3IJYB

Structure of s67-27 in complex with kdo(2.8)kdo
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
226
structure length
221
Chain Sequence
EVMLVESGGGLVQPGNSLRLSCATSGFTFTDYYMSWVRQPPGKALEWLGFIRNKAKGYTTEYSASVKGRFTISRDNSQSILYLQMNTLRAEDSATYYCARDISPSYGVYYEGFAYWGQGTLVTVSAATTTAPSVYPLVPGGSSVTLGCLVKGYFPEPVTVKWNYGALSSGVRTVSSVLQSGFYSLSSLVTVPSSTWPSQTVICNVAHPASKTELIKRIEPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Immunoglobulin light chain (IGG3)
total genus 37
structure length 221
sequence length 226
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijyB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ijyB01
1P5VA 4O58H 4DKFH 5E6IA 3N1FC 4J1UB 3HPLB 5EZLB 3FQNA 1BD2B 1LEIB 5A16A 2J7LA 4N9OB 5CINH 1NCAL 3JWDL 3QDJD 1JHKL 3GO1L 3MYJA 1GPOH 2ITDB 1IEHA 2B1AL 3VMNA 2GYSA 1OAYH 1RZGA 4ISVA 1B4JH 3VFVB 4Z7WF 2NY2D 2ZUSA 2ZP0T 3KPNA 3FN3A 2BDNL 2KL6A 3PWJA 1U8NB 3MZTA 2IQAB 3L3HB 4AH2A 3S4SA 4OCLC 4G6ML 3SKOA 5DK2A 3MGOB 4WI2A 2OJEB 4OIBA 1S9VB 2L4OA 4MA1B 1U91B 4JRXD 4GBXC 3IDXL 1RFDL 1UH3A 3OXSB 1W8OA 5GGRA 5EOQH 1P4LB 1WK0A 4XPGH 4RNRA 1IAMA 1LEIA 2F9BT 1I7UB 3RNQB 1BIHA 1PJ9A 5D5ME 3EJJX 4YXHL 3SDDA 1DQML 3B9VA 4S1DC 2F53E 1ZWIA 3F6LA 5IW6B 4QRQB 2DRUA 1ZVYA 1CGWA 4HGMA 3U4BL 4NNXB 1KLFA 5F9DC 1WCQA 3IXAA 2X10A 1K6QL 5HXMA 4N8VG 4XX1G 3FONA 4A6YL 4FP8H 5T1MA 2EKJA 2M26A 2EDNA 1DBML 1QHPA 3QUMB 3V79C 3HKFA 1OWWA 1I9IL 1A0QL 1M71B 4P2CG 5GIRB 4ORGB 3L3HA 3OMZA 4P3DA 3G08A 4LEOA 3WBDA 2XT1B 5HY9A 3I85A 3EHBC 3ALXA 5C8JA 1HQRA 4UIKH 5HHQB 5D1XD 3F12B 1FRGH 1AXSA 5J9PB 4C54A 4DVRH 5MEOB 2J4WH 4OTXH 1BVKB 2YWZA 4XCFL 2DWDB 3MV9B 3S34L 4AG4L 3HUJE 4I5BA 4JM2C 3QCVL 1D6EB 1CDJA 4ZD3H 3QZWG 3EFDH 1RUKL 3C8DA 5LQBH 2O5YH 1MCBA 4WFFD 5FK9A 3IRZA 4JN1L 1FZJB 3S37H 4RGMB 3LV3B 2BSSA 4YR6B 4MQTB 1PKQA 4M6NH 3QFJD 4OLXH 4XMKH 4P2RD 4C56A 2P8PA 5D1ZC 4BSVB 43CAA 3SDXB 4HIJB 1ORSB 1P9MA 4JO4L 3MRCB 2DJSA 1K85A 4UV7L 2DM2A 4WENB 3FB7B 3MBXL 1J0YA 1PZUB 5ALCL 4PR5B 4FQ2L 2C3XA 5GS1C 2VC2L 4PJIB 4V1DB 1BQHG 4YHYC 3UPCA 2HH0H 3QRGL 1RURH 1BOGA 5EOCJ 3L6FB 5L2KB 2A6JA 1MPAH 3CSPA 1R3KA 2FD6H 1F8TH 4ORZC 4L4VA 2X89A 3WFHB 5FA4A 1RMFH 1UZ8B 4OLYH 2BFVL 4GOSA 3UC0L 1LHZA 5L9DH 4LHJB 5AAWA 1S7VA 2PXYD 1D5MA 1MCWM 4OBRA 3B3IB 5EIIB 3IDNA 1CR9L 2QHRH 3TA3A 1I8MA 3JTTB 1L9MA 2W1NA 5C09B 1KJ2A 4FMKA 1U92A 4Y16B 4PJIA 5IB2B 3O2DL 2ED9A 4MMXC 5B38G 4X4YA 2C1PA 2IQ9H 4LLDA 3T0WA 5D2LE 1N6UA 3KPRE 4LAJH 4X80L 1RV6X 3REVA 5IW3A 3BWAB 1FH5L 3V6BR 3ARDB 2A74A 3GB7B 4XCEA 3O3UN 2G75B 3TZVC 1V3MA 1JJUA 4BSWB 3MOBL 1VADB 3DMMA 4Q74A 1JI2A 5MENA 3ULVH 2DQIL 4UQ2B 1WEJL 2C1OB 3P30H 5SX5H 2NY0C 1J05A 4CVUA 2AK4D 2Z4QB 4YHNA 3TA3B 1HEZA 4U6XB 1KPRB 1RUPL 1H3PH 2XTJD 1NCBH 4G5ZL 3OSKA 1EGJH 3L3KA 4HH8A 1ZA3A 2P5ED 3DSFH 3T4AA 3MGTB 4M7JH 4ZXBA 4LSDA 2WBJC 4MA3A 3DSNA 4HIEB 4OKVB 4YUEL 5FM5O 1CXIA 5J11B 5ADOL 1CFSB 3MJ9H 4UZGA 1UJTA 3OQ3B 4WO4A 1BIIA 3MSPA 4QHUA 5D6CA 4P4RA 4JG0H 4CW1B 3IB4A 4PRPB 3CNKA 1QFWH 5F96L 3MRNA 2EYRA 4MYWB 3NIFE 1V3JA 2VLJA 3U0TA 1DUZA 4JPKH 2YD5A 4Z78A 1M7DA 3ARBB 4KJPC 4KQ4L 2OTUA 2W07A 4IS6B 5KG9B 2AV7B 4WFFE 4WFHD 1AXIB 5E94B 4XAKD 2GK0B 1A1NB 1QNZL 3K1DA 3BYYA 4NWUL 2CJUH 2HFGL 1FV1A 3NIDF 5GGQL 1AKJD 2UYLA 5C09E 1HKLL 3CFKB 4S0TD 4HT1L 5GRVK 4JY5H 1P7QB 2WIIB 2FR4B 4N5EC 2OXGA 3MLVH 2H3NB 4OZGA 4XPAH 2FHBA 2ESVE 4LFHD 4U3HA 1X9QA 1JYVA 1HHKA 4R4BB 5KSAC 2PO6A 1DANT 3HAEB 4PD4J 1OARH 1F42A 2A9MH 4NDMB 2DQDH 2HKFL 4WO4D 4HMEA 1FYTD 4RRPG 5F8QC 5AYQA 2WUCH 4RGMC 5DYOB 1EEUA 5D2LA 1RI8A 2XKSA 2UZIH 3S36X 2X42A 5I15L 3EO0B 4NKOA 4YHKL 1MCWW 1G9MH 3NAAL 4R7DA 3QEHB 3HTLX 3TV3H 2R9HD 4XP5L 5C0DA 1SJXA 2AERT 3UO1L 4F8QA 1A1NA 2FX7H 4L1HA 5JPMA 4XC3L 2MJWA 3UTSB 3MGAA 5ACLA 4AEFA 3RVVD 3TA3D 1IGCH 3B9KA 4NRXA 3RWHB 3L7EB 3LEYH 1MCEA 2K7PA 1CIUA 3PDOA 4GUPB 2VE6B 3DWTA 1V7MH 1R0AL 1I9RH 3KLHC 4L9DA 4WVRA 2WBJD 3DUHA 4BZ2L 4HUUA 1NGXA 5CZXD 4HLJA 1DQDL 3RHWK 1Z0NA 5F97E 5IP4A 4JFOB 2Y7QB 2XZQH 5JOFB 3WIHA 4DFIA 4KMTL 4TSAL 4QHKJ 1V3LA 2PKDA 4D9LL 3RA7H 1KTLA 4GAJH 5GGTA 4LCWA 3QUMA 1ZVSB 4G9FA 5ID0A 5IWLA 3SJVE 3GSWA 4MXWH 3W11D 5DRWA 4DGYH 4TSBH 4OD1H 2BNRD 1IZJA 1E4WL 5DJCB 3VXSB 4HCRL 2VDQH 5F7YC 1QRNA 1AO7E 1L7IL 2IAMA 2L7JA 4FNLH 4J4PC 3QZWB 3GFUA 4NSKA 1V7NL 4PJEB 5AWNL 3VFTA 5EPMA 4OZGE 4HV8B 5F1IA 1P4LA 4HUVB 4R8WH 2YPLE 1FZJA 2WINB 4Y16A 1F90L 3KDMB 3QWQB 3SPVA 3VFUB 5KTEL 5GS1B 2P5WA 3RTQA 4AL8H 3MLRH 1IAII 4YEFA 2RFXB 2B2XL 3EYQC 3PGFH 5EN2A 1XGRA 2C3VB 3QDJB 4JQXA 3VA2C 5FYKL 1XT5A 2E9JA 2KPNA 4N9GB 5J12C 3HA0A 1B6DA 1T0NA 3V4PL 4HIHB 3MRMA 3AAZA 3L3OB 4NQED 1OCWL 3C5SB 4IBLT 4OQTH 4KH2A 4RIRA 2DMKA 3RGVC 1P7KB 1FNFA 1T66D 4U6HA 1NSNH 4JO3L 4HUMB 5FYJH 4EOWH 2R4SL 2XACC 5BO1H 1BD2E 4HUVA 3TO4B 2FJFB 2W0LA 3EOBB 5E2VL 1A47A 5E8DH 4P5TA 2J8UA 2C3GA 2W60A 4NOFA 1FNLA 5E5MB 1W8NA 4JPVH 3ZT7A 4YXLL 3CFEB 3D0VA 2LAGB 3PL6C 2H9GA 4XWGL 1PW3A 1JVKA 1WAAF 1WWBX 5DXWA 4W6WB 3PDGA 5DJAA 1RZ7H 2NY0D 2ATKA 4QRSA 4FQCH 2FCBA 5A3IC 5DQJA 1JPST 4QOKA 3KYNA 3VFWA 1MCSA 2EICA 3DX9A 4K71B 3KYOB 5GS0C 3AREA 1UKSA 3VXRA 5IEHB 4DAGL 3V4UH 5I1IH 5ICYB 4RGNB 