3IKMB

Crystal structure of human mitochondrial dna polymerase holoenzyme
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
419
structure length
355
Chain Sequence
EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into processive human mitochondrial DNA synthesis and disease-related polymerase mutations.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA polymerase subunit gamma-1
total genus 57
structure length 355
sequence length 419
chains with identical sequence C, E, F
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ikmB01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 3ikmB02
1X54A 4HWRA 4XU1A 4HA8A 4XEMA 2CJAA 4YRPA 1J5WA 2ZTGA 4YP0A 4YRGA 4YREA 2AKWB 1SESA 3MF1A 3HXXA 4RDXA 2DZCA 3RKYA 3A7RA 3V7SA 4DQ2A 5ELNA 4H2VA 3IALA 2AKWA 4YRNA 4YROA 4HWPA 4WJ3M 2I4MA 1NJ8A 1W66A 3LSSA 2ZIOA 4PHCA 2Q5IA 4G84A 4EX5A 3RF1A 1E22A 4P74A 3LC0A 3P8YA 2EJGA 1WPYA 3L4GA 2EAYA 4YRIA 4YRTA 3E9IA 1WYDA 2P0LA 2DKGA 2ZZFA 2C8MA 2ZT5A 4YRFA 3VQYA 1X2GA 4YRKA 2E3CA 1SERA 4H2WA 2DXTA 4TQDA 2G4CA 2RHSA 4UP9A 1G51A 2EJ9A 3NENA 3OD1A 4YRQA 1EOVA 1E1TA 3LSQA 4CH5A 3RGLA 2ARSA 2E10A 2J3MA 3A7AA 2E64A 2J3LA 3IG2A 1HC7A 3PCOB 3NELA 3QO8A 1ATIA 2CGHA 1NYQA 3HFZA 1KMNA 3HXZA 3P8VA 4LNSA 2RHSB 4PG3A 3MF2A 4OP0A 3A32A 2I4NA 3I7FA 3M4PA 1HTTA 4TTVA 4XTXA 4NCXA 3IKLA 3UFGA 4H2UA 1WQWA 4AH6A 4BWAA 1SETA 2ARUA 4G85A 2DQ3A 3A74A 4H02A 4K88A 4XU2A 3L4GB 2Q7EA 2ZINA 3BJUA 2PMEA 4YRCA 1BIBA 3A31A 1V95A 3HY0A 3RL6A 4H2XA 2ALYB 3M4QA 3G1ZA 2ZT6A 2FYKA 4K86A 1X55A 4Q6GA 4YDQA 1BBWA 3HXUA 2DTHA 5K1PA 1X01A 2ZT8A 1JJCA 5KNNA 1YB3A 4P71C 4P72A 12ASA 2DEQA 4OLFA 1WQ7A 3QO7A 5K1XA 4YCUA 4H2TA 4ZTZB 4P72C 4P71A 4CS2A 1LYLA 1YFSA 3EFRA 4XU3A 4WI1A 1E1OA 5ELOA 1X56A 4YRSA 4HWSA 1NNHA 2QHSA 3ICAA 3HXWA 3V8JA 1HXDA 1ASZA 1KOGA 3RACA 2EWNA 3WQZA 2ZGWA 4WJ4A 3V8LA 2ARTA 4E51A 1NJ5A 4CH3A 4TVAA 4TWAA 1WU7A 4YYEA 4YRMA 4H2XB 2AMCA 3IKMB 1WLEA 3A5YA 4YPFA 3VQVA 4UP8A 2ZXFA 4O2DA 1Z7NA 2I4LA 3V7RA 1GGMA 2HNIA 4KR2A 3VQWA 2DTOA 4XTZA 4CH6A 2DTIA 1B70B 3TEGA 4X5OA 3VQXA 4H2SA 4ZTUB 1USYA 11ASA 3TEHB 3UGQA 1H4SA 1USYC 3HFZB 3REXA 3KFUA 2ZR2A 1B70A 4P75C 2ZZEA 2PMFA 4UP7A 4ZIBA 1G5IA 1B7YA 3HXVA 1ASYA 2RHQA 4YRJA 4YCWA 3NEMA 3L1AA 2DDZA 2IY5A 1EFWA 2QHUA 2DZ9A 1PYSA 2AMCB 1SRYA 5F5WA 2ZR3A 1NJ1A 3A7UA 3QNEA 3REUA 1WNLA 1FYFA 3BFMA 1IL2A 4DPGA 3HRIA 4RMFA 3TUPA 3UGTA 3DSQA 4XEOA 2ZNJA 4P3PA 4KQEA 3L2ZA 1NJ2A 3QTCA 3HY1A 1YFRA 4KR3A 3ERRA 4Q15A 3QO5A 4P75A 1YGBA 1KMMA 2ZZGA 3MEYA 2Q7GA 4P73C 2CJBA 4P74C 1NJ6A 5E3IA 4P73A 5C52B 1H4VB 3RUXA 4P3OA 1RIQA 2E5AA 3V8KA 1G5HA 2Q5HA 3PZCA 1B8AA 1EQRA 3E9HA 2C7IA 5C51B 1VQZA 2DU5A 1EVLA 2P5IA 4XTWA 1PYSB 2ODRD 1X2HA 2IY5B 2ZT7A 3RKWA 1BIAA 5C53B 1C0AA 4CS3A 1B76A 1B7YB 1EIYB 1Z7MA 4YCVA 3HRKA 1E24A 4HVCA 3EFSA 4YRLA 2QHVA 2ODRC 3TEHA 1QF6A 4P3NA 2E41A 2XTIA 1JJCB 2DJZA 2I4OA 3P8TA 4TVWA 4BW9A 4TQFA 3PCOA 4EO4A 1EIYA 1N9WA 2DXUA 5HGQA 4XTUA 4YRRA 3RKXA 4UPAA 2ALYA 2E1HA 3R07A 3NETA 2Q7HA 3W3SA 4WF2A 3HXYA 3RIRA 2ZCEA 1H4TA 4K87A 4L87A 1YFTA 3HTZA 4RQEA 1NYRA 2DQ0A 2ZIMA 4XU0A 4TVYA 2CIMA 2EL9A 4H2YA 2XGTA 4J15A 4HWOA 2DU7A 2RHQB 2EJFA 2CJ9A 4XTYA 4RQFA 3FJPA 1BBUA 3A5ZA 4CS4A 1ADJA 3V7CA 4TVAB 2DVEA 3HFVA 3UH0A 1ADYA 2LW7A 2E65A 2ZNIA 1QE0A 1H4QA 4CH4A 4XTVA 4HWTA 1L0WA 3CMQA 2QHTA 3VBBA 1EVKA
chains in the Genus database with same CATH superfamily
3FHJA 2QTCA 4MO2A 3OE4A 4DS3A 1PVVA 2IPAB 3F5MA 1MUUA 4V1CB 5EG5A 4AB1A 3OQBA 4N01A 2X0EA 4UBKA 5MGNA 1XTSA 5A3QA 4TTJA 1RIFA 1UM9B 2DP4E 4MQFA 4PXAA 1KPHA 3F74A 3Q11A 5G3YA 1G9XA 1FC0A 3A9UA 5DNEA 1V8BA 1AS2A 3UMSA 4EY3A 3HCBA 4KR9A 1VSQA 4JCCA 4N1AA 4R01A 1FYDA 1GNPA 4NBLA 4RZQA 3MS2A 3KP1A 1D04A 2B1RA 2Q5LA 3KTAB 4R3UC 1WAMA 3WNCA 1PQWA 2FZEA 4Q9JA 4Z4EA 1JV2B 2I3BA 3CGWA 3RKYA 1SXJC 2ZANA 2BEUA 3KZXA 3ADCA 2DY1A 4N0PA 1E0KA 3ZD6A 2WYOA 1FL9A 1XEXB 2BFDB 2OB2A 3MWKA 4MWSA 4ARZB 2AL7A 1GHTA 3S55A 2H63A 4M89A 5KTRA 1W85B 2LUOA 2BYTA 1C8BA 1TT7A 4ZQEA 5IKMA 1V45E 4JLNA 4KPUB 3E5NA 4M3NA 1VMIA 5EIBC 2ANBA 4NS4A 2O8BA 1D6MA 1L8AA 3AKYA 4KGVA 4ZC8A 4ND3A 1DC8A 3UHFA 4IWYA 3V7YA 1Y63A 1M73E 3OTQA 1DPGA 2WYUA 3BXEA 5E4TA 5HUQA 1PW5A 3R9KA 3VX3A 1GRQA 3EXFA 4M8IA 5I4KA 4FZVA 3A25A 4X97A 4NAUA 3LC2O 2B1JA 2BZ0A 3UJ9A 2WTMA 4BLQA 2IITA 3MMPA 5IH3A 3E35A 1Z0FA 5KYYB 2BGTA 4HHEA 3AL0C 2PO5A 4ER7A 1YZFA 3ZU4A 1IZ0A 1L7NA 1E2LA 1KR5A 1OKKA 2BRUA 4IMJB 4Y1RB 3FCOA 3T6KA 1RJWA 2I2AA 4DQVA 2AQ8A 4K28A 3W04A 4JT9A 4QG7A 1YGPA 1I2ZA 3ZI4A 3AWIA 1D0IA 1L6RA 4XUGB 5J4YA 4ZP1A 3GJRA 1CG6A 2REXB 1Z4LA 4UAGA 3FUUA 3HQ4O 3IQXA 4V0RA 1W36D 2HJVA 1BN6A 2P77A 5J1SB 4N49A 3CUWA 3X1MA 2YDXA 3MW8A 1A7AA 1QGUB 1YJQA 4YRQA 3DZ8A 4KAFA 5J9FA 4F8YA 2GAIA 2WUWE 1KZ6A 1YKSA 1TIPA 1GSHA 3H42B 3MCZA 4CQMD 2NMVA 1Y9JA 1LNZA 4PSCA 3EQ9A 4CF7A 3N8IA 3NFRA 4OSEA 3QVSA 2J3MA 4J1SA 4LV5B 4MV8A 5AW5A 1EXDA 1D5CA 1UJ6A 2HU2A 3DE6X 3LX6A 3M9XA 5FOXA 1TF5A 4QATA 3L7CA 3ZIAD 1H8ED 2PGDA 4QQ8A 2W5UA 5JXJA 1IAVA 2IXTA 3NW9A 3PR2B 3QXGA 1NR7A 2CLCX 1CLUA 1WDTA 3H9BA 5F35A 1J20A 2GLXA 4NWIA 4BRSA 1GUAA 2GLUA 1V2GA 1MIOA 2EZUA 3C3CA 1E89A 2H8KA 