 4D9QD 3VGEA 2IFFL 2P48B 2P5EE 2PYEB 4ZSOB 4KJWD 1NAMA 4RMTA 2P8PA 1CGSL 1JN6A 3OHXB 4P99A 5FK9B 4EI5A 1CLZL 2NR6C 2DL9A 4MDJA 3INUH 3X3GH 5AWNH 4PJIB 2DLHA 1K8DB 1FO0A 1A7NH 1R0AH 1NAML 1I1AB 1ZLSL 3TJEL 3NPSB 3RKDD 5L2KE 2JJWA 4EI5D 4HZLA 3ZL4H 5CMAB 3U0PB 5I1GH 2FO4A 3V52L 5EZJA 1CDGA 2R15A 3M8OH 1FO0L 4MNQA 3FO9B 2OL3H 4JFEE 3R8BB 1U8IA 3PWPA 4QWWD 3RGHA 4X6EB 1OGTA 3SDXF 4YHIA 4HD9A 5E1AB 2OI9B 4KK5C 4BZ2L 4AMKH 1U41A 5FKPA 4LBEB 3QNZB 3TT1H 3CXHJ 1NDMA 3ARQA 5D6DA 2DLEA 1C12B 1JI1A 3HFMH 2F58H 1MFAL 1CGWA 4ZFZB 4QRSB 4R4FL 5I16B 35C8H 3PQYB 2FEEI 4TPRL 2VLJA 1PSKH 1T21B 1F90H 2VDRL 2X7LA 4PJ8D 1D5BB 1KEGH 1AQKL 4K55A 3VDAA 1TQCB 5F9WC 3NTCH 1MAJA 2FEEL 2NTSP 5DHVB 1NFDF 3CZJA 4R96A 2VQUA 9CGTA 4GW5A 1FSKC 1JWUA 2VLJD 2FDBP 5F7KC 2YZ1A 2JIXA 1EUUA 3I50H 3LV3B 2PW1A 2NY5L 2DI9A 3AM8C 1U36A 2D31A 3DARA 3AFLA 4HWZB 2F54E 4GT7A 2Q7NA 4OM0L 4NQDA 4ELKB 4PJCB 3BH9A 1N3NA 3WFHB 4R7NA 4DN4L 5I1DB 3LKPB 3RWGA 3NZ8A 5CD5D 5MHSD 3WXWH 1FBIL 2NX5B 1Z2KA 4WWKA 3I3EA 4RISL 3SDYH 3T1WA 3CPLA 4NQDD 4RGNE 3OV6A 3MA7A 2NY6C 4QGTA 5EIQA 4S2SB 3CFEB 4GXUM 1HHGB 1EV2E 3MRMA 5JXEC 4WWKD 4ODXA 5IHLB 1MHHA 5EORH 5IB1B 4ETQB 1F2QA 1V3JA 4P5TA 2MOVA 5GHWL 3QHFH 3SDAA 3VXSE 4F7CA 1DQLH 3T65A 5DQ9B 1R3IL 1PG7W 5GGUB 5L0QB 2ADJA 5AYUH 4JRYA 3MRFB 1CVSC 4I18B 3RVVC 4KY1L 4XPBL 1BZ9B 4PLOB 4M1DH 5C07B 1MFCH 2V9QA 1DEDA 3IDYC 5EC2A 5GZOC 5IMOB 4PV9A 2RCSL 3SDAD 1FH5H 4MAYC 5DEGA 3I85A 3PHOB 3N1PC 5DYOB 4LCIH 1S9WB 3MV8E 4JRYD 4QHKI 2W9DH 3GI9H 1YPZE 4TUJA 1NBVH 2IQ9H 2VZUA 4EJ1C 4PJGF 2PNDA 4F2MA 4Y4FC 3STLB 2IAMB 3C6LB 1NC4B 1NMBH 3B5HA 4PRBB 2JKXA 5D7IA 2ITDA 3QQ9C 3ALPA 3D3VB 1PD6A 2MHAB 4PFEA 2JELH 1F3DJ 4YZFE 4HUVA 3VRIB 3C9NB 