3IKCA

Structure of s67-27 in complex with kdo(2.8)-7-o-methyl-kdo
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
217
structure length
217
Chain Sequence
IVMTQSPSSLAVSAGEKVTMSCKSSQSLLNSRTRKNYLAWYQQKPGQSPKLLIYWASTRESGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSNNLRTFGGGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of CDR H3 in antibody recognition of a synthetic analog of a lipopolysaccharide antigen.
pubmed doi rcsb
molecule tags Immune system
molecule keywords Immunoglobulin light chain (IGG3)
total genus 48
structure length 217
sequence length 217
chains with identical sequence C
ec nomenclature
pdb deposition date 2009-08-05
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ikcA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 3ikcA01
5B4MC 2ATPB 4RISL 4IJ3B 2RCSL 1DL7H 1I9IL 4P2QD 4RWHA 3RWFB 1DDHB 1LDSA 3BW9B 1F8TL 4LCIH 2A38A 3QDJE 4HJGA 4OZIE 3QUXC 4PRDB 1XIWB 4B50A 4MLSA 4WFGD 5IVXE 5SWSE 4JE4B 1VCAA 4OLEA 1FC1A 3QDGD 1S7VA 5SWZE 5H35A 1U8QB 2FB4L 4Y5YC 3MACH 1ZEAH 4A6YH 1TZHA 1RZJH 5J6GA 1SMOA 5ACZB 2IPUG 4DOHB 1XGTA 1BQUA 1E6OL 4FP8L 4LVNC 2O26U 1QSEA 4FNLL 2WBKA 5E99H 2WLZA 5HHQA 1KCLA 3O3AB 4R97C 2ESVB 4XWGH 1Z5LB 5L9DH 4JM4L 5CBEB 3D5OF 2CRIA 3O6KH 2VXVH 1IKNC 2CLVA 2X4TB 3R8QA 3FQNB 1HIMH 4KAQL 1JGUH 1JGDB 3RAJH 4DCQB 1U95B 3P0YL 4PPTA 4Y4HC 1K2DB 1D6VH 4L4TB 5ILTL 2O93L 3FB7A 4FG6C 3LEYH 4DGVL 1NBYB 3QR2A 2DJSA 3L7FB 3MRCB 5D5MB 5E8NA 4PJDE 1WF5A 4NOFA 5A16A 1DBML 3UBXI 2K3TA 2FJFB 4IRJB 5DD6B 4U1SA 3EGSA 1YPZB 2C1PB 1KYOJ 3ETBF 3RL1B 5EO1B 4LHJB 4RISH 4DEPB 2M26A 4RMUA 1WBYB 2DI9A 3P9LA 1MJJB 4MD4A 3GKZA 2XYCA 2B1HH 3SE4A 3T0EC 1QEWA 4QOKB 4QY8A 3QWOB 5EU7E 4MX7B 4P2RD 4OFYA 4QHKI 4JQVC 5IVXF 5C0CE 2IGFH 3SKNA 4WUUB 1W0WB 1G7QB 2C3VA 4M7ZC 2FJHA 3SDXE 1A14H 5GRXG 4NKIH 2ITCA 4R7DB 4YEEA 1KIRA 2JIXD 1LEIB 4M5ZL 1CGSH 3S37H 3BP6B 3BESR 3G6DH 2M8XA 3RI5F 2IPKA 2O5XL 5CEZD 2J7LA 3SGKA 4ZUTB 1EXUB 5CCKH 3NCBB 4LOUC 2WUBL 4UNVA 5E2JA 5KSVA 2X7LB 4LLUB 3VXSA 5EOCJ 3JWOL 5HYJD 1IBGL 3MROA 3TO4A 1ADQL 5DVNA 3BPNB 4NN6B 5IIEA 4EN3A 2XQYK 1JPSL 3I2CL 1D5MA 3MV8E 4XNXH 1OSZB 3QT2A 5C08A 2QJDA 2Z8WC 2R29L 2GUOA 1X5FA 3F7PC 1AXSA 3NGBC 2G9HB 4C58B 3D85B 2DQFB 4M1GL 2ZUQC 4W4OA 2CMRL 2NX5B 5EUOB 3EKCA 1MHHB 3MUZ1 4WO4D 3HC3L 4HWNA 4GAJL 4JFEE 1JK8B 1Q72L 1Z5LA 4MXWH 4P0DA 5D7LB 5EIIB 3MUY1 4JZNA 1N3NA 1AGFB 1H3PL 3LSOA 1B0RB 2OJEB 2BVOA 4DZ8A 2RB8A 2NY7H 5J11B 4LCCA 5DI8B 4PRHE 4CAGA 2FSEA 1CXKA 5F7EL 4C57C 4S1RH 1CICA 4GSDH 3ECBB 3WUWA 2FJFA 4PJFE 1HZHH 1U3HD 3ARFB 3SQBA 2ARJA 3HAEA 1ORSB 2BXYA 4Z0XA 2AJXL 3M1BB 5C0EA 3HPLA 2HT4D 5KSAA 5GGSB 4WJ5B 4IDJL 1VDGA 4KY1L 1CT8A 5FA4B 3TN0B 5ID1A 1KN2H 1QEWB 3QNXB 4QY8B 3N1GC 3T0AA 3OKDB 1WGOA 5T3XE 4OCLC 1FQ9C 1FSKB 2VDKH 5HHVL 2R2EA 4JEGB 4F58L 1R5WB 4HWZA 1IMHC 4U33A 4MCZA 1Y18B 4OBSA 4N8VA 3O4LD 4XHQA 1MLBB 1WJ3A 3C60C 4GBXB 4DK6A 3L3GB 3WS6A 1JIBA 3DX6A 1RIUL 4JDZA 3K8MA 4GRWH 4O58H 4BFBD 4PJHE 2OQJA 5DMGD 4LLAA 1ZGLB 2YUWA 3QQ3B 3O6FA 4XVUC 1IGFL 1KF9B 5DJCA 1RVFH 4QXTA 4U7KA 1NMBH 2RBLA 5DC9B 2V9QA 4NRYB 4XMPL 3W0WB 4NO5B 3ULVC 5EBLB 5JIIA 4K9EL 5GRWA 4J3WA 3T08A 3LB6D 3G08B 3KYMA 3SE9H 3L3JA 1QACA 1E0OB 1SEBA 1WITA 4QKXB 4XXCC 1B2WH 4OB5L 5E94B 3KJ4C 2FYYA 3HZKA 4L5FH 4L8DA 4AL8H 3K2MC 1D9KB 4G6KL 1C1EH 2WK2A 1LK3L 2PW1B 1IC5L 5D70H 3C2SA 3BZ4B 1JK8A 4FFWD 4M6AA 3ARPA 1T1ZA 3GNML 3LEXA 1KENL 3IXTA 5TDPA 1Q9LB 5E6IA 4JPVH 4Y4KB 1A6ZB 2AI0L 3CFCL 4HWBA 3VDAA 5FHBL 3NCYS 3U7YL 3IDJA 3K4DA 4NM4L 1OP5K 5J13B 5IHLB 3KDMB 1UFUA 1I1FA 4WFEE 2A9ML 1KEGH 2ZOLA 5GRVK 3VFPA 3UC0H 5ICYA 2BVPB 3F5WA 3V5HB 1RURH 3GMLA 3E6HB 1WICA 1MELA 1QSFB 4FQ1L 4KDWA 4MVBD 5TE4H 1T80A 1A6PA 2HH0L 2NY2D 2D9QB 4AH2B 1TVHB 4I0PC 3RL2A 3SGJC 1LO2L 2DIBA 4Z78B 3GUTB 1CFNB 3EYQD 4U1HB 1AJ7L 1IAIH 5ITBH 4M7KH 3EDJA 1HDMA 2NY6C 3CU7A 1P6FA 3EZ8A 3NTCL 1C5CH 4DUVA 1QRKA 4H20H 5DJZA 5GS0L 5HHOD 1CQKA 1HINL 1ZTXH 4Q6IC 4HGMA 3BIKA 5FK9A 3BZFA 4I0PA 1BBDL 4MCZB 5IB3B 1SY6L 3T3PF 1OL0A 1JGVH 1UXSA 2D0FA 3T0WA 4QRQB 3VWJB 5IVXB 3OMZA 5FOBB 1S9YA 4ERSL 5I2IB 3VXMA 4LBEA 1NMAH 5D7LE 3L5WB 3LEVL 3DX6B 1F3DH 5F7FA 3O2DA 1OHQA 2W65A 5LJYH 2VWEE 4OZGF 5D7KD 1BQSA 1KOAA 1UH4A 3NOIA 2CK2A 1BZ7A 3FMGL 2AEQL 5E8DH 4MJIB 2VLLB 3ZKND 2AEQH 4KMTH 3ESVF 4G43A 3W0WA 2NY6B 4DGYL 4OT1H 5DXWA 5LVEA 5C0IB 3F7VB 4YPGA 4HH9B 4PJXE 5D7IE 1JCKA 3LMJH 3AB0B 1AC6A 4Z7UF 2UWEF 4ZFOA 5DTFB 2OZ4H 2PO6A 5JPMB 4HUWB 4G8FA 1D9KA 3VWKB 3CZFB 3MMEA 3WIHH 1C16B 5F7KC 5DMIH 2PW1A 4ZS7L 5IT2H 4DOHE 5T33H 1S7TA 1WZLA 1C5CL 4P9HC 1AQKL 3FT4A 1YUHA 4U0RB 5IKCA 4HUUA 1ODAA 5D7KE 2F58L 4P9MH 1A4JA 3O3UN 4HIXL 3I75A 3C08L 3GSRA 4IMLA 2VQUA 5JA9A 1RZ8A 7FABL 1YYML 1WISA 3V0WH 5EU6E 3PWVB 3RWHB 1YMME 1W72L 3ARVA 5KSBB 5EFIB 1I75A 3C9NB 2FBJH 1J05B 4WVRA 3KPOA 5AYUH 2HTLC 4PJEE 4UT9L 1JZ3A 1YMHA 4M93C 3N0PB 1IGYB 5GSVA 3W9EB 5HHOE 4TVPE 3T3MF 3GNMH 5DJZB 4ELMA 4KDVA 3TBVA 4JCMA 4HBQA 5K9QI 3BRGC 2BHUA 3D25B 2R4SL 2MNUA 1L7TH 1LK3H 2HT2D 4AG4H 2E5EA 3BIKB 4NO2B 1SYSB 3S34L 1BQHA 2HN7B 3P0GB 3RWJB 1LDPL 3QHZL 4GW5A 1XGQA 4GO6B 4EQ3A 3VXMB 2JK5A 4H25B 4ORGB 1ZHBA 