2C29D 5HA5A 3X2EA 4DCNA 5CXQA 2FG7C 2XR1A 2BT4A 2OR3A 1FTQA 1BVUA 1TAQA 2VUUA 4JKOA 4C22A 1QUEA 3QTTA 3FMVA 3TXAA 4CLHA 2G71A 2VYND 1IG0A 1MH1A 2H0QA 4D8UA 1SKMA 3V97A 2RMKA 2O2XA 1SHKA 1YJ8A 4EGCB 1F2TB 3H84A 1YE5A 2RJNA 2Y9PB 4BP3A 2HOQA 1KKUA 1T9AA 2RFLA 1B6SA 5FL3A 4KPYA 1BFDA 1JG1A 1M10A 2D3TA 3EGEA 1P1KA 4MVJF 4HYTA 5HF6A 3F5QA 5E2BA 4EG0A 3TW4A 1DBIA 3C48A 4OFBA 4YIKA 2LXNA 1IYZA 1Y5LA 2OGWA 2HSEA 2H31A 4DMRA 5BSWA 5E1MA 4AZ3B 1ULHA 3RC1A 2JGDA 3WBFA 1EE1A 4AG6A 3GFQA 3HDJA 2ZK7A 4QO7A 5KEIA 2C2GA 1TQ4A 3CT6A 2P1ZA 1OXVA 1NZDA 1HNWB 1KMIY 1UIRA 3A1NA 1Y5RA 1TUBB 5PNTA 5BQ3A 3PX7A 4XZ3A 2HBQA 1HYQA 2AR7A 1GGKA 2QLFA 3DB1A 2JLBA 2ZT6A 2O57A 1C9KA 5B2EA 3EGCA 4JXKA 3W4JA 1JDBB 4A7PA 3T0IA 1IHOA 1F2UA 3B6MA 1TLLA 3GYBA 1DAOA 2FW0A 2F1OA 3QPCA 4ITVA 2EFJA 2GZAA 5THKA 4DXDA 1UWLA 2Q4RA 3WIDA 2WP0A 2BUCA 4MR8B 1UUFA 1TF7A 3C7KA 3PCTA 2GD1O 2JFHA 4BPRA 1W8DA 4PZZA 5A5DA 1K98A 3W8RA 4XYEA 2JI6A 4JCOA 3CB4A 2FEWB 2O8NA 4IDQA 1CCWA 2VP9A 3O7WA 4LVUA 4LYHA 4DSAA 4B3RB 4OQDA 4RCVA 4F3YA 1AUXA 3FNFA 5AJTA 1WXHA 2VZLA 1RNLA 2FOIA 4NX2A 4MZDA 1STOA 3D6NB 2E5LB 1PT5A 4Y2PA 2C7PA 1T9GR 5L3RA 2DUMA 2OFWA 1Q5PA 4DDVA 1OIVA 1JJAA 1YU6A 2EX0A 3USCS 4BX2A 1SQSA 4FZRA 4R9VA 4L9AA 5J43A 2Y68A 2QHSA 4BZWA 2X5OA 3DLBA 1DEHA 5F76A 2RI0A 1KOGA 3MK31 1TRHA 4UZEA 2M98A 5BN3A 4QTZA 5K4GA 1V1RB 3G7UA 2PMWB 3WQZA 3T52A 1R27A 3TOVA 1SC4A 3CF2A 3T5TA 4AY2A 2ZSKA 2HQRA 1S1CA 4J94A 5IKOA 1GL7A 4B0PA 3CVXA 5CEEA 5HZGA 3I76A 2MSCB 3JTEA 1XVTA 3VZRA 3TAHA 2IPMA 4TZ0A 2ZR8A 1UOEA 4RQAA 3GGCA 1F2TA 3X2FA 1VSUA 2WMDA 3ECAA 4NVRA 4HCJA 3SR0A 4Z9BA 3WP1B 1UBOS 4Y6SA 4AO8A 2PCJA 1V41E 4GXTA 4MVJD 4YAJA 2V7WA 2UV8A 4OGKA 3L0SA 2P2LA 3DXYA 3IIEA 2XHZA 2YFYA 4GWLA 5F3RA 4GKBA 4J0JA 5IJ9A 3C3AA 1MG0A 1ECGA 1MB3A 4FKBA 4KE8A 4D3SA 4C89A 2GF2A 3K0AB 4KN8A 2Y1WA 3VHXB 1ORHA 3R0JA 2JJ1A 1NOJA 3SZOA 5BSVA 5GVSA 1GU0A 3SZLA 5KDDA 1GGMA 1L5HB 1M74A 3QWHA 4RU1A 1YVPA 1UODA 1J1IA 2WWGA 2A58A 2C7RA 2YWDA 1C50A 5DB4A 1V3VA 3I3OA 4ZPXA 2PUBA 4D92A 4UXIA 4TTSA 4AJOA 1RHUA 4BLSA 1UBUS 4FMBB 1G2PA 2WJAA 1E18A 3EGIA 5EWMA 1P19A 3ASYA 1SPBS 1MO5A 5BUCA 3MBIA 4BQSA 3FFTA 4K9MA 1XA3A 1QIKA 3DEIA 4RAQA 4DR7B 5DXAA 3V34A 3MJEA 3A6LA 4WLUA 2IPNA 3G2OA 3FSEA 5ICMA 1DMSA 1NVDA 2I65A 3GLRA 1RM5A 1KOFA 3REXA 1NNLA 3OIYA 4WBNA 1OLUA 3ZEAA 3P9KA 2ATVA 2ONYA 5C8YB 2R47A 1ZNXA 1T35A 3RVSA 3ZWPA 1E3TA 4GXRA 5KOJB 5JIBA 1CE8A 2A4MA 1HPLA 3OQJA 3VPAA 3GVXA 3N0RA 4LYEA 2X8JB 4KXFB 1QO0A 3EDCA 4NECA 3H2SA 1W49A 2YIDA 3QLJA 2WJHA 4D9JA 4KQMA 5K99A 3I4LA 2DE0X 3O1JC 5LFAA 1W5AA 5FUVA 2XYPA 3GUCA 2O2HA 3MSXA 2QHUA 2BIFA 3ABSB 1DQRA 4WNAA 4NXMB 1PYSA 2PM8A 3A8TA 4CMEC 2P3OA 1JWBB 5SZJA 1OFTA 3TSYA 4WZBE 2YHIA 1KAQA 1L5WA 2MSKA 4B6JA 5L3SB 3KUCA 4O2AB 1VKOA 3GDFA 3O9ZA 2VBFA 2GA8A 3BE8A 1FXWF 3OP1A 4LRUA 2XF2A 2A5YB 3PLRA 4XFKA 2F43B 4FT4A 3SS7X 4D99A 5E4YA 4BEVA 2YWXA 1R0YA 1NVEA 1IQPA 1Q84A 1PJBA 5BQPA 4CQJA 4NNPA 1Y6FA 4OHYA 1NY6A 4P36A 2IPLA 3P0RA 1IXKA 4FNMA 3PE4A 4BMSA 5LYJF 1OB2A 2RHWA 1SCKA 3FCEA 4B46A 4DA0A 3IDSA 2HK9A 3NHAA 4Z86A 1JIVA 1H8EA 4F4JA 3DNFA 5HCUA 2BEUB 3E05A 3IV6A 4JP2A 4XLTA 1GCGA 3IQWA 4L76A 5EFOA 2I5PO 2QOEA 3S2YA 2QYOA 3G0DA 3THSA 4MW2A 5AXAA 5CK5A 3AEZA 3OBBA 3KTAA 3HKDA 3AZOA 2XSZD 5ECWA 3W8EA 1B6TA 4FK8A 3WZ2A 2J85A 1DAHA 1FFCA 4DLBA 1P5RA 1QZZA 5FPQA 4A92A 1I6WA 1VSVA 3H9GA 4KR3A 3ERRA 2W98A 4ZVSA 3QO5A 1KOJA 5B1IA 3TDMA 2QZPA 5I7SA 2CD9A 4MQFB 2GM4A 1KI3A 2ZOSA 1JKFA 2FW7A 5ES3A 2IYAA 4BE9A 4UBLA 4QUAA 3V4LA 3FOFC 1R6XA 2ZRGA 3DTTA 4H3SA 4AIRA 1TYEB 4HLUC 5L7WA 1O6FA 4QREA 1U3GA 1ZKDA 1PR5A 4R6WA 1XN4A 4MYRA 4UOZA 1N32B 1WKVA 4JLPA 5IFKA 1U7HA 4U39A 1LI4A 4H1HA 5KYVA 4HEA6 2WOOA 3PQ3A 1T36A 2LCQA 4P3OA 1PT9A 1WUYA 3W2IA 4EITA 2AG8A 3A4IA 3HGTA 1EFAA 1LXCA 3U4MA 2P2GA 4RGQA 3H9QA 2HPZA 3OF3A 3V7UA 2IJGX 1NT2A 2YTZA 1DP4A 2L69A 3DCJA 1G6HA 5IEJA 2Z4TA 4GU5A 1NDQA 3E9HA 1UXIA 1VGQA 4IMIB 1XVUA 4MRSA 3BRWD 1P9OA 4V1CI 3GOQA 3EZXA 1Y82A 1YR8A 4R81A 1OD6A 1R74A 3TB4A 2J4CA 5KSZA 2ZCJA 5F4ZA 1QIFA 4QQRA 1HEIA 5K3DA 5DJ5A 2NYAA 4J4BA 2P2NA 4HDSB 1OJLA 4EJ2A 4BO5A 1PZXA 4AZVA 5IWCA 4D43A 2ZKLA 2V0CA 1DQNA 2RB4A 4FONA 5I8PA 2X22A 2N9UA 3BFVA 2GCOA 2IW3A 2RGXA 5LBUA 3F97A 4QBTA 1X8LA 2Z08A 3EF3A 3KYDB 4EW2A 2BCJQ 3BMOA 5DCUA 1C7IA 5LQKA 4NL4H 1UPTA 2I2WA 2DUWA 4MV7A 1EIYB 4E09A 1ZIPA 3ZK9A 1UWKA 1P2DA 1TUIA 4YCVA 4TRMA 5CCDA 3W9YA 2TMKA 2NO9A 3A4MA 4DV0B 4EYQA 1ZDMA 2H5IA 1QGOA 2YWCA 2P5YA 5HS6A 3NEPX 4J0QA 5KSWB 3I5YA 4WXEA 2XT0A 5DX1A 1NAHA 2G28A 3EH1A 3PU6A 5TMBA 2N75A 2PZ8A 5AW6A 4GGPA 4GXNA 4QDKA 3HY3A 2PRKA 1YS2X 3WGHA 3ERCA 1KAGA 2HFKA 3K1ZA 2K87A 4A27A 1RWWA 4IIJA 4GBMA 4JSRA 2R8BA 1QFZA 1T0HB 4GT1A 4MGEA 3Q10A 5SY6A 1PJ3A 2W6IA 1J4AA 4FMCF 4UPDA 1DC4A 3MIIA 1YIDA 2GWRA 1N6KA 3AR5A 4KK4A 3RYIA 1P75A 3ID6C 1DUIA 3WWEA 1RAIA 4S1VA 4IFTA 2P6UA 5AM4A 1AKEA 1JN0A 2QW0X 3RB8A 8AT1A 4WF2A 1IM8A 5C46F 4UUQA 1PJ8A 1II8B 3VMMA 2FW6A 3FNEA 2IP4A 4IDCA 4L87A 3HTZA 2ZDGA 4KSBA 1NYRA 1HH4A 1OUMA 3GMIA 4DLKA 1A97A 1XDUA 4E08A 1ES9A 5LD2B 3ZGOA 1M0SA 1VL6A 2P5UA 3AONB 3CWQA 3KQSA 4ZV4A 1OI4A 2ODAA 4I55A 