4AH2B 1IGIH 4OGXL 2ZUQC 3JSSA 4XBPB 5KSVB 1LE9B 3VDBA 3PWJB 3MGOA 4QHLB 4G43B 2QADD 4AT6A 4PJAB 1U8PA 3P77A 2IQAA 1Z5LA 1N2RB 1I8LA 1W72L 4FQQB 4JZOB 4DKAA 3O6FD 2YC1B 1HYRC 2I26N 3D87B 2YA0A 2Y9RT 3F7QA 2HWZL 1I85A 2F53B 4N8VB 3KPSD 7CGTA 5JR1L 1PZ5B 4OQTA 1XF1A 3TBVB 3VRIB 5C0BE 4G6FD 2H26B 2VLME 4N0YH 5IW6A 5DYOA 5MP6H 3RWDB 1WF5A 4OAWB 1R3IH 3KYKH 4F3FA 2ADJA 3G6DL 9CGTA 4YDIL 3IFLH 3MNWB 5IVXF 5GRUL 1CDHA 5B8CB 1D6VH 4PS4H 4IHOB 4N0FA 4CW1A 3HFMH 5D1QC 1AFVL 1IBGL 3D85B 2JJSC 5B8CC 1J11A 3GIZL 4PJXE 5ESVA 5J6GB 1LDPL 1YEEH 2LTQC 3AVEA 5T1KA 4L4VE 5EZOL 5BMFH 5IB4A 4UUJB 5IHBA 4P46B 3NACL 3GHEL 3T4YA 4F9LC 4XP4H 2NTFA 4PFEA 5E94A 5F9OH 4MVBC 1DVFB 3OR7B 2QQKH 2VLRB 4MJ6A 4DK3A 1KPUB 4WTWA 4H25A 1QR1B 2IAND 2MCPH 2L0DA 3L3JB 4OGAD 3WDIA 3X12A 3WHXB 1YY8A 1NGYA 3TO4D 4GRMB 3GI8H 4PRIE 5JPNB 4NIKB 1A9BA 3HC0A 5E0QA 3WIFB 1TVDA 1SMOA 3ARED 4AEIL 3BP7B 4WHTA 4XNMA 1PDKA 5DVLA 1XF2A 4WDIB 1ZGLP 1J10A 2NX5D 4I0PB 3BDYL 1KFAH 1QTYT 1Q9OA 1T1YA 1D5ZA 1DBAL 5J12B 2R0LL 3GKWL 1FZOA 4I0PC 3KNBA 5FF6A 2AKRB 4MNHA 4X98A 1T04A 1F58H 5IQ7H 32C2A 4ZSOE 1F3JB 3MOQA 4V1DE 1QR1A 2YZ8A 3TO2A 3P9MA 4I2XA 3HLAA 3EZJB 3EZ8A 3L1OH 4I0CC 4WI5A 1Q0XL 4BFIB 2DQJH 2IFFL 4FZEH 5HGAB 3BGFB 3BPNC 1VB9A 1S7RB 1NFDA 3K46A 3SDAC 5EU7C 4P3CL 2I9TA 4MJ4A 1WFTA 5CHNB 4JFPA 1E6OH 3JVGA 1RHHB 3G04B 5FYLD 4X7SH 1K2DB 4JFHD 1DQMH 5C7XL 3ARDA 4FQIH 2LTQB 1IQDA 3GSNB 4Z7VA 1ZK9A 5IOPB 2IANA 1P6FA 4ZO9A 4OJFH 3GMPB 3FO2A 4N1EA 3GBML 2BOBA 3LV3A 5DFWH 1AGEB 2E6QA 2Y5TB 3MUY1 3O2VH 4XWOC 3IYLW 2BNQA 3HC4H 5I1HL 1IC5L 3MROA 5IROC 4K71C 1RZ8B 2D7NA 3VCLB 1YQVL 1U3JA 2ZJSL 4HWEH 2FO1A 1SJVA 3TEUA 1X5YA 3MJ8B 4HHAB 3TFKC 4S1RH 4EI5B 3BKJL 3STZA 1XGRB 2C3VA 3SO3B 5EB9A 2GK2A 1NLDH 4KAQH 2VXSH 1M05A 1AJ7H 5DHYA 5FGBC 3EFDL 1KT2B 2IGFL 1FVCA 4JDVB 4RFOL 4XP9H 4F58L 4LRIA 2NX5B 4I0PD 2YK1L 3N1PC 1SBBA 5DEFA 4XXCA 2Y72A 5FUZL 4WW2F 4OLXL 1ZEAH 1G6RA 3SGKC 3E2HB 2YD7A 5F1KC 3LIZH 1AGCB 1QO3B 5JNYB 5I9QC 5F3HB 1NAKH 2JK5A 3OF6D 3ARGD 1UEYA 4MJ5A 5CEZH 3VCLA 4CN6A 2KQMA 3L5WB 3HR5A 4G8GD 3BXNB 3QRGH 3CX5J 3GSQA 1A6WH 2NY3C 5C0FB 4KJYB 1A3LL 3I02A 3PABA 1NL0H 1V8HA 3K4ZA 1UENA 1G6VK 1MHEB 3O8XB 1P7QD 5L8LB 1ACYH 1A6TA 5L6YH 2NZIA 4RAUB 1RMFL 5DO2C 1F4WL 4UOW1 4S1DD 5HHXH 5DHVB 3DUUB 4DZBA 4GXVL 1FL3B 5D7JC 1QLRB 1LO4L 4HDIB 3OJDB 5FV2A 2QHLA 3QDJA 3IDMB 1RK0B 1ZGLA 1QBAA 1CYGA 4UT7L 1OT1A 4H0IA 4WGWB 5DDHB 4N0UB 4OGYL 5BV7B 1YNLH 4L8BB 5D8JL 4G6JH 4A2LA 3REWA 1KN4L 2VL5B 1I7RA 2CK0H 2VDLL 3EYSH 3MBEA 4U1HA 3CCHB 2VAAA 4X83A 5JUEL 3N0PB 3DETD 2VXUL 3PV7A 1AH1A 1K3ZA 4NQDE 4J3SA 4PRPD 3DX7A 2EYTB 4NNPL 2P46B 4PY8I 5FKPB 3RZWA 4DCQA 4GAFB 1QQDA 3EDDA 4GMTL 2D4DA 1OF2B 1H3PL 3SGEI 4P9HC 3BP4A 8FABA 1N7ML 2AV7A 3OF6A 5HGDA 2D7TL 5HYJA 3RZCA 4XHQA 3LRGA 1T5XB 3QEQB 2XZZA 1WIOA 3O3DA 4YUEH 5CSZB 1OAUH 2OJZL 4GQ9L 5C0DB 2DIAA 3I6GA 4HLZH 1CDGA 4ZOAA 5AZEH 5HDQH 3LH2L 4P5TD 5BXFA 1NDMA 2PYEA 1JZ8A 5EZIL 4POZD 4LLVB 4WFGD 4NQXB 1B6UA 4O2EB 4CJ0A 3WXWL 3QYCA 4NQUA 2W0FB 4NKIH 5EUKB 3O41B 4MQSB 2UY7A 3WO4C 4MWFA 4LLUA 3MUHL 1RULL 4UTAH 1A2YA 5KZCB 1JGLL 2BMKA 1HHIB 4OLVL 5D1XB 4OSUH 4MAUH 4NBYB 2QADB 4P5MB 3ALWA 1A1OA 1Y6NR 2JELL 3FO9A 3GIVA 4KDWA 3NCJH 3R0NA 4FXGA 4JQVA 4CN1A 3ME0A 3Q5OA 5ITBH 4RSVA 1Q9OB 4IDLA 1DBKH 1NC2B 3D2UA 1MCKA 1CD0A 2HJLB 2Z8SA 1ZLWH 2XY2A 3VGAB 5FKAB 2DQDL 2DQTH 4YHZL 2ZCLH 4NO0D 3PHOB 2X05A 4JFZL 3WNOA 3QH3B 5CIPA 1ZA6B 1ED3B 4GAGH 4NWTL 4HUUB 3KJ6L 4DVRL 1RUAL 1VFMA 1RU9H 3VXSD 5ABDE 4NCDA 5DMKB 5C0BA 4OLWL 1K8IB 1NCTA 5TGBA 1MWAB 4Y19B 2ZUWA 2D7PA 3G6JA 4ALAH 4ZQKB 2J5LC 1AR1D 5JXAL 4JN1H 2BNRA 3S37L 3IJSB 1KIPB 4JM2A 4OZHA 2F19L 1CN4A 3KR3H 1LEKB 2DLIA 1UZ6F 4XBEH 4CMMB 1QFUH 5I0DA 1RUMH 1V05A 2IWGA 4OFDA 5HD8C 1HCFX 4JZNB 4XC1H 1BQUA 1FFOA 5JPNA 3FHQA 3ZE0F 3QEHA 3GIVB 5CEZE 3KLAA 5IEHA 3BZFB 2NLJA 1RIUL 3C6LC 5DRXA 2YRLA 3QNYB 1XIWD 4LRNL 2LU3A 1KBGL 4M3JA 5E8EA 1A7PL 4GXUM 2ZPKL 1MVUA 4TSAH 1VFOA 2CDEA 3TVMC 3K8LA 3BPOC 4PG2A 4Z76B 2BK8A 2R2HA 3RA7L 4ONOA 5JIKA 2AGJH 3G5YA 4FFVC 1IC7H 2OTWB 5L9DL 3DHMA 1LEGA 3DNKA 1MFNA 1K3IA 4JGUA 3VGEA 4HGWA 3BVNB 2F54D 5GZND 4MB5A 2BXYA 2ZWLT 2WW8A 3D0LB 4UT9L 3HMWL 4PB9L 1HCVA 4ELKB 3MPCA 5T1LD 4YX2H 3G5XB 1VHPA 4ZS6D 3L7FB 2CPCA 5ITFA 4RIRB 3UJIH 1JPFA 2FATL 1NCWH 2ADJB 5T3ZH 4OCYH 3TNMB 4CUCA 4JFEE 4XHJD 5JHDA 4NHUA 1FORL 1Q72L 2HP4A 4LP5A 1CFQA 3BKMH 5CP3A 1OVZA 4NKDA 2Z35A 3PJSB 4NM8H 2DYPB 1JI1A 4LEXL 4MA7L 1BZ7A 4IRJB 3UEZA 5GPRA 1GH7A 4PJEE 5E99L 4NO0B 5T1MB 3O4LD 5IBUB 4OCRL 1T0PB 1LO2H 4LCUA 3P30L 3FB8B 1FL5A 4X9FA 4OD2A 5BV7L 3QEQD 3ZE2E 3L5HA 5HY9B 4XXCC 4LHUA 3RWCB 4OQTL 4G5ZH 5C0NC 4XNYL 1NMBL 5FOJA 4M1GH 3QIWA 1JYXA 1JF1B 4F9LA 4OZ4B 1SY6H 4EOWL 4C57C 4URTB 4MXQC 4LIQH 4ETQB 1S7QB 3IFOB 4XBGA 5HVHC 3OJVC 3ARSA 3AMKA 4KGLA 5E4EB 2WSKA 2YC1A 4UDTB 1OAKL 4YK4B 5E6ID 4PRNB 5I30H 4BFBD 4HIJA 2I24N 1ZLUK 5CJQH 2GTZB 1WBYA 4UI2A 4Q9CA 4JFFD 4KTDL 4HS3B 3QO0B 4XVUC 1FYTB 3G5ZA 5J1SC 2BNQE 4IRSA 5FYLH 5T1KB 1HH9B 4PD4K 4OLUH 2F8VA 2NW3A 3TM6A 1R6VA 1S9YB 4NWUH 1H0DB 5D1ZB 4MNGB 4D8PB 4WW2C 3KS0H 1JWSA 4OGXH 3L5WA 3P4LA 3HZKA 3ZO0A 