3IKMB

Crystal structure of human mitochondrial dna polymerase holoenzyme
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
419
structure length
355
Chain Sequence
EALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKELIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQRKVLKLHPCLAPIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSRDTTMKEMMHISKLKDFLIKYISSAKNV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insight into processive human mitochondrial DNA synthesis and disease-related polymerase mutations.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA polymerase subunit gamma-1
total genus 57
structure length 355
sequence length 419
chains with identical sequence C, E, F
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03129 HGTP_anticodon Anticodon binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.930.10 Alpha Beta 2-Layer Sandwich BirA Bifunctional Protein; domain 2 Bira Bifunctional Protein; Domain 2 3ikmB01
3.40.50.800 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Anticodon-binding domain 3ikmB02
1J5WA 1NJ5A 3HTZA 1QF6A 1B70B 2RHQB 2ZT7A 1KOGA 4YRNA 4H02A 2Q5HA 4P3NA 2E64A 2ARUA 2P5IA 2IY5A 4TQDA 3R07A 3RKYA 3HY1A 3A31A 5K1PA 1NYQA 1WPYA 2DZ9A 3V8JA 4YRFA 3HFZB 2ZZGA 2ZGWA 4YRPA 4TTVA 3HFZA 3HRIA 2RHSA 4H2SA 3L4GB 4YRQA 4DPGA 3PCOA 3RF1A 1X56A 2DKGA 4CH5A 2HNIA 2Q7HA 1L0WA 3PCOB 5HGQA 4K86A 3A5YA 1VQZA 2DXUA 4AH6A 4P71A 1X01A 4KQEA 3PZCA 3MEYA 4RMFA 2ZTGA 1E1TA 3VQVA 3HXYA 2ZCEA 1X2GA 2QHTA 4PG3A 3HY0A 4G85A 2CIMA 2P0LA 1C0AA 1BBWA 3HXUA 4P74C 2RHQA 1WNLA 3UGTA 4X5OA 4XU1A 3ICAA 3LSQA 4E51A 2DDZA 3E9IA 2E65A 4CH3A 3LC0A 4OLFA 3UGQA 3A7AA 3MF1A 2E41A 1PYSB 1USYA 12ASA 4XTXA 2ODRD 3TEHA 2ZZEA 3G1ZA 1YB3A 2Q7GA 2DU5A 3E9HA 2ALYB 3QO7A 3CMQA 4HA8A 4UP7A 4WI1A 1E1OA 4EX5A 