2DU7A 2PD6A 4RQTA 1KAMA 1HL3A 1M5TA 2F3UA 5JAHA 5IM4F 1MIHA 4XUDA 3G8YA 2ZPUA 5LB4A 4BBZA 3UJPA 3LUCA 2OQVA 2IHNA 5KTPA 3VYTB 3FJYA 3RU7A 2QZ9A 3RVNA 3SDBA 1YFKA 2R7NA 1O9HA 1J25A 5DKFA 4KXQA 5FWXB 3CMMA 1HETA 3DMNA 3CE9A 3QKSB 4KXXA 5KI6A 5JZVA 2XVZA 4S05A 5EZYB 3DOCA 1G66A 4P4GA 1PYGA 2HF8A 1T0PA 3EVAA 3EZ6A 5COAA 4UEWA 4KKXB 1OYOA 5HKBA 3CFYA 4ZHSA 3SLGA 3D6JA 4PGFA 3C4VA 3E7WA 2PO7A 3VH4A 1IBRA 4IJVA 4PGAA 4I4LA 3A9TA 4WVLA 5C1PA 3WJ2A 1SCDA 4I4NA 1C9YA 3U7QB 5I51A 3BZUA 1W0JD 2QJRA 4YJFA 2EFGA 1YB5A 2FEKA 1IJBA 1H2EA 3H9EO 3A1DA 3AKDA 3AI7A 3ZHTA 1GGNA 5BSGA 4Q37A 5CDTA 1FX1A 3AL3A 3DEFA 1XPOA 1K8ZB 3OZWA 4FGZA 1ZUD1 3CX7A 3L92A 2BGRA 4OQXA 4A1FA 2CHGA 4F04A 4KEAA 1RP7A 4UHFA 5IVPA 3LD9A 1UKCA 2O6HA 3FGOA 4CNBA 5JFOA 1TYAE 4NLLA 3VR5H 5LVAA 1PJAA 1D4FA 4IJWA 3B3QA 3V48A 2E7ZA 1NW3A 2C7VA 1KAEA 2V7TA 1YGYA 2ZR7A 3IALA 1VSTA 1A9OA 2B1QA 2FPSA 2AKWA 3BWBA 3X44A 1JQDA 4DFDA 3IBCA 2CGEA 3EVGA 4E12A 5DM70 2VJKA 3OURA 5FTMA 3TMKA 1Z25A 4JYBA 4YAEA 4CKZA 3LZ6A 5BW6B 1GG2A 3KUUA 4FQ8A 4H77A 2V5UA 3OAAD 4FFSA 4JQYA 4LQLA 5IM5A 3CH4B 4PSDA 3GELA 3KE8A 3FYDA 3QX7A 1Z2EA 2BDEA 4Y0NA 2XA1A 1ZOIA 1EWVA 2R1TA 1J90A 3DO6A 3FPSA 1NM5C 1Q0ZA 5K0NA 1K4KA 1X9HA 4QTUB 2H5EA 5IXSA 4F06A 5KPDA 4QBGB 3RBVA 1TFRA 4FIZA 4KRXA 1DKUA 4U00A 1FS4A 5JYCA 3HS3A 3NNNA 3VH1A 2OBMA 3IO5A 1FUIA 1E1CB 1YZUA 2COUA 5FA6A 1E9SA 3C3PA 4O0LA 3S29A 3DPSA 1J24A 2OTCA 5KTKA 3GFBA 2RK4A 1X2GA 3KKMA 4CEJB 1UC4B 3FX2A 4DV5B 1THMA 4PONA 3H87A 4JBXA 2XSZA 5DLQC 1G1AA 3TJRA 1UZLA 1SERA 3TQHA 4YP1A 2QSUA 3W77A 2PVCA 1BRMA 1D1TA 5EIOA 1H0KA 1M0WA 2QX6A 2VI5A 3UVEA 1DDIA 1R8SA 1U4SA 2V59A 2ECFA 2DAPA 2ZSAA 1P7PA 1KJJA 4LJLA 3O0TA 2RHSA 3RAEC 4UJ5A 1YS4A 3NWEA 2ZI6A 1V8DA 1T3LA 3RS0A 3VYWA 5ICFA 4PG5A 3W2FA 1DEOA 3DJYA 3KQHA 2XUFA 3BIJA 1EVEA 1HZZA 1VB3A 1TTPB 2IRWA 1RSZA 1Y34E 4QDXA 5KWSA 2CDBA 2KYRA 3RGLA 5L9AA 3UTDA 3DMRA 4PNEA 3KZVA 2E64A 3LXXA 1ID1A 3OWHA 4PAGA 4ZU1X 3RLFA 2XNDD 3BWVA 2IELA 1VP3A 4EB3A 2YDYA 3FOAA 1RPZA 2R6HA 2VBIA 3D3KA 4ZO4A 4RKRA 2R8OA 5HIIA 2OYCA 1USUA 4AJ2A 1C0IA 3WDMA 5JE8A 1JLKA 4DUGA 3PUVA 2BELA 4D4HA 2X86A 2YVLA 4F6CA 4CFYA 4EZEA 3G5LA 4PX2A 1HE8B 1FLNA 4C0XA 5JI2E 4KFUA 1NUSA 3VKGA 3N07A 3IKJA 2ZDHA 4FWIB 2WF5A 4P08A 1NQUA 5E6RA 2CGHA 2Q2VA 4CR6A 1XTRA 4ZYUA 5DVZA 2ZE7A 2JL1A 4A15A 5DLYA 3QW2A 4RZUA 1DUSA 5JR3A 2EP5A 4J3NA 4O4JA 2X2FA 3DAPA 4NV3A 1PYDA 2CMFA 4L0CA 5DSTA 1CUAA 3EW7A 4MYTA 1KZ1A 2WUGA 3FSGD 1MCZA 2O7SA 2DB3A 1AKYA 1G21A 1VA5A 3DPUA 4TWBA 1ZCJA 1F0KA 1GKLA 2WSSA 3VPFA 2YNMD 2WMYA 3QU5A 1SBHA 4CCSA 3IVRA 1G21B 3L7NA 3ABRB 2NSHA 3Q7EA 2QRMA 3F96A 3U60B 4OHVA 4QOJA 4CCAA 4OGLA 3OLQA 1GAXA 2X0JA 5AUPB 1IY2A 2PCLA 2QRNA 3BYZA 4UTXA 1OLXB 4LX8A 2DULA 3FUVA 3DO8A 4R2LA 1E60A 4YA6A 3BE5A 1GPNA 1P4HA 2ZRPA 3UFBA 3W2HA 4KQFA 1CJCA 4QODA 3L4GB 2WJGA 2EHJA 4JI4B 1H65A 2WPDD 1CQIA 3RUIA 2Q8NA 4YCMA 5GZ3A 4HZGA 5EJEA 4EUKA 1M5RA 1G7RA 2D2EA 3R8XA 3MNFA 4FMDF 2ZR9A 4OHUA 1KJQA 1IVYA 2PQ6A 2QAIA 2FDXA 1U02A 3MPOA 3PPIA 4IHJF 4ZZ2A 3HBMA 4OQMA 3FDFA 4EELA 2ADMA 4D74A 3HXUA 1FYWA 4ML3A 1FXWA 1W30A 2COEA 1CEQA 2ACEA 4JODA 5FBLB 1NGSA 2IHJA 3HG7A 4JLOA 4BQPA 4D6YA 1PEDA 2GN1A 3P0EA 3THWA 3OPQA 3DKVA 5F12A 4OFXA 1QFJA 2FI1A 1M2OB 4FFOA 4MP6A 4WAUA 3PRYA 2H7VA 2PN1A 4HQOA 3D31A 3W7AA 1VL5A 3NHPA 4EUNA 2QVYX 1M66A 5FOSA 2CXRA 3IE2A 4J7XA 3HA2A 1J5XA 2WHPB 3ENQA 1WMDA 2F8MA 2IHYA 4Z4HA 1A4XA 4P72C 5CIQA 2GKOA 1Z4JA 2QE7D 2MR6A 1U4NA 1XJWA 1SKYB 4O1HA 4XU3A 1L7EA 4WL0A 1KY3A 2W4IA 4TGLA 3QV1A 5TV2A 1Z6XA 5JSZA 4HGZA 2OBXA 4CEJA 2VHJA 2PX0A 4HNAB 3DR3A 1EG2A 3GYGA 4D3XA 1H05A 2EEZA 3UV7A 1IY1A 4B0OA 4LJ6A 2WHPA 4KVGA 3AGPA 1WOMA 1E62A 4GP9A 3LA6A 4JR1A 5LM3A 2NSYA 5JH7B 4LV6A 3O84A 2MINB 2R8ZA 2Z8ZA 1NLMA 4X54A 1P1CA 2BPOA 1RQXA 3CZPA 1PR2A 1PJTA 1REQB 4E03A 1NVTA 4UW9A 1PWYE 4MKHA 2PWAA 1JJBA 2Z83A 3S99A 1F0NA 2EF0A 4KE9A 2EDCA 4Q4HA 3T38A 4E51A 3QBEA 4DCGA 1N7HA 1K5PA 1Z68A 2XTAA 2SNIE 3E15A 2HI0A 4OBXA 2Q4BA 5EJ8A 4LWPA 1QNLA 3OHMA 1XZAA 1Y3DE 3RSOA 2QLJA 3PJEA 4UDXX 4KO8A 3O3MB 3SHFA 4CLRA 3TFOA 4WE3A 3KQNA 1R8XA 3HCEA 5DOVA 3VNSA 1HDRA 1LS1A 1OXTA 1Z5OA 2XMQA 4RL4A 1M2HA 1B4DA 1PJQA 2PJZA 2R8XA 1LPBB 4OYLA 2B5VA 3N8KA 3WMWA 2WICA 4GVXA 1CD5A 1BNCA 3QLVA 5CH8A 3LK6A 3NEAA 1UFOA 2OV8A 3TQRA 4AUKA 3RRFA 3DHNA 4GVPA 4BGDA 2C7GA 1R5BA 1ZN9A 5AKYA 5F51A 1BOOA 3EDRA 2WF7A 1LEHA 5JALA 2VAXA 1GNQA 1WE2A 5B64A 1E4EB 3TOCA 4D0RA 5JO9A 4KR2A 2B4QA 3VQWA 4YCNA 4HPWA 4XTZA 1G7TA 4J0HA 2XRYA 5LXTB 4XR9A 2VEOA 3RIEA 3U7QA 4EO9A 3L1JA 1AMNA 3ILHA 1B16A 1K3UB 1B70B 2BMDA 2H11A 2CSXA 3R7FA 3ZE1B 4IS2A 5BMVB 1SXJA 3QWFA 1W5EA 3ENKA 4QUDA 4JLJA 2YJZA 4QXRA 1H2BA 1VG1A 5K0EA 2J0SA 3ZWVA 4D98A 3BQNB 3CX4A 4YHBA 4IXNA 3G9ZA 2QRQA 3ST7A 2Q45A 2GJSA 2IUEA 1UBEA 4XPZA 1PLKA 3JQ7B 3FTPA 5E6RB 2OOKA 1UDRA 2PIDA 1F4PA 2XE7A 4M7OA 1OXBB 3GOHA 1ZOOA 1GCAA 3IS3A 4MWBA 2PMFA 3UAVA 3B6IA 2AF4C 4HUQA 1QQBA 1DRUA 4OL9A 5EUCA 4ZIBA 3WGUA 4GUDA 3TB6A 3GT7A 4C06A 1UJBA 3M2TA 2XQKA 4IV0A 1WCIB 3H4TA 1XKXA 4MGYR 1IWOA 1T4BA 3E2MA 1CLEA 1P2BA 1U1IA 1ZITA 4NZYA 1LPOA 4BEWA 3OLZA 4MA5A 4RA6A 7YASA 