2ESVE 3I85A 1Q0YL 1W8NA 3FFDA 4HWUA 4LCCC 3GJFA 4WW1B 2AJSL 3KPMA 1LEGA 4KKLC 5D7IB 1LEKA 3EO0A 4JFPB 1K8IA 2R2HA 5EBWB 1HXMB 1IT9L 1QTYT 1UKSA 4IRSD 3LS4L 5FM5M 1AI1H 3PWJA 4D9RE 3JWDL 1U93B 3LZFH 3ZDYE 3TNNA 1H8NA 3H9SE 3QJFA 1H5BC 4LDEB 1R3JB 3QDJB 1QYGH 3QWQB 4PD4J 4JFDA 2PO6B 1JN6A 4M1DH 3HR6A 1XF3B 5IF0A 1NDGB 5HI5D 4YGVA 1YEEL 1PBYA 3F12B 3H7BB 4Y8DC 2E7BA 4N0UB 5IROC 5M95B 1EJOL 5K93A 4PIRF 5DSCB 3L95A 4XBGB 4BQ8A 1M05A 3RNKA 5JOFB 4ENED 2BNUB 2PF6A 3ROLB 1PG7L 2HVJB 4CVXB 5J06A 5C0GB 5KVMC 1IAKB 3IU3B 4IRSC 2R4RH 1EUTA 2C4FU 5MEQA 2H32A 3EFFB 1OT2A 4OSUL 3W82A 3DNKA 4I18A 2UWEB 2EH7L 5D7JA 1FG9C 2P5EE 3TIEA 1UJ3B 2EZ0D 2WWMC 4R4FL 3VXUB 4WENB 5JW5A 2OTUA 2ICES 4U0QB 2O61A 2WQRA 4K7PX 3GMRA 3QUYD 3ZL4L 1FSKC 4M03A 4X99A 3W39B 1NFDB 1IZKA 3QUMA 5DJ6B 4JQVA 4C59B 1ES0B 2XXMB 4PJBA 1CFVL 3I9GH 4Y2DC 1NJ9B 4LGRB 2CKBH 3P11H 4ZFGL 4GAJH 1C5BL 3P9MA 1FZOB 5F1KC 3HNTL 4PBWD 2OL3A 3U0WL 2G75A 4U1JA 4N0CD 1GL4B 5CJXC 3MA9H 2DMBA 3N06B 3QUZC 4HKBB 2JB5L 2ZUVA 2VUOA 2ED7A 4G8GE 4XNXL 5TFSL 3QCVH 3CDGA 2DLHA 2HTLD 3FFDB 4JRXB 4HHAA 3V6OC 3C6LD 3VGDA 2JB5H 4LSUL 2P45B 3EO0B 4MA8L 5FV1L 3OB0K 5IM7B 4X4YB 1U8LA 4ODXA 3FZUC 1CGVA 2Q3AA 3H7LA 4IIQA 1NKRA 3T0VA 4LKCA 4MGXA 3FO2A 4OZIA 1U93A 2IPTH 1FYHB 5L2KD 3RWIA 5E9DB 5BV7L 4RIRB 3INUL 3VFGH 3P40A 3AC0A 2W92A 4DVBB 4F37K 4N5ED 1S9VA 1JRHH 1W2KT 2VYRE 1AR1D 2MKWA 1ITBB 3MRBA 1XF3A 4JDVA 5ICXB 4GRLD 4N9GB 1J0YA 32C2A 4I4WB 3WUWG 5EPMB 5FGCE 4Z7UB 1WAAE 3REVA 3PDOB 4XAWL 4JLRB 3CDFA 1NLDH 1YEIL 3DIFB 4L29A 3BJLA 2ZOKA 3VE0A 1SHMA 3CFJB 1QR1B 1T89C 2B1AH 1PZUB 4ELKB 1ZLWK 3LKQA 1NAMH 3P77B 3RKDD 5D4QA 3V4VL 1A7QL 4YHIB 1IRAY 3NAAH 1JTPA 2AEIT 3NACH 5DHVB 4L1HA 2FATH 4B7IA 2OZ4L 1GOHA 1GGBH 4XMKH 3HRZA 2VR5A 2YPKA 2O5ZL 4WWKB 3WCYA 3WNMA 2D31B 1MCQA 3T2QA 5ILTH 1XF2B 1XIWC 5T3ZD 5HI3D 3QUMB 1HIML 3GMMA 4KAQH 2FO4B 4JO3L 4PJXB 3LQZA 3IJYA 2NW2B 5F44A 1G6VK 4LARL 3G6JA 4LCYA 4MAYD 4YR6A 3MREB 4DKFL 4Q9RL 1UJTA 3SGKC 4HPYH 2IBBA 3GHBH 5EIVA 5CGYC 3LKOB 3NABL 4KHTH 4CADB 3IU4H 4OLUL 5JHDA 1INEL 5JDSA 4ODWB 4NC1E 2W38A 4IRJC 4NQCA 3GBML 3CXHJ 4HC1A 4ONOA 4K07A 2IAMC 3MV8B 3O4LA 1CXIA 4HQQH 5D7SH 2YWYA 3EYFB 3DVGB 2F9BT 3M45A 3U9UA 1RHHB 1S7UA 1EVTC 2IANA 1YNTB 1ZS8A 3O2VL 4RWYL 2F8VA 2Y6SC 3CK0L 4LPYA 5DJYA 1C8PA 3G5YA 5DVKA 1T5XA 5EU4A 3U2SB 2HH0H 3CSYB 4OGYH 4GRLC 3N85H 5D1ZB 4Z76B 4DUWA 1DFBH 1PW3A 4E41E 4OI8A 4YBQD 3AAZA 5BJTB 1HXYB 4XGZA 2ATPA 1UC6A 2R2BB 4XNMB 3QDGE 5SWZD 3UTOA 5SWSD 3TH4T 4P5TB 5IEKA 4QXWA 3RWFA 4WFGE 3BQUB 1NGWB 4B41A 4G9DB 5ISZA 3QPXH 4P23A 4WHYG 1YECH 5CMAA 5CJQL 4XPTH 2HFFB 3L3OA 3QUYA 1TZGH 1LK2B 2X9WA 3V6ZB 2YN5A 1FBIH 4NWUL 1PEZA 1C1EL 1J1XH 1S7VB 5H35B 4ONFH 1UA6L 1KULA 1U8QA 1KN4H 1S5IL 4MA3A 4PJIA 1F02I 3BO8B 5HI4C 4TSCH 3L3IB 2ZUSA 4LSRH 1YPZE 1MI5A 1BD2D 1GAFH 5F9AC 3SE9L 1TETL 1NBVL 1RJLB 2E9WA 1KNOB 4JB9L 4NHUA 1BX2A 2D31A 3GBMH 2VLMD 2FHFA 4XMPH 4P2OD 1RVFL 5JW3H 3Q48A 1IGFH 3VD9A 4G3YH 3JUYA 4GLRH 3VI4E 2XKNB 1JMXA 3QRFM 4HUVA 3LQZB 4KQ3L 2GQHA 3QXVA 5EUKB 3S4SA 1MAML 3OXRA 3QUYC 4IIQC 3X11A 3RZWA 3ULUD 4YZFE 2XV6B 5GSRA 3L7FA 1LP9A 3BPOC 3MRCA 5D5MA 1RZKL 4KMTL 3N50A 4IBLT 2EIBA 2DDQL 2VKWA 1P53A 2XXCB 3ARUA 3PG2A 4FG6D 5I1GL 4O2CB 2XZQH 4NYLB 4E0RB 4NPYA 1HSAA 5F97E 4E5XA 1EBAA 3O3EA 4PJFF 4UU9B 3HZMA 3QIWD 2HJLA 5I8CB 2GJZB 3P9LB 4MD4B 5AWNH 2W9EL 1U92A 3LKNA 1NKOA 3SQOH 1RZFH 4H1LH 4EXPX 5T3ZH 1YNTA 4NQXA 1TQBB 1W0WA 4M61B 2C3VB 5I1LA 1IFHH 3IKKA 5TF1L 3RWDB 5DVOA 4YC2B 1FJ1B 1PZ5B 1ND0A 1F3JA 4ZG1A 1UJ3C 1SBSH 1U3YA 4WHTB 4P57B 5IEHA 2XKSA 3RKDC 3AAZB 4D94A 2DF3A 1IAIL 5I8OL 4RCAA 5E9DE 3BKJH 5DFVC 1MCCA 5HHME 4Z7OF 1N0XH 4PY8J 1QPPA 3TCXA 4FQ1H 3T0EE 4XPAH 5ISZB 4GS7C 1R24B 1EHXA 5IB4A 1JPTL 3MCLL 4YK4B 3TH2T 1X9QA 2KQMA 5FYKH 3C2AL 2EIDA 3M8OL 1NAKH 5FKPA 1LE9A 4NUGL 2F54B 5F3BA 5EC2B 4HXAH 3T4YB 1KJ2H 3A67H 4S1DC 3LN5B 5E6ZA 4IRZH 4NCDA 5INCA 5SWQA 2CUHA 3D85A 4AQ1B 3QQNA 1WBXA 4LRNL 3RIFF 1I1RA 5ADOH 4KWUA 1IC5H 4ONGH 3PQYD 3I02B 1BX2B 1ADQH 5MEOA 4AL8L 2X1XR 2PCPB 1J86A 2HA1A 4CJ0A 3K4AA 2YD3A 2NNAB 2XKNA 3PF2A 2AGJH 1E27A 2DYPD 2EYSA 3CVHL 5BXFB 3HNTH 4BUHA 1IGMH 3GGWA 1ACYL 4UBDC 2O5XH 5F1IA 4TSBL 4OFPA 1INQB 3CVIL 4PRPB 3HN3A 1VFAA 3S37L 3UTQB 3NFNA 4DTGH 3HZYB 1CICB 2NZ9D 4FA8A 1LHZA 3VGEA 2W1NA 5CZVH 5GHWH 4HJ0D 4K9EC 1LD9A 3M1BA 2CRZA 4KVCL 5C09A 3LIZH 1J7VR 1I4FB 3X3GL 1ZVSB 1RIUH 3S3SA 3O3DA 1ZT7A 2JF1A 3JV6A 4DZBA 3MLYH 1AD0A 1U41A 2X1WL 4G8GB 3QNXA 1MUJB 3SDCA 5I16B 3FQWA 1T7VA 2B1HL 2QTEA 3ULUE 3VGFA 3S7GA 1ZA6B 5LGHH 2YZ1A 3MLTB 4PJEB 4OJFL 1MCOH 2X09A 3B2VL 4HDIA 4NQEA 3OKLB 2GFBA 4BSVB 4YE4L 3DSFH 3MBXL 1CTOA 1HNFA 2MCPL 4RMVA 4AY0A 1X6NA 1KN2L 2KBGA 3DX7A 3AREC 5KAQG 4FQHA 1I7TB 3SE3C 5DZNA 3PABB 4WTXA 1N64L 1JWUA 1DLHA 4U6XA 2H1PH 4YJZL 3NZHL 1CLYL 1AKJB 1CU4L 5E03A 1F42A 5HHPB 4AIXA 1UB6B 4DW2H 3NFPA 5ALBH 4Z5RB 4ZFOL 1WIPA 4XCFL 4P5TC 5HGAB 1U6AH 3SDXF 4Y0GA 4U0RC 1AQDB 4PGCB 4YDLC 4NO5A 1D5ZB 1T22B 2VXVL 2VLJE 4YX2L 1B4RA 3BKYL 3GSQA 1M7DB 4APQA 1GYAA 4HIEA 3KYMB 4XTRD 7CGTA 3WN5B 5DJXB 1NCNA 1NL0H 1JNJA 1CDCA 3D48R 1IKFH 3VDBA 1VA9A 3O8XB 2NTFA 3UTSD 