3IKMB

Crystal structure of human mitochondrial dna polymerase holoenzyme
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
419
structure length
355
Chain Sequence
EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase subunit gamma-1
publication title Structural insight into processive human mitochondrial DNA synthesis and disease-related polymerase mutations.
pubmed doi rcsb
molecule tags Transferase
total genus 57
structure length 355
sequence length 419
chains with identical sequence C, E, F
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ikmB01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 3ikmB02
4H2VA 3P8VA 2ALYB 4OP0A 1QF6A 3HXZA 3VBBA 4YRLA 3L4GB 1SRYA 2QHVA 4H2XA 3IG2A 4H2TA 2EWNA 3UGTA 4BW9A 4DQ2A 2ZT7A 4YYEA 2ZGWA 1EVKA 1NJ2A 1WYDA 4P73A 3EFSA 2EJ9A 3E9IA 1B8AA 1NJ1A 4XU2A 5ELNA 3L2ZA 1G5IA 4P75C 1YB3A 2DVEA 3HTZA 1BBWA 4XU3A 1L0WA 2ZNJA 3RKYA 1V95A 1WLEA 2AKWA 4Q15A 2LW7A 2I4OA 3A31A 4UP9A 4RQEA 3PZCA 4TVAA 3MF1A 2G4CA 2ODRD 2C7IA 4P74C 3V8KA 4HVCA 1X55A 4ZTUB 4YDQA 4CH6A 5E3IA 2DTIA 3TEHA 3V8LA 4ZTZB 3L1AA 4YP0A 4H02A 3VQXA 2ZR2A 1Z7NA 4HWPA 3A74A 1KOGA 3MEYA 2CIMA 1SETA 5C51B 1WQ7A 3TUPA 4E51A 3A32A 3RIRA 4KR3A 1PYSA 2EJFA 2DTHA 4K88A 3REUA 4XTXA 2DU7A 2DJZA 3VQYA 1H4SA 4H2SA 2DZCA 4H2XB 3V8JA 1JJCA 4TTVA 1WNLA 4YRPA 1VQZA 1N9WA 3LSQA 4KR2A 3PCOB 1HXDA 5ELOA 3ERRA 3OD1A 4YCWA 2ZZEA 2ZNIA 3RUXA 2IY5A 11ASA 5C52B 3LC0A 2P0LA 2Q7EA 2Q5HA 3A7AA 4TQFA 5K1XA 4P71A 2RHSA 1ASYA 2CGHA 4HWOA 1WPYA 4OLFA 2E64A 2XGTA 1HC7A 3I7FA 2Q7GA 1B76A 1NYRA 1NYQA 4WI1A 2XTIA 3PCOA 2ZCEA 4KQEA 3RKWA 2AKWB 2J3LA 3MF2A 2EJGA 3NENA 2CJBA 2ZIOA 4TVAB 1EQRA 3RACA 3RL6A 2EAYA 1X56A 1X2HA 1USYA 3W3SA 2HNIA 5K1PA 3HXWA 4BWAA 3QO8A 4H2YA 1HTTA 4TWAA 3TEHB 1SESA 3HXUA 2PMEA 1J5WA 2RHQA 4YRCA 3A7UA 4YROA 3ICAA 3LSSA 3A7RA 4P73C 1USYC 2E5AA 4XU0A 2ZZGA 1E1TA 1PYSB 3BFMA 4WJ4A 4NCXA 2DTOA 4HWRA 1H4VB 1C0AA 4UP7A 2EL9A 2I4NA 5KNNA 1YFTA 2ZXFA 4XTZA 4HWTA 12ASA 2ZZFA 4CH5A 2FYKA 1JJCB 1GGMA 4P72A 3UFGA 2DEQA 1BBUA 4YCUA 1EIYB 4YRSA 2DU5A 3HFVA 2IY5B 1E1OA 3NEMA 4P3NA 2ODRC 4RDXA 3V7RA 3E9HA 4TQDA 1H4QA 3P8TA 1RIQA 1BIAA 4CS2A 3BJUA 2RHSB 4YRRA 4YRFA 2I4MA 4YRNA 4YREA 4RMFA 3RKXA 4UPAA 1YGBA 1LYLA 4CS4A 1EIYA 2CJAA 1ASZA 1G5HA 1WQWA 1WU7A 1E24A 3HRKA 2ZT6A 3P8YA 4XEOA 2P5IA 2J3MA 4YRMA 4YRIA 2AMCA 1KMNA 3QTCA 4J15A 1SERA 3A5YA 3HFZA 1YFRA 2Q5IA 1EVLA 2DXTA 2RHQB 2ZT8A 2CJ9A 1X54A 2E10A 3IKMB 4H2WA 1G51A 3QO5A 2ZTGA 1NJ8A 1E22A 4P71C 3A5ZA 1ATIA 2E3CA 4PG3A 5C53B 1B70A 1IL2A 3QNEA 3M4PA 4EX5A 1FYFA 4HA8A 4WF2A 2PMFA 1NJ5A 2C8MA 3CMQA 4XTYA 4ZIBA 1QE0A 3FJPA 4YRJA 4CS3A 4XTVA 4HWSA 3HY1A 2E65A 3QO7A 4P75A 3IKLA 4G85A 1X01A 3G1ZA 1Z7MA 1KMMA 1ADYA 1NJ6A 1B7YA 4CH3A 4O2DA 3RF1A 4WJ3M 4P3OA 2ALYA 2DDZA 3TEGA 3VQVA 3HY0A 4YRKA 4K86A 3L4GA 2E1HA 1NNHA 4P74A 3R07A 4YRGA 1W66A 4XEMA 2ZIMA 3UGQA 3RGLA 3REXA 2DQ0A 1X2GA 4X5OA 1ADJA 4UP8A 2ARTA 2E41A 2QHTA 1YFSA 2ZR3A 4XTWA 1EFWA 3V7CA 1BIBA 4P3PA 3V7SA 3VQWA 2ZINA 2DKGA 4K87A 4CH4A 2DZ9A 4P72C 2I4LA 3M4QA 2QHSA 4YRTA 4H2UA 3HXVA 2AMCB 1H4TA 3HFZB 3EFRA 4AH6A 2Q7HA 3HXYA 2DXUA 4PHCA 2DQ3A 4YCVA 4EO4A 1EOVA 4Q6GA 2QHUA 1B70B 4TVWA 4XTUA 3NETA 4L87A 2ZT5A 5F5WA 3WQZA 3KFUA 4DPGA 3IALA 4G84A 4LNSA 4YPFA 3NELA 3HRIA 4RQFA 4YRQA 3HXXA 4XU1A 3DSQA 4TVYA 2ARUA 5HGQA 3UH0A 1B7YB 2ARSA
chains in the Genus database with same CATH superfamily
4H2VA 3P8VA 4AZSA 5JSZB 4YALA 3IXMA 2P9GA 1II9A 1LLDA 3LPMA 1S4QA 4NFSA 2OD9A 1FQKA 5E6UB 3SF0A 2CKDA 1SRYA 1E9CA 3T9DA 1LSUA 4HPJB 4KUGA 2VJCA 3U2QA 3QK7A 2JD0A 3VR2A 3PIDA 1QUFA 2DSTA 3BAFA 4ZO9A 1AQUA 4DJEC 3HA2A 3LBYA 3OCXA 1T0IA 3NEAA 4FYXA 2KE5A 4IGKA 5TY0A 3KTFA 4LA4A 4W1QA 3R76A 3LT5A 1I2ZA 5BMVF 5IJZA 3FNQA 3O3MB 4HK4A 3ORFA 1RJWA 1T3TA 4LE0A 3ZCTA 1SIBE 1EFPA 2W43A 3IVGA 4JJIA 1D2AA 4BX0A 1VPWA 5TRTA 3USES 9MHTA 1VE9A 4IDPA 1GUAA 1MD9A 4N39A 2PUWA 5KTRA 1FTQA 3R2JA 3VMFA 3ESBA 3Q7RA 1K7FB 1R5JA 4G5RA 2Y6UA 2JCYA 1C1XB 4K2AA 1LNZA 5KJ1A 3L0BA 3AL2A 3LP8A 1HQYE 2I3ZA 4RSGA 1ZVQA 3IPYA 4M7PA 1VPDA 2XSZD 4F2WA 3RRBA 1WZ2A 3A37A 1LSJA 3IMKA 5CR9A 5C37A 1SC1A 2TYSB 5KX5F 2BZ1A 3TEMA 1XZQA 1IJEA 2GLTA 2IYUA 3K32A 1P74A 4MQMA 4P7FA 4Y1FA 4CMJA 2FB9A 2WMDA 1OFVA 1PUJA 2Q5EA 1UK9A 2VP5A 4WH0A 1NJ1A 4RM2A 2L42A 1GUYA 1QKIA 1DRVA 3DKIA 2E0IA 3L2ZA 2WLTA 4R2IA 2O8CA 5E9JA 2ISQA 5CLHA 1YZHA 3TEFA 2WMYA 4D42A 2CL0X 1QHIA 2J6IA 1V3UA 1EDZA 1R0KA 3R7AA 3ZKAA 4PBSA 4X20B 2ZEJA 1PV4A 5CA0A 2H51A 4DLNA 4RHCA 4YFVA 1O77A 1PZEA 1K86A 4A8JA 4HTFB 1N7GA 3VOSA 2IZ1A 1EK0A 1P61B 5DWVA 3PC8C 4IXDA 3WIOA 3WFIA 1U02A 3N70A 4BO6A 4GWLA 1ZH2A 3R9WA 2FF5A 3ESZA 5D87A 1UBUS 5SY4A 5F4BA 3H5NA 2DCMA 2ZSEA 2COUA 2G4CA 1CY4A 5L7YA 5GJVC 2VYCA 4C7KA 2ZLBA 3GK3A 1QYRA 3WGOA 3ZPXA 1WETA 1FB5A 3HYNA 1J0CA 1P3Y1 4IH9A 5KHOC 1G59A 1UODA 2Q1XA 3JAWB 4KPUA 4CT0A 5E1OA 4DR6B 2GPWA 1MO2A 1T6ZA 4MIYA 4Q9AA 4TLMB 2FEOA 3ECCA 3O1HB 2QZPA 1L7XA 5IFKA 2X0IA 1MLDA 2XGMA 2PIAA 2BFCA 5BW6B 5FULA 4LOHA 4ZTZB 1QMGA 1RWVA 3K3PA 4YP0A 3A9UA 4LWZA 4G5YA 2IV2X 5A5DA 3LLVA 3VHQA 3WJ1A 3GPBA 4AU1A 2YJGA 3DUWA 4QKQA 1JAIA 2HB6A 