4MV1A 4K9OA 2F59A 4P7FA 2QLNA 3VR4D 1WW2A 3EEOA 5MN5A 2HF2A 2VWGA 2OHHA 1II8A 4KDEA 2WSLA 1Z12A 2XLCA 3FPCA 1QO9A 3LZDA 3EFOA 4D1YA 4ZFNA 1O96B 2X9VA 1UT5A 3G17A 2UXDB 1DKQA 1YZVA 4DAEA 2PPLA 4Q4DA 1G5RA 2DT8A 1MQAA 4XH9B 2V6FA 1GZ6A 4GNRA 1P8AA 1P81A 4EPRA 4B2YA 1UDCA 2I7VA 1I33A 3KR9A 3DWIA 2W6OA 3REUA 5F2KA 2HYIC 2OVFA 3JQ8B 3IBSA 1FYFA 4KRFA 3BFMA 1IL2A 1TMOA 3CH6A 3PDIB 4MK4A 5LJIA 4BO4A 3DBRB 1LVHA 1FRQA 5G41A 4Z1MD 2SECE 4QBIA 4YCJA 1KVUA 2WEKA 5CLLA 3H9JA 4V39A 1J70A 1V35A 1JH8A 1LBSA 1OGJA 2ZB2A 4PLCA 4W9RA 4P3PA 4MV6A 5TEVA 4D45A 3O8BA 5JCXA 1RC8A 1JR2A 2NVWA 3R41A 3ZXSA 1L3CA 2OXTA 4QRDA 3IIKA 4BBAA 5JEDA 1ZPDA 4ZGGA 2V6MA 3C15C 3NIWA 4CT4B 1FUEA 4FQ5A 2P3LA 3KPWA 2BUBA 3QG5A 5ER9A 3PA8A 2Q46A 3PUIA 2X8WA 1Y7TA 1YR3A 2X40A 4IQ8A 1K6XA 1XMIA 4L07A 1YGBA 1EQ2A 4ARCA 1QS0A 2OD2A 3W3ZB 4AW9A 3TRHA 2GEDA 4IVPA 1LPSA 2JIDA 4IJKA 1JLRA 2BY4A 2YNMA 2OV2A 2GARA 2AN5A 1R8JA 2YWGA 3PQCA 2C98A 3NDJA 3WXBA 2HWWA 1WMFA 5LZ9A 5C52B 4HDSA 4JJ7A 1V39A 4DL9A 4BYGA 5CT5A 1ZIDA 4IJMA 2X0IA 3I83A 4DCCA 4C0BA 5C7OO 4FUQA 1JHXA 2VLBA 1AK9A 1K5HA 1ZI9A 3HY4A 4BCDA 1TRKA 3EWAA 3LHFA 5DI9A 1I7LA 4E2ZA 3A0UA 2BJHA 3R3UA 4K26A 1U2ZA 5IBQA 4LXGA 2JLUA 2NP6A 4UFNA 4F38A 1MKYA 3LJKA 3UQZA 5JOQA 5LN1A 5KVQA 1KJIA 5KWEA 1FS5A 1PJZA 2DKOA 3HPQA 2EXXA 3DDCA 3O21A 1KO4A 1HSOA 1T5IA 2JW5A 3H18A 4MEBA 3TZQA 3DTNA 1KEPA 2XUDA 2O7QA 1KC1A 1EXMA 2H4HA 3DAOA 2QAGB 4H0CA 4RL6A 3V80A 5CB8A 3R5FA 5KJCA 3SCZA 3AVTA 3L7OA 3SS9X 5EZYA 2Y6UA 2W00A 1QRRA 1RBZA 4K6MA 1YTLA 4QPPA 4ZA2A 2XZLA 1RWNA 3D4OA 1LQTA 3OFJA 4GMKA 3SQNA 1LI7A 3OIWA 4UNQA 4MVWA 2BEWB 3KR1A 3V2UA 4EZBA 5C1IA 1DAFA 2IYYA 3I42A 2ZWPA 2HK7A 3LRXA 4EENA 3NP7A 1O4VA 1TM7E 4RFSA 2YCLA 2FUKA 5BXYA 4Z3OA 1F38A 2D7DA 2H4XA 4J1NA 5FUWA 1MFPA 2JK1A 3P4UA 1J9EA 3EAFA 4H4DA 1NQVA 3MERA 4I66A 2Y4OA 5BW4A 1AUVA 3A6EA 3CLUD 3HCNA 3MGBA 1G60A 3VU0A 4HVLA 2QR3A 4B3GA 2X0FA 1AO3A 4WFJA 4WADA 2AOXA 1SKAA 3EBOA 2KM1A 3CLVA 3IMEA 3INGA 5CX1B 1RI1A 2FDRA 1XD2B 2I3ZA 3DV0A 2IP2A 3DXZA 4IDEA 1LRJA 4DG5A 4B82A 4I1UA 3NTXA 2GXAA 4DKJA 1FVHA 4Q3BA 1EP2B 1V3TA 2PRYA 5DTJA 1Q74A 1PNVA 1YACA 4M7PA 1GZDA 5HGQA 5KTNA 2AQKA 4GUAA 3UC9A 4HX9A 2QTNA 4ER3A 2D4AA 2ALYA 4OXYA 4F4FA 1YHNA 3GARA 4PXYA 1NX6A 2VYQA 4AIIA 5BY2A 1DO0A 1U7ZA 2YZKA 1SC6A 5CH5A 2XMBA 1KS2A 3EMKA 1NLYA 2C8JA 2GZRA 3IXLA 3NOVA 5CA1F 2UYYA 2I91A 1ECLA 3OQNA 2GNAA 3UAGA 1P7VA 3OX2A 5D1HA 2YX1A 1PL8A 2PSHA 2W6ID 5H0IA 4E88A 1IZ9A 2ZAOA 4H6WA 3FCCA 1J2YA 3LYHA 2BSQA 4N39A 2W2XA 3TTVA 3L43A 1RKVA 4OREX 1BWQA 3IVAA 1NBMD 2OD9A 1X1RA 5EQDA 1OFVA 4AAYA 1M34E 5EI5A 2E89A 1ZIYA 2MWMA 3ZIUA 2NUTA 1Y37A 4NAHA 2C84A 2A8YA 1CR1A 3I6IA 2O7VA 1KMQA 3N8GA 4FR2A 1Z34A 3OM8A 4MHOA 3ZV5A 5LQAA 4LJYA 1ILEA 3LCRA 3JZFA 4U3JB 1SOUA 4WW0A 2FVYA 4F72A 2L18A 4O8ZA 1DIOB 4RZHA 4N48A 4RKFA 3PUJA 2QTMA 1Q2UA 1M5UA 1JAHA 2HA6A 3NUGA 1VCMA 1N8SA 4DVJA 2ZM5A 3F6BX 3H1AA 1E3DA 2JCGA 5B4UA 2H7XA 4I1OA 2B25A 1UBRS 5HJ5A 2BFBB 1I1OA 1E5DA 2VL7A 3MD9A 2XOKD 5DP2A 4YRPA 1G8PA 5ECGC 3P4XA 2PA0A 4DREA 4J75A 2DH5A 5SZHB 2FNAA 4C21A 1GU7A 2I1QA 1MW8X 2IYRA 2IE0A 4MGHA 3VHXA 5FUYA 2EIXA 2XDAA 3Q7TA 2C5EA 2OC4A 1YKFA 5A6SA 2BFFB 3H4VA 2IHVA 1NNEA 4RUKA 1H42A 1Z5PA 4XSVA 1AKVA 2ZJ0A 1H1LB 5LNK6 2DEUA 5HBRA 3QFRA 3RYFB 5JDCA 1PNRA 3B9BA 3PENA 2XODA 2WAMA 3UW3A 3GHYA 1ZD5A 5JY1A 4J7UA 3OFVA 4S0ZA 5FLXA 1NNUA 1NU6A 5JPDA 3PWSA 5BNWA 3MN1A 1DG3A 3FN4A 1QZTA 5ALKA 4HNRA 3UAYA 1ESMA 1ZCFA 2OZKA 5FD8A 5FBZA 3ZWCA 5CBPB 4EX5A 1WXEA 2C2HA 4B34A 4P74A 2I1WA 5BWNA 2NTVA 1A88A 2RSLA 1DL5A 2AEEA 2AFIE 3DKKA 3JQBC 4FLEA 4L8LA 4YGYA 3TCKA 3IPRA 5CD1A 1Q0PA 5DEOA 3NB0A 4L5JA 1HOTA 2WHRA 1E98A 3UHOA 3QUTA 3HU2A 4YIHA 4FN4A 4J0IA 1FJXA 4MVYA 1VRWA 2VNIA 3T7EA 4MRNA 4MGIR 1T15A 4FILA 1IOVA 4GS5A 5G0WA 2B2NA 4UE6A 1QXSA 4IQGA 3H2YA 4MRRA 2CNNA 2QJFA 5K9ZA 3IVXA 3STTA 5BYAA 5EYPA 3KSUA 1T1EA 3R3JA 1CB7A 3GGOA 3QXCA 4FT2A 1O95D 2IZ5A 1F8UA 3Q5GA 2MYUA 1U28A 2BSAA 2H4FA 1YS1X 3DLTA 3LO8A 3O8RA 1AZWA 4G4IA 4C20A 3QFFA 4GM4A 1SB8A 5G0VA 3KAJA 2HJHA 1UEXC 4I6GA 4HAIA 4BQIA 1QHGA 3HMKA 3N3BC 4XI9A 2VDUE 4Y2QA 4LBVA 1BHJA 1U8TA 2WJ6A 3B1XA 3X1YA 4OK3A 4JEHA 4JVNA 1Q7GA 1CUCA 1D07A 1MTZA 1P2SA 1UZMA 2WFMA 3H11A 5EKSA 4NNJA 3I72A 4UAJA 4RVFA 5CGQB 4YECA 3BH7A 4WOPA 3W5BA 1J5EB 4R5HA 1ODLA 4PZ9A 3EPJA 3MELA 5K01A 3A7EA 3L6DA 3FGPA 1E2MA 1ZNYA 2DHQA 2QM0A 2R751 3MM4A 4NZ9A 2BMJA 1P31A 2QUBA 3P2OA 4Y2RA 1Q0QA 1N3BA 4GL4A 4ZQCB 3SKYA 3W7VA 1E77A 1SUBA 1HC7A 3CSSA 4JJIA 4I9GA 4QC2A 4PZAA 3IPCA 4ALNA 3B2NA 4L6CA 4EK9A 2ZZMA 1IY0A 3CKLA 1F3LA 2RGCA 3CO0S 2VATA 2VNJA 3HJNA 4KIJA 2FP4B 1SKQA 1AB6A 3PYMA 4IO0A 4L6AA 4LJKA 4N7RA 4RHYA 4TN5A 4Y2SA 5LYYA 1PEKE 1L9XA 4NDAA 3OE7A 4A8JA 2X2PA 4I9FA 4QLBA 4AZ3A 4B3CA 5AVQA 1CZKA 2Q3EA 4Z5XA 1JR3D 1E3QA 2OHIA 2PRJA 3BGDA 2B78A 3I04M 4P33A 1K7XB 5L8VA 5HKKD 4F71A 4B2IA 4MGKR 5K45A 3OUTA 2Z1MA 4QPDA 4FE3A 2HAEA 3EPPA 2DTXA 2A14A 1ST3A 4UBMA 4WZBA 5I8WA 1L3IA 4TTVA 1ZH0A 5AVXA 5JJLA 5D84A 4IUYA 3OWOA 1HT2E 1QHIA 4TYPA 4H2UA 4IWNA 4MS3B 5KJEA 1OWOA 1ANKA 4AH6A 1ZNWA 1YULA 5GJWC 4YQFA 4ZYXA 5EHNA 2MIIA 4NCKA 4NU8X 