5T3XH 4NO3A 2BDNH 3W0WB 1A6UH 4NN5C 3CH1A 4J3TA 1E6JL 4UDTA 3BIKB 1D3CA 3O3BA 3HI6H 3EYFA 4NZDA 3TBVA 4JVWA 3U48A 5KSBB 1TQBB 3I9GL 5BZWB 4KRMB 2VWEC 4Z7WB 3QXUA 1A4JB 2DWEB 4CU6A 3ZKXB 25C8H 1L6XA 3MJ7A 5C3TA 1CICC 5EORH 3NH7L 3BGAA 1UWEL 4B7LA 4PJEA 1AQKL 4F37F 3VWKB 5JW5A 3QUZB 3RGVD 4MNGA 4D8PA 4WHYG 1XGQA 2O5ZH 4KK6C 2BSTA 4KXZI 4MA8H 3MROB 1G7QA 1XCQB 4QXTB 1GVIA 2AKRA 4X98B 1FIGL 2QQLL 4EBQL 1CLOL 4I5BB 2DQCL 3MODH 2D7OA 1TTUA 1GGYA 1DQJA 3CFKA 3IXAB 4D0CA 3LPFA 4WY7L 2ZUUA 5DGRA 1TZHB 4MNQE 4X5WA 3T0EE 4Y2DB 3KPRA 4OV6F 2QQKL 3LN4B 1PG7L 5CBAB 4PJFA 2G60H 3LN5B 4ONGL 3GRWA 5C0CE 4OBSA 4AG4H 2WWMD 1KT2A 3J8F7 4XVUD 1S5IH 5D6DC 1YN6A 3BRDA 2ZCKH 3QFJA 2KZWA 4X5LA 3FT2A 2C9AA 3ZSSA 4LARH 4PRHD 1XFPA 2EEAA 1FGNH 1C16A 4KKLC 5BQ7B 4KU1A 3B9KB 3MUZ1 2SEBA 5C71A 4ZDHB 4GSDH 1FFPB 4Y4KC 4GRLD 4M5ZL 4OZFA 1V3KA 2E9BA 4C83B 2R1YB 2D31A 5ALCH 2EDYA 2W91A 5I71B 1CGYA 5EA0H 1QZ1A 1J8HA 4D0BA 5ISZD 2R15A 3B9EA 3ARVA 4KKCD 4PGDA 3MO1A 4M5YH 4MD4A 1KUMA 3QG7H 1EDQA 3QHTC 3VD5A 1SHMA 4I13B 4RAVB 2FBJH 4KTEH 3BP7A 3BZ4B 4JGJA 2J5LB 1DN2A 5GSVB 1M7IB 4BUHA 4P23D 1I1YA 4EKXA 4N0CC 5B22A 1TQCC 3LKQA 1UM4H 2JB6A 2NZ9C 5BV7C 2CRMA 3NCMA 3ZTNL 1YN7B 1WQVT 5DVMA 4JQXC 4K94H 4LLMB 1GOGA 1MCQA 4FRWA 1OAQL 4W4OC 5DD5H 4P3CH 3IDGA 1DSFL 1N26A 4WI9A 1WZKA 4ZFFA 1OQOA 1OGAA 1FIEA 3C9NA 4P99A 1U6AL 3D85D 4X7SL 4LSQL 3RWIB 3NFSH 3EAKA 4JPIA 4FQIL 3NCFB 1S78D 1ZA3B 2VIRA 1G7JB 4WW1A 4H0HB 1WTGT 1T66C 4M6OL 2VZSA 5IEKB 5IB1A 4Y5VA 4DCQB 1U58B 2JLLA 5IESL 3CZFB 3AXLA 3HC4L 2AJYL 1NC2D 5IHUH 3AB0B 1BBJB 5ALBH 1TZGL 2EDKA 3DRQB 4XMPL 3TLRA 3VU2A 3DBXA 5F7HA 2O5XH 1AKJA 1A7QH 4LSRH 4Z6AT 1WWWX 1J0IA 2E8YA 1IQDB 4H20L 3U9UB 1DUZB 4LBEA 1BJ8A 1SVZA 5ICXB 4ZOEA 1AD0B 4M7JL 5L0QC 4WV1B 3HN3A 5D93C 3PHSA 1QSFB 3TT3L 2NX5A 4RMTA 3AMLA 5JDJA 3N9GL 4M9OA 2HWZH 2MWCA 5BJTB 2Z91B 4NRYA 3PWLB 1J8HE 4NQEB 4OCSH 3V5HA 1H5BA 4PGJA 5FM8A 1G7HA 2DIJA 1LEGB 5F89B 2ICWI 5GGVH 1U8LA 4KROC 1RD6A 3UROR 1XGPA 4AQ1B 5E03A 5F3BB 4PRIB 1CE6B 2X4NA 4HK0B 3KJ4B 3NN8A 5C70A 1I4FA 4QY8B 3ARFD 4HQQL 4P2OA 4U1SA 4BK5A 3EDFA 3RFZC 3JV6B 1W0WA 1HKLH 3KJ4C 2P5WB 3ILQD 2HG5B 1CD9B 2EYSA 1X5LA 3RL1A 4LCIH 4X9BA 1MI5E 4XPAL 1MCCA 2WNGA 4WCYL 4K55A 2WZPD 3DRTB 2OI9C 4EXKA 4PUBL 4J8RA 1ZHKB 4LLQA 5D1QA 4BFGA 3TBYB 1KN2H 4UINH 4U05A 2ITCA 1LO4H 2MQ3A 2PXYC 3AM8C 1KLGB 2YS4A 5A2IH 5K9JH 1WAAE 4NJ9H 3QI9A 4OKDA 1YY8B 2HT4C 1G9ML 3DYMA 1HSAB 3TV3L 3M45A 2AJVH 3OKEB 1QFPA 3RUGF 1JNNL 2FL5B 1SYSA 3UPRB 4KV5E 2Q76B 1F11A 2VDOH 1CK0H 3V6ZA 3QCUL 4NZJA 5GGTH 4POZC 2NY6D 3RZCB 2GSGB 1U2CA 4HBCH 1YUHA 5C9KA 2VLLA 1DN0B 3RVWD 4K23L 3QDGA 2YWYA 5KS9E 3QT2A 4Q9QH 5MHSE 4WWID 3PDDA 3SCMC 2OYPA 2IPTH 5CIPH 3FRPA 5HYSG 2EDEA 3O4LA 3D85A 2FYYB 3IDJB 3HRZB 4J3UA 4S1SH 4NUGL 1FC2D 2GJZB 3OG4B 4AQOA 4OZFB 5AEAA 1UM6L 2VQUA 3V0AC 5F71A 3AREC 5DFTA 4P3WA 5JXEC 3CDGB 4POUB 4RGND 2B39A 4L4VD 3R06A 3QRFM 3SDDB 1MCDA 4ZAKB 4F7TB 2BC4B 3ARZA 3IU4L 2DAVA 3C6LA 3QO1B 1UH2A 2XKNB 4H5SB 1XF5A 3QUML 2HTKD 2O93L 2WIMA 1E4WH 4X8JB 4TOYH 4H8WL 1HWHB 2ESVB 3ILQC 5E1HB 4D94A 4R0LA 3WXWH 4GW5A 1KJ3L 3LKQB 4F7EB 1XF4B 4TUKH 4TVPE 3RWJA 3VXMB 3VWKC 1E27B 4UQ3A 3TH4T 5IR1A 2WM0A 3BW9A 4YO0A 3SQBA 4NKIL 2VLMD 5ICZA 3KWWA 4LSUL 1XZ0B 4ZUSB 3D69A 3VWJC 4KTYA 1JZ2A 1YMHB 2D0GA 4Q9BA 1YPZA 2OQJA 2R2EB 3L95B 4P5MA 5FF6B 3V52L 4FQJH 3MLRL 1MHHB 1WJ3A 5BVJB 3GBMH 1NGXB 2VLKD 3QO1A 1CXLA 3AY4A 1IC5H 5HI3D 2F15A 3C6LD 1I7ZA 4ONHB 5F7DB 1HZHH 1QSEA 3IGAA 2WLYA 3GMQA 3QISA 1JF6A 4K9EL 1A4KB 1RIVL 2NY5H 3ZHLA 1KGCD 5B39A 2CKNA 4WI6A 3KPTA 3VXMA 4X8XA 2Z93A 5CEYA 2ERJB 2VQTA 5C2BL 4CADB 5T3XE 1FNSH 2I9TB 4HIXL 1JTOA 4G80B 4PJXA 3VXSA 2UVFA 4Q7DA 4IJ3B 1G7IB 1S3KL 2VZUA 1NH6A 2BY0A 4J3VA 4H26B 4MNGE 1JGDA 4NQVB 2XZCL 4AT6B 5JXED 3MXVH 3PWVB 4P3DB 5BS0A 1ZANH 5EU7E 5HYJD 3BH8B 1NAKL 1QYGH 3GMLA 5FUOH 5GQBA 3SPVB 3ARFA 3VFUA 3LOWA 1LD9A 4FQ1H 3V4UL 1XF3B 3VXPB 4PRIA 1FZMB 4Y1AD 4OZIE 3VFNB 2AXFA 1TTFA 1FNGA 3RWCA 4PJFE 4XNXL 1NLBH 4UNTA 4LNRB 2FJHA 3CFEA 3D0VB 3UTOA 2YOCA 2EDQA 4KKAC 1NAMH 1TJGH 5DVOA 4Z95L 3E8UL 1IAKB 3FJTA 1PGRB 3MZGB 4X7EC 1GL4B 3TNNA 4KHXL 4JDVA 4JR9H 5EZJA 3T65A 4N0YL 4F8TA 2DQUL 1X5XA 4C4KO 1WITA 2BXZA 2OM5A 5D8JH 1ZLVK 2X4UB 4QHLA 4GS7C 2XN9B 3W9EA 1KN4H 4DTGL 1C12B 1PKQE 4Y4KD 4GS7B 1M7XA 4M6AA 5GJTH 4U1IA 4NM8L 2Z91A 1FDLL 4HLZG 4PJ5B 4NC1E 3P4NA 3BI9X 1GOHA 5I75B 3HE6A 1C5CL 1NEZB 1BQHA 2HMIC 1IAKA 4HXAH 1JWMA 4L5FH 3TNMA 1HXMB 4HMCA 4HS6B 4GMTH 1MWAL 5F88A 2OX5A 2DQEH 4PP1D 3EYOB 2VLJB 3U0TB 3TYFA 1UXWB 1MJ8H 3CK0H 1AHWA 2VR9A 1MCNA 2VMFA 5J6HA 3KXFA 4PV8A 5JOPE 1MUJA 1AKJB 1MJUH 1FNHA 5DK3A 4HC1L 1P5UA 2DLHA 3BT2L 4AM0A 2VDNL 4XGZB 2WQRA 2X7LA 1ONQB 3LEXB 2DI9A 3C8KA 5D6DA 3BH9A 5I17A 1JUFB 5I30L 5KSBF 4I3RH 5I76A 5EOTB 4R4BA 1U93B 1KPRA 4OD3H 4I2XB 3DVFA 4WI4A 4OF0A 1YEJH 4YBHA 4TPRL 2YSSB 2FWOB 1NEZA 2X40A 1OM3H 3VXNA 4Y16D 3CH8A 5IW1A 3N1QC 3GKWH 1XCTB 2IPUG 1CDUA 3F7PC 3SBWC 1N8ZB 4GKZB 4L29A 3W39A 1J1OL 1OB1A 2NYYC 1J9CT 1TJIL 3C8HA 5B38A 2VN7A 3IFNH 4I8DA 3WNPA 2EXWC 3N06B 2IG2L 3QI9C 3BO8A 1CDYA 1UACH 4JM2F 5A1AA 1GGBL 4WWKD 