3ZI4A 2WVJA 4Z4HA 4PX2A 2XUQA 4XB6B 3G7UA 5I4KA 1FOEB 1L5VA 1TZ2A 1ZVJA 4L5YA 3TLYA 1FFGA 4ED9A 4OHYA 2XD9A 3C6ZA 3K73O 4B71A 1SC9A 3ZNQA 5BYJA 2GZ1A 3ZWWA 2XOKD 3LT1A 2XTZA 4AIIA 1A8SA 1OYOA 1T0PA 2QYOA 4R05A 3WZLA 3A26A 2CLMB 2QIOA 1CVRA 3COJA 2VHQA 1LBQA 1NKSA 1UEJA 1Z18A 3JD2A 4B47A 4N18A 5KUTA 2FETA 1A8PA 1VQ1A 5A9RA 1JEYB 4RAOA 4DPMA 1ZVVA 1SK8A 2EV9A 3ZXUB 2PO5A 1JJCA 2C9BA 4U9HS 1WNLA 3R3VA 4GPTA 3V4OA 1QFSA 2EX1A 1UPBA 2EBUA 1MAVA 3OQIB 4GICA 1RAHA 3X2SA 3BZUA 1XLTA 3AYXB 2PE5A 3Q0TA 3SM9A 3DDUA 3H1AA 3CUKA 5ELOA 3Q9UA 4IILA 5DT2A 2GESA 3TAXA 1V9SA 1PJ8A 2IVZA 3LP6A 4WBXC 3EJ6A 3VYTB 1DAGA 4CF3A 4EENA 1P5ZB 2XLBA 2QD1A 3C5VA 4ND7A 4NATA 4R5MA 4XRRA 1RLTA 4WW0A 4GE3A 1RR6A 1SB8A 2XZLA 1U98A 1MO6A 4KQFA 3UXMA 1PU2A 4K05A 4M4SA 2IQIA 5A4FS 1F1JA 3LC0A 1X8LA 2ZTMA 4JL8A 4QIHA 4JI8B 4FEYA 4A0RA 4ASUA 4CLEA 2RJ3A 3A7AA 5JC1A 1ZI8A 4CCYB 1KAGA 3L1VA 4G8CA 2PRKA 3MA0A 4ZVKA 1RYZA 2AXPA 4WHMA 3WTBA 2VDUE 1TQ6A 1ASYA 1I6WA 3PDIA 4A23A 2GK6A 3FAKA 1T2DA 3VR3D 4S1OA 2X5OA 1Z6AA 4GLBA 1B76A 2ZU0C 3V3TA 2QX9A 3KE8A 2BGIA 3KYCB 3A04A 2GJAA 2GF0A 3L79A 2OPBA 3OICA 3LU1A 4QNMA 2VWPA 5IJXA 2C58A 3ZU3A 1RWWA 2GEJA 1CTQA 1Q83A 4YIHA 4LJKA 4NU5A 1WW2A 2HMAA 2V7PA 3FMFA 4KFTA 4B09A 1NBHA 3FNBA 1OT3A 1K97A 3JQBA 1V39A 4XM2A 1WNTA 2C07A 1P4GA 2W6QA 1BEEA 3KUXA 4YJHA 3HBFA 4M0KA 1EFUA 2Y1XA 4LHWA 2GZDA 1Y4AE 2OB2A 2WWIA 3ZY3A 1EQRA 2O1EA 5F2EA 3PXDA 3ZCRA 4AX4A 5HE8A 5IAAA 1NJSA 3H9EO 3U61B 4FP9A 4LYDA 4RANA 4XGRA 3W3SA 1NFFA 2A67A 3HU2A 4CKEA 1YB1A 1NMQA 3JYNA 4PCLA 5KNDD 4CEIA 1SVUA 2I1QA 4ZO4A 1HLFA 4WKNA 5ILGA 4B4WA 3CISA 3HXWA 4O2LA 4C4ZA 2QORA 5TQJA 5IHXA 4RMGA 4A10A 4PVCA 2HYIC 1RWQA 2P5SA 3AGQA 2C5AA 4RTLA 4TYWA 5A0VA 4ER3A 1B43A 1MX3A 1QTIA 2FPWA 3CF2A 3QVSA 1S2MA 3R7DA 4Y6OA 5HMMA 3AF5A 4TMYA 4C21A 1CEYA 4TRMA 5AHKA 1KEEA 2JJ1A 4LK3A 1TA4A 4GFDA 1N8NA 4GO1A 4XYBA 3SIRA 3GCWA 1J5EB 1N1EA 4FFVA 4FGJA 4BEBA 3HHPA 2JZNA 4GQAA 3P0FA 4HB3A 1SOMA 2EX4A 1PWHA 4U2GA 2HN9A 3RUHA 4BLSA 4ESVA 4FINA 2XYVA 3NRBA 4E2YA 3KSAC 2CWWA 2R6HA 2VRWA 3F5MA 3PVSA 4W82A 3V3KA 4DIMA 3LA6A 3IAS1 2I4NA 1FPQA 3MFQA 3STUA 1EK5A 1FBTA 5JJBA 4ZU3A 1XPRA 4XTZA 5JANA 4CM8B 4BMXA 2DUJA 4CH5A 4D92A 3PDHA 4TTPA 2Y76A 3W8NA 4K9LA 5C8ZA 4G5FA 3VH4A 1FS4A 5CIYA 2H4FA 2JLBA 2IHJA 3RTCA 4B3DA 4EGFA 2O5EA 2IOFK 2X19A 3BL5A 1E1QD 4IGIA 4YCUA 2I7DA 1RMYA 3D4PA 2OWEA 2WHPB 3IBGA 3KZOA 5ALUA 5KNBD 3FGZA 1T13A 2YJ3A 4BP1A 2IY5B 2XZOA 1TJPB 1C4XA 2XNHA 3A4TA 1SQ0A 4QM7A 1IAQA 2ATIA 3DAGA 3ZQKA 4MQEB 4IKOA 5P8WA 4RDXA 3A4NA 2P3SA 4Y0AA 4QTZA 1WVIA 2FSPA 2JAXA 3ANYB 1E7YA 4RVGA 4WKGA 2Q2WA 3C43A 2NVBA 4RL6A 4BOYA 1M8JA 3ND9A 4JEIA 1I1NA 2NVUA 4YNBA 2YIVX 4O0MA 3NWPA 3JTEA 4EQZA 1RZVA 3AUTA 3BWCA 1M5RA 4IRXA 2Q0HA 4D79A 4ND5A 1E20A 4MMXB 1J0BA 3KKZA 2IXDA 4MJXA 1Y8ZA 3Q7TA 3DOFA 5IH7A 1UK6A 3D3EA 1ZN8A 2X40A 3L01A 2YR0A 2HA7A 3E9MA 3HBMA 4DPKA 4MHTA 4FFWA 5ERXA 2G72A 1V7CA 3TTXA 1PJBA 3KLMX 2OXCA 4OHPA 1BKYA 3FFWA 3L0YA 4R81A 4WKOA 1E24A 5HIIA 3PC7A 1TAGA 2ZS8A 2UVQA 4HMQA 3AX6A 1XTIA 5AM2A 1BC5A 3E8SA 1VECA 5FWYA 4ADSG 2AN1A 5DLYA 5LNK1 2VOEA 3P9ZA 4CL8A 2F1HA 2FJUA 3TLBA 1XMVA 4QJBA 3WP0A 2PSHA 1MG5A 2RAPA 3MS2A 2ISCA 2BKXA 2V3CC 2OCGA 1PJAA 3MTQA 4DUZB 5F7ZA 1KSJA 4QWWA 1NIPA 1YFRA 4U0KA 2FDCA 1HWYA 1EVLA 2H4JA 1NV8A 2IODA 4JUFA 1JA9A 1XLVA 2FXIA 2QL7A 2QRKA 4M99A 3UUFA 4WBNF 5LYJA 3CH6A 1X54A 1D2GA 1EVIA 1VRCA 1P2UA 5K3AA 3EDMA 4PO8A 3PEFA 3ZHQA 1I2MA 4DRYA 5E4JA 5YASA 4MS3A 2NPIA 2JLRA 2HWKA 2XMRA 1DV2A 1NN1A 1T2FA 1VYVA 5EEGA 3TBKA 3C8MA 1UJBA 4RE6A 1HG0A 1KK0A 4F46A 4F4HA 5BQFA 3NDPA 2YXDA 4HGRA 3ZZMA 3E9QA 3FH0A 3CUSA 3ZJVA 3TJZA 4GNRA 3S99A 3ZQ4A 1Y3IA 5DTIA 4X1KB 2WFAA 2V96A 5A6SB 4BV2A 3VNVA 1NT4A 4TMTA 5KTSA 3GJ5A 2JFXA 3P97A 3EOAI 1T29A 2EFJA 4GG1A 1FU8A 2PGAA 1PSZA 2ODTX 3DOEA 4UJ3A 4A5SA 1ZGCA 3FNIA 4HRYA 1VHDA 1TTHA 5IYZA 2J0QA 5EN4A 5DGCA 1PHRA 5K3SA 5JZOA 4V0MA 3RFCA 1RE0A 5KZMB 1LRKA 3AI2A 2IOFA 4JMLA 3KZKA 4N5HX 5DN9A 5KKAA 3H9JA 5DXAA 3ROMA 3MB8A 2WBLC 3H11A 3IOMA 4ALNA 4E32A 1V5GA 1VLQA 3DNFA 1F8GA 2XMQA 3NKLA 3ONFA 4EEXA 2HFKA 3IIJA 1JG4A 1QLWA 2JZOA 1Z17A 2ZTSA 4MWTA 3PC8A 2EERA 3HVRA 5DHPA 4MQFA 1KKUA 1IOLA 1DBWA 2IXGA 3AR4A 1XNHA 2ZJ8A 1O9GA 4HDCA 4IGAA 4DMRA 4W5TA 3ZDZB 1IBCA 3CKLA 5C3MA 1LVGA 4K2HA 1MO3A 1VJ1A 3L46A 1FCJA 4RZIA 3EQ9A 4C5BA 2O3RA 4KRXA 4RIFA 3SX0A 1SD5A 2Q28A 2PG3A 3EGOA 3KG2A 1HYGA 1KXZA 2QHXA 1C4KA 4IOMA 4R7TA 3KD3A 1AG9A 3P9QA 2XMZA 2WJWA 5AJXA 1AKQA 2G5GX 2RIRA 1KEZA 5DASA 1C8BA 5ADHA 4L9SA 1IVSA 2HA6A 4JJ8A 5B3AA 3RLIA 4I50A 1ZDMA 3D31A 2ID8A 5E0OA 4O2AA 2GN4A 2RJNA 5DLDA 5FEUA 8LDHA 2CXPA 2V8BA 4M1QA 2JJ8A 4IUDS 4NBLA 4D4KA 3RC2A 5BT8A 2PWYA 3B1KA 1C0LA 3IDAA 4CGYA 3T5GA 2CFOA 2V7UA 1IXZA 3NXSA 3SZOA 1QO7A 4QXMA 5J2TB 2JGAA 3LXMA 4KO8A 4Q05A 4CRWB 1SBZA 5T6MA 5JXJA 3ZHBA 3HACA 1II0A 2VDWB 5HILA 4CM7A 4DLAA 1Q84A 2Z1MA 1JILA 1U1IA 4FFBA 3H4VA 3EZGA 3EULA 4LJLA 1XIVA 3DTNA 3GJQA 1XV5A 4M49A 1EUCB 1SC4A 2QHSA 2PZGA 3KSDO 2FLKA 3CMCO 5DK4A 2WU3A 1ZNQO 2YHIB 4Q9LA 4G23A 1DWQA 1KAHA 1ZNXA 1G7RA 4BAZA 4NNJA 4BEVA 4G1CA 5IDWA 2H0QA 2DHDA 3QVKA 4ERXA 