4PIPA 5FTJA 5CPFA 1N7IA 1PHRA 2D8MA 2WU3A 3GUUA 3ICVA 1MIOB 2GNOA 6GPBA 1BKSB 3QOWA 3EW9A 2BM9A 2OZLB 4LYAA 1HY3A 2FSVA 1XZBA 7REQB 2ZINA 3MBKA 2A0KA 5IJ9B 4HDKA 4U2DA 2BZ1A 4K8OA 1YJBA 2OHVA 4JDUA 4MULA 2R1ZA 3LV8A 4KFTA 4WCVA 3GY0A 2C7BA 4GPTA 5TGZA 3SY8A 3ETNA 3P2KA 2J30A 4M0FA 4DR5B 3KLPX 3EQ8A 1KA9H 3A4LA 2YFKA 5BO5A 2YZ2A 1RWVA 2F1KA 2NT3A 3ABZA 3ND5A 1U3CA 2VF5X 4LWQA 1RYHA 1QQ6A 3E1SA 2INGX 2OCGA 2DTHA 2DBVO 3F49S 5GP1A 5BNFA 2WKQA 2J4FA 5K1PA 2VZ8A 1LK7A 5C31A 4D5EA 3TL3A 1QGUA 5FNZA 1FYVA 1HR0B 4BVEA 5MDHA 5EIXA 1TK9A 1I3OA 1NW6A 1Y8QA 3KOMA 1PWZA 4P71C 1ZAKA 3RHSA 4WDQA 1TECE 5EP4A 4HD8A 5FWNA 2CE7A 4QEZA 4NOKA 3P2IA 3WQSB 2JPDA 3RABA 2XV1A 1TD9A 2YWJA 4B83A 4ZTZB 2GRUA 1BE0A 3CVOA 3RC2A 2ZIWB 2M6SA 3DVAA 4TKZA 4EY5A 2VLIA 1YIAA 1H9CA 4URFA 1TK3A 3RARA 3F6CA 3UXYA 2QLLA 3MRXA 2FCAA 1D2GA 4Y1RA 5EJ9A 1S2IA 4RZIA 2GD0A 2DFDA 3R6DA 1SCBA 5F64A 4Q3LA 4W63A 1C2TA 1DBVO 2FUCA 5HYVA 3HXMA 2NADA 1FFGA 2JLSA 2IYQA 3OJLA 2PL1A 3IEIA 4ZEXA 1FVFA 3HXWA 1E7SA 3ETDA 3EXFB 3K5PA 1QANA 4UPVA 3EZYA 5ADHA 1G17A 1U8YA 3PNKA 1G0OA 2FGKA 3RACA 3IOCA 4K2HA 4D9BA 1C1DA 4KWHA 5EPEA 1JL3A 3W8NA 3VR1A 2JFQA 4YQEA 1TX4B 1SUCA 1WUHS 2QTGA 3BORA 3H8VA 4U63A 3RHFA 4BLWA 2LVBA 1HL7A 1CUSA 1CQJB 1Y48E 2SBTA 3CF6R 1U0RA 1G6KA 3ZHSA 2DU8A 3V8LA 1TVKA 4MWTA 1JLMA 4X71A 1EDOA 4ESEA 4DR3B 1RU3A 1J6UA 1P9LA 1LDGA 3D3JA 3O94A 4HOYA 4I7EA 1CUVA 5ALXA 1J2RA 5AT1A 3RAGA 4DQUA 3M3HA 2XIJA 3L8MA 4PG8A 4HDOB 1J1ZA 3G23A 1RAFA 3IJPA 1LC0A 1M2GA 1ZI6A 2RBEA 3BD7A 3O03A 3O38A 3EAGA 4B35A 4BMCA 3CNHA 3FD8A 3GAMA 5KINB 4ALJA 2BDTA 3DO5A 2N0SA 1T2AA 2WWTA 4DLNA 4MLZA 2ANCA 3CQ9A 3HN6A 4ZRDA 5TJHA 3N1UA 4UP8A 2JGDB 1BDBA 3FCSB 1ELOA 3NG1A 2AFRA 4PN7A 1CQXA 1RBQA 4LHSA 4RIGA 4H7JA 4K40A 1T91A 1V5WA 1I2AA 2FWBA 4OOFA 2IBSA 3I9OA 4B45A 5G0UA 1QFMA 1Z62A 4G0VA 2ZAIA 3T0FA 3LPAA 2FX3A 4TYQA 5IK2D 2XVMA 4WECA 5JANA 3TMAA 5J40A 1YTUA 3G2PA 3BH6A 3LDUA 1XDWA 5FOTA 5AJZA 4JQCA 3P32A 4OQYA 4XDHA 4CL3A 4LI0A 2VJMB 3L1UA 4JNKA 2JLCA 4E3WA 4ZEOA 3PA6A 5BURA 1R9GA 4KI7A 3E3OA 1GRRA 4HX5A 1P6UA 4X1YA 3R0VA 4ENUA 5GIOE 2O3QA 1WHSA 1Y89A 2R6DA 2GCIA 2HH9A 2WIFA 1BCRB 4FHCA 4X65B 5EEHA 3P9RA 2JASA 3MWEA 1GXSA 1AQIA 2FRXA 5DGDA 1QP8A 2R8EA 1V0JA 3C3JA 3Q9UA 1SVLA 3LY5A 3OZAA 2ZP1A 4K05A 4AF7A 1KTIA 4JXXA 1OHHD 3FTQA 3OMXA 3E0QA 3M1LA 1MOPA 4FYWA 4HVAA 3UT5A 4OXQA 1YVEI 1GZ4A 1Q21A 1V3UA 1HT1E 1SUFA 2Y1FA 1G5IA 3VZCA 3E3NA 2CEKA 2FZCA 1HG1A 1BJKA 1ODCA 3BIFA 1FLVA 1RLIA 3CNBA 3P4YA 4LXQA 3VSCA 3NOXA 3AXSA 3SEQA 1CF2O 2VHUA 1O57A 1PFYA 4JLDA 1ZXLA 3DZCA 5ALNA 3WLIA 2C0PA 2RGUA 5FTNA 3TL2A 4BMDA 1Y3AA 2QRHA 3DUFA 3ZDBA 3AJDA 4RC9A 4RGYA 2I6SA 2FUG6 4UTOA 3V8QA 5IFLA 1SY7A 1MAHA 3GRVA 3CUSA 1SH7A 3GCDA 3H9CA 1E1DA 2BGMA 1U90A 4MZXA 3ED1A 1QM5A 1CUEA 5DYYA 3V4ZA 3E2IA 2ZUVA 1NJ1A 3GT4A 4RWZA 4TWZA 4EBFA 3DKPA 4BNDB 4C2AA 5I7VA 3K2BA 3SHWA 4BNWA 4G1CA 2NUTB 9ATCA 3AJ8A 2DHCA 1SCIA 4ZWNA 5DT9A 2FOLA 5KQPA 1SU4A 3T5CA 1GPAA 3FNQA 3I05A 2ZSBA 3HRIA 3HH8A 2EGHA 1CQJA 2VHZA 4CPDA 3PDUA 5I9LA 1N33B 3DFFA 4IHJA 2VTVA 3TX6A 5HRCA 4OP3A 3W5CA 3NH6A 1YUBA 1YK1A 4OHCA 3WR5A 1HZZC 3ZQ4A 1UBMS 1CS0B 1DCFA 4DJEC 5H9WA 1VL0A 3R4CA 1CIJA 1Q3KA 2JEOA 3BD9A 1GZSA 1AGXA 3C98A 1PTKA 2H2GA 3CLHA 3GFPA 4H6VA 4PHHA 5KCZA 3HY1A 1Z28A 2CUTA 4DQLA 1CEEA 1GSAA 2GEUA 3NHFA 4X1OA 3ZY3A 4UJ3A 1C7ZA 3P9CA 2JATA 1A7JA 1NBWB 5DEIA 1JR3A 1E3IA 4YACA 3RFUA 2AJDA 1M67A 2AT1A 3C24A 3EIXA 5FBKA 5EEGA 3ICCA 2WPNA 3VI4B 2VDRB 4B5LA 1UAGA 2QYTA 2VKQA 5E2IA 3ZW9A 1WZNA 4ZAYA 4ZT4A 5EUQB 4JJGA 1E94E 5IJWA 3GBSA 4RVNA 3NKVA 4ON9A 4BX0A 1KK2A 2CJBA 3QBDA 4RJLA 1RXWA 1XGKA 3SM3A 4P74C 2W2KB 4QT4A 4B6PA 4ZYWA 3T7CA 3AH8A 1H4VB 2I29A 3IPLA 3N2KA 3PXCX 4EATA 1AD2A 1DTEA 3WSVA 4N3AA 3RUXA 4P7BA 5FPPA 3TCNA 1X7XA 3VOSA 4GI7A 1BXRB 2I2BA 1XMPA 2OO5A 3IQGX 3R5XA 3U3ZA 4PNPA 3DZIA 4H16A 4C4TA 2XWQA 4CQMA 4AG3A 1N5OX 4YN3A 1B8AA 4C4RA 2AR9A 4NZMA 5MF6A 2BEWA 1UBFA 4G0WA 3HXPA 5AW1A 2QENA 2W6ZA 2QN9A 2ZU0C 3GPIA 1CW2B 3I2HA 4ILEA 4UQOA 1M8FA 1UJ5A 2C9ZA 4A0FA 2R00C 4F86A 3HVRA 3DMHA 5KKAA 1LPNA 1TK2A 1TPYA 2FMHA 5GOZA 4EHKA 4N6OA 3LLCA 1ZR4A 1V48A 1TO2E 5CT8A 4TOIA 3B8HA 4I14A 4NYJQ 4CTNA 1LPAB 3H4IA 2LGJA 2IZ6A 2MCFA 1V1JA 1Z4PX 3EDYA 2WV7A 3KHUA 2Z6QA 1H2AS 2P65A 1PUJA 5JLJA 4C0WA 2R2AA 1S7GA 2LDBA 5GGXA 4PS1A 3GHHA 2NSDA 3ZEIA 1FCJA 2A5LA 4JUIA 3T4PA 5KTMA 5JTTA 3ZBQA 3KQWA 1BU5A 2ZBUA 3ZGNA 1XVIA 5JSKA 3HRKA 5DM4A 5KVVA 4CCYA 1T26A 1RS0A 2Z3ZA 3F7MA 4RHUA 3HXKA 2GESA 4YK7A 3UV6A 2CVFA 4B5KA 2E3JA 4YDHB 5FUBA 2QHVA 4GX2A 2Q1UA 5IDQA 1O0BA 1NE2A 4C4AA 4MW7A 3WLFA 1R3UA 2LPMA 4ZICA 3TEHA 5TGDA 3UQYS 1SVWA 4A8JB 3HPRA 2J08A 2E41A 4Q9LA 2OK8A 4FR5A 2YMPA 1WNFA 1A5SB 1YZQA 2NO0A 2W7TA 3UMYA 1I4EB 3GK3A 2G9ZA 2FFRA 2GBPA 1P1IA 2HJGA 3E1GA 1VQ1A 3NHWA 4H08A 3U39A 3ZV6A 2UAGA 2ZG6A 3BQMB 3L7KA 4ZK2A 3DWGA 3GEDA 2HT6A 3DZBA 2GYVA 2O8DA 4CVNA 1W1UA 3UTCA 1IU9A 1USIA 2GPBA 3H05A 2VRCD 4KO4S 3AQIA 1T9GS 7ADHA 3PXAA 1D3AA 2RAUA 4KH1A 4KMSA 4AO7A 1NHGA 2VEDA 5KNCH 4GMXA 4BWGA 2JA1A 1OZAA 3ESXA 5IVIA 3AERA 4GX5A 4MVJE 3K5HA 2AFIA 3C74A 4JP3A 1C2YA 1KTVA 2D0PB 1FW6A 