4P46A 3KXFA 1Q9WB 4S1SL 3GK8H 4JY5L 3ARPA 1MHCA 3O6FA 4M8QB 1FC1A 1SYVB 4ZXBB 2A73A 1I8LC 3PGCB 2WSKA 5KW9H 4WI8A 4E5XA 3SY0A 3EYSH 1IL1B 5E6IA 4AL8L 3DVGA 4U3CA 4GH7B 2DWEA 5EPMB 1MI5A 3KXFD 1FN4B 2FJHA 2XPGA 3NCBB 5I2IB 5J1SC 2Y06L 4MNHA 1UXSA 2QKIA 1UB6A 4RNRA 3F7QA 3FQXB 3DMMB 3TN0D 3IXTA 5F9JB 3EOBB 5BVJB 1UQSB 5E6ID 3LHPL 2PYEE 4ZSOE 4QRQA 2OTWB 4M5ZL 3SGKA 2C4FU 5IQ9A 3TCLB 1WTGT 1U93A 3LPWA 4JM2F 1RZ7L 3RX8A 4YQXL 4OTXL 2XRAL 4WJ5A 4UDTA 1MFBL 1MOEA 4OJFL 4IOFC 3FB6A 4XC1H 1LWRA 1C5BL 5ALCH 1AGEB 1I9JH 4HIIA 4JZJC 2O26U 1C1EL 2NLJB 2BNQA 3GO1L 4DKFL 5EN2A 4WFED 1NC2A 3BAEH 3L3GA 1FL3B 2RHEA 4KVCH 4BSWA 1XF5B 3MLTB 4OCNC 4J2XA 3QIUC 5ADOL 1AD9B 1Y6MR 3GJFB 4JFYA 5F7EH 4WV1B 2BHYA 2VXVL 1HIMH 2BNQD 2XYCA 4JQIL 1T5XA 4QOKD 1NC2D 5HVWA 4GRLC 2FB4L 3SE9H 4PG9B 5FFLA 1T1YB 4JB9H 5FHBL 2V5RA 1KULA 1N7MH 1G6RB 1YQ2A 5C9JA 2Z8RA 2AI0H 4YAQA 2ID5A 3B5GA 1U8PB 5FDYA 2P24B 3F6IA 1GC1L 3GI8L 3UYRH 4B7LA 4JN2A 4LHUB 1AP2B 4OCSL 5ANMA 5C8JA 4IRZH 2GTWA 3WD5H 5C3TA 3Q3GA 4F8TA 3PQYE 5T1DL 4ODSL 4L8SC 4YWGH 4FXGA 1FGNL 4YDVA 2WZPD 3VI4E 2D7PA 1RJLB 4P4KA 3MZGB 2A0LC 5E6ZA 1J10A 3O45B 5IMKA 5IHZB 1MIEL 3QXDB 4N90D 2PTTB 3LEYH 1NGXA 4FS0A 3GFUA 2AV7B 5EOQH 2N56A 5B3JE 2O61B 3RX7A 1H3TA 2M1KA 3SOBL 2DQJH 5E70A 2EDYA 4NGHL 1NJ9B 2OMNA 1FFQA 5C08E 4L29B 5JMOC 4DUVA 1AXTL 1JGVH 5LJYH 1Q72L 4NHCH 1RK0A 2F15A 2XG4A 1Z9SA 2JB5L 1CGUA 3A6BL 3S7GA 3L95A 4GKSB 1JFQH 1FNSH 3OJVC 2NY7L 2NZ9C 3SDXB 3O3EA 4JPKH 1JK8A 4HGWA 4HIJA 1GGYA 5EU4B 5T1LB 4RMUA 4PGBB 5DJYA 4PJCE 4RBPH 2J7LA 5JDSA 1OAUH 3RQ3A 4ZUSB 3S88H 2JJSC 3GMQA 32C2B 1KCRH 2VZSA 3EO9L 4HK3N 1X7QA 4U6YA 1WIPA 5EOTB 3REVA 3SO3B 3DXAA 1MCHA 1LD9B 5ESAB 3N1MC 3REWB 4XHJD 4LRNH 