2HH9A 4XGNA 1SQ6A 2X6TA 4GVPA 2VWHA 1NXQA 2G1UA 1VTKA 1YFKA 2ZWVA 1G20A 3B3GA 3DLHA 2B9VA 4ZEVA 2KQUA 2IEYA 4G4IA 1Y1KE 4CMGA 4BECA 1OX4B 5IUKC 1D5CA 1DFGA 5FOQA 3ANSA 1AO0A 2O2HA 3K31A 4URHA 1VSVA 3DAYA 2PKXA 2XRZA 2QVXX 3BORA 1TUBB 2ZE8A 3DBOB 3OQ6A 3PZRA 3DPSA 3VNSA 1B70B 5A5FA 1N9GA 1S2GA 3ESXA 3QZUA 1ZWKA 2G25A 5E8JA 5EAIA 4NP6A 4AMZA 4WK0B 4D3DA 2C3PA 4NRDA 1K5GA 4PFQA 3WB2A 1K3TA 2R87A 3FCUB 3KFUA 1GPAA 1W49A 1WUYA 2X8BA 3A9WA 3H8JA 3DLIA 2JFHA 2P3QA 1JTVA 2GEBA 3I6YA 1NHGA 4L2IA 4N7RA 4C6HA 2V8OA 3I6MA 3MWFA 5HOQA 3SBXA 1NQOA 2ZBEA 2C3UA 1BCRB 1U8FO 4BO5A 3V1NA 3GRPA 5IBQA 3L0DA 1RXEA 1MEOA 1A9ZA 1F8XA 1YZGA 3G6KA 4Y2TA 2VAMA 1RXUA 4YCAA 4XU1A 4AF6A 4B3XA 3BE5A 3BSSA 1U63A 5DHRA 3DLCA 3NZEA 2HMYB 3PXBA 4GOLD 3U3MA 1JDTA 1L8XA 2XBMA 4KFRA 1YMQA 5CDTA 4A2QA 1SCUA 1TM3E 1MA3A 3GFTA 3CLKA 5FI1B 3OZUA 1VE5A 4R1PA 1NQVA 1ZGAA 1XDZA 4KXMA 4OCZA 3UPDA 3BXOA 1EZ4A 1S3SA 1Z39A 5E7JA 1Q1GA 4G0XA 3HXZA 4RDIA 4DMLA 4IIXA 1AGNA 4ZQEA 4LDJA 2IIQA 1O6GA 3GAFA 3MWDA 4RJTA 2G07A 1MFPA 3VU1A 4NMMA 1M2WA 4H2XA 4Y67A 2QVBA 4G97A 1RKQA 1Y42X 2DUMA 1SCQA 3RYFB 5DNYB 4NOMA 2QUJA 1IPEA 2H1VA 2OAQ1 3O26A 2GD1O 4KXXA 4E6EA 1P1RA 2OQIA 2SKEA 4BW9A 1E8DA 4BKMA 3F0TA 4R1NA 3MN1A 4YECA 4BBZA 1NFQA 1QZTA 3LKVA 3DV0B 1SIUA 5KNCD 1ZW1A 1GU7A 3R24A 2P5UA 3PEWA 3G2KA 4PHHA 2WW8A 4IO1A 5J58A 3L1KA 1V47A 2OHVA 4ARZB 5C5IA 1D07A 2FSSA 4HG2A 5BN3A 4M54A 4AIRA 5A1TA 5BW5A 4G36A 1YFZA 5B58C 2H7XA 5EMHA 2FPIA 3NIGB 3UOAB 3KQPA 4GVXA 2IYAA 4RHEA 5ALDA 1XD2A 1PZMA 5ANRB 1J7JA 3LX6A 2P9TA 4M98A 3N2ZB 2FEXA 1ZBDA 2R6CA 3OWXA 2WWRA 3PD7A 5FI0B 5G0VA 4DDTA 4ZANA 1I1OA 1W7AA 1SKAA 3DP7A 1AHPA 1WXDA 2G17A 2VNHA 4G0VA 1HRDA 2FZKA 3F3YA 5DBGA 1Z0IA 5HTKA 4H4DA 1YKSA 5SY9A 3T34A 2OQVA 3OQOA 4CU2A 4E1VA 3OLZA 4O6VA 1EG2A 1FFCA 3U6KA 3H5TA 1RJDA 3MSCA 3PT9A 3RAPR 4K40A 3I9NA 4QGSA 2NXJA 1H8HA 1QGZA 3A27A 1NV9A 2C1ZA 4IFEA 1E9DA 4M6WB 2PKCA 1VBNA 2ZRGA 3QWBA 4M86A 1COWD 1DX6A 2ODQA 3BXHA 5A7HA 4X84A 2LCQA 4EKGA 2Q1UA 3UMCA 1P1BA 3KKQA 3E1KA 3NW9A 2XYRA 1G8KA 4OJYA 5E38A 3A6DA 2ODRD 4HQ0A 1SKYB 1YS4A 2G9NA 3BK2A 2CVZA 2P77A 4C6SA 1WZIA 1V6SA 3WA6A 1N2SA 1HLPA 1RE1A 3BQ9A 1E9SA 2JGKA 4JUCA 5JTTA 3RWOA 1F6BA 4LI0A 4TKMA 4V0RA 2Y93A 1CQXA 2IIPA 2NGRA 1JSRA 4LN1A 1NRIA 2WP8J 1W93A 4HD8A 5BQOA 5I4BA 4LDZA 4LQ4A 5F2OA 4Z9AA 2EBWA 3FDFA 3V2HA 3VDXA 1XJCA 4HNAA 5DXFA 3LL7A 5HR5A 4QUJA 2JIMA 2BJVA 3VQXA 1I10A 5BR1A 1OFUA 4FDVA 4A36A 1QWOA 4FJ0A 1ZICA 3WYNA 1Y1QA 5ECWA 2I6UA 3ZLBA 1RJFA 1ORDA 2PUGA 2VZLA 2FX5A 4L57A 5SYAA 3F8WA 1A72A 2C9CA 4ZYVA 2XDAA 1MB4A 1XVAA 3BREA 3L6OO 3OF3A 4E51A 4ZGGA 1P9OA 3PSAA 1NC1A 3O82A 3MOIA 4HLDA 5I7VA 2KM1A 3QX3A 3U4MA 2E4UA 1PJTA 5HKKA 5DMHA 1FMJA 2IDZA 2VHCA 2N46A 4LK2A 4RM3A 2Q3FA 3R77A 1EX7A 4G2TA 3S44A 1BE8A 2B35A 2FTKE 1LEHA 2BM8A 5DX1A 3VAZA 5ALMA 5GZ1A 5CT5A 5JNWA 2JLYA 3BRWA 2BDEA 5KAMA 3T4UA 1PJ3A 5DHTA 1G18A 2JBAA 3V1LA 2GZ2A 3NUGA 4CMBA 3EEFA 1UT5A 4LZWA 4UM7A 3ZS9A 1MT3A 4DNOA 3BZWA 1RXWA 3GZNB 3PHGA 4KAXA 4Z5XA 3I72A 1ZK2A 1DEHA 4MEAA 1HXDA 3GLTA 4MW2A 3CT6A 4E5SA 5HFNA 1B42A 2WJ4A 4MQ5A 4GGOA 1YNOA 1SXGA 4CTOA 4G4GA 3CY6A 4B46A 2HWXA 3LLMA 1QF7A 2OSBA 4KE9A 4CEJB 2VJMB 2GOYA 4YUWA 3NHRA 5ILOA 4EZEA 4FOSA 5DI3A 3RASA 5JCXA 5MN4A 4M53A 1HOTA 4JT2A 3RK4A 3EODA 3PRHA 2HU7A 2A9PA 2FW6A 3DL4A 4FDMA 5BPFA 3RVQA 4CKEB 3HMKA 3OCWA 4RPCA 5LQNA 4ER6A 4MRPA 5FBRB 5DZSA 1HYHA 3FNEA 3L93A 3QWAA 3ELWA 4J29A 2WHRA 2H16A 3GIWA 2E64A 4UTZA 1W2GA 3IUNA 3PGKA 1GEEA 5EERA 4E2FA 4QXPA 4ENRA 1D7OA 1JWLA 1YXMA 1M6VA 2HLDA 2QEQA 3HLYA 3RJMA 3UBMA 3ZBQA 2REXB 1NYRA 1N0WA 1SRQA 2OVFA 1GKKA 2ZR9A 3B5EA 3L7MA 2G8LA 3GQBA 3LUHA 1EFCA 4LWOA 5CH3A 3V8VA 4AF8A 5KTTA 4YX9A 3AETA 5JNSA 3LIPA 4MUKA 4NMXB 4CLOB 1JBEA 2LPMA 5EE3A 1QG2A 3AHJA 1OV6A 2VRCD 1VE6A 3BIOA 1ACMA 5DNCA 1U0LA 4XJSA 1EHYA 1E6KA 2ZR8A 2GA8A 3D8BA 3U3XA 4CIBA 2EJGA 1N32B 4YV0A 3LFHA 4KNVA 2F2TA 2R4QA 3AVPA 3QXJA 4LZOA 3PDWA 3NENA 1TRHA 3IB6A 1KOJA 2XD4A 4BJ3A 1QP0A 1P4JA 1HE5A 2OCBA 2HA2A 1ACJA 1D3AA 3FRJA 4FDLA 2W2QA 2YXPX 3EWNA 4U7GA 1X2HA 2VQ6A 2Z2YA 4ZOLF 1U7OA 3HCFA 1TJ3A 4FYJA 4U6QA 5GGXA 2ZSIA 1WCIA 2JLZA 3SZLA 4I14A 5E9QA 3QTTA 3WHPA 3GLFA 2IY9A 2FPGB 1YC5A 1EUDB 2QW0X 5KTYA 1AS2A 4G9EA 4MAFA 1KAQA 4ZVLA 3IIEA 1HY3A 4FHZA 1J24A 2G4VA 1T43A 2OG1A 2QTFA 3EK2A 2J8ZA 1E99A 2DR2A 4CEHB 4JNCA 4IQGA 2W2PA 5K6RA 2ACWA 3TG2A 1UMCA 1H5NA 4AXBA 4D4HA 6ABPA 4UCQA 2BF7A 3MTIA 3DBRB 3G1TA 3TW8B 1S89A 1PL6A 1ZNYA 1N5IA 2DFDA 3B6KA 4WEQA 3HZZA 1OWNA 1NDHA 2PT9A 4DG9A 1DIOB 1NBWB 1X7ZB 4R3UC 4FMCB 4D81A 2Q6OA 2DKFA 1XNGA 4EHHA 4Y2JA 3ZHZA 3QLEA 3PT5A 4NTZA 4GRIA 3TCXB 3IE1A 1Y4DE 3P2OA 1HQKA 1Q19A 3DDNA 2YQZA 3AOGA 4ZQHA 1MV5A 5K3FB 4F4FA 2BEVA 3NJRA 5AVQA 4O29A 3GRYA 4YT5A 2JIZD 4O59O 2DLCX 4D0RA 3OJLA 1J09A 2EKPA 4J1NA 2QD5A 2QW1A 5LOVF 4RTNA 4QA9A 4R2JA 4D45A 3NBMA 1CUXA 1EB8A 5JIBA 4ZMBA 1EDBA 5C18A 1IJKA 1VOTA 3BEDA 3TNLA 5GVSA 2X22A 2XGOA 4TUYF 2XHZA 1N2ZA 4N5NA 4X54A 3HSSA 4ZHQA 1GOTA 2MTBA 3FRIA 5I9LA 1I4EB 5EINA 3MTBA 1MNAA 3MAGA 4L16A 3THYA 5C7OO 3CKMA 5LQAA 1C8LA 3H3FA 2F9FA 3QITA 1U2TA 4G81A 1DXOA 1NVVQ 3HB4X 4F96A 