3P3YA 3HI6L 4S10A 4OCWL 3PF2A 3O8XC 4FZEL 3K4AA 3FZUD 2NY7H 3R1GL 5CJXC 5FO8A 4AMKH 1QR4A 2OJEA 2V7HB 2XRAH 1X5FA 1XGUB 1VENA 4LVHB 1XR8A 3NH7H 3CVHB 4Z7UE 3ORJA 1X4ZA 1ZHNB 2H6PA 3D3VA 4ODVH 4U2YA 1OHQA 1IGJA 4KI5E 1H3WM 3PWNA 3BKCL 5I74B 1OY3B 1IFHL 2Y7QA 5L7XH 3A67L 1GCFA 1CFVL 3H3BC 4OJFL 3KR3L 3BDXA 3RX8A 1DQJB 1R5WA 3ARGA 4AZ8A 4MXQD 5LWYH 1FZOB 3L3GA 4X6CF 1NCDL 4ZTOH 1DEEA 1LO3L 3OR6A 2IALB 5C9JA 3IETA 1NGQL 3PWVA 3TBTB 4YFDB 1NMCC 1AR1C 1A14L 5E2UL 2OXHA 2JE8A 5IJKA 2Q8BH 4PJ9C 4P9MH 5J89A 3QDMA 5T3ZE 1MCPL 3U46B 4YR6A 1QLFB 5E8OA 2E7BA 3O81A 1S7SB 4O4YL 4PLJC 5DF0A 3WFEL 5D72H 4YIQB 3HNVL 1FN4A 2R69H 2FH8A 2FRGP 5HHPB 3FFCD 3HE7D 2OZ4H 4XNUH 3GZKA 2H45A 2HVJB 2YUZA 5E6IC 1KYOJ 1ND0A 2VZOA 4KJQD 1ZEAL 1CD1A 4ODHL 3WO3B 1FFNA 5CZVL 3ZDXF 1MJ7H 5FO9A 3RGVA 1IILE 3HZMA 1NCWL 4ZSOB 1IT9H 2CKBB 4OCYL 4KPHL 4DEPB 2ZNWA 1CBVH 4HX1A 4F7EA 2VDRL 4RZCB 5SWSA 3MA7A 2YXFA 4BK4A 2XWJB 5D1XA 1MJJB 1UG9A 5CCKH 3U6RB 3AUVA 4N5UA 4WWKA 3O6KH 4MJID 1ACYL 2PYEE 3MLWL 4NBZB 5IF0A 4M7ZB 1I7RB 5HHXL 1UXSB 2CIKA 4PTTB 4S2SB 4GXVH 2A0LD 1RZIB 2J8UB 5SX5K 3C09C 5CEXB 4LQFL 4NFBA 1HN1A 1T20A 5FO7A 2DJ4A 5KZCD 1OAQH 2HJFB 4Z7QF 4FZ8H 1YNKL 2IH3B 1MH5A 3QA3B 2CKBA 1S7UA 3C2AH 3S5LG 3SJVA 4U1NB 2ZOLA 4RZCA 3BQUD 4X7TB 1MHCB 3FQRB 1YC8A 1DN0A 1MSPA 1J88A 3VWKA 1CFQB 1UB5B 4K3GA 3QHZH 4NZTH 3LKOA 5JHDB 4UTBH 4YHIB 4YC2B 3Q2CA 3WL9A 4KROD 1T1XB 5DMIL 1G0DA 1UYWH 3PWLA 1T83C 5DA4A 2FYYA 2VABB 3IDJA 2NW3B 2A83A 3GSQB 5FHBL 3WEXB 3VRJA 5IROA 1BWMA 1UWGL 5JDSB 2R0ZH 4X9IA 5C0FA 2YPLA 4H1LA 4FQXD 1FPTH 2VE6A 5A16B 5IFJB 2P43B 4OFKA 4F7TA 3MRFA 4OLUL 1QSEE 4M1CD 1H3VA 5C08D 4AEHH 3FB6A 1ADQH 4KQ3H 4U1HB 1T4KA 2N7BA 3VXME 3NCYS 2IH1B 4NC1C 1WISA 4LCCB 5HPMA 5DJYB 1DCLA 3BGMA 2EYSB 4NRZA 1AXTH 5KSBA 1BLNB 4ETQA 2WQ8A 3MRDB 1AP2B 5DEGB 3NFPA 3AS3A 5A43C 5MERA 4L3ED 2X70B 5ID0B 3MLXH 2XPGB 5EZIH 3UJJH 4U3XA 3P0VL 5J57B 2Z8RA 3OKKB 4WTXA 3TBSB 1CE6A 2YR3A 4Y5VC 4BQ9A 1HHJB 1MVUB 5BS0E 1EVUA 2H3NA 1PLGL 2EH7L 5CAYB 4L4TB 1JHKH 4MD5A 1KXVC 3RQ3A 3T1FB 1VPOL 1ZHLB 2COQA 5BJTA 3GJFB 1F45A 3TC9A 5F70A 5D71H 3LKPB 3T2PA 4NT6B 2DQFB 3C5JB 3IAQA 4G6AC 1ZT7B 4M1DL 3UPAA 4KXZH 4OZIA 2DQCH 2IH1A 3NCJL 1GPOL 1KOAA 2B1AH 4PYGA 3E6HB 2LVCA 1OGAD 1TCRB 4LMQI 3IKKA 1B4RA 5D96B 3PGCB 4QOKD 4EVNA 3IJSA 4QO1A 5DT1L 3O8XD 1SJEA 3NZ8A 4RGOL 3D2UB 3HE6B 3T09A 4PJ9B 4J6RL 1T1ZB 1U8QA 1T03L 4LAQL 5E08H 5D7JA 1EHLH 1WTLA 3QXDA 4OIAA 3MRJA 3UTTB 4ZFOA 2GUOB 1WBXA 3O6ML 4QNPF 5ISZB 1CK0L 5HHVL 4ZUTB 3F58L 2VLLB 1MAKA 3GGWB 4HBCL 5I16A 3TYGL 1OP5K 1BJ1J 5GGUB 1ONQA 1F4YH 2CDFB 2V7HA 5DZNA 4ELMB 3K7UA 1I9IH 2F74A 3IJYA 2XICA 4NN7B 1T5WA 1AGDA 3SHSA 1RK1A 3TIDA 4PRHB 1A5FL 1T7YA 4G6KL 5TFSL 3PXHA 3VG9C 1CE1L 2A6DA 4KJWC 4I4WB 1AIFA 1QBBA 3QFDB 4ENED 4Q0XL 2J4WL 4MJ2A 3BP6B 1JPSH 3LN5A 1W72A 1IGYB 2AABH 3LN4A 1IL1A 1RJYB 3TN0B 5JLZB 1J5OH 3ARFC 1TPXB 3IU4H 4XRCB 3SDAD 3VFOA 1PAMA 4JG1L 4GAYA 4P9HL 1U2HA 2EO9A 5DEZA 3TN0C 3OR6B 1OOAA 1CFNB 4GG6F 4OTXL 3QUMH 1MHHA 1TIUA 5K9OB 5CWSA 4U1GC 3MQIA 2GSIB 3ETBF 4P23A 3OAUH 4PJ5E 1G7MA 3FOLB 3UTSE 1ZHBB 4K07A 4LSPL 1B2WL 1MFAL 4KZEH 3IJYB 2OSLA 5EU3B 4UV7H 4XNZC 4KFZC 2XI9A 4NPYA 4P59L 3ULVC 5F21B 4KK5C 2BNUA 4JHAL 5BQ7A 3SCMA 3WNLA 1WIUA 4PJIF 4TULL 2G9HB 4LSUH 4XMKL 3C87A 2ZOKB 3BD5A 3CX5K 2OTPA 1HIML 4WRLA 3E6FA 2XQBH 3EO9H 1IEBB 4JO4H 1FBIH 3MJ9A 4PRDB 5IB3A 5KVDH 4MA7H 4PGDB 1YYLL 2NNAB 4XZUB 4Y19E 1IM9B 5IT2H 1NFIA 3GHBL 2AQ3A 5DURB 4NZRH 2HH0L 5D7LB 4TNWF 3MLTB 1G9MC 2O61B 2E7LC 3FQWA 3OKLA 1RIHH 3KYNB 3VFWB 2A74B 1CGSL 3GB7A 3O0RH 1I8IB 4LSSH 5JLZA 4YFLI 1F00I 2FJHB 3SBWA 1TZGH 1F8TL 2P42B 2AS5M 1RIVH 2NY5L 3WUWA 5HHMD 3MCKB 4M48L 1MY7A 1SEQL 5IB2A 1GZQB 4P46D 6FABH 5KVFL 2A2QT 5DS8B 4I2XE 4KZDH 2W9EH 1DLHA 3QQ4A 3QDHA 2QHRL 3QDGD 2CLVB 4KJYA 1CLZH 1VEPA 4JZJB 2DTML 1KCRH 5MEOA 3IFPB 5BOPA 4CNIA 3MRKA 1NGZB 3UXFA 5EUOA 2CRZA 2YA1A 1U93A 4X5XB 4K7FB 2SEBB 5L8KB 3I6KB 3UTQA 2VXVL 5C08B 4DKFL 4ZMAT 1HEZB 4XVSH 2H32B 5FYLL 5CINL 2HT4D 3FT3B 1ZGLB 3OB0K 2MCG1 3QIWC 1TPXC 5KJRH 4M61B 3MR9A 4R7NB 1M05B 5DHYB 5HGGS 4F15B 2W92A 3ABZA 4GJTB 4CDGC 3QNXB 3CDGA 4Q97A 3NCYP 5GS2H 4NYLB 2DBLH 1D5IL 2HT3C 1ZTXL 2MTPA 1BM3L 3MJ9L 4KGJA 1EGJL 3ZL4L 5GRZA 5GGRB 3PL6B 4H1LB 2YPLB 5LGKA 5FK9B 4MHHG 2DQFA 3C5JA 5KN5B 4H8WC 5CZKA 2EC8A 5DVKA 1ES0B 1N5AA 5DK0B 1PFCA 4DZ8A 4PJDB 1RFDH 3WKMH 3G6AB 4XPGL 3UTTE 5DHXB 4BUGA 4O2FB 3W9EB 1XGPB 5F96H 1U8LB 3IS0X 3TH2T 3U1SH 5EU6E 4JN2B 4PPTA 4H88H 2W59A 2FJGB 3IU3B 5GRJL 3TPUB 2X7LB 4Z7UB 1NKRA 4M61A 4RMSA 3Q3GA 5SV3A 4X7TA 3X11B 1CL7I 1WWCA 1ZKAA 4ORGA 3AGVA 5B3JF 1TJHL 4OF3A 4EBQH 4LF3B 4IRSB 1YN6B 2OP4H 4JCLA 1CGUA 1UCBL 4FXLA 4HT1H 1UADC 1G0YR 4L5FL 2EO1A 4NUGH 5ACMA 3IDIA 3GMQB 2PYFA 3OGCA 1K4DB 1URLA 3KLSA 3KPRB 2ZNXA 4G9DB 5C0AD 4Z7NE 4M62H 4QTIL 4XHJC 5I1KH 1LO5A 3OKDA 2EC9T 1CVSC 4QRPB 1MJUL 4O51B 1J7VR 3TZVD 4P5TC 3MRRB 4H1LG 3BHBB 3BT2H 3KLHD 2B5IB 1EFQA 1S5IL 3RIFF 4HWBA 5I75C 4YBLB 3CXDL 4XC3H 2FJGA 2R1XA 2NXZC 4HWBH 2EIDA 4D9QE 5IMOB 4GRLA 1JP5A 3VXUE 3FT4A 4LCWB 4MLSA 5MENE 4KUCF 2I27N 4X7DC 1GGTA 1QRKA 1JCKA 1NDGA 