3VQWA 4XU3A 2DU7A 3VBBA 2CJAA 4HWSA 4RQFA 1ASZA 4L87A 3W3SA 1YGBA 1YFTA 4TWAA 1E24A 4P3PA 1NNHA 4YROA 3RL6A 1IL2A 4Q15A 2I4NA 3MF2A 3P8TA 2I4LA 3REUA 3UH0A 3OD1A 2AKWA 2ALYA 1GGMA 4YDQA 4CS4A 3NETA 3V8LA 1ASYA 4YRLA 1SRYA 4XTYA 2DJZA 2QHVA 2QHSA 3RACA 3HXZA 1ADJA 3HXVA 3QO5A 4UP8A 1JJCB 1KMMA 3RIRA 3EFRA 4YREA 1H4TA 4YRMA 1WQ7A 2ZT6A 2I4MA 4H2YA 1EFWA 4P73A 2EJGA 2E3CA 2EL9A 4H2TA 1NJ1A 5E3IA 2AMCA 4YCUA 2IY5B 4P75A 3HXXA 4WJ4A 3V7SA 1EVLA 4XU2A 2J3MA 11ASA 4TVAA 3UFGA 4ZIBA 1EOVA 4P71C 3I7FA 3HRKA 4Q6GA 4XEOA 4XEMA 5C52B 1Z7MA 4YCWA 1N9WA 2EJFA 3A7RA 2EAYA 5C53B 3P8YA 2DTIA 3TEHB 4H2UA 4WJ3M 3ERRA 2DZCA 1LYLA 4P74A 2E1HA 2ZXFA 1NJ6A 2CJBA 1KMNA 2EJ9A 2EWNA 4YPFA 3QTCA 2ARSA 4CS2A 1SETA 4XTVA 1X2HA 3A32A 3LSSA 2CGHA 4O2DA 3P8VA 5K1XA 3L2ZA 3BJUA 4P3OA 1NJ2A 3BFMA 4UPAA 1JJCA 3NEMA 1BBUA 2PMFA 2Q5IA 1EIYB 3QNEA 1HC7A 3REXA 2FYKA 3A5ZA 3RUXA 1HXDA 4P72C 4OP0A 3RKWA 4YRKA 4BWAA 2ZR3A 4EO4A 4YYEA 4CS3A 2DTHA 4BW9A 3L4GA 2DXTA 3IKLA 2I4OA 4CH4A 3NELA 4CH6A 4H2WA 3FJPA 1Z7NA 3RKXA 4KR2A 2QHUA 4UP9A 3WQZA 3V8KA 3NENA 2AMCB 3V7RA 2ZIOA 5ELOA 5C51B 4XTWA 1FYFA 3M4PA 1B8AA 1YFRA 1G5IA 4WF2A 5ELNA 1EQRA 1PYSA 4XTUA 4KR3A 1G5HA 4TVWA 3A74A 4H2XA 1B7YA 4HWOA 4H2XB 3VQXA 1BIBA 1B7YB 4DQ2A 1WYDA 1WU7A 2ZZFA 1SERA 2DQ0A 2XTIA 3L1AA 4P75C 3V7CA 1NYRA 4YRTA 3DSQA 3KFUA 2ZIMA 2ZINA 4K87A 4RDXA 1QE0A 4YRIA 3EFSA 1V95A 2ARTA 4P73C 4HWPA 4RQEA 1USYC 3M4QA 1HTTA 3HFVA 2RHSB 1RIQA 2PMEA 2DQ3A 1ATIA 4K88A 2ZR2A 4G84A 4LNSA 4YP0A 1EIYA 1B70A 1X55A 4TVAB 1X54A 1ADYA 3RGLA 2ZNJA 4TQFA 1WLEA 4YRGA 4H2VA 5KNNA 4XU0A 2E10A 4YRSA 1EVKA 4HVCA 4TVYA 3VQYA 2ZT5A 3IG2A 1G51A 1WQWA 2LW7A 1W66A 4PHCA 2G4CA 2CJ9A 2AKWB 4XTZA 2ODRC 1H4VB 4ZTUB 2DVEA 1NJ8A 3TUPA 3IKMB 4YRRA 4YRCA 4YRJA 3IALA 3HXWA 1B76A 2Q7EA 2J3LA 5F5WA 1H4SA 3QO8A 3A7UA 4ZTZB 1E22A 2C7IA 2C8MA 1H4QA 4NCXA 4YCVA 1BIAA 1YFSA 2DEQA 4J15A 4HWRA 1SESA 2DTOA 3TEGA 2E5AA 2ZT8A 2ZNIA 4P72A 4HWTA 2XGTA