4DUYB 1XNQB 3T3DA 1DKOA 4EHLA 3ETCA 3PC4A 3TPFA 2HMSA 2PDAA 4RTOA 1K27A 3RU9A 4PX5A 3JVVA 4QQRA 1A9RA 3ZHSA 5JSYA 4BX8A 3L7JA 3W9BA 1YAHA 3RFTA 4MB0A 4PN7A 4HDKA 2ZJAA 4TRRA 1XPUA 1TIKA 1D9XA 3A9CA 3TXAA 4CQNA 4KSCA 2OTCA 2BFMA 2PUVA 2XJ9A 3ECSA 3GC6A 4JP3A 4YRNA 2VZ0A 3IXLA 1L4LA 3FKSA 4WLOA 3MMXA 4CF7A 4US0R 4AKIA 5IKMA 1JJ7A 3M4ZA 4S24A 5JAMA 4ZAFA 2YZ2A 5JWOA 3T3IA 3G2HA 1NYLA 2YN4A 2VHJA 1EX6A 2GCPA 1ADGA 1XZCA 2NO7A 2VDMB 4I1IA 4TSKA 5IP5A 2OA0A 4DQKA 2ZM5A 2IXTA 1E3MA 8ADHA 5TJ9A 4ZAWA 4ML3A 2PIDA 1NLYA 1DT3A 1QTNA 3KTAA 1G16A 1PGNA 1M1ZA 5JSHA 3N8DA 5LQCA 4KEAA 4N9WA 4J4BA 1S8FA 3MK31 2OV3A 5D2CA 2RAFA 2FQXA 5K3OA 4MDFA 2Q3CA 4ZCTA 1M0SA 4TTAA 3UV6A 3PFKA 3OMXA 4F9GA 1IAVA 4UUOA 1NG1A 2H5LA 3DEAA 4HNVA 1HNXB 2AQKA 4YRIA 4WADA 3FF4A 1B3BA 2J7PA 2M98A 3E15A 1R5BA 4IGEA 3GLGB 2OB1A 3E9YA 4DJ5X 1QG6A 2HK8A 2HRQA 1N92A 1XU4A 2ZIAA 3A3KA 3ACDA 3THSA 1LUAA 1Y37A 3SC2B 3BH0A 2IFTA 3M4NA 4TS9A 5FD8A 5TGTA 1N57A 2VPYA 4M9UA 2DXTA 2J08A 3B9QA 3D0OA 2DOKA 4XWGA 3I01A 5FWXB 2BT4A 2H3HA 4L5CA 4EYKA 4LHEA 3GELA 1NKTA 4R84A 4BMYA 2DFPA 3UJBA 3NKFA 3E48A 4BJ1A 1DRUA 4GMXA 4Y2HA 1A9XB 2DLNA 5G02A 2CCJA 1POXA 3O0DA 1ODJA 3H9QA 2DFKB 1WHTB 2JGJA 2QMUA 1XN4A 3OZFA 3S70A 3TNJA 5C8DA 5EXTA 1O7JA 3JQ8A 4BTVA 1G4UR 1G0OA 3A28A 3R5XA 2WDPA 1N8TA 2PJDA 3ER8A 1DEKA 4EABA 1SCIA 3NOXA 5T3UA 5TIIA 4N4AA 1AC5A 3ZVMA 5LMCA 5IWCA 1HDRA 4BZQA 1K6JA 3FCYA 4UUMA 5AI5A 2FOXA 1DPFA 3KOOA 1J1UA 4TOIA 1CDZA 3PL5A 2DF8A 2XUFA 2YN2A 1GAEO 3LOUA 4HWSA 2C98A 2FCRA 3M9XA 4KMMA 5BO5A 5M3BA 2JL1A 2IV3A 3VGPA 3EMVA 4EW3A 2Q07A 3FCCA 2OLEA 1NJ6A 3X2EA 2H2IA 1QIEA 2I2WA 2Q5QA 3GUHA 4G0QA 4EGSA 2Z2KA 3WL7A 5JV5A 3MJ4A 1K68A 1H6AA 1FUUA 3RF1A 2Q7XA 2Z4TA 3OT4A 5C5DA 3FHTA 5AVKA 2H08A 2QP3A 1NPTO 1AUOA 2MSDB 1XTPA 1QB8A 3EGIA 5BQ3A 1A1VA 4EHNA 4ZAYA 1Z83A 3TLGA 3BMOB 4EGCB 1E1NA 2ZJBA 3ETDA 2M1ZA 3UXEA 4HUQB 4R83A 3KK0A 2NACA 4I4TB 4KBFA 2ZS9A 3KB6A 1Z2AA 1XWFA 5EWMB 1W2WB 5FX2A 3CVXA 1CR2A 4YRGA 2RCYA 2C4VA 4D9FA 3CMMA 1S8OA 3H7AA 1G7CA 2AE1A 1U5BA 1QXSA 1XDDA 2D54A 2OV2A 2PRZA 1QOPB 2XOXA 1HTBA 4OATA 1ZSVA 1P4HA 3RPEA 1SR8A 1BXGA 3M5CA 5ED4A 2BY4A 1C7ZA 4GKKB 2HCBA 4OVKA 4L6AA 3QE3A 3X2FA 1VPEA 4F4JA 1RM3A 1V1MA 1W85A 3M6IA 4QO8A 3A6PC 4ETWA 1I0LA 1FSGA 2W4IA 4OJQA 1MW9X 3E2IA 1E2UA 4XTWA 3IHKA 3SIPA 2FX2A 4A91A 4DNFA 1WMSA 1F8UA 1II8A 1E4YA 1GV1A 1DWPA 2WAXA 3NI2A 1CUWA 4Q3LA 1IHDA 1WCWA 3IDOA 2Q99A 4HN2A 4MPTA 3H2ZA 4K6OA 1KVRA 3SSMA 2P5TB 2WLSA 4F71A 3CLVA 5A4DA 1ULTA 1P18A 1KI1A 5KNBA 2OGTA 2ZR7A 5FB3A 4FVTA 3GVIA 4EI9A 1OA0A 1HEYA 3MYYA 2P91A 4Q34A 5FLYA 3W8EA 3WBFA 5BN3B 4C0KA 4H2UA 1AT1A 3I5AA 1SVOA 5C9ZA 5T4HA 1W44A 2H52A 4MWCA 3SKXA 3CEPB 2N75A 1JVNA 1PKEA 2B1QA 2AFIB 2FAXA 4L9AA 4OMDA 4EG0A 5E95A 1P1FA 1Y7HA 2MIIA 3HFZB 3PIIA 3EE6A 3HCDA 2O2ZA 3EZ2A 4LDNA 1RHUA 4AO7A 1GGNA 1NUSA 3A6KA 3EGDA 1M9NA 3VKVA 3G23A 1TX4B 5EQDA 3AF3A 4IDAA 3CUUA 3QELB 5JAIA 3IBSA 1I3NA 3JRXA 4EI2A 1FFAA 2C7VA 2HXGA 3R7SA 1ADCA 3QX7A 3MBOA 4KSYA 5A6VA 4FX5A 1EWQA 3HPQA 1CRZA 2BN4A 1ZIPA 4MDYA 3AHEA 1XQXA 4KQ2A 3RBXA 4R1SA 3JASB 4NZMA 3O3NB 2ZT5A 1SC3A 4MH0R 3WL4A 4B8WA 4J76A 2I2DA 4QU9A 1IZ8A 3FUUA 2JFUA 2I2AA 2XUPA 4TXLA 2OAGA 5A71A 1JHMA 1NHWA 3PE3A 4L02A 4AROA 1QC5A 4DW8A 4RTMA 4G84A 2IYZA 3T15A 2HTFA 1VA5A 4EYEA 5GJBA 3KXKA 4KX3A 3DB2A 3DHVA 521PA 1APBA 2FP4B 1XFDA 4J0KA 3THXB 4V0LA 5B6PA 3WNDA 1XZKA 2C99A 5F5LA 3QFFA 3ROPA 4BAGA 1LSOA 2C00A 4TTTS 4JOBA 1VJGA 3T7EA 3ZW7A 1YZFA 2ILVA 4BNYA 2IXAA 3QEMA 4RORA 3AY6A 2ACEA 1RKBA 3BJRA 1C9EA 4IIEA 4OQEA 5JCZA 2CXOA 4MQ4A 4P2GA 5CDSA 1JHQA 3FYUB 3M4XA 4C7OA 1N7HA 4UEQA 3GFVA 5FLXA 2GILA 2ALYB 4OP0A 2QPTA 1QF6A 4RTRA 1NAHA 3UT5A 3IMEA 1ZCZA 1JLRA 2UYOA 4IQ8A 4WUTA 4QE3A 1OWPA 1U2DC 4IJMA 1O8CA 1K7EB 2B1RA 2NVOA 4GXQA 2IUTA 4HT3B 3MGGA 1Q16A 4H2TA 1E1LA 2OCPA 3M5DA 4OHCA 1MW8X 4JBYA 3CU5A 3VI3B 4GLLA 1G8AA 4GS5A 4RVFA 2AN3A 3WQBA 3P9PA 3K0KA 1VKHA 1T0UA 4DLTA 3Q40A 3G5AA 4P4LA 1N3YA 5F77A 1ZSYA 1NN0A 1GTZA 1LQUA 4BCBA 1OPRA 1SN7A 4P32A 4XOUA 2FI1A 4KLRA 2XYHA 1TECE 4KR0A 2C3OA 1C29B 3HO8A 4PAOA 5CEFA 1AKRA 4LJSA 1T4GA 1N9ZA 3OEYA 3OT5A 3SSOA 3IDZA 4LSGA 2X7JA 4I6GA 4EB8A 1O97D 5HQ3B 3WB1A 4BJ5A 1M1YB 3MBKA 1WB5A 1HDEA 2FE1A 3DQQA 5F7OA 4K6GA 4BLRA 2V03A 4PNZA 2V3WA 4RULA 3PFHA 3AHCA 1CUFA 2QM8A 3BE6A 2CVOA 1G5IA 3Q8XB 4M9XA 4P92A 4EI7A 2JVJA 3Q8MA 2FPPA 1E2GA 1HYEA 4N0DA 1NBMA 5D8DA 2P9ZA 1RDFA 4ZREA 5HA5A 4BP9A 1XVVA 4TLCA 4HDMA 4IFIA 3OE4A 3KWMA 3L0SA 1X77A 2WUEA 1Z0KA 2JJYA 4KU4A 4FZ5A 1G3UA 1CQJA 2GDJA 2WFMA 1FRFS 3NGLA 4V39A 5EHQA 4LOKA 3V2IA 2DU8A 1H2AS 2J0EA 4G5SA 1G5FA 4KLAA 3ZVNA 1A5SB 1FW8A 3F9RA 1ULBA 4LF5B 1E8MA 1V7PC 2BFBA 4RQEA 2YRFA 4ZCLA 1PQ4A 5EHGA 5HE9A 1BXRA 1F9EA 3PRYA 3U39A 1YQUA 1TJYA 2REQB 3TW4A 4CKBB 3MMNA 3UGJA 1AZTA 2QV7A 1WXWA 4JBNA 1C0IA 2C7IA 3SHOA 4KAAA 1J21A 4P7GA 4BNVA 5AT1A 2OZLB 4CIWA 1PZXA 3H9GA 4L51A 2DE0X 2LD4A 3SU8A 3GMTA 2WZBA 2YZMA 3G6WA 1E5TA 1T9HA 4IKEA 1KFBB 4QM6A 3GUZA 3GBPA 5JYEA 2NO6A 1AK1A 2VVTA 1M83A 1GA1A 2IITA 4CVNA 2VDRB 1JR3E 3KPYA 4PSCA 4IG9A 5KDOA 4F2DA 1R9JA 3R5TA 2VK8A 2OO7A 4DYHA 1EAYA 5I47A 