5IMLA 3CMOH 1NBYA 4LAQH 3MOAH 3CVHB 3TA3B 5JR1H 4IRSB 3DXAD 1EFXA 3GMRA 2ADFH 4ONFL 5GS0D 1NFDB 3CLEH 3O9WB 4ZQKA 5GS0L 2R23A 1KPRB 1MNUH 4WTZA 5C07E 1UA6H 2VZOA 5HDQL 3I6LE 3QO1B 5HI5C 3BEWB 2AXFA 3KYOA 5FYKE 1EFXD 5HVGB 1ZT4A 3WN5B 3HNSH 1DQDH 1J0IA 5JW5A 5T3XE 3S97C 4JHAL 2VDLH 1ACYL 43C9B 1FVCA 4IDJH 4HGMA 2VQTA 1P9MC 2PO6C 2DS4A 4DFIA 2VDOH 1YN6A 4XHQA 3D3VE 5C0EB 2C1PB 5FUZL 2IG2L 4S11A 1E28A 3KYNA 5FECA 2VABB 5F7FA 5DHVH 3PL6D 3MMEB 3MXVH 3LQZB 2BSRA 3AS3A 1IC1A 3L5WB 4NQXA 2ENSA 1RULH 4NN5B 4PJHA 3E0GA 1IEHA 1GHFL 1X5XA 3ARDA 4MD4B 2MFNA 2HMIC 4NWTL 1G7LA 4M61A 3HI6H 1EZVX 3HN3A 4OKVA 2KBGA 1BQSA 1T20A 4E0RA 3SE8H 1UH4A 1IM9A 4Z8FH 3ARDD 1CXHA 4AG4H 5A2KH 4PJ9A 2BMKB 3GMMA 2IEPA 3G5ZA 5CCKH 3TZVD 2RAMA 2I9LA 1FDLL 1MFNA 5F7WC 3DUHA 4HHAA 4LLDA 3ILPB 4K2UH 3QUMB 1AY1L 1RIUL 3GSUB 1IM9D 3QXAB 5DJDA 4R26H 1M6OB 1FFNB 1R5WB 3WUWB 3FO0L 2OS7A 3PWUB 4O2FA 1UWXH 1DN0B 5FA4B 3PE9A 3F12A 4YXHH 1EEQA 1CGTA 2XZAH 4PRNA 5DJ8B 4GKZB 1QP1A 3KR3L 4IOIA 3AXLA 2BC4A 5GGQL 4M6OH 4JRXB 1OM3L 2VLME 1ONQB 2YHGA 4HF5H 1I7ZB 1MIMH 4X80H 4F57H 4HCRA 4HDIA 2AABL 3VXRA 3SCMB 1UJ3C 4HPOH 3RX5A 3TNMB 1T0MB 3ALXA 4RA3A 3N1GC 3O0RL 2CJUL 3UTQA 2VISA 2CDFA 5DJ2A 4FQIH 3A0OA 5C6TH 4HCRL 3BFOA 3LKOB 1VFOA 5GRWA 1OGAB 3L5IA 3VXUE 1RIHH 5H37G 3TFKD 1X5KA 5FKAA 2HG5B 2ZUQC 1SY6H 5ENWB 2EE3A 2HH0L 2G9HB 4BH7B 5IROC 3EJJX 3ORJA 4JM2B 2AEQH 3CGTA 1FRGH 4Y5VC 3MCKA 5IVOA 4GW4A 3CSPA 3ZDYF 4JJ5B 2FGWH 4CMHC 5F6IB 2FLBT 5BRZA 2P45B 4YPGA 4ZPTB 1T0PB 3ZKMD 5TDOB 1OW0A 5L6YL 4FG6D 4NBYB 2OJEB 4KROB 5C0DB 1NMAL 3T0EA 1YEIH 2F19H 4GAGH 5MI0C 1V8HA 4NZUL 2GTZB 2VLKD 3FB7A 3OJMB 4AM0B 1ZLWK 2BVQA 4KMLB 1SYSA 4YHLH 3SJVA 1B3JA 5GJSL 1DLHB 4ODWB 3VMNA 