chains in the Genus database with same CATH superfamily
4GMGA 2VYVD 4HPWA 3PPWA 1RAAA 2XNCA 4DILA 1H85A 4B09A 3VKHA 1Y3DE 2C0PA 4KE9A 1Q3HA 2QW8A 1S89A 2HA2A 5CRIA 5AD1A 2AI2A 1T5HX 2VDQB 3CBGA 3CRMA 5L7YA 2VJKA 3TUJC 1OB2A 1VGVA 3FR8A 3ND8A 2IJGX 4RIHA 5KS2A 5E7QA 3OSUA 5FUYA 4NBSA 2WPDA 4BKQA 4U6SA 1ECGA 1ZZEA 1ES9A 3RRYA 3EWAA 1KI6A 3HY1A 3V1MA 1DJOA 4O4IF 4C1BA 2WTUA 2JBWA 5E7MA 4ZIRB 1Y5IA 4GKAA 3H19A 3KE8A 1C41A 1V9CA 3MEQA 4G1MB 1WCWA 4HFNA 4L4RA 4C0BA 3TNDA 1JLSA 4UPDA 4ERNA 2Q28A 2W6OA 2ZRCA 3FYUC 3KTAA 3H42B 4H2SA 2B2CA 3T7KA 3L4GB 2PDAA 3MC1A 1CY2A 1KYIA 4HH4A 4FHEA 2ZJBA 4EY6A 2YCBA 2V4ZA 1Z2CA 4DWVA 1N5DA 3BTSA 1ECLA 3EEIA 3GEIA 4RS4A 4ENQA 2ZXUA 1DRWA 1UPXA 2OK7A 3DXZA 4LBYA 4FHFA 1T8RA 1YZYA 4B76A 3BG5A 4BFTA 2PV7A 2YCLA 1QYXA 2R25B 3FVTA 4ENUA 4KFCA 2PRIA 1VQZA 2V55B 1N6IA 3AI3A 1IVNA 3PI6A 4P36A 4TPKA 5F33A 1VJRA 3DDHA 4RV4A 2O7SA 3EIUA 5C8VA 1MXFA 2ZVJA 4JH0A 4DZZA 3G17A 4JUIA 3CLVA 4EYGA 1L8QA 4Q12A 3UH1A 2B82A 5K3FB 4KQ9A 4M54A 4OFBA 3CSSA 2W98A 5SZIA 3B1FA 4EKGA 1IBKB 5KYYA 2CFIA 3E18A 3ZWXA 2VCEA 2PZ8A 4J16C 4LN1A 2E18A 5LPNA 5B37A 2ST1A 1J0DA 4IW3B 3BKWA 4UKDA 3ETEA 4WKOA 3RSOA 1N5OX 3UW3A 1XHFA 4G5HA 4MRMA 2ZJ7A 1B8NA 4TQ9A 1CQWA 2C83A 2D2FA 2GPWA 4FCWA 4HO1X 3LDAA 1ZM4A 3S7ZA 2R8ZA 2RHLA 2FN8A 1M75A 5K0BA 3WDMA 2CCKA 2JFPA 4BKRA 2N46A 1QE3A 4WN9B 3VH3A 1XA4A 3HG7A 3WIOA 1E1CA 1YK0A 4ERXA 2VHZA 3DVSX 1J99A 3B3AA 3TQHA 3SWWA 1A1SA 3MS2A 5FFFA 3T1NA 3OPXA 2QVBA 2F62A 1GPKA 2XCUA 4EY8A 2C5HA 1YFKA 1TQ8A 2Q1UA 4P58A 4PHGA 3STUA 1SZCA 2PYDA 4RZUA 1VRCA 3IV6A 1IATA 2PUGA 1X8LA 2QE7A 4Y7CA 4Y9UA 2Q2OA 5AW9A 2AZMA 4JHLA 1O0SA 2HRZA 4BZWA 2Y0CA 3SCZA 2AMJA 2Q7GA 1FBTA 4G01B 4QO8A 3WSWA 