4J0EA 3ZWKA 3BWYA 2CV0A 1COZA 1R5NA 1VL8A 2C7BA 5BT9A 3K53A 4QGAA 2CIMA 3REFA 1CZOA 2VCYA 3OC0A 1J56A 4ILKA 1F3LA 4MO2A 5B58T 1KYQA 5E3JA 5FTJA 4G5OA 1GIAA 2JIBA 2Q3EA 4DGQA 4GC5A 4R1TA 2VTBA 5TQ0A 3Q3IA 4K9MA 2IW3A 2BCGY 2OHFA 2Z8XA 4FD3A 1XDUA 1NP7A 1Z0DA 3BHJA 4IWNA 1IBMB 4E5MA 2DU7A 2CV2A 3EXFB 1UKCA 1BTOA 2CLSA 2O0HA 2UZAA 4PZ9A 2FMXA 3BWMA 1QGUA 4GZ6A 2B2XA 4DMFA 3AESB 4NU6A 3SMQA 4JSRA 1KQGA 2DZCA 4BNDA 2VBGA 3M6LA 1GNRA 3V8JA 3H1GA 3QNWA 1EM8A 4TTVA 3IH5A 3BS4A 2I3BA 2O07A 3NHZA 4HO1X 4WFKA 4GF5A 1K1EA 2DECA 3AUJB 4RKRA 4ZVPA 1EA5A 2O8NA 3OZWA 4ITRC 3SOZA 3T3EA 3KQHA 1YZNA 5JDIC 2D4AA 4MHSA 1K8YB 3SS7X 2R8BA 5EJEA 3VKHA 2C8LA 3RTDA 4C0XA 3KPVA 1PS9A 3M49A 4G1BA 2Y92A 1M54A 3OAAA 1ZH8A 4DRXA 1JQBA 3N2KA 5LU8A 2VXYA 2XW6A 3GH3A 11ASA 2FP3A 4S1PA 4TL9A 5EJIA 4F6CA 2XRMA 2NZXA 1V16B 2OUIA 4FLEA 4D43A 3HM2A 1C2YA 2FQQA 2PANA 2P0EA 4PZLA 4BBJA 4TQFA 3UAGA 4BEWA 4ETMA 1JN0A 3LPLA 3BAZA 3E23A 5T8KC 4YXWD 5JUWA 1DTWB 3U44A 2ZRMA 4HWOA 3RIXA 1G2OA 3IT1A 2G9VA 1ZD2P 2EGHA 1M7HA 4HLUC 2P3LA 1KZ4A 3Q3CA 1SD1A 2GEFA 4FPXA 1I3LA 4ZZ2A 5KQLA 2HL6A 1MQ8B 2PKEA 3GDGA 2HNKA 2DBVO 2HX1A 2I29A 1ZFNA 3RYIB 3HUFA 2XTIA 3DTVD 2C7QA 2ZZKA 4OO3A 3H8SA 1EFAA 5CCBA 1E5QA 2Q4TA 1VA4A 3P2YA 4H31A 5LLDA 3R9KA 3WKAA 3TWOA 3VU8A 3WQHA 4AYWA 4HEA1 3LRXA 1F60A 1RWMA 2VUUA 1GLNA 2PT7A 5IAEA 4J94A 4DT1A 3ZBPA 4OAOA 1U3DA 4ENTA 2A9OA 4QULA 4YJHB 2O50A 3DUFB 3M33A 5LUAA 2H2WA 2CNWD 4E70A 5H9VA 1ZJYA 5CJ2A 5BSRA 5CXXA 1MH9A 4GMFA 3KRTA 4Y6GB 3WYGA 1H05A 3R3YA 2W6OA 4OI1A 2CXXA 1HX7A 5EPEA 1PZFA 1E7MA 4EAAA 4BWAA 3KXPA 5LDHA 1GZ5A 1EEXB 3UMMA 2ZQYA 1UXIA 4PF1A 2IYPA 4WZAA 3WVNA 3RVLA 1J9EA 1YU6A 5B1EA 1CBUA 1AKTA 1Z0FA 3K8QA 4ZO8A 4ZXFA 3ZQJA 4QUIA 4BGVA 4OL0A 4FB4A 4ZYXA 4X62B 2PZJA 2RHQA 4ZHQB 4YRCA 2L69A 2Y9MB 4O1MA 4EAQA 1QK5A 4RABA 3QOWA 2QE7D 2PBZA 4G56A 3SE0A 3PD1A 2YUTA 4IYJA 4L8GA 4E2XA 3DD1A 3IESA 1PJQA 1BRMA 4QUHA 1E9FA 3WK6A 2WYIA 3A1NA 1AV6A 3W6ZA 3C8HA 3L8GA 2A3RA 3H5AA 3KR9A 1DAPA 2D2EA 2YQ5A 1LVUA 4FOLA 1WXHA 4HVAA 1FLNA 1HFJA 2Z9BA 2X3UA 2JFGA 4I1YA 4J16C 1T1EA 4BB0A 4CLDA 4NSNA 1B3RA 3P9KA 5JQGA 1H4VB 2PS0A 2ERCA 5D3KA 5M2QA 1OH8A 3B2QA 3A6EA 4Y1GA 1A5TA 5F1YA 4BFUA 4BEJA 3AKZA 3IAAA 1YKFA 4BB6A 1XZFA 1YFTA 1P73A 1UM9A 2UYCA 4WCFB 1ZM4A 1AB5A 4EKIA 2R25B 12ASA 4KWTA 5EPUA 1KSFX 1RHJA 1UFKA 1Z74A 3QRWA 1I7PA 4B6JA 3GH1A 4ICIA 3H42B 2OFXA 3Q2OA 3V2UA 1OBVA 3WGYA 4B17A 2FW0A 3AJDA 2LKDA 4FT4A 4TXNA 5DFAA 1CSEE 1PNRA 2QN1A 1QNFA 2IK8A 1Y8RB 3A2NA 3QPCA 5KMGB 4X6UA 4W9NA 4DAEA 4NBVA 1AX9A 4Q4HB 1NF8A 4A82A 3CLUC 4ZPJA 2FUEA 4PR3A 3AFOA 3LUAA 4KGXA 5KJ6A 3GLIB 4TLDA 5EIBC 3WJ7A 4KXQA 3L6EA 2H5EA 2R66A 2EEZA 4OM8A 3TNDA 5H9WA 2GA9A 3E9HA 3Q11A 5F64A 1OH7A 1EHCA 1SBYA 5DHQA 2E2WA 1U7HA 3G1UA 2O5RA 5J5AA 5KWEA 5ECGC 3SKVA 4P98A 1J8QA 3V7WA 3LT0A 1IN1A 1L1QA 2ZCVA 4ZIRA 4MGZR 2NV0A 4MVJM 4N49A 5CG1A 2A1UB 3SS9X 3BXZA 5BV0A 4N5MA 3RBAA 3FAZA 3HXKA 4Q3NA 1ZN2A 1N4AA 4A0GA 2C5HA 2C7GA 4DLLA 4B3SB 2Q6IA 4V0NA 1TZMA 3CQ9A 3I5XA 1NQWA 2DXIA 1L0BA 1OLOA 3E61A 1N3LA 3T5MA 2PZ8A 4AJJA 4QRHA 5LZ7A 2G40A 2H2FA 3BFKA 3TD2A 3HDYA 2AR9A 4EW2A 1POWA 4QUKA 3CUYA 1Y9JA 3K8YA 4XWKA 2UUCB 4F7WA 2PRIA 5AW4A 3T7RA 2ZSDA 5K8JB 4KIFA 2YC4C 4A92A 4K6MA 4HX9A 4LSZA 2IBSA 3VTFA 3M5WA 3QG1A 4DC9A 3OOJA 3D6NB 2R47A 3G0HA 4JLDA 3QQ5A 1NVWQ 1DIHA 1U7WA 2P0AA 4K28A 3VDMA 4BKPA 2AMCA 3UJAA 1SHTX 2R8YA 3IP8A 2Z4RA 3T41A 1MNQA 1U2DA 5FWNA 4MJ7A 4W7HA 2RHMA 4JKIA 3RSSA 5KYUA 2F17A 2YDYA 5A5VA 3WKDA 1GXSB 1QAMA 2Y1OA 3R3XA 3AEQA 2AW3A 4ZXPA 3W5IA 1EP3B 1RJ9A 5K5EA 2WM9B 2YS7A 3D8HA 3LBFA 4X7RA 1ORWA 4XUGB 1TUEA 4N5IX 1EWVA 4D44A 3L8YA 1XWIA 1OLXA 2RI0A 5JPDA 3HSYA 4L4UA 2BW0A 2E3JA 3SYTA 1OXXK 3A5ZA 2JD1A 3KU1A 4DDUA 1OB2A 3O90A 3R40A 4DUPA 5T4BA 1KH3A 3I45A 4LPKA 4JWTA 3QNEA 1ECCA 3T7TA 1FYFA 2EWMA 2L18A 3RUPA 1EXVA 3PE6A 4N7JA 4BKRA 2PX0A 2FR0A 3S2UA 1Z0SA 4ZIBA 4TLLB 3M9LA 4MCAA 1AIPA 5IT4A 4J1QA 4KLCA 4X3CA 3RJTA 2Q5JA 1N7IA 3KLPX 2O54A 6ADHA 3ZZ1A 2ZYUX 4OBXA 1XJQA 4FKZA 3DLTA 4GMHA 2OZEA 3ASYA 4HDOB 2XTNA 3VRHA 3ETGA 5AHRA 1LPOA 1EFTA 5EMNA 2JF0A 3R7WB 2AN4A 4MR9A 2ZRPA 3BXPA 4LW8A 4NG4A 1KMMA 4ZQCB 2QK4A 4MA0A 2BEUB 1R50A 3O5AA 1WWKA 4R2XA 4ZKEA 2HQSA 4LG1A 1V5WA 2QN2A 3JALB 3RVJA 4TTIA 1DG9A 5GOZA 4RPKA 5L40A 4GM1A 4OX9B 2BE7A 2F62A 1MVLA 3HUDA 3GLFB 1TYZA 3DZKA 2QUBA 1WP4A 1XZIA 4TRNA 1GG2A 4C2AA 2DHQA 1MOSA 3QU4A 4K86A 3V46A 4LRWA 4CM4B 3ORQA 4JVMA 1V4NA 2Q8NA 4NJOA 5T7BA 1XKTA 1X39A 3DXXA 1I5RA 2XQIA 1DQPA 5LBUA 4AFNA 1JQAA 2IYOA 1XCOA 1W66A 1WTCA 4KQ9A 4TMKA 3AVYA 1V25A 3WDLA 5KYWA 5DO9A 2RGUA 3RGLA 3EGEA 4C0WA 2DQ0A 3BIFA 4FZ3A 2P2LA 5AM5A 3SYRA 4K0KB 2PEYA 3IVRA 1GCAA 1QCDA 1W94A 1UQTA 2D2IA 1IQPA 2JCGA 3F4KA 4JVLA 5FOWA 4ARVA 3T1TA 1PNVA 3EGDB 1X1DA 4QNRA 2V55B 2YOFA 2IDKA 2PS1A 1LD3A 4P7KA 4KBGA 3IUSA 4F2HA 1QYVA 2C61A 4JA2A 4HFNA 3HJBA 4I6JA 1VPLA 1B15A 1XTTA 1Y63A 2ARKA 1T8PA 2FMIA 2JI9A 3DOOA 3N75A 1NW8A 1XQ1A 1YR9A 4XSGA 3ZGYA 5HQTA 1DE0A 3K9GA 4TN5A 4IYRA 1CEQA 3EAGA 1SOWA 2QF7A 4CWAA 3EZ7A 1R6TA 1S6YA 1YZUA 1E4VA 1OXVA 2F8MA 1RI4A 2H0AA 3N07A 4OIMA 3JWEA 1RQRA 1QC5B 4P72C 