3QAZB 5JR1L 5MP6L 1RZIB 1NEZA 3RZCA 2VLJB 4NN7C 1CL7H 3I02A 1VFBA 2LABA 2XPGB 5L2KA 2PCPA 1YDPB 4KH2A 1DN2A 2F53B 4IRSA 5LQBL 4PBXA 2E7MA 1QRND 1QUNA 2NNAA 3L9RA 3O45B 1IAIM 3X3FL 4X5XB 1A6VL 4HKXB 1UCBL 1I9IH 3JWOC 1UKTA 2DQGL 3IDJB 1KC5H 1JPSH 3I2CH 5DJDB 5F89A 3MV11 4OD1L 2AAVA 5FYKU 1T7WA 5FM5O 5EWIH 5FYKD 2WBJD 4K94L 4HAGA 1DSFL 1ZSDA 2UZIL 4TRPH 5EOTA 3FFCB 3V5HA 3CIQA 4WY7H 5KOVC 3SOBL 1YEDB 1FDLL 1TVHA 4QXGH 3RVWD 4KRPB 5EA0L 4NKMA 3WFEL 2R23B 2BY0A 3BHBA 4WWKC 3T04D 5CUSH 5JO5B 2PKDA 4M5ZH 7FABH 2Q86A 3EDKA 3FQWB 1YJDL 3C6LA 4M02A 5IBUB 4P4KA 4MNQA 1FVEB 1K4CB 2EIZB 4EI5D 1WIOA 4PB9L 1JMZA 4PGDA 1CS6A 5E4EB 3MCKB 1JGEA 3M17B 4H1LA 3RGVB 3SCMD 3VWJA 5IVXA 5T33L 4LSTL 3KPSA 5IT2L 1L0XA 3LH2H 1AHWB 3LKPA 3DHMA 3MLSL 5INDB 5CEZH 2HG5B 3QISA 1X5GA 5TQ2L 1S7XA 1BIIB 4OV6F 4N1HB 4OAWA 2EH8H 4P9HH 1J8KA 1I8IA 4BK4A 4JDTH 5HGDB 1XGUB 2KKQA 3ALXA 4Q9BA 5KSUA 3ZO0A 1EHNA 1KCUL 3B83A 4XP4H 5LQBH 3UTZA 4GG6E 3MODH 4WI7A 4CU8A 4HH9A 2B8OT 4APQB 4S2SB 2IPUK 2YPLE 3OPZL 1S7WB 3AROA 4BH8B 5E24E 4WFHD 4UDUA 2AK4D 5JXAL 2CLRA 3DX8A 3WIHA 1ERNA 1XR9A 4L3ED 4MNGE 2NR6D 4G8FB 4N0FB 3U79A 4ETYA 3O2DH 1QBAA 5D72H 4XWGL 4LK4A 5FO9A 4M9PA 3WKNA 1U3JA 4YX2H 3WEXB 2GYSA 1LO0H 5C09D 1LE5A 4QRSB 4Z95L 2I27N 4RBPK 1RZJL 3I84A 1U6AL 4XI5D 5DO2D 4O51A 5GZNC 5HSFA 3O45A 1F4AA 3PNWB 4PRNA 2EYTA 1OW0A 1WBZA 1XCQB 5EO1A 3O2WL 3EYVA 3GSVB 2YK1H 1YY9C 5H94B 3QNZB 4FFZL 5C6TH 3D3VA 3HCVB 4NZDA 1A3LL 2EC9U 5ITBL 5F6IC 5ESVA 4G7VL 5EFIA 4P48A 4MX7A 4P46B 2G5BB 5C08D 3QG7L 4WUUA 2OP4L 1MCOL 4JPWL 4YAQB 3BDBA 4Y4FB 4LU5H 2AQ3A 3MYJA 2Q7YB 3O6LL 5B3NA 2A9MH 2Q86B 4MQ7A 4Y5VC 3EDDA 1BECA 5DUBB 1WCBA 2Q6WA 5ICZA 2NY2C 4G6MH 4PG9B 4X8XA 5JTWA 1QP1A 3U7YH 1VEMA 5FA3A 3O9WA 4L9LA 4UDTA 1AP2A 1J8HD 4PD4K 3RPKA 3OKEB 4JG0L 2VH5L 1NCBH 3GJFH 4U6VL 2W59A 2X4OA 4ZUWA 4YBHA 5C2UB 2NXYB 3GSNH 3VD5A 5EZOL 4H25A 5JIKA 2CRYA 1MEXH 3A6BH 2V5RA 3KPMB 3DUHA 2JB6A 3IDNA 4F9LC 4BA8A 4JFPA 3BWAA 2VISA 3ZDZE 1IGIL 1QLRA 1D5XB 4NCC2 3B8YA 4AMKH 1KEMH 3UTZB 3F6LA 4OCSL 5I75C 1RZKC 2F5BH 3QJFB 1CL7I 1EFXA 3MRGA 4JHAH 2HKFH 3TO2A 4JVPA 4WV1C 4GAFB 3C6LC 3LPFA 1AGFA 5TPWL 4NFCA 3NGBB 1AGBB 4O2FB 1QD0A 5D2LA 3C6SA 5FIEA 3KJ6H 4I5BA 3RVTC 4M7JH 3BP5B 4RMSA 4MB3A 4K71B 1OP3H 1N4XH 4LCCB 4D0DA 1I8MA 3B9KB 3D9AH 2V5MA 3GRWA 4U6YB 4A2MA 5I0ZA 3RTQC 3KGRA 4OQTA 2WMPA 3O9WD 1AO7D 3AXLA 5F70A 2NY0D 1GC1C 4YHPA 3QI9B 1N7MH 3EJZC 1FAIL 4KKAD 1GVIA 1XCQA 4RAVB 5B8CA 2WIIA 1IAKA 3IU3A 3V7AE 3NPSB 1G6RL 3RDTB 1QHOA 3ZHKA 4PJFB 4MNQD 5C6TL 4R9HA 3QEHA 4HUKB 3TZVD 1W72A 1S7RA 4Y1AB 4YDKH 4NSKA 3THMH 5FF6A 4YAQA 1REIA 2H41A 3HZVB 1HZHL 2EIEA 1P9MA 4NP4L 3UTPE 4JKLA 3SQOL 5EZIL 3VI3F 1JZ6A 4PJBB 1FE8L 5B22A 3K8LA 2IH3A 4YXLL 5JPNB 3V0AC 2VAJA 3E2HB 5DVMA 1U3HC 5DEFA 3LQMA 1INDH 5DO2C 4WI5A 4DEPC 4JY6B 2XWJB 2XZAL 4TNWK 5KVFL 1MI5D 1ZGLA 2I26N 4M5YH 4NKQB 4NWTH 1CBVL 1ULVA 5BZDA 3GMNB 3O6FB 5D5ME 4K7PH 3BVNB 4V1DE 1ZANH 1JPGA 2Z4QA 5C07E 3WS6C 3CDGB 5DQDL 3HC3H 5GGRA 2MSPA 1NCWH 4QHKJ 3T0ED 4JRXA 1QNZL 2J4WH 3L3HB 4HUXA 2NCMA 4O00A 3SHSA 5EU6D 2B2XH 1K6QL 4HF5L 3UROR 4Y4HB 4WUKH 2EH8L 2EICA 3C5ZA 1K4DA 1RQ5A 4JFQB 5TQ2H 3UTSA 1JRHI 2V7NA 4IS6B 3KPSE 2D7TL 1BWWA 2NQCA 4D2NA 2CSPA 1T03H 4N0UE 1FCGA 1LO3H 5D1XA 1IKNA 4PB9H 1JE6A 4N5EC 2D0HA 4Z7WE 4D0CB 3AS3A 1UACH 3VGBA 4Y4KA 3MNVB 5CCKL 4OD3H 4JPKL 4FABL 3QZWB 3KPSD 5HVHC 3BUYB 4OGAC 3PUCA 1HHIA 4ENEC 2YZ8A 8CGTA 4RAUB 4BQ9A 3SDXB 1TZGL 3G6DL 4D0DB 4MB5A 4JLRA 4WI2A 1G0XA 4Z7QF 1PSKH 5DK3A 5J12C 4QEGA 3VFPB 4J7RA 1CFBA 3VWJC 1FGNL 1OAXL 1X3DA 3F5WB 1QR1A 1OGAA 1CD1B 5AYQA 1D5BA 4WUUD 5K9JL 1MCEA 2QQNH 1CFTA 4DUXA 1NANH 1TZIB 3B43A 1NGXB 1T5WA 2NR6C 3S35X 3GUTA 2QHRH 1P5UA 4KROC 5GISH 5ALCL 3OKYA 2ZPKH 2AEPH 1HH9A 3HRZB 5FYJL 4K3EL 1R5VA 4JFDE 2PW2A 4XP5L 3EO9L 5IJVA 1GPOL 2Y7QB 1S7QB 3QEHB 2E7CA 3MRFB 3MUGB 4ZYKA 3S96A 3F7YB 1E4XH 2AV1A 2NY5H 4P3DA 1TJGL 4I0PB 1SJXA 3IJHB 2CKNA 3PL6C 5JPNA 2PXYB 5MP6H 3HUJA 5IHUL 4PUBH 5J13C 4OCXH 1TPXB 5TE6L 1ORQA 1BJ1J 4WUUE 4JANB 1MJUL 1ZWIB 1JNLH 3AUVA 3CFEB 5A2JH 4X6DA 1U8OA 1FVDB 2F15A 2NY4C 2WV3A 3G5VB 4DKFH 4E42A 3MV8A 4F7TA 4XCYA 3VXRD 3TA3B 3H9YA 1P4IL 5CIPH 3P0VH 2Z31B 3QUZD 1M71B 5CILH 1DEEB 1DUZA 3K0WA 4E9LA 4FQJH 4ALAL 1FPTL 2YPVL 4X6CA 1K4DB 4JVWA 4ZPVB 1RIHL 5F6HI 3U6RA 4UT6H 5FO8A 3FB5A 1EA9C 4KK5D 1MQKL 5DEGA 4S0TD 3FTGB 3OKOB 4K3GA 4P49A 1KFAL 5JIHA 3TBTA 4TTGA 1JWMA 2NPLX 4F7CA 5C0AB 1DBKL 4XNMA 8FABA 4M00A 4S1DD 4TUKL 4OM1H 4I9WD 5EBMA 4MNGA 2E3VA 3BQUA 3OKMA 2FL5B 3TZVA 5CZKA 4YPJA 2D03H 2BJMH 3QNYB 2V2WB 1I1AD 4GBXC 2W60B 1NCCL 1KXVC 3PWVA 1B6UA 4PV8B 2BHYA 3C9NA 1FVCA 4ZTPH 1NUDA 2GY7B 3K1DA 4YC2C 4HBCL 3LIZL 3X3GH 4AT6B 5CINH 2VDLH 2HYMA 5E8OA 1FC2D 3BO8A 5KTEL 2ARWA 4KJPD 1QA9B 5F3HA 1PX3A 3OAYH 3QHFL 5C0FA 1DBJH 2GEEA 3UZQA 4AENB 1S7QA 4Z18A 4GBXD 1I3RA 1G9MH 4EUPA 3OAZK 4P3DB 4GAYA 4QRRE 3IFPB 4QHLB 4UT7H 3A0OA 4DAGH 1CR9L 3PDDA 2O5YL 3V0VB 2HRPL 1SQ2N 4K8RL 3IJHA 4LSUH 4NNXB 3QEQA 4ZFZA 5I8KL 1C12A 4QRPD 1I7UB 5JW4N 4TUOA 2QKIB 2DM3A 4TYUA 2GSIA 4XPHH 5F7UA 2ICWB 5GSRB 5I8KH 2AJYL 1BFVH 1QVOA 1LEGB 3QIWC 4D9LH 4JM2A 3RVUC 1EHLH 