2EKZA 2RGAA 4IWXA 4LI3X 4BNIA 1QHXA 1KFKB 2ALYB 5SZHB 1V5GA 3GLRA 4KLZA 5H9WA 1Z13A 4O8ZA 2VS1A 3DW1X 3DUFB 3OLZA 3Q3EA 4W8HA 2Y2UA 1TDJA 4ZEWA 1NNLA 4EHHA 4B4UA 3S2EA 2DMRA 5BPHA 2FN7A 3IQDB 3TLEA 4NL4H 4DTCA 1X1DA 2C1EA 2VLBA 2B9EA 1QOQB 3EAFA 4PLVA 3U0BA 2IY7A 4MCAA 5AOAA 3R9WA 2H17A 3AG5A 2H85A 3QWIA 5HM8A 4EG3A 2NO7A 1BXRB 2F1RA 3F3YA 1RHKA 3MUOA 5GZ3A 4TWAA 3P2EA 4YIKA 1A4XA 1GTSA 1GCUA 5JNVA 5CAEA 4TYMA 2OGTA 3QLEA 3Q40A 4YJ2B 4IWNA 4KG7A 3STXA 2DJIA 5CVVA 5FBWB 2WSYB 4XZ3A 3SEFA 2QYOA 2IX3A 2CJPA 4OO3A 4AIRA 2RDMA 3IJRA 3A9VA 3BCUA 1D1QA 1J9EA 1SXGA 3OKFA 4C0SA 5A4DA 4ND6A 3AU9A 3E1SA 2YWHA 3ILXA 3ADOA 2FMTA 5TRTA 3REUA 1KIMA 3DMDA 3KSUA 4Q7KA 3SI7A 2Q0SA 4DEYA 3VOAA 1W47A 4NFYA 4L73A 3FYUB 1XU4A 3GLKA 5G1NA 2GYWA 4ASUA 4QYIA 4Q9JA 4YCLA 3HU5A 4U2DA 3ZZUA 5TIIA 4NZOA 2FPPA 1OCEA 1OXTA 2VAWA 3C3AA 4INAA 2CK3A 4QXQA 4U6QA 1E5QA 5MDHA 1A8IA 8ABPA 4RD3A 4ER6A 3PFWO 4MV3A 2LGJA 5CMLA 2QRPA 2IYYA 3FZGA 2I66A 3UMVA 4JJIA 3WGOA 3HXVA 3DMFA 3WQHA 1T36A 2XZOA 1V2HE 3G5TA 3QO5A 2BF7A 2GEJA 2J48A 2VAMA 2W6NA 1SUWA 4YH1A 1HSOA 4YP7A 1NUUA 3BE8A 2R6CA 1JXQA 4I08A 1KETA 2E82A 4RKQA 5FR1A 2IHKA 4KQCA 2FSIA 3GHHA 3WJ7A 3H6GA 3F96A 3FUUA 4F38A 1C3VA 3RIRA 4JQZA 4YTEA 1AM4D 4W5TA 1P1IA 1HLFA 1E58A 3IELA 4AXXA 1C4KA 2NO0A 1Z3CA 3RC3A 2BJVA 2PZBA 3GMTA 1XN4A 1XOIA 4TQAA 2VYFA 1ULAA 2C2KA 3E1KA 3LHKA 3VKWA 3HCCA 1SBCA 1TA4A 1GUZA 4RK0A 3X1MA 3UT0A 3DP9A 3N75A 2ONJA 3RC8A 3KXLA 4EFNA 5LIRA 1N34B 2Z1DA 5K8IA 3GT4A 3KUXA 1H8EA 2RAVA 4QBKA 3H1PA 2G0TA 4DA6A 4AS1A 4OYRA 2O8DA 1IQRA 5T8KC 1OGIA 3ZHSA 2ISCA 1IBLB 1YRAA 1A1VA 1K1EA 2Y77A 4BHTA 3V9PA 3BQ9A 1L8LA 3EF0A 3LDUA 3T7CA 5K01A 3ZZMA 1HDRA 3R5KA 1T35A 2PPVA 4YJ2A 3R6WA 2WKPA 4QHYA 2QTHA 4CR7A 1CF9A 1A9RA 4K1LA 2P1RA 2AJ8A 3FGOA 2HQSA 1Q19A 2HV8A 2JD0A 1AV7A 3ESDA 3K1ZA 4I8IA 1CULC 