4HAOA 4ZOAA 3M4QA 4Z4EA 2J6CA 4CKXA 4HFMA 2O5VA 4D74A 4EZIA 4QXOA 3OPXA 1ZR4A 1UOPA 2CLIB 1ILEA 4MV0A 5EXSA 1J8DA 2FE4A 4QU8A 3KVYA 4L9RA 1E32A 1UPXA 3JVDA 1O6BA 5ICCA 3E9DA 4FYYA 4JKYA 2DR3A 2KYRA 1ZH0A 1UZUA 4AF7A 1RQLA 1YASA 2D59A 2G9UA 3QUTA 4JC0A 2AMFA 2MYPA 1B7GO 1RWXA 1C4WA 3W5VA 3VH3A 5BSWA 4JITA 5JDIA 2O14A 1KY5A 4EL5A 4IJVA 1HDCA 2I2FA 4FGSA 5GIOE 2VSNA 1XTZA 1FDSA 4ZDWA 3VR5H 3FPSA 4CI0B 2WWVD 4A3SA 3UT5B 2TMKA 4PO3X 1US8A 2YQ4A 2H63A 3EXEB 1XK6A 1OBCA 3K9WA 1Q6ZA 4QLOA 3LQ4A 1NPDA 4ROTA 1P17A 2OY0A 1M0TA 2PLNA 1QRAA 3I1IA 4IXMA 3CR7A 4YJDA 3FKJA 1ZD5A 1RPAA 3O0TA 1GDDA 1J49A 4JFRA 1V2HE 1VCNA 5DBFA 1Z4IA 2PMWB 2VHXA 1YB7A 2X2PA 4MVJF 2V7EA 4NCBA 1S3IA 1DAKA 4HLUA 4A26A 3HKCA 1IZZA 4XX0A 3WWDA 2F3TA 3P0RA 4EJMA 4J0DA 4HQRA 3PXAA 1C9DB 1Q1ZA 1X1TA 2C0PA 5FIUA 5G1NA 2AFHB 5GM2A 4PX9A 3UO8B 2R11A 4LZLA 4PZPA 1NULA 3ZHUA 1JIJA 2J07A 3F9CA 2BFFB 4X90A 4MPPA 1FLDA 1K98A 4QFMA 3RE1A 4C0LA 4BQIA 2C54A 2JGDA 2BGKA 5FOSA 5I45A 4KXUA 2ATCA 2YV1A 4K3VA 4K5QA 1M6HA 3V4SA 3WP1B 1IXSB 4B8YA 5A9SB 2AK3A 3FOBA 1T91A 4C4XA 1LDNA 3OA2A 4NAVA 2R6AA 4UNIA 1HEUA 1XYGA 3GL9A 3ZE7A 2AI2A 4Z1OA 4NZYA 3SC3A 4C6TB 2Z8ZA 1FBNA 3F8SA 3M1YA 1CFJA 3ZHRA 13PKA 4GZLA 3BGOS 3MGCA 3OCZA 2FPPB 5EIAA 1DBSA 1VKJA 4TMFA 3UG6A 5HGXA 3T0FA 5KYYA 4CMIA 1C3VA 5K20A 2BTQA 2XMBA 3ADKA 4LJRA 1PYDA 1EZ1A 1Y3CE 5B1DA 4PHFA 4OOEA 4UVIA 4E4YA 5IM4A 3GRUA 4AQYB 2IEBA 4O63O 4QATA 2OBNA 4RHXA 5H68A 1LH0A 2R4TA 3RFVA 1UEIA 4NF2A 4JLVA 3I2YX 4WFQA 3QU5A 5FTNA 2AMYA 2PSEA 4FMCF 4RZUA 3OSUA 1UBGA 4YJ3B 3SKYA 1Y7TA 3RQIA 4BPRA 4PSVA 3ZY5A 1XZPA 1RHQA 5HQJA 1YDHA 2HSDA 2YMPA 4KV9A 1G21B 3COVA 3NHLA 4BQSA 4OLAA 1H23A 4Q47A 2V7VA 5J9FA 3V4FA 4OFBA 3WO0A 1CNFA 3IS3A 5AKLA 1TQHA 3WFZA 2W2OA 3H18A 3STWA 2ZJOA 4I9UA 4NYIQ 2CNOA 1R12A 4BNZA 4JCOA 3DGEC 3E7DA 1ZHOA 2RH8A 3SFZA 4XU2A 1RYDA 1CRWG 1PR9A 3W77A 1ULZA 1GR0A 1IHYA 5BR4A 2DETA 1OBOA 2FSIA 1MKYA 2Z3ZA 3MXOA 4J16A 4JI1B 2DVEA 2FLWA 2JCSA 2E1PA 3INNA 3VQTA 1H42A 1T1SA 3PGLA 4MX8A 4N40A 1JJBA 2WOJA 5JI3E 2AMVA 2HF2A 1ESDA 2FWAA 4EZBA 3IAS6 5LXTA 1KAMA 4BNIA 3E7XA 5HM6A 1V95A 1KVUA 2HJ9A 1SWWA 1WLEA 4MWSA 4FKMA 4JD5A 2PU5A 4ZRMA 1HFKA 4U9IS 1X8KA 1BJKA 2Q9UA 2QTRA 4Q9JA 4JBWA 3X1KA 1U0RA 4AY2A 4XVCA 1P6QA 3A4MA 5IF9A 2DX7A 1CYEA 4PTLA 1JB1A 1VJTA 3P1JA 2Y68A 1E5DA 3TDKA 1ZUNA 4P74C 3PHCA 1W88B 3LQQA 1XZAA 4IZOA 4OP3A 3E9RA 2BTOA 3HVHA 2P90A 3AUSA 4B4OA 2PQ6A 3NJ8A 1JNXX 1NT2A 1MX1A 4KGDA 2YUIA 4CCSA 4CH6A 2PWBA 1T2UA 1TK3A 2G4LA 2QI9C 5F9MA 2BBSA 1LGYA 1IK4A 2GVNA 4Y6PA 1EM8B 3R6GA 1MXHA 3EXHB 2YNMD 3L8DA 2WWGA 1PGPA 3ZCPA 2P9EA 4ZRNA 2I7VA 3CX8A 1GFWA 1KPHA 1KRHA 3INTA 4LFAB 3STTA 1KSGA 5BNWA 2FH5B 2JC3A 4DBZA 5KSZA 5GGYA 4EMBA 1G7TA 3IP6A 4OHUA 1WUTA 3OIVA 1M8PA 1XXLA 5C0OE 5FCDA 1ZQ1A 2IS6A 4DG5A 2Y05A 4OB7A 1WPGA 2YWHA 3R5KA 1L4NA 5DP2A 3AXTA 2V9PA 3LUGA 3M7IA 1JLSA 2DHRA 1SKUA 4ARCA 3A32A 3RIRA 1FVOA 4PAWA 1PYSA 4A0FA 2IX9A 3H1FA 1TFUA 4RVHA 4RTJA 1ENZA 5HK9A 5AP9A 3ZU6A 1YL6A 1JKIA 3LQ1A 4BVJA 2IE8A 5GZ3A 5ADUS 3PKIA 3UAVA 2X4LA 1GTVA 4YR9A 1TCBA 2Z8YA 1XB2A 4M7OA 2UZ1A 5G3ZA 5IABA 2CB0A 3PZBA 2R7LA 3H05A 2XXAA 1IB0A 5LNK6 2B2CA 1HE2A 4QRDA 5DSTA 3EPLA 5CYGA 2QRPA 3GOQA 2WJGA 3RS2A 3LDGA 4RIGA 3QLVA 3W7AA 4QGGA 4HVTA 4YMHA 2XUOA 5JG7A 1NI4A 1UH5A 5JMPA 5U4QA 4O4JA 2QD2A 4KODA 2QAGB 4N5DA 4OMUA 3QE0A 3PNPA 3RSHA 1V8DA 3KSRA 2VJQA 2ONJA 3RUXA 4K1XA 2VYND 4EW1A 3ZV7A 4CMHA 3PX3A 1NL3A 3JQGA 5CCDA 3T7AA 2MYNA 4DNPA 3H0EA 5DM60 3TTYA 4Q3CA 3ZVKA 2P69A 3M6MD 4BMDA 4Z4QA 2O2SA 1N0IA 1H0KA 4E14A 2AHOA 2ONKA 3BDVA 2V0CA 5CT6A 4B33A 3TINA 6GPBA 4LY0A 3EUWA 3SN6A 4AY3A 2Q7DA 2CXRA 1WPYA 5TJHA 1GKYA 1K8XB 1GKUB 3GT3A 3DO8A 3S1SA 1M5UA 3WYFA 3PLAE 2VF5X 3AJ9A 1B1AA 4JT9A 4MYDA 4Y7DA 3HN7A 1V43A 2COEA 1Q1QA 2E4ZA 2P9BA 4J2OA 3S5JA 2XAAA 4EQ6B 1ICEA 3U4QA 2XI4A 3A3YA 3UMRA 1WX1A 3A4LA 5WRFA 1BHQ1 1I6MA 3V9PA 3EMDA 1RKXA 3TW6A 4B75A 4BPBA 4EDHA 4B2IA 4NCKA 3R3UA 4MR7B 4I4LA 1NA5A 5JXHA 1CQWA 1GGEA 4PQRA 1CUDA 3M6VA 4Z53A 1PLLA 3RTGA 1F6WA 3OFJA 3UJPA 3HCPA 4H1TA 4GSLA 4C1BA 1QFJA 2ON6A 2J45A 4RXMA 4YPVA 4ARZA 2XADA 4DDHA 1USYA 5J59A 2NO9A 3SQWA 5B3LA 2RH9B 3MQZA 3FW1A 3ABSB 3VU0A 3PFFA 2ATEA 2P35A 4NL4H 4QBKA 4JIMA 2QR5A 1Y5MA 3WE7A 4C3UA 3H5RA 5K2OA 3U6BA 4CQMD 1YCGA 3SG0A 1H6CA 4FCTA 2R751 2A5LA 1VMEA 3TQFA 1E3JA 3ADPA 3MS7A 1B00A 4RQTA 1XJ5A 5HG0A 2JH3A 1NF9A 1RRGA 4OQYA 1RMTA 3GJ8A 4ARSA 2XCTB 4CYMA 1JBKA 4OEHA 1VE1A 3P96A 1IWBB 1U0FA 4ISBA 1SG0A 1DCFA 2YY7A 1S02A 1QS0A 4UJ5A 4E2ZA 3WMGA 4MRMA 3P2MA 3BCRA 3CW2A 3DJFA 2O2DA 2VSOA 4FSDA 4PZ0A 4CCAA 5AVWA 3MJHA 2AG1A 4ZCQA 4X1IB 3WFJA 4FX2A 2PEZA 3FDXA 3EF3A 2ODWA 3BFVA 4PZCA 4CF4A 1ATZA 3JV7A 1NX9A 4GX2A 3MOGA 1HNNA 4LZZA 4K0RA 4KMOA 4W7IA 2E9SA 1NZFA 1RQGA 3BIWA 1T8TA 1CIPA 3FHCB 4NYMR 3C6BA 3H4IA 4LXIA 4XCVA 3OPMA 3G8CA 3C6KA 1W0JA 1UDRA 3GNTA 2NUPA 3T3OA 4IBOA 3TO5A 2W2NA 4IEEA 1YZKA 2GJ8A 1IRXA 1JHPA 4EVQA 5KDLA 3RM3A 3Q15C 4BC0A 5B57C 2YXBA 4PLFA 4RVOA 3ON5A 5EUQB 4PLYA 4P72A 3LT4A 1QHFA 1I13A 3WRYC 1VG0B 3B1XA 1Z62A 1D09A 3OC6A 3EUAA 1VPTA 4XW2A 1PJZA 4AQDA 2VQFB 1P19A 3VXKA 1EGQA 3HNOA 