1RZKH 3TZVB 1G6RB 2Y07H 3DGGB 1IGCL 3ESUF 2Z4QA 3W11C 5CJOH 1G9EA 1T0MB 1D9KA 4LCYA 2ID5A 3I75A 4PY8J 1MPAL 1V7ML 1PY4A 2EZ0C 1UQSB 3OPZL 2BOBB 3VRLF 4KRPD 4WJ5B 3IKCA 5KSAB 2BFVH 1A4KA 1MAJA 2XZQL 4QKXB 1XMWA 2YRZA 3P4OA 1INQA 1UM4L 2M1KA 2IAMC 2DLTA 1WZ1H 4DN3L 1EEYB 4K9EH 1AE6H 4P4RB 5IUSA 5F7LB 5C9JB 3C60D 1HH6A 4XWOD 1G0XA 5LCVL 2BVQB 5DVNA 3QDMD 1OWRM 1EFXB 3CZFA 1EZVX 4TSBL 3STZB 2QQNH 3MUGB 4R90L 3W9DA 2KZ1B 3QUZD 3RGVB 5FO9B 2WBJA 3IJHA 1RUQL 1YZZA 2NXYB 3QHFH 4YO0B 1FO0H 5TJWK 3G04A 4LRIC 5TH2B 3SGEH 1KENL 1YY9D 2IADA 5GS3A 1WBXB 3FTGA 3PGFL 2P48B 4CVZA 2AI0L 4LLMA 2FO4A 2DLEA 4HKXB 5FYKH 3BVNA 1FLRL 2KBGA 3FO2B 3VI3E 3QH3A 1QYGL 4U1JA 4UILH 5GGUA 3T0EC 1S9XA 1TETL 3CVIH 3ROOB 2G75A 4QXUL 5C86A 3U36A 3S96A 1YEGL 3BZ4A 3ECBB 3PL6D 1UXWA 2BSRA 3UYRL 1IMHC 4PJGF 5JIPA 3RDTC 4X4MA 1M4KA 1CDIA 5E1AA 4X6DE 3FQWB 4XBPA 5KSVA 1LE9A 5EIVA 1P4BL 1MLBA 5FA3A 3V7AG 2VDKL 5DA0B 4YXLH 4M6MH 1WCBA 2DYPA 3WDHA 3QUKA 5DJXA 5FCUH 3T4AB 5DRNB 4KHXH 2V5SA 4ZXBB 5I76B 4OIIL 1GGIL 3ARBD 1KB5L 4H26A 4EEEA 5TE4H 3DMMD 3OX8A 4NQXA 4O2EA 4M02A 5INCB 4Y16C 1ZHBA 4L4TD 4KPHH 2AEWA 1JPTH 2E7LA 2NQCA 3GO1H 4EJ1C 4Z5RB 3HCVA 3QIWD 4Y5YB 1VA9A 2F54E 4U3CA 2IPKB 3DUSB 4HAFA 1QKZL 3LKSA 5CD3A 1NFKA 2V2TA 2NXZB 4K7PX 4QRRE 5DJAB 1Y18B 2EXWD 4LNRA 4P2QA 3HMXL 4HFUL 1C7TA 3EYOA 3QI9D 3A0OA 1Q94B 4NNYB 3VFNA 3LHPL 1ZT4B 4WU7A 3STLB 4UINL 2WBWB 4ODBD 3HAEG 3OKMB 5I1CL 1XGYL 2P8MA 3RL2B 2NTFB 3W5MA 1PQZA 4QHUB 5D6CB 4FXKB 3KPLB 3ZE0E 4DUWA 1FGVL 5GGRY 3DVGB 2I07A 2F5BL 3NAAH 4Y4FA 1Z9MA 1R3IL 3KYKL 2AXJA 3KG5A 2VLJD 5HDOA 2EYTA 3KAAA 4R2GB 2J3SA 3PL6A 5LJYH 3QCUH 1B0RB 4YDVB 2GJ6D 4NQVA 1P1ZA 2X4RB 4JREB 3TF7C 3MREB 2JKXA 4WWKC 5T1LA 3UTZA 1IKNA 1DBMH 3RUGB 4YDIH 3IFLL 3RY6A 4Z77A 5F9WB 1F4AA 3OL2A 5FHBH 1A6PA 4XP4L 3U79A 4JM4L 5GS0D 2XA8H 5D7LE 1OM3L 4XP1H 3DV6A 3RDTB 4M8QB 3JVGC 1WFNA 1JF1A 3H7LA 2VDMH 3VFGL 2ATKB 4QRSB 1RSFA 3ZMRA 4EVNB 4G9FB 1N4XL 3LKOB 1HQRB 1FNGB 4OF7A 4LLQB 4WI3A 5EO0A 1KNOB 1XEDA 4ZD3L 3ZYZA 3CXHK 1T1WA 2RHEA 2OR9L 1A6ZB 3D39B 1IVLA 1IQWH 2O5YL 4EN3A 5ANME 4LVOC 2B4CL 1EUTA 1K8DB 3GJFA 3VXMD 4MCZB 3OXSA 3K74B 2W38A 1N6QL 5F72S 3T0VA 1PBYA 1HK6A 3ULSA 3QO0A 4ZUWB 4PBWD 2E5EA 1ZMYA 1DLFL 5DJ0A 3L9RA 5HYEA 4DGIH 4QXTA 3V6OE 1KJ3H 3OKDB 4QRPA 2W9DL 4I3GA 3P9WB 1MCIA 3UTTD 3JV0A 3VXOA 3RWJB 5JMRA 1OTUD 7FABH 5E00A 1FVDA 3GBLA 1RHHA 3DV6B 2PO6C 1EH9A 1HI6A 2ZG3A 4JKMA 4M3KB 5L2KA 5L7XL 4U33A 1SM3L 3K2MC 5BVPL 1DBAH 3O3BB 1L9NA 1KACB 1LMKA 1MRDL 4J23A 3HE7B 1DVFC 1U8NA 4G8IA 2DL2A 4FG6C 3PP3H 3T04D 3W0WE 4PTTA 4S2SA 5DT1H 3KPNB 3TGXA 1CR9H 2PW1A 3KLDA 3M17A 1NANI 2ED7A 5E8EB 4N1CA 4QRRD 5J11C 2PR4L 5EN2B 2VERN 4JO3H 2AJZB 1BVLA 1S9VA 3FOLA 2CLZB 2R23A 2BVUA 4Z7WE 4JFDB 4CU7A 3SE3C 1LP9A 1IAIH 1FH5H 5IMKA 3ZLQC 1GZPB 1OLLA 4EI5A 4ZPVA 2B0SL 5E1AB 4NBXB 4NRXB 3RWHA 3S88H 2G9HA 3PWNB 5HI5C 3UTQB 5IR1B 4MAYB 2NY4D 5HGBA 2E8ZA 2YD8A 5ICZB 2DQIH 3H2WA 5C7XH 4JFPB 4PP2B 3UJTL 2FDBP 4AJ0A 2GIYA 4FQLH 2AK1H 3X14A 4J3XA 3HHRB 1VSCA 5E24E 3VFMB 2VB5A 4YQXH 5KSUA 4ZO8A 2EH8H 2XZAL 2PCPB 5C0EA 3PGDA 1MIEL 4P4KB 3ZHKA 5F7DA 4P2QD 4BKLB 4MNQA 3MRBB 3VI4F 1JWSB 2CMRL 2JCCA 4OI7A 3O3EB 2YK1H 1EEZA 4ZG1A 1AQDB 2I5YH 5F7WC 4WW2B 3K8MA 4P46C 4HUWB 5KVEL 5J1AA 3D39E 3OKOA 4KAQL 3SDDD 3S37X 4ZYKA 2DQHL 3BUYA 5JA9A 4JPKL 4EUPH 2ARJA 4JCMA 4K7FA 3RWFA 5MP6L 2GT9A 2FIKA 3KPSA 3RZCC 2O26U 2VITA 4KUZL 1T2QL 3HUJF 2EEDA 4JVUA 3N1MC 2ZUXA 4DOHB 3ILPA 3LZFH 4HPYH 1U8JA 1JPFB 2W0KA 1JYNA 1PX3A 3GMRB 5ANMB 3MLTA 3GM8A 1S7WA 3MLVL 4JY4B 3BQUB 5EUOF 5IT2L 1LK2A 1I85C 2DMCA 5TDPA 1MFEH 2QKIA 4JO1H 3H9SB 1CGSH 2YD4A 5HI4C 1E28B 3WFDH 1AGFB 4DQOH 5JQHC 1FPTL 2UZIL 3D3VE 1PG7W 2EIZA 4JHBA 1S7VB 5D70H 4HKJB 4YHKH 4HZLA 4UT7H 2EE2A 4X5WB 2OR8A 2NY4C 3ET9F 5IVNA 1ODAA 4UB0H 1AGBB 1H15A 1NUGA 4R7DB 1IAOA 4P46A 4PV9B 3T4YB 4IOFD 4PREB 1JTPA 1R3LB 2FR4A 4P2OB 4KV5F 5EO9A 2A9NL 3TJHC 4XI5C 3I6LD 12E8L 4G8FA 4DGVL 4OV5B 3EKCA 3DX8B 3RL2A 2A73A 5EU4B 5KG9A 3UJJL 5I17B 3QUZC 1RZJH 3VXTB 5DJZB 4OD3L 3QUXC 3BSZH 4BZ2H 4F7MB 4DKEL 4L8BA 4LLVA 3PIQB 3EGSA 2D7QA 2HFTA 4KJWD 4PJIE 5E6ZA 5AAMA 4EUPA 4PG2C 3VRJB 3WS3B 5KJRL 2DJUA 3HAEH 1B0GA 1T5XA 4FFWD 1N7MH 2D2OA 3UZQA 5LGHL 3WDJA 3GRWH 1NGWB 4KKBD 4HMDA 2E27H 4QRRB 2DBLL 4YDLC 3L3KB 5DD0L 1N59A 4WUUD 5ESQA 3ZL4H 3MMEB 5BZDA 1QQDB 1U8MB 2NY1C 4RGOH 3G6AA 5D7IE 2DF3A 4S11A 1CU4L 5I66B 1KEGH 1A6AA 3MXWL 1Y6MR 3ULUH 2NW2A 4YJZL 5ACZB 4PJGE 5M94B 3O2DA 3EOTL 3C08H 3FB5A 2NX5E 4RWYL 3GSUB 4WDIA 3A6BH 1HOCA 4DVBB 2ATPA 3RY5A 4G9DA 2XNAA 3QXAB 4R8WL 1W0VB 2FZ3A 1NAMA 3V4VH 4L3EE 1DL7H 4ZPTB 5DWUH 3F58H 5DDHA 3DXAA 4LIQE 1M1SA 2PYEB 5BXFB 5TGBB 2R1XB 1FFRA 1JL8A 5FYJU 3VGFA 1TJHH 1Z2KA 1TLKA 1U95A 4J4PA 2VABA 5DJ6A 2APFA 5I1JH 2MMXA 3LQAL 2APVA 3QCTL 4ZTOL 5GZOC 4F33A 1D5BA 1LNUA 4G6KH 1FL3A 4PP2A 3AAZB 3MRQA 3SKJL 4C56D 3OBAA 4MX7A 5JA8B 5J13C 5CLTA 3QR2A 4Q58C 43CAB 5C0IA 5IFHH 5GRVL 3FB5B 3MV8B 4Y2DA 1HNFA 5IB5B 3K8KA 1C5DA 2XWTA 4R4ND 4R97C 3WFEH 2A6IB 1YDPA 3NTCL 4E9LA 4TRPL 3SN6N 4NWTH 4CU8A 4ODXA 1ULVA 1K4CB 1A9EA 1JRHL 3L5XH 5F3HA 5FUZH 4OLWH 3MRBA 4BH8A 