1EX9A 4KO8A 3VTKA 5IMSA 5LMNB 4R83A 3B70A 2X5JO 3PHIA 3MTGA 4MQLA 3VFDA 2J8ZA 1OYVA 1BX0A 3FDIA 3OFJA 3PGVA 2XLBA 1BWQA 3REGA 3AVWA 1KQOA 3ZE2B 1E3QA 4KE7A 1XDZA 3QQ5A 3QUCA 2OHXA 5CDTA 2HMAA 3CISA 3G8DA 3RBVA 5FUXA 3UWSA 3DMRA 5LA6A 1YQWA 3USZA 1Z7MA 1DNPA 4HQLA 1C8LA 1BFUA 3GXOA 5C53B 1W30A 1RYEA 2VWQA 3G2MA 1XI2A 3KEFA 3BMQA 5CIQA 4WKNA 2Q8PA 3EUAA 1MJ5A 3RSGA 4BNFA 1P3JA 1VKZA 1C2YA 3A11A 4DUZB 3ZDAA 4WLVA 1Z68A 3PTAA 2R8YA 2ZRFA 1GZ6A 2X0KA 1B8UA 1MHTA 1OKKA 1QFYA 3KG2A 3Q8WA 1D0VA 3LQRA 4G1VA 2VK4A 2XGMA 3HXKA 1GR0A 1A3CA 1T26A 4RIFA 1M66A 3JQQA 4I81A 3B1YA 5LLSA 4AKGA 1M1NB 3Q6IA 3AGQA 1TUEA 4YALA 4D7AA 2VDKB 4X8OA 2FQWA 3MCAA 2IIBA 1SBNE 4J6EA 3FTEA 3TX6A 4CMIA 2RHOA 5A1TA 5A2GA 4KXNA 4WBXC 3W05A 5U4XA 5TMEA 2ROQA 3A36A 1XQYA 3W8FA 2XZPA 1M83A 3UMYA 4YK7A 4RJKA 2GN9A 2VO1A 1P4GA 4B6RA 4KPFC 1EP1B 5DT9A 1ZM9A 2ZDHA 3C6BA 4ZPJA 2P27A 1G6OA 3VGJA 1XPRA 2V4UA 3ZDQA 5CVUA 1QCDA 3L0OA 1THZA 3CM0A 5GZ6A 4PAOA 5HP4A 3EQ6A 1XLWA 4J3JA 1PSWA 1RLIA 1ZYUA 2C4TA 2QV7A 2CF6A 5K1XA 1SWWA 2VHJA 3HP7A 3L7BA 3BJUA 2WZCA 1TD1A 3KZXA 4ACBA 1EFHA 1N6HA 2A59A 2GX6A 5IT0A 3E9YA 1LUAA 2QXYA 1X0VA 1BROA 4FDTA 5D3QA 2ZCUA 3RU7A 3VU9B 5G0UA 4J03A 4LWZA 4LY9A 1A4RA 4N3AA 2AUMA 2QTGA 4FFMA 2WINI 2J3EA 1IEVA 1NJFA 2VEOA 3L02A 4BMVA 4PPFA 4IJQA 1I10A 4H17A 4X7BA 4FB4A 4YS6A 5REQB 3M70A 1VA4A 4EB6B 3ELWA 2FUEA 4IYJA 2W0MA 3LUJA 4P08A 2E85A 1U8EA 4UD2A 5CLHA 5NULA 1ICEA 3GJZA 4RW0A 4S35A 4WT7A 1P9OA 1WP9A 3KAPA 3KBOA 4NZZA 5K9ZA 4MP6A 4JZYA 3E84A 5HF9A 2JAHA 2WOJA 1T6YA 3DTYA 3WMXA 1QRUA 2W2KA 3EH2A 2AX4A 4AO6A 1YKGA 4J7XA 3EBPA 1YCDA 3GNQA 1T3SA 1EFVB 4EQZA 4NOJA 3ZHQA 2XQGA 3TEJA 5L6MB 5KNBD 2JA1A 2P79A 1K27A 1LBIA 1Z83A 3CMMA 4M76B 4LVIA 1QMGA 5I7UA 5I9BA 1R5JA 3IKVA 1JKFA 2H2FA 4JS0A 2Q3CA 3MNFA 3Q11A 4LISA 3O8OB 4BMZA 4AF7A 3VR5D 