4JANA 3WFCH 3QEQE 3QRGH 4RA3A 4RGMB 1HILB 4XB8A 1HXMA 3LRHA 3VFMA 2V7HB 4PGEB 5HVFB 4MA7L 5FCUH 1HHJA 3HZMB 4KKLD 5D1QB 3PWJB 4PRIA 1HQ4B 3TNNB 3TT1L 1YEFH 4YHKL 3MRDA 4KK9D 4PRHD 4CVZB 3WHXB 2JCCB 3WFDH 3P4OA 1DEEA 2VZVA 5FB8B 3MNZB 4L3CB 1VGEH 3SE8L 3FN0H 3KPRE 2Y06H 4HBCH 4GRLA 4HJ0C 1AGDB 4YGVB 4ZTOH 4JO4H 5L2KE 4R4FH 4AM0B 4LDOB 5GGTL 1WWAX 2NY0C 3R1GH 4HIHB 1PY4A 3CVHB 3FO0H 1NGPH 2H26B 3SCMC 3X13B 3ME0A 1JJUA 2HKHL 3SO3B 2AABH 4UBDD 2DQJH 4FZEL 2C3XA 5LAXA 4JREB 1OF2B 4U2ZA 4GRWE 4JAMA 5DD0H 2XOTA 2Z8RA 4TUJB 4ZXBA 3EFFA 1OCWH 4F33A 3MBEB 2UWEA 1A6TA 1F11B 1IC4L 5D1QC 3LHPH 4PJ9A 4WGVB 1C5DA 4M6NL 3AM8A 3LRSA 5FKPB 3LKRA 4M7LT 5C3TA 1MIEH 4RGMC 3NBNA 3GMRB 4PJ5E 1G7PB 4N9OB 2OZ4A 1LVEA 5A3ID 3DVIA 3V8OA 4YBQC 3WXWL 3DI2B 1MVUB 2ARJQ 2VL5B 3LZFL 3CFKB 2E7HA 1XIWA 3NVQA 1YN7A 1QBLL 1XGPB 3Q6FB 1FZOA 4Z7VB 1HEZB 3MV7E 5IP4A 3BP4B 2BY1A 4GAYB 4QWWC 3M07A 1IT9H 1ZGLP 3MV9A 2B39A 4UUJB 3P73A 1ZXQA 2CXKA 1A7OL 1EEYB 1N59A 4KZDH 4WW2C 1I1AC 1VFAB 3UTQA 1I7ZA 1OAKH 1MHPL 4JM2C 2D7NA 2EYRA 3D0LA 1IILE 3CUPA 5B21A 2EC9T 1AXTH 3DLQR 3MLXL 2LVEA 4C83A 3GBNL 3A6OA 1K2DA 3VWKD 1J1XL 1X7QB 1VPOL 5DMJB 4ZD3H 3FB7B 1HQ4A 4MJ6A 3T8XA 3HHRB 5CZXD 5LKNA 1MUJA 3SDCB 4XP5H 4FFYH 3MV7D 2MJWA 1OQOA 3NZ8B 1Q0XL 2A1WL 3DJ9A 4KK8C 4LNRA 4X9HA 3S36H 3ZKNC 3MLTA 4PJEA 4WEMB 4BH7A 3EGSB 1DN0B 3PWLB 4GKZA 1Z3GL 3T2NL 3J8F7 5GRJH 2XG5A 3Q6GH 2QQNL 3ARDB 1UH3A 4I4WA 4LVHB 3S36L 3VFWA 1CD0A 2VLRE 5IGXH 1Q0XH 4B0MM 2LFGA 3MX0A 5CIPA 3ARED 4OGAD 5FV2A 3PABA 1OTTC 3VE0B 4DN3H 4LLMB 5I1IL 5CHNA 4XXDB 4UAOC 2GITB 3QEUA 5H2BB 4M43H 3KPNA 1XF5B 4ZDHA 3BH9A 4QYOA 2BNRD 4QNPE 1O7SA 2PTUA 4S11A 3TZVC 2X9YA 2A6DB 1D5ZA 2XY2A 1A6TB 1F11A 3ARGA 1T03L 1F6FB 3U30C 1FZMA 3LKRB 3WIHL 5C0DA 4BYHA 4TNVF 4R7NB 5EZLB 2GK2A 1T7YA 2CGRH 4R90H 5CSGA 4B53A 5BRZB 1G6RB 4OLZL 4HCRL 2B2XL 4L4TA 2NW3A 1IC1A 4X5WB 3VXMD 3UO1L 3PL6B 3DV4B 1KELL 1TJHH 1HQRA 1KLUB 2QR0A 4KFZC 1A6UL 2XPGA 3MXVL 1YEHL 1KPVB 1YNLH 5A16B 4UQ3A 3WJLC 1DQML 4EI5C 1W8OA 1RZGA 4P2QB 5E2TL 2G9HA 4M5YL 1YMMD 4NWTL 1IM3A 3MFFB 1MJ8L 3VXOA 3U82B 5KVFH 1S9KC 2NX5A 3T3PE 4Q9CA 3I3DA 4V2CB 1T20B 3UTTB 1XIWD 3DVGA 4LRIC 4QOKA 2OK0H 1SEQL 1QLFB 5B38G 2D7OA 5F72S 4RFOH 3UDWC 4NO3A 2DD8L 5B8CC 4XVUD 4W6YB 1ZKAA 1A1MA 4Y5XB 4DFIA 3AY4C 3KHOA 3WKML 3WNPA 3EOAB 5IJKC 3EAKA 2B1AL 2ITCB 2YPLA 2L7JA 1X5JA 2AABL 4BJLA 3BKCL 4LQFL 4QRRD 3ZE2E 3FO0L 5DDHB 1EHAA 3WUWB 4IOIB 4XAWH 4D0BA 4LNRB 1HSBB 2ARJB 2IPKB 1NC4D 4Z0XB 4FMKA 4ZTOL 5ERWB 4L4VB 1KIPB 4YBLC 4ZSOA 1WUNT 2VAAA 2E8YA 4WJ5A 2IF7A 3WFDL 2OCFD 3GMQA 4LLUA 3MC0A 3VXSB 1T2XA 3QJHA 3MFGB 3D18B 1P4BL 3OKDA 3VXUD 4NDMA 2P5ED 4IRJD 4UIMB 2I60L 1UM5H 3QXDA 5CWSB 5EO9A 1MI5E 2A6IB 4AEEA 4OKDA 5HGDA 5D2LE 1XGUA 2EDKA 4Q0XL 5KSUB 2P8LB 5I18H 2YC1B 4XI5C 2HKFL 5DHVH 4XPHL 3RX8A 4PGBA 3UTPD 3L3GA 3PQYA 4K7PY 4PG2A 5J8OA 1FZMB 5A3IC 3BZEB 1R0AH 2B4CC 4D8PA 3RWGB 1AY1H 4L5FL 2OQJB 4FXGA 4UB0H 2J8UF 3F65A 1LQSR 1U8KB 4XPBL 4XC1L 5HYEA 3HNSH 1TVDA 4GMTL 1JGLH 3EYOB 4YNYA 4JFYB 4UI2A 3MRKB 3BXNA 2FIKB 4OLYH 4YFLF 1DUYB 4OCNC 1C5BH 2BVOB 1FL3B 3PHOB 5DI8A 2R9HD 2BRRH 1J8HA 1OY3B 4NBZB 1NMBL 2EDYA 3O3BA 1DBJL 4OZHE 1PD6A 1RUQL 2XZCH 5JW4R 2MHAA 3QIUB 5E94A 5FUZL 4UQ2A 1AO7E 2FYYB 3HZKB 2VDLL 4PJ5B 3IF1A 1NAMA 2RQ8A 3SDAA 1T83A 4CL7A 3FOLB 1X5KA 2BSED 2BK8A 3RU8L 4Q9QL 1UEYA 4ZPTA 4CKVX 5KSAD 1TFHA 4PJGF 5HDBE 5JHDE 4NN5C 1T0NA 5IOPB 1SY6A 4QRTA 5EO0B 4WGWB 5EBGA 3QG7H 3ABZA 1VKXA 4HKJB 1R5WA 4HWZB 2NX5D 4YDIL 2AXFA 2AXGA 1JFQL 4TOYL 4KY1H 4I18C 5ICYB 4K71C 5CD5D 2E9BA 3LQAL 4O2EB 5T1LD 3Q3GB 1YEEH 3VXTB 1RULL 3IJSB 5BV7B 3SJVE 3KR3L 1FPTH 4KC3B 4BFIA 5J9PA 4WI8A 3PWUA 2FHBA 2VAAB 4JFFD 4ZUUB 4KJWD 5CILL 3VXUE 1H0DB 1XR8B 4O5LL 4M1CD 3GK8H 3K74B 1TQCC 2Q1EA 4AK1A 15C8H 4XH2B 1WK0A 5CZXC 1XGYL 3G08A 1ZLUH 2R0WL 3MJ9L 1MSPA 2DM7A 3DRTA 2Z9TA 4PB0H 3BWAB 3ZYIA 4I3GA 3QULB 5MEPA 5DJAA 3SGDI 2P47B 3LN5A 2XFXB 1QFWM 4LLVA 2A77H 1HHKB 1WBXB 5L8LB 1BVLB 1SJVA 2CMRH 1T1ZB 4OZFG 3P30L 4NZUH 3IXTB 3REWB 3S5LB 4R6UA 4MJIA 4YWGH 4RBPH 5I66A 1BFTA 4FQCH 3BP5A 5CEZL 2H45A 2VXTL 4XNUH 3X14B 5JNYB 1L9NA 4XNQA 2I9TB 3FONA 1I1FB 2ORBH 1VGKB 4LDLB 1CGTA 1KUMA 3EOBB 4ZFOB 4FXKA 3AXLB 3IVKB 1RZ7L 5HI3C 4HIIA 5F9OL 4JY5H 4Y16A 1EIBA 1UZ6F 1DTUA 3TM6A 1I4FA 4PJAF 3FL7A 4V1DD 3LVEA 1PQZB 5EORL 1MFBL 4FHBD 5TGBB 1FO0H 1ZT7B 5EU6A 1BM3L 3L7EB 3P4MB 1W72H 5L2JA 4U1MB 1OGAE 3RX5A 3UZEA 5BCAA 5EOCL 4KK5C 1CI5A 5FYLL 1X44A 1WZ1L 4WNQB 1QFWI 2EXWD 1UM6H 5E5UB 5EO0A 1NGZB 1V3MA 3IDMB 3ZKXB 3GSRB 3PE9A 4BQCA 4TQEL 1DJSA 1CFQA 4Z7WA 1FIGL 1IARB 3TO4D 1N6QH 4LBEB 1J05A 1LILA 4GH7B 4U6XB 3MJ7A 2XWJA 5AZ2L 1MIMH 2DL9A 3S9DB 1UCBH 1BBJA 4QCIA 1M6OB 2YD4A 2DQUH 5KN5A 2VLLA 5J4MA 2J88L 5F7DA 1BD2B 5DD3L 5HYJE 3FT2A 3KNBB 2VQ1A 4NZUL 4MS8D 2FR4B 1OW0C 4O4YH 4JFOA 2VLRD 3UZVB 1IQDB 5HHXH 5BVPL 3BD5A 1BREA 4HIEB 2N7BA 4HLJA 4R0LB 3V5DA 4PLJD 1SYSA 1HI6B 3B9DA 4JGMA 1D9KC 5IBLC 2CK0H 3RAJL 1F58L 1DBBL 3KJ4B 3NN8A 3L3KA 3BPCB 3E3QC 2WWKO 4ZUSA 2E6JA 3OKKB 5DRZA 4OQ1A 3CZFA 3MMEB 3LEVH 2FEDD 2ATKA 2C7UB 3SGEI 3SE3A 3ULSA 4ERSH 4YXLH 4FNLH 1MFCL 3PWPB 1HE7A 4F37F 