3RGHA 1BEYH 1Q1JH 4RISH 3EHBD 5LXGL 4YHOL 1U41A 2V5YA 3BN3B 1U42A 1RZKL 2D0FA 4AIXA 3B8SA 5CEZL 3VMPA 1HNGA 3G6JB 2ZSWB 5DD3L 2RFXA 5I2IA 1F3DH 5D7LA 2XQBL 5EO1B 2NPLX 1O0VA 5SWSB 1IGIL 1NL0L 4A2MA 3DROA 5CEYB 2HVKB 1HE7A 4CADA 5L6YL 1HI6B 5CGYC 4UU9A 5F1OB 2GFBA 4I9WD 1Z5LB 1KTLB 3WNKA 3R8QA 4TTDD 4PJCA 2XKUA 4MSWA 1ZE3C 4K8RH 1AE6L 1EHAA 3JBG7 3Q5YA 1A9EB 5T1DH 4QXGL 3QQ4B 3VH8G 3GBNH 1KC5H 1UKTA 3QEUB 5LCVH 1YNKH 2CLVA 2PETA 5GISL 3RJQB 5D7SL 1P7HL 1YYML 5HYQA 2HFFB 3D25A 3QAZC 3L95A 4KZDL 3HR5B 2ADGB 3EYSL 1HQ4A 2VXUH 3QHZL 4NZTL 1FFNB 3Q6GH 4NP4H 4V2BA 3L3DB 4HFWB 5DI8B 3HFML 4G9FE 2H2PC 3FFCE 5JW3H 3W5NA 1IBGH 2X09A 4W6YB 2E9IA 3RDTA 4FQXB 2RQ8A 4N0UA 1UYWL 1NFIB 1WBZB 2HKHH 4ODSL 3FT3A 4AENB 5TF1H 3GHEH 3E3QC 3MFGB 4PJGB 4WEUD 2OZ4A 1RK1B 3RX7A 3TIDB 2A6KA 5F9OL 2R39A 1UWGH 5F7NC 5GGSB 3P0YL 5CSBA 3TH3T 3S35H 3ILPB 4GG8B 3QIWB 1OW0C 3U4EA 2V5MA 1KEML 1XR9A 4XPTL 3HB3D 2VLRA 3L5JA 2BP3A 5D7KE 5C6PB 3NGBB 5D1ZD 3QWOB 4F2MA 3MRMB 3PWPD 3QIUD 2P8LA 4O5LH 4JKKA 2NR6D 3UP1A 2HFFA 1BJMA 4L3CA 2IBGA 1ZTXH 4ZO6A 4PJDA 3VH8B 1GC1C 5C2UB 1Z9OA 1LP9E 3BZEA 3AS0A 4NFDA 3O4OC 3U82B 3MV01 5HBBA 2F5AL 5SWZA 4ZS6C 5I19H 5CILH 5LBSH 4LASL 4ZFGH 3VFVA 1XF2B 3OKMA 5TE4L 1SEBA 3PE9A 5K9QI 5FCSH 1W72B 2VSCA 4TN9A 4JKPH 4UTAL 1S7QA 4R26H 1LVEA 2DWEA 1G1CA 3E2HC 5IFAL 3FQXB 5L2JB 3NA9L 4UIMB 2NNAA 4XZUA 4MAUL 3BEWA 3ARXA 4JPWH 2DLGA 1KB9K 3FQTA 4GRWH 2F58H 4YDJA 3MREA 1QOKA 3PHOA 4M7ZC 2LU4A 5HYJB 4J2XA 5HPOA 4FMFA 2H8PB 3L1OL 4N0RA 4Z78B 2A77L 4PJAA 2HAZA 2BOCA 5I1CH 3GGWA 5FDWB 4YNYA 4F80A 1CICA 3SKMA 1DQQB 1ZHKA 3I9GH 1VDGA 3FRUA 4LCUB 2V2XA 3O6FB 4NM4L 1J0KA 3TVMA 1HH6B 1U8OB 4M62L 2R23B 4ZUWA 1C08B 3PWPE 1EHLL 1HHGB 1FV1B 1T5WB 4N5ED 1DQLL 4JFEA 3D48R 5D96C 5E70A 5JHDE 1Y0LA 2YBRB 5ESQB 5E9DE 3RBGA 1RHFA 4IIQC 3M8OH 2XY1A 2V17L 3ES6A 4Z0XB 2WV3A 5DC0A 1P2CA 2IPUK 1DZBA 1WVZA 3O3AA 3QQ9C 2R56L 5AZ2L 2WWMC 2HTLC 3BDBA 5SWSD 2GTWA 1JTTA 3ROLA 5HJ3B 2F74B 1IM3B 5JQ6H 2JIXB 5CJOL 1YQVH 4APQD 4G7VL 1J8HD 3G5YB 4PJEF 5I73B 3V8CA 3HLAB 3K4DA 5FB8B 4L4TE 4UT6H 3E6HA 5IVOA 1O7VA 2AABL 4P2RB 5TDNB 1NJ9A 1PG7H 3OKOB 4PJ9D 1JRHI 3LD8B 5LKNA 2OR9H 1E0OB 1AQDA 4LARL 4YHYB 1QFWI 3CU7A 2Q87A 4O02L 1CD8A 4DOHE 4UV4L 1OT2A 2AXGB 3SDXF 2NCMA 2D0HA 4EN3D 1N5AB 2EC9U 1AC6A 4DN3H 1MF2H 3FONB 1KCVH 2VDPH 1T3FB 5GRWA 5DTFB 4CMMA 5BZDB 1JV5A 1MRCL 2W9DH 4FQXC 2W0FA 2BVEA 4WHTB 4XNMB 3GSNA 4GW1A 3BN9D 1OD9A 3CPLB 1TVHA 1Q72H 1QRND 2HRPH 3C9NB 2JIXD 3OZ9H 1JZ7A 1TFHA 1ORQB 1GJIA 3QHFL 2LABA 5H8DA 4LEXH 1SM3H 4YZFF 3X11A 1T0MA 2FBJL 4KTEL 2HMID 1FCGA 5EA0L 4YPJA 4K3DH 2QSQA 1X5IA 2YRPA 1G1YA 2B1HL 3MACH 2YUXA 3MRPA 4R96A 3QG7L 2R2HB 2P5EE 4EI5C 4D0DA 3DUUA 5D7KD 2AVGA 4M7LL 3BISA 3EDJA 4BSVA 1JWUB 2E7CA 3CVIL 4X9GA 5DD5L 4MD4B 1SEQH 1TZHA 3QIUA 4NCC2 4RAVA 2A0LC 2N56A 2QR0A 2FX9H 5C07E 3VGAC 3BUYB 3FCTA 4G6JL 4LSQH 1P4BH 4XB8A 4E41E 4X6CA 4V1DA 3O9WC 4ETYA 1J0ZA 3P73A 2OMBA 5TQ0L 4CDHA 2JCCF 2L7UA 3BAEL 4MSWB 2HFEA 4K94C 3SDDC 2P8LB 2VAAB 3PGDB 3O3EA 4P4KA 3N85L 3X13B 5JNYA 2PW1B 4G7YH 1KPVA 4AIZB 2AAVA 1FVEB 1IARB 3LMJL 5DUBA 4BKLA 4L4JA 5ETUB 3WSQL 2NY2B 3T65B 1UXSA 3RAJL 4CL7A 4OIIH 3FOMB 4IIQA 2AJ3B 3PWUB 3EYUL 3MRGA 4MLIA 5LAXB 1MCFA 4LPXA 4U6VL 5TDPB 1SBSL 2Y6SD 1E4XH 3GI9H 5D5MF 2LAAA 3CFJA 4JDTH 3BH8A 4XH2A 2YUWA 3BGFC 1S5HA 3BPNB 4F9PA 3CFCL 3L3DA 4K9EC 3HR6A 5ALBL 2VN4A 2D7TH 5DHVA 4CBPA 4MAYA 4LHUB 3BP4B 1PSKH 3F5WB 1A7QL 2VITB 4YH6A 5EUOB 3ZSTA 4G8GB 8FABB 4ZNEE 3HC3L 3FMGH 2PO6B 4X5XA 4M03A 1KXTB 1ND0B 3IXTB 2OJZH 3HMXH 4XAWL 4BZYA 1CS6A 5JW4R 4P48A 3LKRB 4U0RB 5TF0A 5I1DB 5D1QD 2VOTA 4MCZA 5MEQA 2VZVA 5L88L 4OCNC 3W0WD 2X6MA 3ULSB 4DUXA 1QBML 4OFVA 1A7OH 2EKSA 2AJ3A 3PWUA 1U9KA 1FNEB 2E3VA 2DDQH 4MVBD 2W65B 2LV4A 3SDXE 4N8PA 3S98A 3IT8D 1OTTC 2XOTA 1AQKH 5DLML 5IIEA 3K80A 5DSCA 5KSAA 1KIQB 3GSOB 5F9AC 1EBAA 4MQ7B 4X7FC 3VG9B 4PJ8C 3OWEA 2WMPA 1BFOB 1H0DA 3CD4A 2G5BB 2DD8L 3D1MC 5H2BA 2F8XC 4LCIL 1LDSA 2UY6A 4M93B 5J13B 1SYVA 4QF1A 1T7ZA 5EZLA 4HZAA 4IMLB 3MBED 1UC6A 2X1WL 3GSNH 3ARUA 3CXHJ 2GITB 4NO3B 3BIKA 2ZCLL 1I75A 3INUH 4QWWD 5HGDB 4P57A 2NY6C 5BW7A 3ZTJH 5IBTH 3RY4A 1KJVA 4PG9B 4QTIH 5I1KL 3HI5H 5GZNC 3NCEB 4DFHA 3QNZA 1YDPB 2XN9D 2CLZA 4OM0H 5L2KD 5J6GA 2ZCKL 3T1WA 2NY3B 5EOQL 1IQWL 2N1KA 4NO5A 4HWBL 3S36H 1N6QH 1OSPL 1T21A 5HI5D 4P2RA 4AEEA 3MMEA 4WV1A 4X99B 4ZUVB 2FEEI 2EIZB 4K3JL 5FYJE 3DURB 1RUML 5DJDB 4DGIL 3CCHA 2PYFB 2WWKO 4R0LB 4BQCA 3BSZL 3RNQA 1PX4A 3WCYA 1J12A 3H3PH 5IM7A 1KV3A 1NFDB 3EJYC 3KPMA 1WWAX 1ZSDA 1K8IA 5IWLC 4YPGA 4NKQB 1KCKA 3X12B 2FWOA 4RFEA 4C4KT 2GCYB 2FZ3B 2X4NB 4HK0A 5JOPD 5AUMA 5MEND 1CTOA 5AYUH 3G9VA 3NIGE 5EBLB 1HOCB 1N59B 3ZHDA 5FKAA 3VXTA 4IRZH 1T7XA 4JRXA 4YHPA 3LB6D 1NAMB 1UM6H 4NQDA 1XGUA 4XCFH 3WFHA 4WUUA 3H9HA 2XYCA 1A6AB 3HMWH 4KI1A 5IV2B 4WEBH 3F7RA 2DKUA 4HUWA 1KEGL 3DVGA 1TZIA 3HS0B 4GO6B 3ULUL 2AEQL 5H94A 4OZFH 2BNQB 1OSZA 3PDOB 1HWGB 1VEOA 3EO1B 1DQQA 4WHYH 1G7JA 4WW1B 4QRRA 1S7TB 4MX7B 2V6HA 3ROOA 4TUKL 1PY9A 1T7WA 4BYHA 3ECBA 3ESVF 5D2NC 4Y4HC 3BP6A 2CIIB 1GRWA 3D0LA 2G2RB 1MY5A 4OCRH 3TJHD 3RPIB 4LLYB 1QBLH 