3FTEA 2EYQA 2BHNA 2NO1A 2VKQA 3HJNA 1NN5A 4OQZA 1ORHA 3EDOA 1JLHA 4YBZA 4NFYA 3OQJA 4U3JB 2E21A 4TMVA 3I9V1 3D2BA 1LK0A 1YC2A 1VI5A 3B6MA 3BB3A 3BJEA 3G0OA 3RHTA 3SD7A 1EBUA 3EFEA 5FNVB 4Y2YA 3S55A 5J4KA 4G0UA 4IS2A 2QLTA 4MVCA 3S7TA 2ZE6A 5CT4A 5EHIA 4MGEA 2NUTA 2W42A 1BIAA 4E5PA 2WWFA 5JPCA 1I94B 2Z5GA 1WS6A 4DR7B 2YZGA 2XT0A 1WMFA 3L1IA 1LNQA 1JIXA 4XSVA 1FYWA 2P75A 2R65A 2XVXA 3WX0A 5IDQA 4B6FA 2I4MA 2WI8A 1RYFA 3FZQA 3R0VA 1UBEA 2CVFA 1Q11A 3PU6A 5D51S 2J3IA 4JXKA 1EK6A 1LBHA 4MUBA 5E6RB 1O1YA 4YJ2F 1HKUA 3UXYA 5CB0A 4UVDA 4G9BA 2XQFA 2DPMA 5LQDA 2OHXA 4CS4A 2G70A 2DPGA 3E82A 4B3CA 3MMZA 3GLHE 3QV2A 1IUKA 3DULA 3EZNA 4HV4A 4UNSA 3GG2A 1OOEA 5KWVA 1MR3F 4NV0A 1ASZA 2JANA 3MRXA 3KJXA 3P0JA 3PQEA 1A0OA 5HCNA 4KR9A 3K1JA 4MS1A 3TOCA 1FX1A 4ZU6X 1GDHA 2VDKB 4B3JA 3PR3A 3N7UA 1E9AA 2GXQA 4URZR 3DT8A 3A1VA 3QKSB 5HJ5A 1IVYA 2QUZA 3P0EA 3FCOA 4ID9A 4MUMA 4EFDA 1X7GA 1FUYB 4NLLA 3B8EA 1RJEA 4DLRA 3R3SA 5KIAA 3CF6R 2PLFA 5DCYA 1KH1A 5CHYA 3I6QA 3UYKA 3CC8A 3F6YA 2IU0A 2AOUA 4AO8A 1R6BX 2OGSA 4R3WA 1CR0A 4JU9A 3AM3A 4J15A 2HLNA 2WJ3A 3UQYS 4CM1A 2XMPA 1N8SA 4I36A 2GCOB 2NQTA 3AY7A 1OAOC 2HU5A 3I28A 2BZSA 3N0WA 2ST1A 2D5CA 4RK5A 4WL0A 5A2GA 5JMTA 4BNUA 2ZT8A 4REOA 3S1AA 3OIGA 1B14A 4MRNA 3A9SA 2E10A 1NX6A 1NVTA 2ZUBA 1T9BA 2VHYA 4J1SA 4AMVA 5EXEA 1JLLB 1DAHA 4G25A 1G51A 1UBOS 3WDMA 3EPHA 2BYTA 3BF8A 1PIWA 4PG3A 2M1XA 2AC4A 5F76A 3DQZA 4WXHA 2ZYDA 1QYWA 3ICPA 3JD1A 5HUJA 1OKKA 4QG7A 4YAEA 3HJTA 2HU2A 3GNQA 3LDAA 3TFQA 1B0PA 2YDXA 2ZAMA 4HX5A 1ZO8A 4LNHA 1XRLA 2BMDA 4UAJA 4WXPA 5ER6A 5HIMA 3W2EA 4EHBA 4EUNA 4POOA 5K4GA 4RKYA 5FBLB 1MXFA 1RAIA 1RWNA 2YL2A 4NZ9A 3RG8A 3GUVA 4PG5A 5KYWB 1PTJC 1VCOA 3AP2A 4O02B 5AJUA 4NHOA 1AQ6A 2W98A 2NU6A 3U5TA 4X1YB 1WDWB 3D3WA 1Q21A 3AM5A 3PEUA 4JKOA 1ZOPA 3F3KA 4XM1A 1CX9B 3TL6A 4EA6A 1BKDR 3N3BC 2NXNA 1RFLA 3DVQX 2PS3A 5LFAA 1G4HA 1TQ2A 3HUEA 3MD0A 5CNIA 1X2BA 4E11A 3VSDA 2O8FB 5IAOA 2HIMA 4NDAA 4I55F 2E7ZA 2FW1A 4Y9TA 4FGUA 1HFWA 3OUTA 4GNKA 4JQZA 1IY2A 1H0RA 1KMIY 3SQMA 3BKXA 1EUYA 3T7JA 2OXTA 3VQVA 1LB1B 1T9KA 1PZGA 4A4DA 4A6PA 2DQYA 1ZCFA 2GTHA 4UNPA 3QMMA 3M6FA 4EGQA 1ZOOA 2FYTA 3HC7A 4JQSA 4CF6A 4ZQBA 2C1EA 2ADMA 3RRFA 4P74A 2EP7A 1KP2A 3E7WA 1KP3A 5KX5B 2J6HA 3SEAA 1E2MA 4BATA 3VR5D 2Q1SA 2W83A 3L9WA 3S2EA 1PEYA 3U80A 1Y5RA 2W6IA 4JR1A 1K4YA 4EA9A 3BK1A 1HFEL 1XVUA 3KQTA 3Q6MA 3L0ZA 1DKUA 1TAHA 3MYRA 3ST7A 2WP0A 3W3AH 5LMUB 5G0UA 3UJHA 2E41A 3UK1A 2V5AA 2YOHA 4QDOA 4JQOA 1U0NA 1S0UA 4CFYA 1URPA 5D5QA 1PFKA 2CF6A 2DFVA 2G06A 2WF7A 2X8WA 3USZA 2D5LA 1K7CA 3FF1A 2HF8A 1E3EA 2Q4OA 2XT9A 3VU3A 1N7JA 1SEPA 2W2LD 3RFFA 3O8DA 2EAUA 2OG2A 1EFWA 2QRZA 1CY6A 1ZHHA 2UUPA 3O21A 5KBYA 2EBFX 4GIBA 4JQYA 3ZWCA 2PMDA 4DF3A 4JROA 5TF4A 5KEIA 3W8DA 3C8UA 2O8EA 4JVOA 5DCWA 1QRRA 4OGFA 3C24A 3QYFA 1EDOA 1M3SA 2YWXA 3HWSA 3QOXA 4R8VA 1K6MA 1NURA 3FVVA 4WN3A 1KZ6A 3L41A 3RVNA 3T0GA 5I7UA 5CDFA 1UFVA 5CBPB 4QXRA 4QRIA 2GEKA 2DB3A 3OTGA 4YPOA 3RROA 3FTCA 3ZU4A 4B3GA 4U8GA 1R0CA 4MYRA 2C3YA 4LMBA 1IOWA 4QOIA 2RGBA 2FFHA 3R6DA 4ALLA 2PZBA 2X0NA 3GVXA 2RJOA 4KZPA 3KV1A 4JU8A 4BFTA 4MIEA 1WXEA 5B1IA 4DOMA 1WA5A 2AWNA 2IIVA 3NIWA 4IDGA 4K9KA 4RD6A 4U2CA 5IDVA 1OHHA 2FFJA 1RWKA 1XJWA 1P3DA 2E18A 2E82A 4RUKA 4MARA 1KE1A 3WC4A 2QLBA 2FPMA 4KXFB 4A15A 4IG4A 1SNYA 1TK9A 2E4YA 2X14A 1GQFA 2OUKA 4U00A 3TOVA 4YYZA 1N2BA 1VLVA 3ILSA 3R0XA 4P0TA 2MHCA 2IUFA 5HCIA 3IV6A 1GVHA 5FTMA 1G3QA 2V7QA 3UW3A 1TM7E 1UXGA 2G08A 3EZ9A 3ISTA 2A0WA 1VE7A 4J2HA 4P4TA 4F92B 3EZ6A 2IKSA 4WNYA 2DPLA 4RENA 2AL7A 2VUTA 3EDRA 3R0ZA 8GPBA 2XCRB 3KDAA 5FBKA 1T5HX 1VI2A 4BX2A 4G1VA 3HKBA 4KQJA 2BELA 3SPXA 1CJBA 4C06A 2H48A 3BGWA 1G8MA 5E7MA 4RVDA 3QJYA 1NC3A 2UXBB 4UTRA 1Z5OA 3LVBA 5B2ZA 3FMVA 4IIGA 2AZTA 4RV9A 3VO9A 3ZDYB 5JBQA 3LVFO 4HADA 1P45A 5E4YA 4ZN6A 2Q2OA 5JNRA 5TPZA 1Z7YA 5A4JA 1EDEA 1JMKC 3R5JA 1RQNA 4GOOD 3V4LA 5JW6A 1FE8A 1QIGA 4TV9B 1LXCA 4BWGA 2J9ZB 1AS3A 3C3EA 1W0KD 1UWCA 3ROGA 4N6OA 1CJCA 2AOTA 4B82A 1WPQA 2GASA 3GGCA 1LS6A 1U31A 2XUKA 2XMCA 4O3FA 3U60B 2G0NA 2BFDA 5CLIA 2XNSA 3WK9A 4M37A 5DE3A 4DGSA 2EWNA 3VZQA 1ZJZA 1Z45A 4KCGA 2UVPB 3MCWA 3IUQA 1HDIA 3TMKA 3KB8A 4PC1A 5DGTA 4DQ2A 1R6AA 2BFOA 2ODPA 5TMBA 5EGSA 1FDTA 1P0QA 3OG9A 4YYEA 1RC0A 2EKDA 1MEJA 2QTBA 5ALSA 5LJIA 2BSXA 4H7IA 1U1GA 1FP6A 1NJ2A 5EXPA 4GM4A 3U7IA 1H94A 2P40A 4IR7A 1LLCA 3G68A 4RU1A 1TT5A 3DPUA 3MWEA 1KJZA 1KC3A 2BBTA 3PNBA 5JADA 2O7NA 3PXCX 1F0NA 1Z28A 4MI9A 1YQ9A 2ORVA 2Q5OA 5T5QA 2XVYA 4CQLA 2QZZA 4ACAA 2A59A 4K03A 4Q1FA 5CK5A 3GFFA 2RHOA 2B36A 2HCRA 4QNNA 3OPNA 1XMJA 1THGA 1DLJA 1T1JA 4DWOA 4OGKA 3J81k 4KG7A 3OIFA 5J47A 1LPBB 1QQ5A 4JBIA 2R7NA 4KXWA 1TXGA 4OK5A 2V59A 1V8BA 4NIMA 3RIMA 1KO8A 4KYVA 2NZ2A 4EEKA 4ZYLA 3NYIA 2NU7A 5I7OA 4RIHA 2DHCA 1RRFA 1IK6A 2W9XA 1OGYA 3M1LA 5JS2A 3GJ0A 3IIIA 2CBZA 3N5CA 3WLEA 2RONA 1U9CA 2EGUA 3GMIA 4BFLA 5IKXA 3LBNA 3OTHA 3PF9A 1K5DA 1MQ9A 4PAGA 1L5KA 3FOEC 4B35A 3B2EA 1CULC 5AM0A 2XHEA 3H99A 2HHJA 2NTNA 5FPTA 3TAHA 4DIKA 1KS9A 4DTCA 3F4BA 4DQDA 1Z7WA 4MUFA 1Q12A 1JT9A 4EJSC 4LVIA 4JL5A 1QWSA 3O9ZA 1PDOA 1ZGBA 2PX3A 4MO9A 1ULUA 1EEHA 2UZ1B 1CXZA 