4UIKL 2X4UB 4KI5E 3REWA 1R3LA 2VXSH 3OGOE 1BBDH 4I48B 4LVOB 4ZOBA 2IWGA 3L9RB 3BUYA 4N0CC 5CLWA 1A4JB 4RAUA 1S9WA 1HINH 1ZTXL 4MZ3A 1CGWA 1ZLSL 3PHQA 1MRDH 4LCIL 3L1OH 5AEAA 3F6IA 1MCHA 3NCYP 4U1IA 4JZJA 3DPBA 1OGAB 4P5MB 1VEOA 1WEJH 1JN6B 1WWBX 2MCPH 3VRIA 4CN6A 1QRNE 3DSFL 1RUML 3JWDC 1CFTB 3MBXH 4MJID 1JF5A 4FOMA 3RPIA 3BEVA 4HKZA 4NHCH 1K5NB 1G0YR 1HH9B 4Z8FH 5GS0C 1RFDH 4S1QH 4N8PA 2R56H 4LP4A 5T1DH 4YFEA 1V3KA 2CR3A 4YXKL 4WNQA 1BFOA 4TVSa 1EDQA 4RX4D 1OD7A 1RSFA 3CMGA 3Q5TA 2BNUA 2AV1B 4W70A 4QHNB 1BQHB 5ANMA 2DB8A 5ISZD 1UQSA 3ILQD 5CP7B 1KENH 5C0BE 4ELME 5CGYD 5HDLA 2QADC 5DS8A 5DK2A 4NN7B 5IFHL 4CW1B 3VXUA 1KXTB 1ACYH 3D2UB 2VLKD 3AY4A 3QDGA 4NM8L 4LLWA 1I8IB 1U8HB 4XX1E 3CFEA 4H88L 4XPBH 2YBRB 5C0JB 4UB0L 4PBVC 1U8OB 3F7RA 4FQLH 3N9GL 3FB8A 4KJPC 3ET9F 1CD8A 1IQDA 5JOPD 4S2SA 5ADOL 2YMXH 2Y36H 4GLRI 3UYOD 3V5DB 1SVCP 2FECI 1HI6A 1R3JA 2V5YA 5I1KL 1NCDH 4AJ0A 5B39G 3U6RB 1P84J 4O58L 3EJZD 4QNPF 2IADB 1UM5L 2RIKA 1G9EA 4YXKH 2Z35B 4MD5B 4JFFA 5T1DL 1EBPA 2IBGA 2AK4E 4S1QL 4ODTH 3RHWK 4EVNB 5DFVD 1VFMA 2ZKHL 3LRGA 2YPLD 4I48A 4IMKC 4UV4H 2R15A 5HI4D 3Q1SH 2P44B 2EYTB 2ZCLH 1IAII 1B0GB 3SDAC 4OI9A 4M1CC 3QNYA 5DLML 1XF4A 4F2MB 1I85C 4G8GD 4G9FA 4P3CH 5I74C 1F45A 5ID0B 3V8CA 3L3DB 3FO1B 4OGXL 4X4ME 3PV6A 1SBSL 4PV8A 5MI0C 4P5MA 4O9HH 3VRIB 1P1ZA 2G5BA 4WI4A 3MGOB 4JG1L 3MPCA 4I8DA 3VH8A 4LOUD 3OJVC 1MF2L 3RRQA 3FZUD 1KV3A 4Y4FA 4GQ9H 3RVXD 4CN4A 3PQYE 3CX5J 2XQYG 5HGHA 1N5YH 3MNWB 1ES0A 2ICEB 4W68A 3G6JF 3H9HB 3DMMB 2C9AA 2APWA 4PJAA 4X0KA 4PG9A 3TGXA 3WXVL 4XZUA 3TNMB 5IMKB 1JNNL 3GB7A 2J8UE 2B20A 2BP3A 2HJFB 5KSAC 3IFPA 4QHLA 1H3PH 4QGTA 1AP2B 1TZHB 5HGBA 1QFOA 4OZFB 5IMOB 4NQDE 4EQ2A 2IG2H 3GMOB 4U1GB 4ODTL 5GRZA 4PJDF 2X70A 2X4OB 1PX4A 4ZUWB 2C5DC 4KKAC 5BVPH 3OF6D 2ZSWA 1OAUL 4XNYL 3WFZA 3MODL 3IDNB 2VISB 1JGDA 3RTQD 5I1KH 1GOFA 3VG9C 4U7MA 3UMTA 4Q58C 1MCWW 1DQLL 3KYKL 5ABDE 3CJJA 1J5OL 4X7SL 4PP2B 1QRNA 3IJYB 4F7EB 5JMOC 2H3NB 4HX1B 4R2GB 3HG1B 3MRDB 4LSTH 3TIDB 3MRGB 4DVBA 3S35H 3JTTB 2WSKA 3ARBD 3JV4A 1P7QB 3WIFA 3CD4A 1B6DA 4JO2L 5FB8A 1OTTD 4F57H 4I0CC 4L4VE 1U8JA 4OCMC 4PGZA 5I71B 3U4AA 2WBJB 4MD5A 3QUXB 1GGCH 3SKOA 4Y8AA 3I6KA 5IGXL 3O4OB 1BM3H 5JMRA 5TH2A 2G2RB 2YUVA 1FO0L 3LKQB 4GOSA 1TQBC 2FWOB 1NC2D 5GRJL 4R3SB 5B8CB 3G5YB 2IGFL 2WIIB 4IJ3C 1FNEA 4OUUA 2QADD 4R7DA 5L0QB 1C7TA 2BSSA 4CNIA 1BVKA 3CSYA 1FLTX 4HCRA 3HMXA 2EECA 2Y6SD 4ZAKA 2KDGA 1KLGB 4L4JA 2UZIH 3L3DA 4FTVA 4PJ9B 4WO4C 4JFXA 5DRWA 5SX5H 4ORZC 2DQGH 2N56A 3CH8A 5D2NE 3RY5A 4Z6AT 2W0PA 4PJCE 5DJ8B 1CVRA 2DI7A 1FNAA 1TPXC 1AR1C 4KKNA 2VERN 3L1OL 2HFTA 4RRPG 5HTSA 3P30H 3RUGF 4DK3A 4RFEA 4CJ1A 4PJAB 3VA2C 1XGPA 3MREA 5EC1A 1FORL 3LV3B 3BP4A 4CMHB 4XT1C 1NL0L 1JGUL 3CXDL 4UUJA 5IG7A 5C0CB 3ZTJG 3O6KL 4JHBA 1YY9D 2NY3B 4JRWA 4DWHA 1QQDB 2E7LA 1QBLH 2GAZB 1KNOA 2IMNA 1GSMA 2FD6H 2ZCKL 4JZNB 3QG6B 1F58H 1GIGH 4QRRA 5KVEL 1S7UB 4C83B 4K23L 3IXAB 1X7QA 2BNQD 4JKPH 4KK8D 5HXMA 1GC1L 5CJOL 1T5XB 2V6HA 4HX1A 4MB4A 3DUSB 4R4BB 5J12B 1Z2KA 2FSEB 1NSNL 4PJ7F 3HAEH 3O41A 1PLGL 3S3JA 5GGQL 3VFRB 3EFDH 2VABB 1P7QA 2Q87A 3WIFB 1GJIA 5BJTA 1ORSA 4HUMB 1T21B 2BXZA 1A7QH 1HSAB 3LKSB 4BKLA 5HHNA 1DR9A 4UU9A 3R0MA 4FZEH 2D0GA 4JN1L 2JLLA 1IAOB 2PR4L 2BVQA 1BJMA 4LAQH 3O11A 1OAZH 5HY9B 2K9UA 1IM9A 1BEYL 1CD1A 35C8L 2Y9RT 1UYWL 3IT8D 3ULVL 3S36X 1NGXA 4LSVH 3ULVF 1G9MC 5D7LD 2DWEB 3BH9B 3QCUL 1TDQA 3L3IA 3JBG7 2A6DA 3V6OA 4P57A 1RU9H 2Q76A 5BV7H 1MLBA 5BS0A 1CIDA 2X4NB 3VMNA 4ESKA 4BSJA 4PJGB 3HTLX 2NXZC 5FCUL 5E2VL 1XMWA 2BCKB 1NGYB 4QGYA 1N6VA 1B0WA 1F5WA 1R24A 4XTRC 5GIRB 3WFCL 5M7QA 1AY1L 1CXLA 1U3HB 3BN3B 2AJYH 3OXRB 4Z7VE 5T3XD 3MO1B 1HQRB 4KRNA 4OIIL 1EEQA 3LV3A 1KPVA 4X7EC 1H3UA 3D6GA 4LHUG 4R8WH 2F54A 1FFOB 1ORQB 4K8RH 2X6MA 2GTWA 4P5TD 1MCJA 5INCB 5SWQB 3BQUD 4L8DB 3VXOB 4WFED 1EFQA 5HPMA 5FO7A 3FKUS 3G5VA 2C1OB 1G9ML 1MCWM 1J0HA 4E42B 3TH3T 2GJZA 5C92A 5MEOB 1F97A 3CC5B 1CFVH 3I9GL 3TA3A 5K59E 2IG2L 3TPKA 4KPHL 4M61A 4OTXH 4OZHA 1DZBA 1OP9A 2IFFH 3TJEH 1Q1JL 5I8EA 3CSBA 3TJHD 3VD3A 3FRPA 1YA5A 3SBWC 3DUSA 3WJJC 3MRMB 3VG9B 3FTGA 3OKOA 1OLLA 4YDVA 5HD8C 1A1OA 1ZHKB 2ZOLB 4LIQE 1X4XA 5CSZA 1MCLA 4MHHG 4ZMAT 1JYVA 5DHXB 4HT1H 4P2OB 5FXCH 4U7SA 3BKML 2P5WE 1DQQA 4U1HA 5MERB 4ZNEE 4KK6C 3QCTL 3GMQB 4RFOL 1H5BA 2A74A 3RBGA 5HI5C 1JUFA 4GQPH 3OXSA 5DUML 4I77H 3NCCB 1P2CB 2P46B 2WBWB 3QXDB 5CWSA 2NY5C 4KV5E 4LLQA 5EC2A 2EDHA 3RVWC 4G6JL 3TT3L 3V52L 2X1QA 1I1YB 1ZOXA 3IDYB 5IB3A 4LSQH 5K9KB 3OGCA 4HIJB 4KRLB 3QIWB 3T1FA 1VADA 1RI8A 2HMID 3RU8H 4Q9QH 5CEZE 5E5MB 1JNHA 3U46A 4Y19A 1KELH 2X4NA 4L8BB 2KH2B 5I1DB 2EO1A 2EEDA 1NCDL 4LEOB 2BOBB 4HCRH 5C7XL 2J6EA 3U4BL 4XNZB 4XBPA 1UT9A 1T0MB 3DHJA 4LIQH 3HA0A 2NZIA 3MRKA 4N1EA 4HWEL 3TWCH 3F7VA 1A6AB 4YPGB 2NY2B 3NIFE 4L8SC 1FL3A 4TUOB 1CK0H 5FHAL 2GSIB 3NCMA 4Q2ZB 4YHLL 2JJUA 3BUTA 1IGTB 4JY4A 1QVOB 1YQVH 1BPVA 5KSBF 4JFHE 2MHAB 3HNSL 4Y4FC 4HUWA 4KKBD 2VZOA 3D0VB 3O8XA 5F96L 5JUEH 2NY5L 2EDJA 2NTFB 3ZDXF 2DQTL 1RZIA 3AS1A 4GRMA 1NBYA 3CC5A 4MSWB 1YDPA 1OP5H 1FYTD 3EO9H 5E8NB 2VDPH 4X6CE 3DXAE 3QPXL 4M62H 5DMYA 5F9WC 3R0NA 5ALCH 1EAJA 4PRID 5KVGH 