2Z3ZA 3H9CA 4OV6B 1Q1GA 3TAUA 1RE1A 5TF4A 4OOFA 4M7OA 1Q12A 4CH6A 1G5PA 2I6SA 3K3PA 4DLUA 2WWGA 2BFOA 1HDIA 3DE3X 5KMGB 4GMKA 1JFSA 4NAUA 1V3VA 4Q1BA 3UO8B 3UOGA 3I2FA 3BZWA 1BGVA 1F06A 1P9LA 1J8MF 1NW3A 1QG0A 4FE4A 1S2GA 1XXLA 2WJGA 4OTZA 5KOHB 3Q0IA 1HMPA 2UXDB 3EQ2A 4GIBA 4HLUC 2HMVA 3KQOA 1PX2A 3INYA 3IT0A 4FGLA 4K1XA 4XW2A 4QSHA 3UMCA 5L45A 1TW3A 2V7BA 3FOFC 2FYTA 3BVPA 2UU9B 3TQCA 1CUVA 1RYNA 4MUHA 2WNSA 3F6BX 3P9YA 3RUHA 4G5OA 4ZI5A 2WY2D 4TTJA 4HMQA 1U2DC 2Y92A 5A4FS 5JPCA 1OBCA 1ZJJA 2NO6A 2EGGA 2ZBRA 2ZTSA 4FBLA 3WL5A 4KQ1A 5KX5F 2ZB3A 1S96A 3FCCA 1SWVA 4Q1FA 1XMJA 4H0NA 4QQRA 5JSQA 1DRUA 1M5UA 3KX2A 3RG8A 4KAFA 2RH4A 4W82A 1T29A 1O57A 2Y67A 2H4FA 3ELBA 1V43A 3OPMA 4TTAA 3PFCA 5CIYA 4OQ4A 3WTCA 4CF5A 3VC7A 2CE7A 2FJPA 2R97A 4ZTBA 1L6IA 3C70A 4CUJA 1QRRA 1GGEA 3NHUA 1NBIA 1G59A 2PSSA 1I36A 4LVJA 2X0IA 3HJRA 4WWHA 3NHBA 4QYTA 3L1VA 3P4YA 5EZQA 1QGDA 2QSYA 2VP5A 3AB7A 4MVJM 1CP3A 3HY3A 3BFXA 3EZYA 4CQNA 4OYLA 2XJ4A 3D8NA 3EY4A 4DIKA 4HEQA 2GTPA 1A9XA 4DCGA 4LJ8A 2BZ1A 4R2KA 3HZZA 1XTBA 5JROA 3C3YA 4IH1A 3FCYA 1PV4A 1VXRA 2ARTA 4OAQA 1CBUA 1Z5ZA 4MZXA 2JFOA 2W4MA 3M4QA 2VSQA 3BXOA 3Q7PA 2OD7A 2EWVA 5AM3A 1L5MA 3QEMA 5EY5B 1QWSA 2ODNA 2WG0A 1WXFA 5L3RA 1TZCA 2JLSA 3LTNC 3TH5A 5CIWA 2O5CA 1OXSC 4QNMA 1OUMA 2DQ4A 4GOLD 3IP7A 1NN3A 2A7XA 3RUIA 4MVJF 1HL7A 4QUJA 4LKRA 3KT3A 3RYFB 5BNTA 4KHPB 1SPXA 3CLRC 3MHPA 3T5PA 2WJWA 3FRIA 3S29A 1MABA 2ZRBA 4KR9A 2WD7B 4NCNA 3VTZA 1M7GA 2UVDA 5BUSA 3B13B 4Q9IA 3TBFA 3CV3A 3KJGA 4RFSA 2Q5EA 2EVWX 1NG9A 5BOVA 4YBRA 2KLBA 3OPQA 5JALA 3E22A 3C5HA 5BVGA 5CA1A 5CB6A 2YWGA 2CNLA 1YZTA 1K75A 1H23A 5KTMA 4Z4GA 1KDYA 3O95A 1WTAA 1FRFS 1CB7A 2BM0A 3QW4B 1T24A 2PX0A 3PDWA 1ZLXA 4EK9A 3RS0A 1SVOA 4B3XA 1YXMA 4JBXA 4NDNE 1OH5A 5C3MA 1TU3A 4E94A 1WW2A 2D1QA 2YHIB 4CQMD 4M0LA 3TVYA 3I5MA 1FFBA 