4B47A 4DC0A 2CHUA 5DTEA 2EGUA 4M60A 1UDBA 1X6VA 2ZIXA 3CLSD 3CRNA 3FYUA 1EFRA 3KBBA 1BXKA 1I2MA 3AOEC 4GR5A 5FR2A 1V1MA 5TVGA 2R5NA 4IIBA 2IH2A 5J2TB 2VBGA 1VMDA 3WMFA 2ZWIA 2CJ9A 4LC9A 4DJTA 1W1WA 4TTQA 1TQHA 4BNUA 4OQFA 4CMGA 3V7CA 1H0RA 1JI0A 2C9YA 2PKCA 4LDNA 4URUR 5EXSA 5C4IA 2DUJA 4M98A 1CF9A 1LS6A 3DT9A 1QP4A 4IH9A 1B6RA 4DMLA 4BLPA 4TLDA 3HFVA 3ZHOA 4BVJA 2J5XA 3NDRA 1J0CA 5IG2A 2O59A 4GG1A 4YXWA 3TX2A 4HPXB 1XK6A 4HDNB 4YASA 4IV8A 3VZQA 2AOWA 1RHRA 3TJMA 3GGDA 3AHCA 4I0WB 3PQ6A 1MPXA 3PI7A 2PKQP 5BQ5A 1Y1PA 4GBGA 4REQB 3PQ2A 3H2GA 2P9JA 4G5HA 2PX8A 5FI3A 3UXHA 2X5KO 2JFPA 5JHGB 3EGXB 3HEBA 4OYYA 4MW0A 1P4JA 4RULA 1OQAA 1DKPA 4N9QA 1VL8A 2DWUA 1VBNA 2HO5A 1JQBA 2X76A 1V7ZA 3JALB 4IUBS 5C1OA 3JAMA 4D57A 5HJ7A 4L50A 1JH9A 2C42A 1XA4A 1FE8A 1YI0A 3CGGA 1GG5A 3L93A 4NCNA 1FUKA 1A95A 2OBBA 3D7NA 4QSHA 5C18A 2AI2A 3B1KA 1QHHA 3VH2A 1PFWA 1WVMA 5TE9A 2O6LA 2XNJA 4R8SA 2I67A 5GVRA 3FLBA 2ZZNA 3STWA 3JQ7A 1H1LA 2HN9A 2WAOA 1EXWA 4LQCA 2V1XA 4O6VA 1JMYA 2X6TA 2CFIA 5DH9A 4UBOA 1GTG1 5L3VA 5CITA 2ZRHA 3AJAA 3C4JA 3NHRA 4WCFB 2PS0A 1W36C 2BFMA 5L51A 3EA0A 2PSEA 4IH1A 1R12A 3GD7A 4JB8A 1PVOA 2A9JA 3ETLA 1YL7A 2I6QA 4XVHA 2OO3A 2RGNC 2P0YA 3OZBA 4RD3A 4UZSA 3CF0A 3W1EA 2JJ1D 4I1PA 2IX3A 2Q5IA 3U4QA 1GG9A 1XG5A 2YOHA 4X6XA 2CL0X 4AM8A 1U1FA 4ZVRA 3W06A 2GCPA 3DMFA 1WPYA 5FYDA 3CZMA 2IUYA 2EFEB 3C87A 5LU9A 4G0YA 3GPLA 5KSOA 1JYFA 5T4HA 3KG2A 4HQ0A 4ZOQI 1RW4A 3QQ5A 3K70B 3LLVA 2D74A 2P8JA 4YRTA 1KQPA 4JBNA 2B20A 2QLMA 5K1ZA 4R1NA 2JIZA 3AJ9A 4AS2A 4FB4A 4TYWA 2X7XA 3C2QA 3C8DA 4L5BA 4HEJA 3V8RA 1CEXA 1JQ5A 3IAUA 2I22A 1EESA 2V9PA 1OGYA 1B1AA 3L7LA 1PV4A 2R7AA 4AMGA 2Z9BA 1Z0JA 2FQWA 4XOIA 4P7KA 1U6KA 4TTIA 5AK5A 3V33A 2P0AA 3VR5D 2DGDA 2YUIA 4PQYA 5KOYA 2E3CA 1L7QA 3UUWA 4WA7A 3LVQE 2CK3D 3G02A 2IYSA 4M1SA 4LBZA 4Y7DA 3RVRA 1KY5A 1ZH2A 5JCZA 1SC3A 2BJVA 1SEVA 2I4IA 4I46A 2FB9A 4EVIA 1F9AA 5D00A 4LNUB 4ZIRA 4BQQA 4YAIA 6PFKA 2HMTA 3AEKB 4X6YA 2XWSA 1XV5A 1E4YA 3D2AA 3EE6A 3AUJB 5CURA 3PXGA 1ZUIA 1EOVA 4AP5A 1K7CA 3EMDA 4D3DA 5IAAA 3IOMA 4B2PA 1DC7A 3QZUA 4CH5A 4RF3A 1TJ3A 4PCLA 4D9CA 3FPLA 4UBIA 3RK4A 3RVJA 1VPEA 4C4ZA 2P6MA 1UM8A 3RTAA 3BZWA 3JAKA 4M9SA 3K8YA 2VTKA 5BRAA 2JIBA 4RJKA 3HGQA 2IVZA 2CLKB 3T41A 3RPEA 13PKA 1G5PA 5KMGB 1M1ZA 1TC2A 3R77A 4RVOA 4JL8A 2Z2ZA 4QDUA 3L1IA 3MGAA 1JFRA 1KARA 1YOVB 5JAMA 4HFJA 4UREA 2Y27A 3UHJA 4B3FX 4LJ5A 3OFND 4X92A 1J1UA 3D6AA 1WQ3A 2H4JA 3P9SA 1OR8A 4DIBA 5JSHA 3ZUPA 3QHPA 4YWJA 1MD9A 4HXYA 4LFBB 1IRIA 4UHBA 2QAGC 2XJ9A 4C0HA 2IT1A 3PXXA 4S12A 1QAQA 4E5SA 1C80A 1S2GA 3FBGA 4LISA 4JYZA 2EG9A 1X70A 3K8OE 4G0OA 2EC5A 8LDHA 3C0KA 4OI4A 2AK3A 2O8EA 4EKIA 5C32A 3VR6A 4DW8A 1KZ7B 2QTRA 4L74A 5AIAA 4CM9D 2ZSIA 3AHFA 1Q0LA 2F48A 3LU1A 1RPTA 3ZK7A 5JASA 3LCMA 3QLEA 4V0OA 4H4CA 5BUZA 4RVUA 3F71A 4Q16A 1F8GA 2EARA 2CLSA 2NZVG 4BWAA 4B3SB 4Q3DA 2HD4A 1QH8A 4PICA 2CJYA 2MSLA 2OWDA 2VP5A 2FFQA 5TB5A 5BPFA 3T1VA 5AVWA 5J47A 3RD5A 3WLHA 1NWCA 5C5DA 1PR4A 2HX1A 1CQPA 5T8KC 4XVUA 1OLXA 5FPKA 1JB1A 3HVJA 2RKBA 3T0GA 3IA2A 2FGJA 1XU4A 2O3SA 1EHCA 1XP8A 2O1SA 4I4TA 4HMQA 5LDGA 3TPCA 3KQPA 5L6MB 4W99A 4RADA 3R5HA 1IJEA 3A6KA 2YRWA 5HTKA 4ZMRA 3R76A 1CDOA 3G1ZA 1T3GA 2G08A 4QOEA 2IHBA 3TTSA 5JFTA 2C5BA 4EW3A 1T3ZA 4LRWA 5LP1A 4FFWA 3OTHA 1BW9B 1ADFA 2GCNA 4RORA 4DLWA 5ALVA 1F2DA 3IKVA 4L5IA 4TV9F 1OPRA 3RS3A 4AP9A 5B4VA 1CDEA 3GZTB 4PWYA 5C8VA 3WBBA 4G5XA 4CDNA 5JZOA 2JHGA 4AT1A 5E4JA 5IAEA 2MHCA 3B82A 4RLSA 5M04A 3ADPA 2AXPA 3TUJC 3RSZA 2Q28A 3T5AA 3K72B 2F8LA 3YASA 2BBWA 1LYLA 5JG7A 3HJGA 4LC0A 5CFMA 1QIIA 3BMQB 2EKLA 3BL5A 4LSMA 2XZTA 1NVUQ 5EHGA 2AJCA 4M4SA 5EN4A 3ITKA 4P4SA 1PL6A 4QOIA 2AVDA 4LY6A 1L8QA 5AP9A 1NXOA 1QMGA 4K9KA 1PE0A 3FDZB 1ULSA 4IR7A 4RA9A 3AI1A 1L1FA 4DT1A 3T1HB 3ZZUA 1FIUA 5FADA 3WLRA 3HO1A 5AOCA 3KUXA 2R1VB 1GYQA 3EA4A 1CVLA 3ZE8A 1TQ6A 3CINA 1JDSA 1C4KA 1KP2A 2XGMA 2W4QA 4DRXB 3EIHA 2KLBA 3AZQA 3DFZA 3BE4A 2JGNA 2XBUA 3JCZA 2FPGB 2IYTA 5A0TA 4HDNA 3CY6A 2ZTSA 4TTAA 2YZMA 2AGVA 4R8RA 1GNVA 1BQEA 3KFXA 1XTKA 1OAAA 4UHEA 4X6UA 5YASA 1NJ5A 1IK4A 2BM1A 3WWCA 4A16A 1A9QA 2WD8A 4D82A 5FEUA 5K8CA 2BHNA 1Y6RA 3H6KA 1B7GO 3KJXA 2JJMA 2HA5A 3KKKA 1A8SA 1TCUA 3NATA 3QFCA 4P84A 1KS9A 3PNSA 3EASA 5C7YA 3CG4A 1R0BA 1OBVA 2PZJA 5J1TB 1WB9A 3IEMA 3K35A 4ASUA 2WWYA 3UF0A 5G40A 3U31A 4DBLC 1E63A 3WXMA 3JATA 1U2EA 3GRAA 4L08A 2B1IA 1IZZA 2X8BA 2ZIXB 3VQVA 2VF8A 4Q9HA 1YRAA 1ECPA 1JF8A 3BXZA 3C39A 4B9AA 3OCCA 2AJLI 2O3RA 4WK6A 2XWBF 3CH5A 3N05A 4AN0A 1QX3A 3AR8A 3L02A 2AEMA 4NH0A 3B70A 5IASA 3UPUA 3JXEA 1JT2A 1NW5A 3JD2A 4RSRA 4W6ZA 3V8MA 4PQRA 4U6SA 5LOVF 2F90A 3LC7O 1Z5WA 3IMGA 4ZAXA 2ESRA 2P9ZA 1TF2A 2BZGA 2QZ4A 4GC9A 4TL6A 4AD8A 3QOYA 1EK5A 4AY3A 5JNTA 1HEUA 3FCAA 3FUTA 3FWPA 1S8OA 1Z8NA 1XQYA 4GKJB 3QVJA 1X94A 1ODSA 2QIOA 4IIHA 1JPJA 1SZDA 2O0MA 3TQCA 4U9UA 2R4TA 1QGDA 4ZZIA 2MOKA 1UZNA 2Q3CA 1LY1A 4BTLA 1MC8A 4R2XA 1DAEA 1RKQA 2Y99A 1Y33E 1Z2AA 1U8CB 2G82A 3PK0A 1IHUA 4KPGA 5FBRB 3HFZB 2HCRA 3UOGA 2NU6A 3PZBA 5A06A 5B3JC 3WNBA 1O94A 3DHYA 3MS7A 3OF5A 2WJ4A 3CPSA 2Z1NA 3DFIA 4TSRA 1I5RA 1XAJA 2XMCA 3PHCA 4NP6A 4CGZA 