1E4XI 1H3WM 3VFOA 4Y2DA 4EOWL 4IMKA 4JHWH 4Y16D 5C0AE 1HWGB 2A1WH 3H3BC 4KI5D 1MJJA 4PYHA 5IVNA 1FH5H 3HS0B 5BZWA 3QQ4B 4NHCL 2CDFA 3AS0A 4NQSB 3Q3GA 4Z5RA 3C08H 2X4PB 2PO6C 3HUJF 5E7BA 5GSVB 3W9EA 3L6FB 4HPOH 4ZXBB 1AQKH 3IKCB 1CICD 2N1KA 4KQ4L 4PJ8D 1JZ5A 2AJZA 5E1HB 3UJJL 1ONQB 4XVTL 1INEH 2GJ6B 5IQ7L 4UTAH 1G7PA 3BE1L 4NBYB 4UIKH 1G7LB 3PP3H 5GJTL 3T1FB 1IC7L 4P2QE 4UV7H 5KSVB 3GHBL 1JTOA 4NO0D 5E5MA 2PXYC 3RZCB 4XCNA 1ZHBB 1KJMA 1SM3L 5IIEB 4P99A 2NY1D 3EJJX 4PV9B 4OT1L 3WXWH 2IQAA 4YHNA 2F53A 2VLRA 2CKBB 1UWXH 4K7PL 3MV9B 4KGLA 1CBVH 4HKXA 3V6BR 2YD6A 3ARBA 1T2QL 3LCYA 1EEYA 1QSFE 5DQ9B 1G84A 4J6RH 3ULUH 3TA3D 2BOCA 5D7LA 1VGKA 3EOBA 4HFUL 3BRDA 1AKJD 4OCYL 1ITCA 2DQUL 3DGGA 2EYRB 2LV4A 1XR9B 3D0LB 4KROB 4M93B 3TCLB 4G7YH 5M94B 1F4XL 4KRPC 4RQQA 4LLYA 3F12A 5ESQA 5D71L 2E9IA 4N0UA 5I1EL 1X4YA 3LB6C 3ZHLA 2XWBA 2Z92A 3WNKA 1OARH 3NTCH 4W81A 5JA8B 3NZ8A 2IAMD 2PTTB 3R1GL 2FRGP 3ROOA 1G6RH 5GGTH 1EGJH 1PY9A 1YEGL 2Y06L 2OTWB 3QH3A 4G5ZH 3HPLB 2XIDA 2BC4A 1MQ8A 2EDDA 3QNZA 5E5RB 4J4PA 3RVTD 3C5ZC 3M17A 3HNVL 3W2DL 1LO5B 1FO0A 1MFBH 1MFDH 5D2NB 5CHNB 3STLB 4OAWB 1ZLUK 1RZ7H 5F7DB 3O0RL 5TPWH 3QDJD 4FFYL 4JM2F 4MA8H 2ORBL 4FQQB 2VQ1B 4N8VB 2IMMA 4MAYC 1KGCD 3VA6A 1EO8H 1A02N 4P5KB 2PYFA 5D70L 3Q2CA 5JHLL 1W0VB 2I5YL 4JDZB 4OZGB 2HT4C 3GBNH 1F4YL 2YD8A 4U6HA 1RUPL 2CLRB 4R7NA 2FZ3B 1ONQA 2FH6A 3WNNA 3R06B 1CR9H 4OZGE 4DAGL 5BV7C 1FFRA 1OAKL 4JN2A 3K2UL 3HB3C 1BLNA 3IDIA 4QRPB 3W9DA 1WLHA 4TTDC 4QTIH 3TYFA 1IGJA 5D93C 2A6JB 2IQ9L 4HWEH 3GI9H 2JB6B 3KPRA 3OHXA 5EIQA 5T1MB 4X4YA 5IM7A 5T1KB 5EU7C 3RWCA 4YHML 3VW3L 1N5AA 1IM3B 5BW7A 3ORJA 3K46A 4JQXC 5JHDD 4ZTPL 3RWIB 1OPGL 1RIVH 4WTZG 1Q94A 4JJ5B 4KGJA 2J6EH 5HDQH 2JKXA 1AGEA 3VGAC 3DGGB 4C56A 1MIEL 1YC7A 3VG0L 4JDVB 4N9GA 1A5FH 1X5ZA 3IDXL 1NEUA 2GTZA 3MYJB 5EPMA 4Z7UA 1JHTA 5IV2A 3T09A 3VMPA 4G80B 4GMSL 3B9KC 1OLZA 2APVA 1EJOH 3QCTH 3KYNB 3PXJA 5JZ7D 1BFOB 2CLZA 3IDXH 1R3HB 5FGCB 2CDGA 1DQJA 3RDTA 2WIMA 3LN4A 1NGPL 3MBED 4QF1B 4YGAB 3OB8A 3FQRA 3ZHDA 3TC9A 2DM4A 2HVKA 2W0LA 3D18A 2ZG3A 5I75B 1S7RB 3H9SA 3ZYJA 1VSCA 4JO4L 4P2OC 4XP1H 4NSKB 1Q1JH 3LS4H 4OUOA 5FF6B 3VW3H 4LLWB 5E9DD 3O2DL 5BOPA 3OR7B 5IK3A 1KB5H 3GMMB 2ADFH 3O4LE 4U2YA 2C4FT 2EE9A 3GI9L 2W0FB 5B38A 4NKOA 5I2IA 2HJKB 4NQCE 4KTDL 4I3RH 3UDWA 4OZGA 4GS7B 5I9QB 2LTQB 1QZ1A 4WCYH 2FZ3A 1PKQE 1SYVA 5TE7H 3W11D 4WU7A 5FYLD 4YZFF 3MYZA 3VH8G 4JFYA 5I1AB 2WWMD 3MLSH 2Z35A 1I9JH 4GG6B 4N5UA 4Y5VB 2CUIA 3KPRB 3K8KA 4K3EH 3O0RH 1YY8A 2WUBH 5IMLA 2EE2A 4MDIB 2WUCH 4Y5XC 3NCJL 4NNPL 4NRXA 1MFDL 1B0GA 3IF1B 1MAJA 2LU7A 3U2SA 4WWKD 2NXYD 3JZ7A 5CGTA 5GRUH 2DTSA 3U36A 5CBAA 2OBGA 4EBQL 1NGQL 3FRUB 3WDJA 5D1XB 3PV6B 5LXGH 3N1QC 1UENA 5E00A 6CGTA 4HUUB 4JM2D 3VH8B 1A14L 4HIXH 4X6DE 4MAYB 1UXWA 1BQLH 5B4MD 1UACL 1NCCH 5E6YA 3QUKA 5EULV 2PR4H 3SPVB 5DUPL 1KJ3H 2QV2A 3C5SB 5I1EH 3GJFK 5IMKA 5DEFB 2EZ0C 1QG3A 3MLRL 3E6FB 4ZO9A 2VDNL 3K3QA 2GCYB 1TTFA 5E8EB 4KUZH 3MZTA 4LFHD 3HC4H 2VDRL 2DQHL 1J9CT 2OK0L 2XTLA 5FCSH 4POZC 1KTRL 1R5VB 5IJVB 1YN6B 1OD9A 3EZJB 2BDNL 3PGCB 3PIQA 4PTTB 4DGVH 4XCCL 3WFBH 2VE6B 4RDQG 5J0BA 3HI1A 1Z9OA 4FQJL 1D6VL 4ALAH 3VCLB 1CDJA 4K23H 1GIGL 5IK3B 5C8JB 5KG9A 3DBXB 3NMEA 2ZCKH 5EUKA 2CO7B 2R0ZH 2V7NB 5T5NG 1X5LA 5FGBA 4XRCB 4HMDA 5IFJB 3L5HA 1D9KD 1OP3K 1TCMA 2CXGA 2OX5A 4TNWF 3U1SL 1VEPA 2ZUYA 4FQIH 3MJ6A 4PUBL 3G5XB 3KLDA 5E6ID 4W4OC 1BOYA 1QHPA 1T0PB 1PGRB 3TESA 2WBJA 3BP7A 2YXMA 3DXAD 3B8SA 1FYTE 1KPUA 4HPOL 5AAMA 4TSAH 2QQLL 3VJ6A 2XN9A 1AJ7H 2P5WB 4HIIB 4PR5B 5GS1C 1NDGA 1P6AB 3TO4C 1DL7L 1NCAL 3O6FD 3WLWC 4OLWL 5A40E 2BSSB 5EDXA 4CNIB 3JTSB 5IVZA 1QSFD 3MCG1 4JFHD 5L2JB 3WO3B 4LL9A 3LS5L 5DR5L 2PW2B 2Y7QA 3TFKD 5DSCA 1BZ9A 2EEAA 1JYNA 5DRWB 1DCLA 4XBGA 3RVUD 3I50H 4Y4HD 1TVBA 3F7YA 1YYLL 3UEZA 3CFCH 2ZSVB 1HN1A 4WHDA 5GHWL 5DD5L 1M7IB 4UMGA 1CFSB 1CN4A 2V2WA 1I7RB 4KUCD 2BY3A 5ECJE 1HH6B 1EAPB 4JHAL 1UB5A 5A2IH 3TV3L 2B0SH 2YD7A 1G7IB 1ZHNB 1KJ2A 4X9BA 1UJ3A 4KKCC 2LVCA 3CPLA 3KS0H 1IGML 2XZZA 2O61B 4G6KH 3F62A 5D96C 4Z0BH 1GZQA 3SCMA 3G6AB 3T4YA 3VWJD 4BFGA 2J5LC 2F19L 4CDHA 3MUHL 1LO3L 3DECA 1SMAA 4Z7NE 3UPCA 5C6WH 3G5ZB 3PGCA 4JPIB 2D7TH 4F7TB 1QLEL 1RUAL 2ITDA 4OM0L 1DVFB 5LCVH 2OL3B 4BSWA 1TTGA 2NY6D 5C07B 3U4BH 3BGFC 1U8MA 4IRZL 1XEDA 5E08L 4HF5H 3ZMRA 5C7XH 2EYSB 5BXFA 4HXAL 3VFVB 4M8VA 4GT7A 4NUJA 3VFSB 4LHUA 4PRPA 3ULSB 3HZYA 3OWEA 2QQKL 2X4UA 4PRIE 2P24B 2YN3A 4W6WB 4WI6A 4F7CB 3U4EA 4NZRH 3VFMB 2AK1H 4D9QD 4OI7A 4JPWH 1II4E 3C87A 4MVBC 5HHVH 4LKCB 4BKLB 4OZIF 4XHJC 4ELMF 1S5HA 5I8OH 3MRIA 4PJEF 1RMFL 5CGMA 1KPRA 4U1IB 5GGUB 1S9VB 3VRJA 4RGOH 4XCEB 2P5WA 1M7XA 1EVUA 3VXQA 3O2WH 5MHSD 1IFHL 1IQWL 2BHZA 2E6PA 3B4NA 4BSVA 3BEVB 4X4MA 4E41A 3DYPA 5T1LA 4RGOL 3FQXB 1U36A 2NY4D 4LSSL 3PHSA 4FFWC 2H26A 1S7SA 1XZ0B 5KANG 3DIFA 4L29B 1AGCA 2OR8A 5SX4H 2VB5A 1DVFC 1FAIH 4OTXL 5C0BD 4WFFD 5ANMB 5DJ0B 4LP5A 3TP4A 2AQ1A 1CCZA 2UV3A 5IQ9B 4TUJA 3MRJA 1G1YA 3FOMB 4M9OA 3L5JA 1RZKH 5DS8B 4ZFZB 4BZ2H 3MO1A 2X4SB 1C5DB 2M1KA 3LRSB 4JFEA 3WNLA 2ICWA 2Q20A 4W6XB 3ZZ1A 1AC0A 6FABH 1I9RH 2BSTA 5F9DC 4Z7OE 4KMLB 4D9LL 3MRLA 4PGEA 1VACB 2ILLA 3CDCA 