1KJ2B 3SDXE 5E5UB 3WS6A 3DROA 3T0ED 3TCXA 3PIQB 3AGVA 3AAZB 3QEQD 5SV4A 1DQQA 2LV4A 5DXWA 2WIIB 2LVEA 4ODHH 1X5LA 3ULVL 4AEHH 4MA7L 4YDIH 3KWWA 1LO5B 3RDTC 3IFOB 5DJCA 3NACL 1MCNA 4KUCF 4FABL 3KNBB 1MCOH 3OMZA 1MVUB 4U1MA 5DQJA 1LHZA 1YNKL 1FNEA 3FQUB 5CBAA 3VA6A 4CVZA 5E4EB 4F7TB 4EBQL 5DI8B 2A74A 5F8QC 2G60L 2APVA 4HX1B 1DBBH 1D5MA 2DQGL 3BPLC 4N1CA 2Y72A 2BVPA 5M7QA 1QEWB 3RGVB 1HEZB 1NFDE 4LQFH 1EGJA 1R5VB 4PY7B 4UILL 5EZLA 1FIGL 2XZQL 1FFOB 1KIUA 4M7ZB 4P2OA 1BGXL 5ICXA 5EU5B 2H8PA 2J8HA 4H1LG 4OBRA 4JKPH 3TLRA 4G8FA 3ARZA 1AGBA 4G9FD 4OCRH 5KG9A 2X4PA 1EGJL 1YEDA 1RVFL 1AHWA 4PPTA 3D85A 4OFDA 1UXWB 2P8MA 4HMCA 4MXWL 2NW3B 1TZGL 3BDYL 2YPKA 1AXSA 2ESVB 5C0BD 4HK3J 1KCLA 3PV7A 1SEBA 4U1SA 3D85D 1EXUA 4PRHB 1PG7H 4GSDH 4PJ7F 2VXTH 3RVUD 1FG9C 1FP5A 3VRLF 1ZT1A 3WIHH 3ULUC 5L7XL 3MREA 1BQHB 2NY3B 4XWOC 2J6EA 2P7TA 3VCLA 2FJFA 2E5EA 1S9VB 2VR9A 3OXSB 4U1HB 4APQC 2IWGA 4WO4B 1GZPB 4EN3D 5ADPH 4OGYH 3U7WH 1JHKL 3MROB 4XP4L 3HZKA 1RAMA 4JFDB 4B50A 1OPGH 1QHOA 1PAMA 3S34H 2J6EL 1G7QA 2YWYA 5I73C 3AU1A 4KKBD 1CICA 5DHYA 4DFHA 4PRAB 2R0ZL 3CAFA 5ACMA 5EC1B 5IG7B 4M6AA 1GZQB 3QUZC 3TO4C 3CFJB 1PX4A 3E3QE 2ATPB 4HC1H 4XZUB 2NY1D 2V17H 2PYFB 3R06B 5I9QB 4WTXA 1CICD 3PWLB 2N4IA 2V5SA 4XBPA 3IGAA 2P1YA 3LEXB 4YHOH 3CVIH 1X9QA 1E4JA 2B1HL 1XIWB 2X44D 4Z7WA 3RWIB 1MCFA 1DBKL 5F6HI 3CVHH 3LKQB 3KG5A 3WNPA 4JRXE 4DJMA 4FMFA 3PUCA 1KB5A 4BKLA 4Z7OF 1TFHA 3D39A 4KWUA 4X98B 4HUWA 5T3ZH 2R2BB 2DQDH 2OQJA 4LIQL 4ZDHA 3T2NH 1A7NL 1WBXA 4I3RH 3KPLB 2ZSVB 2JK5A 2OL3A 4PBVC 1DUYA 5KSVB 1TLKA 1QKZL 2IF7A 3EZJB 1KB5L 5ID1B 1KYOK 3D39D 5HYQB 4YHYB 2IC2A 5I1GL 1HH9B 3TH2T 4QTIL 1OTSC 2IQAA 3SGEI 1OGAE 2OL3L 1T80A 5F72S 4N68A 4B7IA 