4RVCA 4FEAA 3GDWA 4WOBA 5AKHA 5JWHA 3A9TA 4EPTA 2B34A 1OASA 4P7JA 2BEJA 4PQGA 5C5EA 1O94D 2GKOA 1HG1A 1SAYA 1JFFA 1FUEA 4LNUA 3HA3A 1CWUA 1PD1A 2D0DA 2NZYA 4QTXA 3NWJA 1NI4B 1IVNA 4JI4B 2BUBA 4ZJPA 3Q7IA 3AHIA 3FPKA 4QOFA 2YV4A 1PL8A 1MABB 3CNNA 1B6GA 1GSHA 2CEKA 4QX6A 3JQGB 5CX4A 3NBKA 5C1IA 1JUDA 3GY0A 4DNXA 2IP4A 3GDOA 3HJCA 2NUAB 3ABOB 4F4DA 1DO2A 4BU1A 4JBLA 1SXJC 2XNDD 4TKUB 5AKXA 5DW3A 3EIHA 1Y8QA 5KX5A 4KPYA 3REUA 4EB3A 1SUAA 2AIRA 2WU1A 4UVHA 1SVIA 2I03A 3UJ8A 3VQYA 5FV7A 3UA3A 2W71A 5D01A 5IT9A 2K6GA 3KT3A 5EIXA 2QV0A 1Y4UA 3GA0A 1YQTA 3LVRE 1I6KA 5BSVA 5EFZA 2PUHA 3KKOA 3RIEA 3VHXA 1BQ3A 3GI1A 4AG5A 2Y0DA 3H13A 1CF9A 4HAZA 5JFOA 3KYDA 4Q24A 4B2LA 1N9WA 2JVIA 3RREA 4LV8B 2P9JA 3MWYW 4BXOA 2OHHA 2GYUA 3OE7D 3IBCA 2HT6A 5G4LA 3K0EA 3QFSA 5AO9A 4FFSA 2X9NA 1Z25A 1DHTA 3BCUA 3CJTA 1V48A 3B70A 7GPBA 5HXAA 1DJMA 4PPFA 2XXBA 2CXUA 1YR7A 2P1DA 1QX3A 3ET4A 3FRHA 5JFTA 4LJ7A 1VB3A 5A3JA 4PNPA 2XNKA 1MB9A 4Y6LA 1NW6A 1PFVA 3WGVA 5DTQA 4AP6A 2E5LB 1CVIA 3ASUA 2ZJ1A 3OO1A 5K3DA 3B6EA 1KZYC 2FUG1 5TC4A 4KXLA 1YRQA 4YB8A 4IVPA 1SZJG 1JTEA 4L76A 5B4UA 4PPQA 3HJUA 4XGIA 3I7FA 4R6WA 1E94E 1UL1X 3PQ8A 3GLKA 4FHCA 4KXYA 4ZP1A 3RKUA 4DLXA 2WSSD 1FYDA 2XE7A 3FYTA 3V7UA 4ZTBA 1QP7A 1N33B 3UK6A 1J2RA 2BEWB 5TQ2A 4F4IA 4D2IA 3QIAA 1GSOA 1XDGA 1Y1LA 1PTJA 1ZD9A 4XPZA 5FUXA 3RRJA 4K3UA 5HS4A 1R0XA 4R1MA 2AKWB 1VJ0A 2W2KA 2XWJI 3A25A 5EZQA 1A50B 2D1TA 2RGGA 3C3WA 1U2ZA 1FXUA 2VZ9A 3NHBA 1SVKA 3V8MA 3ZDCA 1UT6A 4D98A 3O83A 4CT4B 1USWA 3MCVA 3W90A 5CVTA 3ER9A 3JQRA 1CUAA 1JSXA 4RHTA 3NGMA 4E6PA 1EWYA 3PR1A 4FMDB 1O6FA 1BMTA 2R86A 3DHYA 1HT0A 4GWKA 3DMRA 3I8OA 5I01A 1Q0PA 1CIVA 1VB5A 4M0EA 3BQNB 3KC2A 5K1PA 3DA8A 3UY4A 3R7NA 1A4IA 3QUBA 4XASA 3RIGA 2NYAA 1QRUA 3URKA 1SMKA 4U1RA 4HF7A 3H19A 2VO1A 4N65A 1V8PA 4RZ3A 3HXUA 4Y2UA 2QRNA 2CZCA 1JIIA 1J5WA 1O3YA 1OH6A 2NWQA 3N8KA 2IVFA 2QLFA 4QQFA 4OXQA 2GYWA 2BLNA 4EA8A 1WJGA 4IRUB 2D2XA 5EE1A 3JX9A 4YROA 4RD0A 3U37A 3ZCVA 2J5KA 4Z9XA 3G0DA 1YA4A 3MHTA 1Y6JA 4QOEA 4A0SA 4L1KA 1BXKA 3NEJA 4AULA 2ZUEA 2ZJ0A 2GTIA 5L3SA 1R00A 4H6VA 5GADl 3UJ9A 1IWOA 3UEOA 3ITNA 1ECGA 4LF8B 2PGXA 3MUFA 1OV4A 2I22A 1VYUA 3AIIA 1JQDA 3RF7A 1WHSB 4HWRA 3WLPA 4RA9B 2NUTB 4OP1A 4CM6A 1YJAA 4Q3OA 1T35A 2C4HA 2FG7C 2OQ2A 4M55A 4BV3A 3PKZA 3NC4A 4CN9A 5KNNA 1HQDA 4BBAA 2HT1A 3V8QA 4WWHA 1V5FA 2AI1A 1BSVA 3O8QA 3M81A 5E7QA 3A4VA 2RAUA 1Y8CA 2VH2A 4JQCA 2ZANA 4POAA 2HBYA 1XHEA 3J7AC 5F7JA 1BS1A 1YDGA 3EG5A 3I0NA 2VQDA 4Q39A 5TQVA 1TO2E 2HCTA 2IEDA 1P31A 4PGFA 1EXNA 1XP5A 4JJZA 1BMDA 4A73A 5EZYB 1KXJA 4BB5A 3FSGD 4TMWA 3GRVA 3ZI7A 2ZUCA 1AURA 2GFIA 1MC4A 1BNCA 3QV1A 3SHFA 3LMKA 2CD9A 4NCNA 4ND3A 3SF8A 1H2WA 3LWZA 4PVDA 4BAUA 1ISRA 3CRMA 1XRQA 1XAHA 3RYHB 1VG9B 1LLFA 2JDIA 3IPCA 1WEKA 1BW9B 3W9YA 3TUZC 3DC2A 4HUJA 2BP7B 2IYVA 1W25A 1TF7A 3P8TA 2ORWA 2KMLA 4MYCA 3IEPA 3WLMA 1OU4A 3KD2A 1DV1A 3HYTA 4OQXA 3BJUA 2VT7A 2C59A 5JO9A 4COOA 4R40A 2X6QA 4Z6KA 5JJ5A 2PHZA 3IV7A 3JAKA 3N2GA 4Y18A 2W0MA 2UXDB 3I37X 4NYIR 4KREA 5AXBA 3L8CA 1WW3A 3PHBE 2HPHA 2O57A 1Y3DE 2P9FA 2E4WA 4Z3DA 1JSLA 1JA1A 3A0RB 4HLQB 3PGVA 4YACA 1RI3A 5LB2A 1VMAA 2NYRA 2GM9A 4ALMA 4BN5A 3B48A 2GS9A 1JSZA 1RTKA 5CLGA 2DPYA 4S1TA 2GM3A 3F6CA 5ALQA 1W4ZA 4JLNA 4QDJA 1KDVA 5LLTA 3PCRB 4ANFA 3DTVB 2EHJA 4Q18A 1FTWA 3GFPA 1NBEA 4E94A 1M2FA 1H1TA 3GT7A 2PXCA 1IULA 1WD5A 3EUFA 1A9YA 3MINB 4I8IA 1J0EA 4BMPB 3L0CA 1NUPA 1QVWA 1JKMA 1SURA 1G64A 2F67A 3QF4B 2VH1A 5DRYA 1MOQA 5FOVA 4V2UA 3N58A 2I34A 3KJFA 3OZGA 4Z3OA 2WM3A 1IG3A 4GOMD 3ZJ4A 3VNAA 3UCFA 4V1CA 5IKPA 3QTCA 3VA7A 2EKBA 2LKCA 3BKWA 3NONA 4GMDA 4RFVA 4DV7B 2PYZA 4MKIA 2DULA 4KXVA 1IUPA 1JE1A 2DWOA 2QTCA 4WK2B 3L18A 1R66A 4DR2B 1DC5A 5LKAA 1UEXC 2I4IA 1JU3A 2GPAA 2ZBUA 3EF0A 3LV8A 1JR3D 4YJ3F 5TV2A 5BYKA 4H2WA 1QQTA 2P2SA 3LRPA 3CZ9A 3VVMA 3GEBA 4DZZA 2O3JA 3PQ2A 3VJLA 3G9UA 3T7IA 1MIOA 2ZYRA 4FHFA 3W3AD 3WHLA 1M6EX 4OP2A 4D25A 3I3OA 1FP4B 1T24A 1IC6A 2HA4A 2XZPA 4UKDA 4UUPA 2MJLA 4XD7D 4AJNA 4DM7A 4QU5A 2I76A 2C4TA 2I1WA 6PFKA 4TKVB 1SVNA 5FOTA 3EX7C 3K5WA 3EQ7A 2WPDD 2D7CA 3V4VB 1JSCA 3UAZA 1X7XB 3Q0IA 3HGTA 2VBFA 4II2A 1F5SA 4LCBA 3S4YA 1KYWA 2HV9A 4CMEC 5JRDS 1BG6A 3KJGA 4DIEA 1SWVA 4BQOA 4XWWA 2Q9BA 4DIFA 5D6NA 2NP7A 4JI2B 5IVKA 1B0UA 3EG9B 5DKFA 4LTNA 3CT4A 4TTJA 4CN8A 2QRHA 5BORA 1VSTA 2IEGA 3G1ZA 3HSKA 2ZJFA 2HLPA 2Q1TA 5TX7A 1OY1A 3K2BA 3LUDA 5HUQA 2IYYA 2YJ4A 1N2CA 2QX7A 4OAPA 2N1MA 4L6CA 1WXGA 3JATA 2R2AA 3VKFA 3G59A 1Y34E 2XNCA 3C6QA 1H2BA 4RD1A 4RD4A 4WSOA 3SR4A 4EY3A 3BL8A 4HDSB 2WM2A 4B3RB 4PSAA 3CM0A 1GL9B 1GZSA 1D2MA 1A9QA 2QMZA 4G0WA 4L3OA 4UBLA 2FPRA 3DBLA 2BE9A 4XLZA 5FHQA 4BVFA 4M1MA 1ZXXA 3PJGA 3KB2A 4HPWA 4EJSA 1TYAE 3WAJA 2FMFA 4MJ3A 4YI3A 1UR5A 2FMUA 2YC2C 4DVGA 1H22A 2L82A 2HOQA 4MKZA 3KXLA 1P9RA 1ZD8A 1WM1A 2ZIMA 3G8BA 4KDEA 2GWHA 2B0CA 1R18A 1J2EA 4X8OA 2R5WA 1ZIYA 3WJAA 3B9RA 2GZMA 3CG0A 3BXGA 1ICIA 2VNIA 5C34B 4DCOA 4JBGA 3TE7A 4C5CA 4WBNA 1HV8A 1QFYA 5JAPA 5IT0A 2QE6A 5FPQA 5LQUA 3DBHB 1ZU4A 5E2IA 4IFTA 2C8VA 5BSUA 5AW1A 3QYPA 1DPGA 1SU4A 4E4TA 3OU6A 4G24A 4J4HA 4PZAA 3Q88A 5JCOC 3ER6A 1GU1A 1SVLA 1YA8A