1U58B 3EW3B 3FT3B 4PJXA 5E2WL 2ED8A 4FQPA 4NJ9H 3G6JB 1NBVH 2NXZB 2CQVA 3LH2L 3RQ3A 3TF7C 3N9GH 1IBGH 4AQOA 3JWOH 1GCFA 4IRSB 1F13A 4H88H 2O5YH 3U7AA 4CVZA 3QFJE 3IFOA 2GIYA 3P73B 4OZHB 4ODWA 3DETC 3VFVA 1KN4L 2C1PA 1N59B 1OVZA 3CFDB 1TNNA 1MPAL 3DXAA 3QXTA 4YDVB 2COQA 4EVNA 3P2TA 4OQTL 2VH5H 5DD5H 1NDMA 4RRPA 1UWGL 2VO5A 3TYGL 2W07A 1ZS8B 4FQXD 3UXFA 3WFEH 1EPFA 1G7QA 4AEIH 2A83A 3ZE0E 4U1LA 2JJTA 5DJYB 1FDLH 5F8RC 1S5HB 1OAZL 2R56L 3SKUD 2A2QT 5FM8A 3D3VD 3HUJE 3VXRE 1I3VA 2BJML 4HV8B 3HE6C 3WBDA 4GG6F 3VXQB 2GJJA 5TQ0L 1T04A 1Z9LA 1FVEA 1K4CA 1RUMH 5IEKB 3CMOL 5IB2A 4E41B 2DLFL 4H5SA 4Y19E 1T89A 3QIWA 4P23B 1KFAH 1JGEB 3MCKA 3RVVC 1NCTA 3RGVA 3TBYA 2VTFA 4FFZH 3ZE1F 4BM7A 3TO4B 1AD9A 3VXPA 1TLKA 1FYTA 3LKPB 2HFFA 3QUYB 2QLVB 2HLFD 3L3OB 3VI4F 3Q6FA 1RIHH 3BIAX 4PTUB 1MRCH 4U3HA 4S10A 3P0YH 4ZDHB 1Q8MA 2LE9A 2GUOB 1T0MA 1KB9J 3IU4L 3FFCD 3FN9A 3FOMA 1HOCB 2A0LD 2DQFA 5ADPH 4JM4H 2GT9A 2X70B 3V4PH 5EUOA 2GK0A 2CJUH 2ZSWB 2LQRA 3G04B 4FFVD 5F71A 4NHUB 4R26L 5EIIA 1E6OH 1IGTA 4JY4B 5ADPL 1BOGA 1KTLA 1YEKH 4Q97A 5GGSY 1ZEAL 3FO9A 4A6YL 5JXAH 3MRLB 1LWRA 4XCFH 1I3UA 2CD0A 4P23C 4WDIA 5JORA 4G42A 1KACB 2ZCHL 1CU4H 1R5IB 3S4SB 4DW2L 4WI3A 5HHXL 3IB4A 2H3NA 4LKXB 1AH1A 3NA9L 1KLUA 2QR0B 1N64H 3PWPD 5IWLA 3GZKA 1F8TH 3HE6B 2VDRH 5CP3A 1I8LA 2FATL 1ZHLA 4WU5B 3MFFA 3BIBX 5AZ2H 4E0RA 3EYVB 4CRPA 4DQOL 4OJFH 4LGPB 5FYLE 4XWOD 5F88A 2VIRB 1T20A 1IL1B 1MREL 3C60D 1GPOH 3C5JA 1FFNA 3HCVA 3OAUH 5ACMA 5KW9L 3T2OA 5FUOH 4DKEL 3O4OC 2GW5A 4X80L 1NDMB 3SKOB 4P46A 3I6KB 4HS3A 4NQSA 5TH2B 1F4WH 2R1XB 1A1MB 4Y5XA 3MRHB 4APQD 2IAMA 3L6FA 1JRHL 3HE7B 3MRQB 1PSKL 5EUOF 5LXGL 3GJEB 4WHTA 3UAJD 1WCBB 3INUH 2Q6WB 3ARGB 3FFCE 4YHZH 4ZAKC 3CVIH 3I3BA 1A0QH 4JFXB 3IETB 4J2XA 1T04B 1KCSH 5I0DA 4NQDD 3ULVD 3GIZL 2VL4A 4LSDA 5DJCB 3SJVD 4QXTB 3QJHB 3TVMB 3OQ3B 5EWIL 5IB4B 2B5IC 5IVOA 3PL6A 2EXYD 3MV7B 5EN2B 5DMGC 1TITA 5J57B 1Z9MA 2IQAB 5JDJA 1BF8A 1JWSB 2CKBA 1WWCA 3KPLA 5J6GB 2WBJC 5I71C 2EEBA 1OOAA 4J4PD 4QRUA 2GT9B 3CX2A 4YQXL 2WAHA 5T3XH 2CH8A 2GAZA 4EKXA 4M48H 1WIUA 1ZANL 3BZEA 1T3FA 3MRNB 2P42B 4WV1A 2ADFL 1OWRM 5F21B 1AGBA 4O2FA 3NFSL 3C6SB 4KI1A 1N0XL 3QI9C 3OX8B 1QFUH 2DKSA 4LKXA 3B9KA 4YIQB 1J8HB 3AGVA 3MSPA 3NFNB 3GK8L 4NP4H 3IYLW 4EXKA 4F9LA 5MI0B 2AV7A 2VABA 3KVQA 4JZJC 4AEHH 1QSFA 1CG9B 3BT2L 4GQ9L 4UQ2B 4YXHL 3V7MA 5D1ZD 3BEWA 4WU5A 3RL1A 1RULH 3QH3B 2MCG1 2B4CH 1G9NC 4RFNC 4I3SL 3SDAB 1G7HA 3DURB 2BVQB 3KPPA 4X6FB 4QHUB 5IB5A 4WEBL 5DQJB 3E2HC 5D9SA 2XQBH 5JIPA 2ZCLL 4NZJA 3F58H 1AFVL 3T3ME 5I1GH 3ULUF 5LGHL 1G7JB 3MGTB 4NZTH 2OXHA 3DWTA 3EHBC 5D7IF 2Z91A 2AERT 4S1SH 1QYGL 3DMMD 1LP9F 2W91A 2VR4A 3K7UA 3TLRA 1GZPA 4EDWL 4MJ2A 1I85A 2BMKA 1SJEA 1FNSL 3IETA 3W81A 5L7XL 3GSWB 4PS4L 3RWGA 2DBLL 3BGMA 5E08H 2H9GA 1MLCB 3RP1A 1J8HE 2X7LA 5I15L 5GIRA 5LCVL 3EYOA 3QO0A 4GRWF 4QRPA 3MROB 5I73B 4HS6B 1T66D 3WE6A 2DTML 3MV7A 5EN2A 3NCFB 5D2NC 4OCSH 4OCWH 3KPTA 2KQNA 5BMFL 2ZWLT 1KEML 3O3BB 1P9MC 1FFOA 3EUUA 2P43B 3RTQB 1YJDC 3RWCB 5E2UL 1L0QA 3TPUA 1LDPH 4PJIF 5DMKB 5HJ3A 1VFUA 1ZLVH 1R0AL 1HHKA 3EJYC 1UA6H 3DGCR 1U8IA 4Y1AD 3DO7A 1E4JA 4OCRL 2HAZA 2PYED 5I1HL 3HG1D 2P5EB 3TN0C 3QXAA 1NCBL 1P7QD 2P8MA 5F1OB 1AXIB 5JQ6L 1HHIB 3GFUA 4UT9H 1CGYA 3I6LD 2OJEA 2BSRA 1Y0LA 3IDUA 3X14A 1JPTH 3MCLH 1P4BH 4LASH 4XNQB 3QUXD 2I9TA 4YDJA 1A7RH 1RFDL 2E9JA 1YYMH 4FXKB 1KJVB 2IBZY 3KHQA 3BYTA 3ARFA 5JXEA 4P2OA 3DI3B 4QXUH 1DQQB 4F80A 1K3ZA 5JOPE 1MRFL 5EU6B 5B39B 5MERA 4WW2F 4TSAL 1A3LH 5ID1B 1H5BB 2A74B 1E4KA 1U9KA 4LHUD 5GPRA 2HVKB 4LVOC 4PJ9D 4ZO7A 5DVLA 1FL5A 3TBVB 3U7WH 3IFLH 5TF1H 1P2CA 3WKMH 2R2EB 2VLKE 3DRTB 2JJWA 1UZ8B 4G6AD 2BVYA 3R4DA 3ZYOA 1ACZA 4JRYD 3SGJA 2EIZA 3OR7A 2MPAH 4Z95H 1P7KA 3NABH 4KHTL 4RGNE 2W9EH 5IW1A 5AWNL 3MGAA 4ZO8A 1AHWC 5KS9E 3KPSB 4MXVF 4DKAA 5ISZE 4Q9RH 2JELL 4QT5B 3ILPB 4BUGA 4WW1A 1BWMA 2XZQL 1BGXH 1RUKH 3LDBB 3BGMB 1ZWIA 1I8KA 1CF8H 5C0CD 1DQMH 3H2WA 5EBWA 2APFA 1A8JH 4PY7B 5TJWK 2NY3D 3ZDZF 1OAYL 1U42A 1RUKL 2XTJC 4XPGH 4JFOB 4UINH 1CVSC 1QBML 1MAMH 2R69L 4O4YL 4X6EB 2FEEI 3UO1H 3WS3B 1X5IA 2UY6A 5I1JH 1KCUH 2OM5A 5DD3H 1BF2A 4AIOA 2WWKT 3V4UH 4CVUA 1J1OH 4GKNA 5IQ7H 4JFDB 4KUZL 3LN9A 1K8DB 3DYOA 3UJJH 1JZ4A 3NACL 4WRLA 5F9JA 3TBWB 2R2CA 3DRQB 5FO9B 3DO7B 1NAML 4EDXA 3HPJA 5E56A 3EYUL 5J1AB 3FAXA 3L7EA 3P9WB 5H8DA 1JZ8A 3X17A 4KZEL 1K9TA 4CVWA 5C0RL 4H8WL 2P4AB 4JRYA 5TDPB 1LE5B 2W0KA 2P8MB 4QRSA 4NC0B 1CE6B 1U8PA 3VFOB 3J7HA 2YD9A 4EN3D 4MAYA 1IM9D 3OKMB 1LO2H 1WZ1H 4I0KA 1S9WB 3GSVA 1KLFA 3KDMA 4XPTL 5MEQB 2F54E 1NBZA 1YECL 3PHQB 3MOQA 5DZLA 2DI8A 1NGQH 1CFQB 5EB9A 4PLNC 4Z7WB 1KEGL 4UAOB 2V2TB 3HS0A 5GRUL 3GMLB 2IPTL 3QAZC 4YUEH 5DYOA 2HWZL 3WIIH 5C71A 1T1YB 5FHBH 1CFNA 3AREA 4JY5L 5C9JA 4WY7L 4HKZB 2YRPA 4OKVA 4X99B 3W39A 1HDMB 1IE5A 2VDPL 2JIXA 4WTWA 5KS9A 1S3KL 5EU3B 4G6FB 4N1CA 2VQTA 2X05A 2CUMA 1QSED 2LAGB 3BDYL 1JYWA 4TNVK 2LTQC 3CK0H 4OBRA 1WTGT 4RWYH 4L9LB 1A6VH 1UZ8A 4CMMB 5JUEL 3D87B 5MEND 4NQVB 4S0SD 4OB5H 5A2LH 3V0VA 3L3KB 4WCYL 1JL8A 1MHPH 2J12B 3EDEA 4LCWB 5ITFA 3UJIH 3KYOA 2X89D 5C0AD 3PV7A 1PVHA 3RY6A 4XRCA 4HHAB 2E8ZA 5JW4Q 3TWCL 4X5LA 