5EBGA 1FL6B 1HILA 4CVZB 5KVGL 3KPOA 5DC9B 3PHQB 1N0XL 3BFOA 3RNKA 5I71C 3AC0A 4KRPB 1MCOL 3FRPG 4NQSA 4FTVA 3SQOH 4Y19D 2XNAB 3QXAA 2WP3T 1CL7H 1GGCL 1T0NB 2YN3A 4DW2H 5ISZA 1MCRA 3G08B 1HZHL 2OCFD 3HG1A 1BFTA 1FZKA 3MV9D 4PJBA 1MREL 3KS0J 4MQXD 4NRYB 1R3LA 3IDGB 5ILTH 1NEUA 5IK3A 1OP3K 3QPQC 2CMRH 5J1AB 3F7YA 1JGVL 2AJZA 2Y5TA 3BX7C 3KYOA 3DVNB 4LCCA 5HPMB 2R4RH 5F93C 1BD2D 3JUYA 3V9FA 1S9WB 3SY0A 3RWGA 2XZCH 3MV7E 5GSRB 3MOAL 2Z93B 5ICXA 1ZLVH 2VLRD 4RISL 5LXGH 4N90D 2DIBA 5CJXA 5C6WH 1NC4D 1DBJL 3O4LE 4X4XB 2C1PB 4WU5A 4Q6IA 2DKSA 4YLQT 4HULB 3REVB 4OLZL 3VXQB 1JPTL 2P47B 5DD3H 1WEJH 3IAGC 3VFMA 5IHZB 3BEWB 1Q9KB 5F9JA 3HCVB 1JN6A 3NCCB 3MRIB 4HKXA 4HX1B 1NLBL 2FHCA 5FHAH 5GJSH 3ARPA 5T3XL 4GXUN 3T1FA 3A6CH 1TJGL 4IJ3C 1VKXB 3DSFL 3P77B 1NQBA 3MRKB 2HLAA 2EXYC 4OCXH 1LD9B 5GGSA 3BRGC 3CDFA 5T1DL 3BJLA 3EDKA 4JFFA 5I8KH 3QDAA 5L2KE 3OAYH 4GBXA 1U0QA 1DFBH 1YYMH 4QRQA 3BGMB 1NC4A 4UB0L 3FQNB 1U8QB 4XT1C 3LRSB 1EJOL 1II4E 4XNZB 1H8SA 1Z9LA 4LSTH 1T89C 3QIBB 4MD0B 12E8H 1VGEH 4MA8L 1VFBB 1WFUA 2QEJA 2NZ9D 3UTSA 1SY6A 1I8IA 5JW3L 2MFNA 3HMXA 5AD0B 5J06A 1C8PA 4P2OD 1KJMB 5FV1L 4ELME 2YMXH 1G7IA 3GJEB 4NO5B 2ARJQ 1EXUB 1J1PH 3MNZB 1LK2B 2JB5H 1NBYA 1UJ3B 4LPCA 5TE6H 3WD5L 1L4IA 2XXMB 5KW9H 5L0QB 2R0KH 1MAML 2PNDA 1JMZA 4K7PH 4LU5H 2XA8L 3MV9A 4EDXA 3SCMD 2EDFA 2EDTA 2Z92B 4X4ZA 3VFGH 5DK2B 4JZJC 5K9KB 5JW5B 2P5WD 2X4PB 4PJFB 2A9ML 4HJJH 4YK4C 1TQCB 2E7HA 5GIRA 3ZT6A 4PLKD 4RGNC 4U1KB 3VXSE 2E27L 4LEOB 5JW4Q 1MJ8L 2FL5A 3CK0L 2D03H 4MB3A 2Z31D 4GFTB 5BZWA 3L5IA 1HHIA 4R3SB 1CF8H 2FX8H 4W70A 1KJMA 1K8DA 5JHDD 4GAYB 4I3RL 1NCUA 3B5TA 5CGYD 3GK8H 4J1UA 3TPKA 1YEJL 1UA6H 2BC4A 3EOTH 2I25N 3QUZA 3T8XB 1TVHB 2IAMB 4PRNA 4QHKI 1QRNB 3MRNB 1K4DA 4J3WA 4JKPL 2WLZA 1HINH 3E0GA 3ISWA 5SV4A 4M93C 1I9RL 3V4VL 4JY6B 4LVHC 1CT8B 2ICWB 5JIIA 2J8HA 4FQJL 3WLWC 4PLOB 1F2QA 2PTTA 1KELH 2CDFA 3VXRE 4FQHB 5INDB 3S4SB 1AI1L 3B8YA 5HYFA 4I0KA 4ZUSA 1GGBH 5I1JL 4OF5A 4H0GA 1IM9D 4KRPC 1TITA 2XN9E 3TO2B 2FLRT 2VXTL 3VXOB 1XH3A 1CFBA 4NCC1 3WIIH 1I8LC 4O2FA 4D9RE 4POYA 4X6CB 2QL1A 4ISVB 5B39G 2XRAL 2WAHA 4HG4J 4EN3B 2IAMD 1N6VA 2CXKA 3PQYB 1AD9A 2R8SL 4FN0A 4Y8DC 4LNVA 2VTFA 1VADA 4BFEA 1L7IH 4JDZB 3KXFB 4PV8B 2CGRL 1YUHB 1S7SA 3WNNA 3O45B 1FVEA 5DUBB 3QIUC 4KWUA 5E8PB 3HE7A 1JRHH 4HEPG 1BEYL 4PGCA 2AJSL 4X4YB 3QFDA 1X5JA 3QZWA 5T33L 3BKCH 4JM2D 5I2IB 5DTFA 2XTJE 1NEZG 5TQ2L 5BVJA 4MS8C 1OLZA 4MDIA 1KTRL 1YY9C 1WIPA 4LSRL 2Q86B 3V0WL 5CKGA 4PTUA 4LSVL 2AJUL 3NMEA 2X4TA 3IDNB 5HHNB 4Z8FH 3UBXG 2DWDA 4P5KA 2IF7A 1U3YA 2C3WA 3H7BB 1NGQH 1NGWA 4O4YH 5HVGB 4D9RD 1MFDH 2R69L 4Z95H 1CQKA 1M71A 1DBBH 3K2UL 3LEXA 4O02H 2ESVA 3EYVA 3V7MA 5I1LB 4ZFFB 1AGEA 5I1EH 1MRFL 4K8RL 4Y7MA 3PIQA 4OLEA 4BJLA 5CZVH 5GGVL 3S6CA 1YJDC 1F97A 4U31A 1QLFA 1AHWC 4X0KA 4ZO7A 2GKIA 5CEXA 4Y4FC 4X6FA 1JGEB 1SEBB 2DLFH 4OAWA 3ARYA 4ODHH 3X3GL 3IKCB 4HQQH 1RJLB 2GY7B 2I60H 3V0VB 3VFPB 5GJTL 2EYRB 2ICCA 4ZTPH 2DICA 4HS8L 1W0WB 1IT9L 3DRQA 5T1KD 3CFBB 2MOVA 4HH9B 1MLBB 4IDJL 1Q38A 5IB3B 3U7YH 3Q1SH 1S8DB 3LS4L 4YWGH 1C5CH 5CP7B 3O2WH 2YD6A 4ZSOA 4MA3B 4PJ5D 4U1LA 1JWUA 1UGNA 1MWAH 1KTDB 2FIKB 2BOCB 2CKBH 4FZ8L 4OZGB 4W81A 3KPOB 2ZOLB 3GMOA 4NN6C 5CZXC 4G3YH 3TWCH 1E4XI 1Q9LA 4FTVB 1F4XL 4U6XA 3S9DB 4QRUA 4E5XA 3C8KB 4KVCH 4NKMA 2ZCHH 1JNNH 1HHGA 4B50A 4TVSa 1HSAA 4PY7B 4O5LL 2VDNH 1I1RA 5JHLH 4PV9A 2VDOL 5EOCL 3ZDXE 3BAEH 1GGUA 4LCWE 5E6IB 4L8SC 1BHGA 4UTBL 1H3XA 1TDQA 4HFWA 5DI8A 4TNVF 4JPIB 3B2UD 3VWJD 1RZJL 5EU4A 5I19L 3U0PA 1KB9J 2IPTL 2QJDA 1U92B 4FQPA 4LASH 3DO7B 3WXVH 1QRNE 5ID1A 3U0WH 2X1PA 4Y2OA 3QEGH 1U58A 4APQC 4HW6A 4PGEB 4Y4KB 1S7WB 5CJ5A 1DDHA 3OKNA 3DVIA 1EIBA 4NZUH 2DYPD 5IJVA 4IHOA 4N0FB 4A6YA 4YXKH 1OW0A 3CDCA 4QRUB 5D2LB 5CUSH 1B4JL 2R0ZL 4HIEA 4OKVA 1U8KA 3WE6A 3HC3H 2R29H 3GDBA 4ZXBC 4XAWH 3SJVD 1KF9B 5I18H 2YA2A 2Q8AH 4EDXB 2J8OA 2CUIA 1QHOA 3IVKB 5CSGA 3IDXH 4HKBA 1JZ4A 2EDOA 5KN5A 3SGKA 3C08L 4HC1A 4ODUA 5DJ2B 3MRCA 5D7JB 3GEWB 1U8HA 4CN4A 1H9VA 3MLXL 2EH7H 5ELIA 3UTPD 1G9NH 4YEEA 3N1GC 4Z7OE 4HEME 3HC0B 2VUOA 4HUXA 4OFIA 4RMQA 3SDAA 4PRAB 1DL7L 5DWUL 3VMOA 4OB5H 5JORA 3C60A 1LWRA 3SKNB 2PXYA 1N8ZA 2F54B 5L8JB 4OZFG 3SEPA 5K33A 3U4BH 3QFJB 1T2JA 4A6YH 4AENA 1WZMA 5LWYL 2K9UA 3SDYH 3QG6A 3GSWB 1H8NA 3GSNL 5CSZA 4U6HB 3F12A 1VFAA 5IVZA 4MD5B 3GMMA 1N3NA 1FFPA 4LFHG 3ZKXC 3DLQR 4PG9A 4GKOA 1XR9B 5IBTL 4P9ML 3H0TB 4LAQH 4UIKL 4M8VA 3MRQB 4B53A 3K0WA 1F13A 1DEDA 5MEPB 3S34H 1KXQE 2HVJA 2IFFH 5FO8B 2BMKB 2NXYC 1WBZA 4O51A 1U95B 5DJ6B 2DTSA 2PXYB 3HNSL 4WU5B 4M6NL 4XCEB 3ZYOA 3MXVL 1YNTA 3FFDA 1CDCA 3O6MH 5HD8D 5B39B 5ETUA 2OI9B 4YHOH 4UU9B 4DN4H 4G8IB 5HHVH 4XPHL 3SGJC 4DVBA 5LGJB 3EOBA 3V95A 2OL3L 4D3CH 4FQ2H 2WK2A 5I9QB 5F8RC 4NN6B 3D5OF 1GIGL 3LVEA 1A22B 3CIQA 1YECH 3VFRB 4IOFC 1X5AA 4XXDA 1PKOA 2FD6L 2WINA 3C5SA 4XNXH 3MLWH 1ZVSA 5EIIA 5E4EC 2HLAB 1P7KA 1UEMA 4D0DB 3ULVD 1J5OL 3I50H 4OLYL 5HVHB 3WJLC 4X6BA 2ADIB 2MPAH 4LPUA 4KKBC 1EHXA 1LP9B 4F57H 2VL4A 1JPSL 1RZ8A 1ZLSH 1BFVL 5HYSB 2C7UB 5J3HD 4IOIB 4PTUB 4KK6D 4M7LH 3QIBC 4M4RA 4X8JA 2UZYB 3RPIA 4JR9L 1XF5B 3DX6A 3Q6FB 2Z31B 