3W9EA 5IEHB 5KSAC 2CD0A 4MNGE 2FX9H 3BD3A 3P4OA 4XTRD 2YMXH 1VFAA 4AMKL 3TBSB 2O5ZH 4G7YH 1BIIB 4U6HA 3IDIB 2JJTC 5EU6A 3VG0L 3V6BR 1KC5H 3BUYA 3GHBL 2A6IB 2Y7QA 4HV8B 3KPSD 3OKMB 2D4DA 4QO1A 5GGSB 4OIBA 4RDQF 1X5IA 5CJXC 1AJ7L 3B6SB 3HG1D 3UTSA 5HYSB 2FLRT 3GSVA 1SVZA 3GSXA 5EBLB 1NGYB 3V6FB 1AQDA 35C8L 5EU6D 1J0YA 2HKFH 1A1OA 1PSKL 1G9EA 1LDSA 2AVGA 1AGDA 4LEXL 2EH8H 3UTSD 1Z5LB 3MRJB 2ZCKH 3VFUB 4U0QB 5AZ2H 5BQ7B 2DLFL 4ZFFB 2X42A 4F8QA 3QUYB 1MFEH 4XP6H 4XNQA 2W92A 3VFOB 2GSIB 4WHCA 5DK0B 5F3BB 4OQ1A 4YIQA 4ZFOA 1OTTC 3L3JA 3I50L 1UEMA 3AM8A 2AJUL 3KPNA 3QIBC 4L3AA 3VDBA 5EH1A 1WZKA 3G6DL 1FZMB 3WIFB 2ICWB 4G80B 1HZHH 3NFPA 3P3YA 2CPCA 3VFPA 3GSNB 1BP3B 4ZFOL 3TIEB 4HBCH 1XZ0A 43CAB 3HMWL 4YHNA 3UTTA 1IQDA 1MQ8A 5D2NC 3MJ7B 5HHXH 5HGGS 1DP0A 3LD8B 4LKCB 4HKXB 1WTLA 2NXZB 1IGIH 3NZHH 4K3DL 2R4SL 1U9KA 4AEIL 2B5IC 3IFPA 1BFTA 1DBJH 1TCMA 3BH8A 3ME0A 1D7FA 3HNTH 2CRIA 4JG0H 3BUTA 2A9NL 1IJ9A 4M1CD 3HC0B 3KPRA 3CSGA 4QHNA 5EBMA 4HJGB 4FN0A 2ESVE 2XXMB 1DQLL 1RIVL 3VD9A 5J1AA 4LVHB 1K2DA 4Y5XB 4HAGA 3OL2A 3SKMB 4PRHE 4R0LB 1MFCL 4MAYA 3KPRD 3OBAA 3JWOH 2GK0B 3BP4B 4JFOA 4F33B 4NQTA 3Q6FA 3HE6C 1AD0B 3QDMA 5JPNA 1FH5L 4HXBH 3HI1A 5LVEA 4PGDA 3MUJA 3TWCL 2G75B 2H26A 2YN5A 4HK0B 1HK6A 2Z35A 5GZOD 2VL5A 2W9DL 5CILH 4G6ML 1NBVL 2ED8A 5DO2C 4CADA 2VDQH 1EVTC 4PS4H 2WQRA 1KJMB 5EO1B 1RHHA 1LDPL 4IRJC 1NMBL 1P6AB 1QSEB 1SBBA 4JFDE 5JOPD 1JGLH 4X7SH 4LDOB 3OAZH 1KJ2H 4L4TA 4P2RA 5JUEH 1YYLL 5SWZA 2GYSA 2E7HA 5JIIA 3TVMB 3JZ7A 4KTDL 2VITB 3O11A 5E2VL 3VFRA 4L9LB 3N50A 1ZHKB 5TQ0H 3IXAB 4L4TD 5SWZD 2NXYC 2RFXB 1CFQB 3B3IA 1T7YA 5D1QA 2AAVA 3OAUL 4R3SA 3LVEA 3LPFA 1A3QA 4KKNA 2F53B 4OCWH 3FT3A 3DTXA 2NY0D 3MRRA 5AD0B 3VFSB<