3QFJB 2H32H 1MCBA 1KB5L 3B2UC 4POUB 3TEUA 4GW1B 3HI5H 1F3RB 4DN4H 4HUNB 1H9VA 3LD8C 4NNYA 3QPQC 2UUDK 1MCSA 1Y6NR 4XP1L 1FAKT 5C0IA 4LARH 3RUGE 1OWWA 4JO3H 3QIBB 4X4XA 3WHXA 1OGTA 3GSOA 4QTHB 4OIAA 4JZJB 4RAHA 4ISVA 3V52H 4F58H 4H0IA 1AGDA 1AFVH 3S97C 1C16A 5SV3A 1SJHB 5JQHC 4WTZA 5F1NB 4HIHA 3BRFA 3LHPL 2IJ0C 1YNKL 1IEAB 4X8JB 4KV5F 4FN0A 1S8DA 5HVGB 4O02H 3WJJA 3OBAA 1YUHB 4U49A 3BI9X 4HEPG 3VGAB 1T7ZA 3GSNB 5FDWB 4AIZA 4Z7UE 4YHIA 3I75B 4OZHF 1TQCB 3QPQD 2VZSA 1KIUA 2Z8VC 1UQSB 3I6GB 1WWWX 1XF4B 4F2MA 4HAFA 4AEHL 4ZO6A 1I7RA 1NLDL 1YEIH 3STBA 1Q9KB 1V8HA 4PJBE 1ROWA 1RJZB 4NOBA 4EI5A 1G7IA 1ZHNA 5KSBA 5CJ5A 4ETQA 2AW2A 2NY7L 3SO3C 1AI1L 2FO1A 3ARZA 4LLDA 5HYJA 4B7LA 5D2NA 1GZQB 3SCMB 4HULB 5C9JB 5D93B 1FHGA 4EZMA 3EDFA 5C0JA 1ZVYA 4YHKH 4HWBL 3E3QE 4JPIA 2IQ9H 4N90E 2AJSH 4MXWL 4G8EB 1H3TA 4M48L 1OTSD 3UJIL 4LCUA 4UNUA 3MXWH 3ARGC 5DHYB 5L6YL 3T4AA 1FFQA 3GMNA 1EHLL 2X4RA 4HFWB 2OI9C 1NC4A 5HHMD 1BLNB 2AK4B 5EUOE 1TNMA 4NT6B 5IWLC 2JK5B 4NQTA 2VZTA 5GGRB 2DL2A 1JPFB 5BS0D 1V7ML 4UOJA 4KVNL 1MWAH 1KJ2L 2LAAA 1CDGA 2FDBP 1BZQK 1XH3A 2Z93A 4IDLA 3T1WA 5DK0B 2DQEH 4F7EA 5FYKL 1KCRH 3P11L 2CKBL 3OB0H 2H8PB 2HP4A 2MOVA 3ARSA 4G9FB 1KPRB 3HNVH 3W2DH 3V0WL 3QIBA 4X4XB 4XPAL 3JTTA 3TFKC 1UGNA 1DN0A 3PWLA 4GKZB 1IJ9A 2R2BA 5CINL 1A22B 4Y2DD 2YA0A 3VFWB 3CSPA 1RPQA 4EUPG 4ONHB 3BPOB 3MNWA 2B5IB 3QUXA 1S8DB 1P4LB 5KW9H 2ZJSH 5CMAB 3ZKQD 2Y5EA 1MREH 1CWVA 1LK2A 1M05B 5DURD 3EYUH 4XZUB 2F8XC 2G2RA 3GB7B 3ESUF 2FWOA 2WP3O 3ROLA 5IBTL 1TZIA 2XKUA 1FIEA 4OUUB 4PJIB 5DJ0A 2N7AA 5F7WC 1DQJB 3V4UL 4OCYH 2XN9D 4F15B 1GGYA 1ZLWH 4QF1A 1N8ZA 4YBLB 1BIHA 1WAAF 3QFDA 1MQKH 4J3UA 3HE7C 2NLJA 3H9SB 4BZYA 3S96B 4LLDB 4WHYH 5HYJB 1A64A 1BD2E 2BSTB 4PREB 2AJVH 3SDCD 3HC0A 4GUPB 1ZT4A 5CAYB 4NRZA 2KZWA 2DJUA 2NW3B 4UTBH 4MZ2A 4PJ7A 5GJSL 2HJKA 2JELH 4RGNC 3B5TA 5DFTA 4KQ3H 3HMWH 3CAFA 2FGWL 3GKWH 1LP9B 4OLZH 4P2CG 5E1AB 2AP2A 4HGWB 4MJ5A 2XNAB 4PJ9C 4WO4B 5DHYA 1JNLL 4P2QA 5C0CA 1MJUH 4DGIH 4AYFA 3VD4A 5TE6H 3MACL 4O2CA 4OFYD 3H0TB 2AK4A 3CFDA 1QFPA 4RGNB 3QQ9D 2XTJE 5CEYB 2BNQE 4AEFA 2YA1A 4LSRL 1MCFA 1WFTA 3LKNB 2F74A 2XWTA 4YO0A 4GXVL 3SN6N 1S5IH 5IMLB 4MDIA 3SE4C 3T0EA 3D39D 4AG4L 2AEWA 2HT3D 4PJCA 2RCSH 3HAEG 5FDYA 3VD7A 3KWWA 1A1NB 1DLFL 4MXQC 2H8PA 4IOSD 1FRGL 4RMQA 2QHLA 3BMWA 3DROB 4FTVB 2VDQH 5DDHA 4NKDA 4OF7A 2HT2C 5IBUG 3Q6GL 4M8QA 4NM4H 5C0AA 1Z3GH 3RDTD 3T2NH 1KIPA 3LKSA 1YPZF 5K9JH 5IB2B 32C2B 1FN4A 3O6ML 5DJ8A 3OJ2C 3V5KB 3TZVB 1FGNH 1DFBL 4FZ8L 1EZVX 3VXME 4MA1C 4KTYA 3MRPA 4HJGB 1P4LA 4ZODA 4GFTB 2HTKC 2FHCA 3KLAA 5HY9A 4RFEB 4X83A 2V17H 1H15B 4UIMA 1EO5A 3MRRB 4C56E 5E7FA 5CD3A 1MFNA 5DHVA 3UTTD 2PN5A 4F3FB 4CN1A 3S35L 4PRPE 1Q9OA 4JQIH 4XNZC 2BNRE 2GK0B 2IBZX 4HLZH 4PGBB 1LP9E 2J2ZA 4PP1C 1A7OH 1F6LL 2VE6A 3W0WD 4X7SH 2UYLB 4HJJH 2IH1B 1BOGB 1NC2B 3AU1B 4MAUL 1B88A 4QRRB 1J1OL 2OR7A 3VXRA 3OZ9L 4PS4H 2QSVA 4HPYL 4EIZC 3H3KA 4J3VA 5EZJB 2DBJA 1YEJH 4MDJA 5GJSH 4L4VD 1NMCC 4EDWH 3HRPA 2UVFA 4QHMB 5E1AA 5IFJA 2XNAA 2XT1B 1FLRH 1HILA 4G6JH 1XGRA 1BGXL 4WW2B 3OJDB 4PJIE 3G5XA 3KYAA 2XQBL 3WXVH 4I77L 4DZBB 2BRQA 3MLVH 1DBAL 4PJAE 4X6BB 2FNBA 4FS0A 1SY6H 2I9LA 5I16A 5HYIA 2MPAL 2HLAB 3VJ6B 1RHHA 2IANB 3P4OB 4OFDA 3NAAL 3V4VH 3MRHA 2FJHB 4HKJA 2HFGL 4NJAL 4Z7NF 1ADQA 2A73A 2HKHH 1KIRB 1EJ6A 3MJGX 1LEIA 3DROA 3DX7B 2Q76B 5BVJA 5CSZB 1E4WL 1KB5A 2DYPA 3MLPA 3S8WA 4O2EA 4G9FE 3NIDE 4QRPE 4WFFE 1BFSA 4M8QB 2YUXA 3W5NA 4QO1A 1AKJA 3IJSA 2IFFL 5HHOB 1N7ML 4QXUL 1FN4B 4X7FC 3SDYH 4NZRL 3NIGE 4KPHH 1H0DA 3BPLC 4X9FA 1ETZA 1Q9WA 1JUFB 3QIUD 4PRBA 4Y2OA 4BZ1L 1F6AB 1G9NL 1W0YT 4JREC 3U48A 4PJ5D 4I0PD 5D96B 3CPLB 1U91A 4UILL 4YQXH 1JWSA 4LLQB 3QULA 2D7QA 5GS1A 3QYCA 4F3FA 3CH1B 2GI7A 1VADB 4R8WL 3RUGB 1A9EA 5TDNB 2VZUA 3F7QA 1BVLA 5I1HH 4LSPH 3BISA 1VESA 5CEXB 3CX5K 3SY0B 3G6JE 4FQLL 4LEOA 1KCVH 5E2UH 4ZS6D 3UAJC 1V7NL 5D8JL 3LSOB 4L3EA 4NM8H 2PETA 3IS1X 1ED3A 2ICWI 1B0RA 3VXRB 5I8EB 1NEZG 5F89B 4DZ8B 4PRHA 1QKZL 2Z31D 4Q2ZA 1CE1H 1KTDA 3KPRD 1RU9L 4C54A 4P4RB 3IVKA 1TMCB 5KTEH 4JG0H 2EKSA 4PJXF 3U4EB 3G9VA 4J8RA 5L7XH 3DUUA 1UYWH 4NKMB 2VKXA 4NQEE 2R23A 5T5FH 3I50L 3UJTL 3P4MA 3RJQB 5I8CA 4ODHL 2YUZA 3B6SA 3MRIB 4C4KT 2C3HA 4LAQL 1XFPA 3QDAA 1DE4A 3EOTL 2X4QB 2IC2A 4XCEA 1A9BA 4NQXB 1UM4H 2J5LB 2MWCA 4DQOH 4P4KB 4X9IA 4ZOAA 3MV9E 3MZGB 2A73B 5IB1B 5K9KA 3BZDA 1J12A 5IEHB 2X1OA 3VXSE 4GBXA 2BMKB 1V05A 3LEYL 4LLMA 5CJOH 5C3LD 3JVGC 2B4CL 5INDA 1YC8A 2HG5A 3GSUA 4JKPL 1T7XA 1X5AA 1BBJB 5J3HC 43CAA 4ODVL 5CJXA 3IAQA 1MLCA 2APTA 2WINB 1ZMYA 4QYOB 2GKIA 3T2PA 3JWDH 2ZUUA 4HK3N 4V1DB 4JFEB 4FMFA 1S7WA 4DN4L 3T0XA 3ARWA 1IEBB 2VN7A 3NN8B 2YD2A 3BPCA 4D3CH 1JYXA 5D6CA 4J3TA 2FB4H 1VACA 4HK3J 1U8IB 4KDTA 1G0DA 2KZ1B 5T3XL 4GRMB 3EYQC 4XVJL 1KJMB 3BZ4A 1B3JA 1A6WH 4I9WE 4MSWA 1Q9LA 2APXA 2DQHH 4LPVA 5IESH 4UNTA 3BYYA 3GM8A 3LDBC 2VDNH 4PRHB 1GXEA 5F1IB 5HYQB 3DXAB 1KTDB 4U1NB 1FNGA 5GS3A 3NH7H 1KJVA 2ZPKL 2XTJD 5JOEA 5A2FA 5GISL 1CTNA 1KCSL 1LD9B 1WT5C 2HWZH 3WIIL 1B9ZA 4Y16C 3RPIB 3GHEH 3O3DB 1KCKA 3TYGH 3U0PB 2Q7YA 2XY1A 5EOCH 3IKCA 4LCWE 1WQVT 3UYRH 4RNRA 5K33A 2X4QA 4D0BB 2GSGA 4ZOCA 4NKIL