1J86A 3KHQA 5D7SH 4CRPA 2NYYD 4HV8A 5F1IB 2FX9L 3IDMA 1NBZB 2HJKA 1KIRB 5D5MA 1BBDH 2WWKT 3D2UD 1BF8A 4U1MA 2VL5A 4YGVB 4OD2B 5LVEA 5TQ0H 1QLEH 5DUPH 5IMMB 4P5TB 3TCXA 4QRPE 4HF5H 3B5HA 4GRLC 4G7YL 3K1KC 5DMIH 2N7AA 4RDQG 1HHHB 4TYUA 4PRBB 1EMTL 1DEEB 1MEXL 4LL9A 5GRXG 3JWOC 1U8OA 3PWPA 3CSYA 5E2TL 4IOIA 4JRYB 4F7PA 5HGHA 1F3RB 1SBSH 2CH8A 3MRHB 1F4WH 2XN9A 4U1KA 4AY0A 1G7HB 2NY5C 1KEMH 4XPTH 4Y5XA 4EXPX 2XWBA 2GFBB 5HI4D 3CMOH 3CZJA 1Y18A 1IRAY 5DRNA 4JZJA 3BMVA 4U6YA 3RI5K 4GMSH 4U1NA 2VYRE 2Y36H 4ZFOB 3WV0A 4Z7OF 2DTMH 4KVNH 5ADOH 1MH5B 3TNNB 1A6VL 1JN6B 2QV2A 4KY1H 2R4RL 3BQUA 2OBGA 3ROLB 1DQTA 1I7TB 1A21A 4JFHE 1CI5A 3IAPA 3VFOB 1UB6A 2X4QA 2VDLH 3HZYA 1GZQA 1VFBA 3J7HA 3VD4A 1O5DT 2ITCB 3H6JA 3X13A 4GKNB 1DBJH 3Q5TA 3MFFB 4UNUA 2DDQL 1ZXQA 5HHOB 1A9BB 3QUYA 4OLZH 4OQ1A 2X4SA 4NT6A 4R26L 5DLMH 3GJFK 2Y06L 5IFAH 1ADQA 3ARFB 4ZFOL 4HJGB 1VPOH 2YPLD 3LY6A 3F7VA 4OGAC 2MNUA 1H15B 2YEZB 4HSQA 1C08A 4XVSL 1KLUB 3QJFB 4Z5RA 5JMOC 5FHAL 2YZ1A 5GJSL 1U3HC 4BFIA 5B3NA 3T2QA 2H1PL 3B9KC 4P4KC 5F89A 4Y4HB 4G8GA 4NQCE 2RCSL 5FYKE 3WIFA 4P2QB 1BZQK 1XIWA 4NN7C 3C2SA 4OCXL 3OKNB 3MA9L 4P23B 2XPGA 5CP7A 1D5IH 3RKPA 4AMKL 4RA0C 1F4HA 3BPCA 5IBLD 5HDQL 3U7WL 4FXKA 1K5NA 1EUUA 2JCCE 2XTJB 1LO0H 4OM0L 5T5NG 1IGFH 4AK1A 2AQ2A 1QP1A 3OV6A 5IIEB 1FO0B 4CVXB 1VGEL 4MAYC 2EEBA 3W82A 3ZDZE 1CFVH 1OSPH 1KPVB 4AIZA 3KPPB 2BNRB 2C4FU 4PGZA 5T5FH 4JKLA 4OFPA 1RULH 3SO5A 4APQA 5E2WL 2HYMA 3QJFA 1F3JA 1F4YL 1ZT7A 1JGLH 3P4NB 1P9MC 3EUUA 4GBXB 5FECB 4PJFF 4MA1C 5KW9L 4NGHH 3LSOA 3T77A 3FQUB 5HDBF 1NBVH 2HLFD 1A1MB 2JJUA 2ZUTA 5I66A 2QR0B 1A2YB 5KANI 5BRZD 1A14H 4JZNA 4EQ3A 2XG4A 3NZHL 3QULA 4R4FL 3FL7A 3MNWA 2PW2B 5EWIH 4Q0XH 2BSED 4YHPB 1MCPH 2AEPL 1DBKL 2K7QA 1FLTX 2R0WL 4XCYA 2P7TA 1C16B 3AS1A 1BMGA 4ZDHA 5HSFA 3NA4A 1MVFA 3HNVH 4JFZH 1E4JA 1WZLA 3QPQD 1UQSA 4DGYL 4QT5A 1RJCA 3RP1A 1RU9L 3F65A 2QBWA 5D9SB 4UV4H 2FX8L 3UYOD 2WANA 3S3SA 3TN0D 2VDQL 2PN5A 2VDPL 3ZKND 3QJHB 2JTDA 2Z9TA 3X3FL 1MFAH 1LO5B 1RJYA 1X3DA 2C7UA 1D5MB 5CBEA 3UMTA 1V7NH 5AWNH 5IKCA 4NQCB 1QSEB 3B9KD 4QRTB 5IMKB 1FE8L 3FAWA 1CBVL 2ARJB 3MTRA 5HVWA 4J3OC 5KVDL 5T5NF 4MQXC 5C09A 1MJJA 3CGTA 4U7MA 2AXGA 4YAQA 3U9PL 2J6EA 3BUTA 1C5DB 1RIHL 2EIBA 2ICEB 1A3QA 3TO4C 4P23C 1KBGH 3BXNA 2B1HH 3TZVA 1XH3B 5FGCE 5J3HC 5DD1L 4PJ8B 5DR5L 3B9AA 5F9WC 4OGZA 1Q9WA 1T6VN 4YHNB 6FABL 3P4MA 2FJFA 3TO4A 3UTTA 4FFVD 4NC0B 3C2AL 4EI6A 2B7DT 2RIKA 4FFWC 2G5RA 4RA3A 3RIAK 1CLZL 5EU6A 5I8OL 1EX0A 5MEPA 1ROWA 2FATH 3RRQA 4PGCB 3FB7A 1KSRA 4N90E 4HIIB 2VXVH 4ZPVB 5H35B 5T33H 3LQZB 4JAMA 4FABH 4GBXD 1A6TB 3L3GB 5TQ2H 2H2PD 5HVFB 3QA3A 3QUYD 4OUUB 2APTA 3U6RA 1J18A 1FYTA 5IBUG 4U1SB 3QNZB 5E9DD 1MLCA 1RQ5A 1CGTA 3G5ZB 2NY2C 2Y1VA 2YHGA 1UB5A 1JHTA 5BV7H 2X4OA 4K3HA 2KQNA 2CIKB 4HAGA 4JRXB 1TETH 3OJ2C 4Y5YC 5EC2A 3PUCA 2HN7A 3CSYB 4M1GL 1JNHB 3JWDC 4R9HA 3BMWA 3O6LH 2F8OA 4ODUB 3MRDA 3UDWC 5GS0L 1MRFH 5H2BB 4JB9H 2FGWH 3B9DA 4FQXA 3OJDA 4JAMB 4U7SA 4I9WE 5JOEA 5DHVH 3MCG1 5HDBE 2X1QA 4XTRC 1E4KC 3L3IA 2E6JA 5EU5A 3U1SL 4Y88A 4ZAKC 3C6SB 4KTDH 3MV8E 5GRUH 2EXYD 2JJVA 4H88L 5GRJH 3QG6B 4R7NA 1D6VL 4HS8H 2BHZA 3FN9A 2PTUA 3WEXA 2XFXB 1AFVH 2RBLA 3DIFA 4WUKL 5IJVB 3JWOL 5MEQB 4MNQD 1LDPH 4IDJH 3C60C 4NKDB 1T6WA 3O4LB 4YWGL 1ZLWK 5KOMC 5EZOH 1BZ7B 3WD5H 2FHFA 3DX7B 1B90A 2V9RA 1A3RL 2X4PA 3MCKA 4LU5L 3MJ6A 3DETC 3GSRA 1CLCA 4Y1AA 2Y4SA 3WFBH 3KPQB 4XNQA 2ZUVA 4TUOA 5E08L 1E28A 3HI5L 5CD3B 3JTSA 5SWSE 3CLFL 4M8QA 3ARGC 3WIHH 2MCPL 1JGUH 2J6EH 2FB4L 3CJJA 2HJFA 1BIIB 4F7CB 1BAFL 4PJCE 4JFFB 1IC4H 1MFCH 1N0LA 3VD9A 3T2OA 3HI1B 3ZKSD 5JXEA 2P8MB 5IOPA 4NDMA 3Q0HA 4IS6A 3BO8B 4QYOB 4LGPB 1U8IA 1QSFD 3QNYA 1VACB 5MHSD 3VD3A 5FOBA 3BDYH 3N50A 5ISZE 1OTSC 1BX2B 4O2CA 2APWA 1X7QA 3H3PL 3PXJA 4MS8D 3MV8D 3S97C 4XP1L 2AEIT 3S4SG 4Y4KA 4PGEA 1P7QA 3EDEA 1C5BL 1CLOH 1YEFH 1Q9KA 5KOVC 1NUNB 3OXRB 5IK3B 3HRZA 1INDH 1OGTB 3CFIC 4L3CB 4WY7H 3OPZH 3PQYD 2P44B 4MWFB 1PVHA 3B2VH 5C0RL 3I6LE 3ARDC 3B83A 2ESVD 3L7EA 1D9KD 2Z8VC 1SJEB 2R2BA 4P9HH 3BW9B 4KRNA 2B4CH 3RU8L 3ZZ1A 1OTUC 1JFQL 2HTKC 3FFCB 4LGRB 3V6ZB 5DEFB 4ZAKD 5CGTA 1YJDL 4JQIL 1UVQA 4M9PA 1DLFH 1DDHB 4GRMA 3CC5A 3HPJA 1FG9C 2VO5A 2QQNL 3QAZB 3E3QE 4MZ2A 3O3DB 4UDUA 1Q9WB 3H8NA 5I16B 4JRYE 1IL1B 4YBLC 2HT3D 3QIBA 4MD0A 4GSDL 1OAZL 4QRPD 5F6HI 2KH2B 1HHJA 1FO0L 4LVNB 3ZTJG 1FL5B 3U83A 1GZPA 3OXRA 2P1YA 32C2B 1EFXA 3OAZK 3BEVA 4NZRL 5HGHB 2NY4B 3OB8A 2DM3A 4M00A 1KJ2B 4CMHC 4WNQB 3CLEL 2VISA 3ZDYF 4BA8A 3GMLB 1MRDH 2UWEE 5KVGH 3TVMB 1MCOH 2YD9A 1WV7T 3SCMB 1FAKT 1MI5A 1WLHA 1MHPL 3LN9A 4M7KL 2NMSA 2ZJSH 4NFCA 2AJUH 1I3GH 1KJ2L 2JF1A 1CL7L 1GGCH 4L8DA 2ZKHL 3DTXB 5ITFB 3ZKMC 3FN0L 4GKSA 4GG8A 4XPBL 1MWAA 3BKJH 3MLSH 1MREH 3V5DB 4N0CD 4ZQKA 5CWSB 1C1EL 3ULVE 1R3KB 5IGXL 1QSFA 4LLWB 1DSFH 3QXDB 3QIBD 3S88L 3FZUC 3PQYA 2BCKB 1EV2E 2PUQT 3GSVB 3MV9E 1T80A 1U6AH 4YFLF 5TH2A 3GNMH 4Q9RH 4EZMA 3KPRD 4KKNA 4GKNA 2DM4A 1IAIL 2D9QB 4LKCA 3LIZL 3U4AA 3MX0A 2AK1L 4BH8B 4L8SB 2Y25A 3NOIA 1KYOK 3ARBC 3NFNB 5DJ0B 1KLUA 3FB8A 3HRPA 4Z0BL 1GIGH 3VFSB 1UT9A 2WUBH 3LS5L 1A6WL 5IESH 2EH8L 4HH9A 3D9AL 5DJ8A 1LP9F