2O0JA 4PO9A 4ZJPA 2I3DA 3UKDA 2REQA 1KL7A 1GYRA 1HE5A 1LWOA 1R0CA 4KJXA 2FOXA 5BSUA 1W4AA 4BNLA 4EI2A 3JU3A 4GQAA 5I7AA 2IYNA 3PC7A 1RFLA 3KEFA 4DLYA 4E7PA 2QPOA 4IGEA 2VH5R 5C35A 4KR6A 2OHOA 1D4OA 2CWWA 5CNKA 2WUVA 4IYRA 4EG1A 1VL2A 2CDCA 3JS5A 2ZCVA 4RDCA 2QJWA 3SNKA 1K9VF 3HFGA 4RS4A 1JHVA 4JB3A 2DZ9A 2W2PA 3GJTA 1Y7LA 4PR0A 4J0DA 1H6BA 3AIIA 1SRYA 4P8RA 1GGFA 3A27A 1IN5A 2QG4A 3QKSA 2AVNA 2VDVE 3FE2A 3ZVNA 4AKHA 4D4JA 2IYXA 1ZY2A 2DPXA 4CLRB 1N0HA 4WLVA 1PR6A 1ZSVA 5K2MA 3TFQA 3BCRA 2Q1SA 1HLGA 3B1FA 4H0FA 4KAAA 2IS2A 2XE6A 3LZCA 3TQTA 1VCHA 1NIJA 1UDAA 4FEYA 4F3TA 1JZSA 4HAOA 4BLOA 2LD4A 1I14A 4I81A 2VO1A 4BKOA 1RKXA 4NFHA 3DBOB 4P6VF 4F85A 3AB7A 3O4HA 4MUKA 4U7PB 1A7UA 2YIJA 4DA6A 5JS1A 1FZTA 5FLEX 4I50A 5CMLA 3SXUB 3IPAA 5ULLA 2ZNJA 1QH1B 4F2WA 3DZHA 3BCUA 4LJ8A 5C7LO 1T1SA 4CR7A 1NF3A 2Q0QA 2A3NA 3I28A 4Z0TA 3M4NA 4BZXA 5KYGA 1QDLB 4RTRA 2IDZA 1BMDA 4FHZA 3U09A 3W5HA 2D5LA 2ZEJA 3NASA 5AI4A 5EVCA 4F97A 1O5IA 3KXKA 2O19A 1KJYA 5K8VA 4D4KA 2PNFA 5IJ0A 2JGRA 2AG6A 1KDYA 4WV3A 5DT2A 3AVXA 2GJAA 3FPGA 2P68A 3RRZA 1WIWA 3MEYA 2VYFA 2RGNA 4IDHA 1CULC 1WXQA 2VJBA 2ZSJA 4NHEA 3UWDA 2I9KA 2EYUA 4I1SA 4ENSA 4EPVA 1BGXT 1QKIA 3BWMA 3PCXA 4FEAA 1JIUA 4GBJA 4YRDA 3HYLA 2QORA 4DA8A 2BGWA 8ATCA 2BKVA 5FBQB 3UHAA 4QSMA 3QENA 3AP3A 3H1TA 2HJRA 5HK9A 1E2GA 3Q85A 1M2JA 4Z8YA 1I7DA 4R9NA 1NJSA 5B12A 3OEHD 2E5AA 5AW9A 4C6SA 3K8ZA 5KQGA 3M5WA 1FPQA 1DBPA 2HNAA 3OU2A 3Q0TA 4CN8A 3AB3A 4NQRA 2O07A 5G4KB 3EXHB 1HQDA 4PLTA 1W4BA 4TRNA 3IB6A 1N6RA 3RU2A 3TG2A 2P6NA 3IL2A 3TM5A 5ELXA 2H16A 521PA 3SF0A 3M6AA 5LZ4A 1HURA 1D03A 1SCAA 1PV1A 4H3KB 3WVNA 3VHQA 4URVR 2ODRD 3CZ5A 1J2JA 1DAMA 2YXEA 1LDBA 1R6TA 1WR8A 2KPOA 4U7JA 5J2UA 4YUWA 4HH1A 2HTEA 3B8EA 2QYHA 1JR6A 1JMVA 4P9NA 1Q6ZA 1ZN8A 2FK7A 3AUKA 5E9AA 3HJAA 3M6MD 1CNEA 1NYTA 5T8KA 3C43A 1E69A 3CRW1 5TR9A 2IOYA 1VLZA 5LDDC 4HTFB 4Q1EA 1SVMA 2OLKA 3ND9A 3CYFA 2XNHA 1NLUA 1JSZA 3N2EA 4H7KA 3AETB 4PSAA 3LOUA 3O6VA 3TLCA 1KPIA 1X92A 4GM0A 3WB0A 1FBTA 3ZLBA 1E1QD 2J3HA 4U2EA 4O4JB 5JARA 3ODGA 4U7TB 2PKYX 3LX5A 3Q8KA 3BGWA 4CM3A 6ABPA 1E99A 1EUZA 1BCRA 2IYEA 2JZNA 2WFZA 4ONEA 4V24A 2JH9A 3RDPA 2Q1TA 3UBTA 2O8FB 2ZWOA 3UAOA 4H1VA 4UXHA 2XTIA 1X80A 3GV0A 1BKDR 1AQUA 4BL5A 4MLCA 5H83A 5LSAA 3VZSA 4H7HA 4IVNA 2BTEA 3GGSA 5GPBA 1F5SA 1G55A 1ZK3A 1IEWA 1BXZA 3HY6A 1RI4A 4PSKA 4DJAA 1PWEA 3O7MA 1E5XA 2VHTA 4JXZA 4HGPA 1FMFA 3P9IA 1J8DA 1SN7A 1DEXA 2AHOA 2FAXA 3FHCB 2JBAA 3VO1A 4DYVA 1J56A 1VJRA 3SSOA 4E5KA 1SQ6A 4PS0A 1X7YA 4LHEA 4DV1B 2CDRA 3ZWKA 3HBNA 2BH2A 1KRHA 2FRDC 1UMCA 5CB4B 4AYXA 4P31A 2VHWA 3MLEA 2P2SA 2IOFK 1IN7A 5B3AA 3BTVA 4POOA 4CXMA 3MJVA 4C7OB 1E6EA 3NVAA 2EL9A 2AG5A 4XXHA 5L6LB 1WPQA 3KXLA 1ZM9A 3OJOA 5ARDA 5G1PA 4ALLA 3ZJYA 4TSFD 4DV2B 4KFSA 1AT1A 1UXKA 1MRZA 3X43A 4RQFA 2YY6A 3MWYW 2EFHB 2IIQA 4K3VA 5BSMA 3NHKA 2VVTA 1JAZA 4UQPA 4Q7KA 3AF6A 3NQ41 3NWOA 2WSBA 3THRA 1ADYA 2XUKA 3FOZA 3SE7A 1Q0TA 1MU0A 1V1MB 3QEOA 1MZPA 2FW8A 2XF8A 3EC7A 2VOEA 2WB2A 3NBKA 3A1CA 3F4BA 4OUDB 1YC2A 2QUAA 3DLCA 1SCUB 2OP0A 4FPXA 3ROTA 3VC3A 3KQOA 3ZBUA 2Q3JA 3RVPA 3CLTD 1KFEB 2Z8XA 1RHJA 5ER6A 1UKYA 1HMPA 1RYNA 1OZGA 2Z9CA 3KLNA 4KP7A 4JI7B 5I6DA 4DZTA 1G8JA 1CRQA 5CAEA 1A8IA 5BSKA 4IF6A 3KQLA 4KCGA 4QD3A 2YBEA 2DQYA 1PSDA 5PGMA 3WK6A 3GA5A 3QU2A 5DZSA 3WKDA 3KSAC 2XDQA 5CFQA 3FOEC 2P3SA 1CE8B 3N6VA 4EMBA 5KOJA 2HADA 3PS9A 4KQHA 1LSOA 1RZUA 5AW7A 2AKWB 5LQMA 3RH0A 1HYEA 4MPJA 4R16A 4Y7CA 2UZ1A 3CZQA 1DX4A 5E7QA 1GPMA 1Y98A 2AFHB 4Z3DA 4RDXA 2YHSA 5CUQA 1U8AA 2HUNA 1JFFA 4JAVC 4KQIA 4EUEA 1OH6A 4ED9A 5HMMA 4BATA 1JHYA 1M6EX 2GBCA 3UJ7A 4NBKA 4JITA 4OATA 2J9ZB 3WA7A 3BFPA 1QG2A 2CJXA 4FBLA 3KEOA 4HWPA 3K0CC 3HI6A 3ORHA 5AW0A 1TVCA 4D8YA 2Z2IA 2F3RA 5CNIA 2DLDA 2C54A 4DJ5X 3ZZTA 1ZMRA 2AQIA 2BP7A 4W7IA 4WJKB 3FJOA 4G84A 3SYNA 1E22A 4RLFA 1S0UA 3ENWA 1AQYA 3GCXA 2JG3A 3LF2A 2DQ4A 4M9ZA 3WLMA 1XDZA 4FNOA 2FHSA 1JKMA 1NW7A 2QTVB 3GEPA 4K5QA 5BT9A 2CXNA 1AK2A 2GYWA 3VYVA 4N5LA 2AH5A 1EJ0A 3EUWA 1XU7A 2Q41A 1KP9A 2OGTA 2WZCA 4GYJA 1A9YA 1W46A 4C5AA 5HS4A 4Z4QA 5A7FA 3IDZA 2QN3A 1RXCA 3BSWA 3GUZA 2WNSA 1A71A 3FDJA 2PD4A 3QMPA 2OQRA 4KACA 5CGZA 4G9GA 3DEHA 3WWZA 5DHAA 1OFIA 4RXMA 2WC1A 2RI6A 2RHLA 4OK6A 3SDZA 3VQYA 2JHAA 4AJ4A 1RHKA 3M4JA 3OPMA 1XYVA 1K5DA 2BP7B 3UCFA 3EDMA 5H82A 1E96A 3MUEA 3F90A 3PGVA 2RHDA 4FFPA 5A6VA 2LTAA 3G1TA 1UR5A 1VE7A 3NHLA 5ICGA 1V2HE 2D54A 5AUQA 2WHYA 2NUPB 1EA7A 3EN0A 4O8CA 4AUNA 5KVAA 2AZMA 3QVLA 3KC2A 3C6KA 4ZMBA 5ARCA 1IXZA 1L4EA 4UP9A 1US8A 3E70C 3I4CA 4X1IB 2PBLA 4TLEA 4F7DA 2VAWA 5HR5A 5KYUB 5EXPA 4UVIA 1U9CA 3UJ8A 4F92B 4NEHB 1EFKA 1AZLA 3RU9A 3KZKA 3LSQA 1HYGA 1WPXA 3FBTA 4LXYA 3S40A 4BN4A 4DV6B 2FW9A 2W8BA 2HHHB 4KPEC 1R6AA 1V6SA 1A8QA 3B2QA 1CJVC 3AR7A 3CNQS 4QRIA 1U4OA 4URYR 1Z16A 1QDEA 3NUQA 5F1PA 3KLMX 1PZEA 5DBEX 2PE5A 1DEAA 3DAHA 3HKBA 5IRCD 3H16A 4ZYVA 4JLAA 5IAKA 3QITA 1E4VA 3UNXA 1AURA 5F52A 2FQXA 3CKYA 1ISSA 2I7TA 3I58A 4NICA 2ZS7A 2XKBA 3L40A 4Q39A 3VZPA 4AQ7A 4AU1A 1HG0A 3AUYA 4RZ3A 1SG0A 5CAEB 3CISA 2LRHA 3K16A 3HVIA 1ARZA 1DEKA 3DGFC 5GGYA 4RVHA 3BK2A 3MEQA 4MAFA 4AY6A 3MJFA 3U3MA 4RH1A 2FETA 1P1HA 1N75A 1FRVA 4Q9DA 1ZH8A 3JQBA 4LDPA 1FNSA 2GZ2A 2PVPA 4MW5A 4C0SA 4ZZ1A 3GMTA 5LC1A 3CZRA 1DKOA 1Z2DA 1GNSA 2D62A 4BBJA 5AVSA 3ZNOA 2PX3A 2WJPA 3CX8A 3QNWA 4RJJA 1K8XB 4CKXA 4EGFA 1M33A 2B4TO 4D4MA 1SWVA 1HT0A 3O4FA 4TMWA 3HM9A 4BVAA 2QM8A 3I52A 3BA6A 4BFXA 3IBYA 2H5JA 5KNCA 3BMOB 5CM9C 3CKMA 4BNDA 2WK1A 4Z7JA 2OCBA 4QRHA 1L9KA 1MFZA 2ZIFA 3UKJA 1TUBA 3TRDA 4QJ3A 5KTTA 3TKAA 2D2XA 4UD2A 3MJSA 1O8BA 2W11A 4FBGA 3U13A 1DTWB 1LDEA 2QU7A 4HDMB 2IV7A 3GRFA 4GLJA 4AMZA 4B76A 5B7QA 1E1QA 2EBHX 5D3KA 1XF9A 5E8JA 3T1YB 1YE8A 3ZH9B 4FSHA 4UULA 4B8YA 1JQLB 3K05A 1A1VA 1B0UA 1QGED 4Q19A 4UATA 1NATA 4JSTA 1QVWA 3R0QA 4ZC1A 3RJZA 5IF9A 4W5NA 5LIPA 2FYKA 4D8VA 2CMHA 1SR8A 4L8FA 4R1LA 4A2CA 3ZZMA 3FETA 4F1WA 1EM8B 4ZGBA 4G0QA 1JDNA 5KHAA 3KX2A 2YXPX 3MWEB 4E14A 1EINA 5A9RA 3OOYA 5B58C 2ATIA 3A06A 1X01A 2OLEA 3FZEA 3TRFA 4CIAA 5HUHA 1SVKA 5SZKB 5BYBA 2WJVA 4ZV9A 2AEFA 4QLAA 2CZGA 4X1YB 1Z17A 4GEKA 3WK9A 5JAZA 2YNMC 2EVWX 1WL8A 3G8AA 1PR1A 3HB9A 3T7RA 5ALZA 1UZAA 5JPCA 4P72A 2BFFA 1KF0A 3WQRA 2ZE6A 5C8ZA 2I8CA 3H04A 2P0EA 2C61A 1Y6JA 4PPNA 4W5WA 4H2TA 1Z15A 3HUTA 4OLAA 3GJSA 1QRTA 2HMUA 1VE3A 1GFSA 3A14A 5E6SB 4C2BA 5CVTA 5A4DA 2AD5A 1YASA 3RFVA 1E1OA 1MNAA 3HJCA 1GFWA 4ZXPA 5KWVA 5KNLA 4DLLA 1XPRA 3AEQA 2FPIB 5HNKA 4MAAA 1KYIA 3WRYC 2Z5FA 1K0UA 1E64A 2WWIA 2FY8A 5EHZA 4O4HF 2WYIA 4M99A 1KMHB 3VDNB 4JGGA 4UHCA 2BFPA 3X1JA 3RRYA 4KLRA 3V8PA 4EMSA 3SVTA 3JARB 5IC6A 3A36A 1FDOA 1JXMA 1TJPB 2Q21A 3ABIA 5DHTA 4AVYA 3RSQA 5BWLA 2M1ZA 2FPLA 1DADA 5IW8A 3RT7A 3SOZA 1IM2A 5JRJA 2G1AA 2JAUA 1QRDA 4MVJI 4OMFG 4UDYX 5KUTA 1MJGA 1SBQA 2CKDA 4J2TA 1Y80A 2VJLA 3JAWA 5JSQA 2J67A 4GHWA 4YRMA 2OFOA 4B9EA 3IQEA 3ZQ6A 4G56A 3EVNA 3SSMA 3C3KA 5G4LA 2YICA 3FNIA 5A5GA 2FH5B 1ZRHA 4EO7A 4DLRA 4XE5A 4OJQA 1F0YA 3OCZA 2DPGA 3TD6A 2J45A 1RXSA 1ZXXA 3QM1A 6REQB 4YPFA 1C41A 3FYCA 4IH4A 1E6KA 3IX7A 1I3LA 1TMGE 3ZLTA 2XGSA 5BOSA 5KX5F 1M2VA 2J9YB 1P2UA 1KI8A 5FP0A 2JDID 1TGVA 3Q4GA 3QLVC 2UDPA 3V7RA 2D0IA 1B8PA 3HJFA 4FMDB 4A6XA 4FR0A 4OX9B 1COWD 1JG6A 1FB5A 1QH0A 3AM3A 4YJ3A 1N2IA 3RG2A 4A5SA 4ASUD 3CW8X 5ERYA 4WLNA 1VLVA 5CDFA 1G8FA 2PZKA 3AEUB 2IV3A 1W85A 4DG9A 3L5OA 3R0XA 2YMLA 1MVNA 1JAXA 4JWKA 1ONSA 4PO1A 4WHMA 1S2MA 3ANYB 3WLSA 4W5TA 4O2AF 2AOVA 3JRNA 5DIZA 1L1RA 3G9TA 3OEEA 4ZYZA 1WKCA 2OQIA 3RNOA 5H16A 5D87A 4CKBB 3QVKA 4HC4A 3HYNA 3ZJ5A 1DKNA 4BUCA 2KSQA 1SU6A 3AJEA 4ROSA 1QFXA 3GRZA 4V02A 3LUHA 3U7JA 1Z74A 3OT4A 3CUTA 5T4BA 5T67A 2IUSA 3L8HA 3HR8A 1G0NA 1TQ8A 3E9EA 3AGQA 4V0QA 2HQOA 5I7EA 2MSDB 2ROQA 4ND2A 4N8SA 1EFVA 1XZFA 4I99A 3LHIA 4V0SA 1A27A 4XQEA 4PZUA 5GZ1A 1ODTC 1LDMA 1NUQA 3I4FA 4HDKB 4MHSA 2CV0A 3WGNA 4B09A 3HDYA 4FMPA 5CLHA 1ZEMA 3MCAA 5CLQA 4B1FA 4E5VA 4W7HA 1Y5IA 2X1VA 3TNYA 2DDZA 3KRTA 3WAJA 1VDMA 2GK6A 3RE1A 3SS8A 3N7AA 4XIGS 4Z2AA 5CFRA 4NCBA 4XWTA 1RAEA 5JNSA 2G9UA 3W9SA 4H60A 3U56A 3Q3JB 4RK1A 2HSWA 3KXIA 2ZR3A 3CEHA 4I36A 3O8NA 3GFVA 4FOTA 4J0CA 1RCUA 2OBNA 3MOGA 5AK0A 3I61A 5K0CA 2IOHA 2NU8B 1ZRMA 2XMDA 3DQQA 4NEQA 4ZZ3A 5KKCA 4FD3A 2H1VA 2HHLA 3V32A 2CT8A 3RS4A 4F9GA 2NSLA 2HC9A 1T5OA 4E22A 2A78A 2J7KA 3NYIA 1H8HA 3EIOA 5B2ZA 1DT3A 3OSZA 4XIYA 1W19A 3JSXA 4RSHA 1RYZA 1AF7A 3E5MA 4FCVA 2NU6B 1YCDA 2QUIA 3IOBA 4EB8A 1C4OA 3LKVA 4G63A 2C07A 3ZE2B 4F2DA 1TCVA 4ZT7A 3OLVA 4DWJA 5EJ6A 1Z82A 4I5EA 2B99A 4COOA 1EVZA 3RS7A 5BRJA 4E13A 2R6ZA 2X19A 3BGOS 1MHTA 2ZJ7A 4W4TA 4JLVA 3IAFA 1GA1A 3L5KA 1NJFA 1M1XB 1PQPA 2PZLA 2KW5A 1GTMA 4D6PA 2B6NA 4EF6A 2YW2A 3TW6A 3K30A 4C5BA 2X7HA 2QT0A 3HGMA 3MCWA 2P4HX 4G2TA 1T5DX 4HF7A 3JRWA 3EGDB 4PIMA 4C0AC 1B14A 2FEPA 1ZMTA 4OM7A 5CLJA 4DLSA 1QHYA 2DBYA 3BB1A 4CM6A 1JS1X 4Q02A 4E46A 5DNDA 1SXIA 1YRYE 3REOA 1OBOA 3AF2A 1U0OC 4Q4LA 4MMZB 3VKVA 4YV2A 3MTGA 3GAFA 4P73A 1N5RA 4BMZA 2D2IA 2Q9BA 2W37A 4MIKA 5EMLA 4JJFA 3SQOA 3MTDA 2WAYA 3TPZA 2O5EA 2WYHA 2C2MA 5U4XA 2J0UB 4JK3A 1WABA 3F98A 3OZTA 4LJAA 4Q6WA 4QFCA 1RIQA 2XX3A 3T1TA 3CMCO 3FRIA 3OTWA 1RDFA 1UK7A 4JLBA 4PLVA 1ZM2A 2PXHA 3IAM1 2R6R1 4U7WA 2BGIA 5CHYA 5G2OA 3TLBA 5BWOA 2BHRA 1JTEA 1YRQA 3N2GA 1XZJA 4QWWA 1A5TA 3G1UA 3JQ8A 5DM2A 3HYSA 1M1YB 2Q4EA 1HDIA 5T5QA 4WXPA 3O0DA 4URHA 2SKDA 1UBLS 4ZREA 5AOBA 5E7MA 4AZ0A 4KPFC 1CP3A 1ZK0A 3L18A 3ADBA 2QDXA 3G7SA 3SM9A 3QVXA 4B3TB 3GF4A 2P5IA 3D7KA 3ESYA 3SC4A 4FE4A 1NF8A 1O0CA 2CN1A 3PX2A 2PX2A 2OHGA 4JQZA 4CKWA 2KBEA 3JASA 4RVDA 5ALYA 4G8DA 4BCCA 3A3NA 1NUHA 4A91A 1C0AA 3BREA 1Z6GA 5CXUA 3OE7D 5ADVA 1KP3A 1J2TA 1Z6TA 2JANA 3HEMA 2RKOA 3QQPA 4RPJA 5ALQA 4AJ1A 1AH2A 2BLNA 1VKJA 1EGHA 3DSRA 5EP3A 3RUDA 5KO2A 3V9AA 3VUFA 4BVFA 4A10A 4CKYA 3K0BA 1CJSA 3B7WA 4OMUA 3NYQA 4DY4A 4EKEA 4YAKA 4HUQB 1K7SN 4XWWA 10MHA 1GU1A 3TKLA 3GLHE 1UOOA 1DX9A 3PBKA 1ILWA 1G4AE 3ED5A 3VGPA 4NU5A 5JD6A 2A8EA 1ZJ5A 3KUDA 4JA0A 4YP7A 3VO8A 5JAPA 1QJ4A 5BSTA 5AVZA 1J0XO 2QM3A 1PR9A 1WD7A 1CYDA 2DJZA 1RYYA 3B3JA 3BH0A 5K3FA 3T7DA 1N2CE 2PQ0A 4NBTA 2C8LA 1YZKA 4WERA 3ZW7A 3OCWA 1JI3A 3B1YA 3PWTA 4AP6A 3QEBZ 2FDCA 6LDHA 2WABA 4C6TB 1NUAA 1FJGB 3MWJA 1QTQA 2VTEA 2YZNA 4EBBA 4LSWA 5AHRA 1Q77A 3K5WA 1D7OA 3ZDFA 3RIGA 1N5LA 1EUCB 4FJ0A 2WT8A 3LP8A