4X1IA 2OV3A 3UJ3X 4P0PB 4L6AA 1I4WA 1QIFA 2H4HA 4K6FA 3TZLA 1MW9X 3HYLA 4I3HA 3A6EA 3QBDA 5HGXA 4O2AB 5DYWA 2VSFA 2P75A 3L06A 3QITA 3UJ9A 1L5QA 2GEBA 2ZB4A 5CDFE 4LV5B 3HCOA 3NCHA 3T0FA 5AUNB 4HRAA 1B42A 5F5WA 1FSSA 3QVLA 5LYYA 1U9IA 4IUBS 4QQKA 4Y0NA 4M1SA 1RJFA 4UZEA 1W34A 3N2IA 2KQUA 2YMMA 5HTOA 2QB5A 3HBLA 1YR3A 2VBGA 3FUXA 3GQBA 4R2MA 4YFYA 3S8YA 3VPSA 4I1IA 1NKVA 3T52A 4DMKA 1PAUA 3QHPA 4RH1A 2QX9A 3LPLA 3RREA 2G82A 3L5OA 3TEGA 2JFYA 4IHJF 2C9MA 2WFLB 1IN5A 4GT1A 4KYTA 4XFDA 5DP1A 5FOTA 5IH7A 4G5XA 4C5AA 3ZHZA 1EI9A 1SIBE 2Z6VA 3LYUA 4KUEA 4OD0A 3SGLA 1ZH4A 4LJYA 3FJOA 3A37A 3PE4A 2WKRA 5AKHA 1Z4JA 4IXTA 3L7CA 3C97A 1V16A 3LL4A 1RLUA 3AU8A 2OEPA 5T8KA 4EEKA 4FNMA 2FWAA 4D8YA 3DOUA 3GLUA 3AC0A 4XLZA 2VYCA 5EL0A 1S6YA 2NAFA 1K8YB 2I3AA 4B6JA 4BBJA 3H2GA 4XX1A 1Y5NA 1XZNA 4HDCA 4D43A 3PCTA 4EQ6B 5LSAA 3UPUA 2C7OA 1IH8A 1NA5A 2XEDA 4RC9A 1L5HA 3WLNA 1QIEA 2H08A 1N36B 4K6KA 2EV9A 4TQDA 1EGHA 5B2EA 1EIWA 2IH4A 3OIDA 2BEUA 5SYAA 2UZ0A 5E0OA 1NYQA 1REQA 1U2GA 3LHSA 2GQ0A 2LE0A 5TEWA 4CM1A 3JQCA 3LUAA 3HFZB 1Q6ZA 2RAUA 4HCJA 2Y0BA 4EUFA 4C21A 1Y3CE 1PEYA 1WMFA 1Z0IA 5CD1A 4YAJA 4OQLA 2DFDA 3GJ4A 4UDYX 4AJNA 4E5NA 2QVXX 2DBYA 3T3MB 2RGEA 4CI9A 2NPIA 3I61A 4LVKA 1VL5A 2O0KA 4RK7A 2CDAA 3EFBA 1RP1A 3OQVA 4ZU1X 4BVFA 5C2JB 5IFKA 1RIIA 4ZHQA 2BD0A 1IHYA 4XVHA 2RHMA 4NBLA 1L8XA 2Y1KA 3A1SA 4ZVKA 1M2KA 4KFTA 2RH8A 4R9NA 3U3DA 2A92A 3P7MA 3ORRA 3CJQA 1E99A 2HCRA 2J9YB 4XB2A 2AG1A 1OYYA 1NF9A 2G7ZA 4ZVVA 1AHNA 2HA4A 3Q7RA 1RADA 4NNJA 2XUQA 3JQ9A 1QH1B 4B35A 3JU3A 4IY1A 5GWXA 3W5CA 2ENUA 2PJRA 1YBHA 2OSVA 3KO8A 4PZ0A 2W2LA 3VR6A 1E4OA 3HXYA 3G68A 3CWQA 3LO8A 1IMOA 3MRXA 2BISA 5FCDA 1KU6A 4ZN6A 4RTKA 2VDMB 5IZCA 3T1VA 4DSTA 1ULZA 4CF3A 3H3XA 4XQ9A 4B5LA 3LCCA 3L7LA 3DOEA 4EENA 3SM9A 4ZZ0A 3TMYA 3DHVA 4M0FA 2AI3A 2IC5A 2IYTA 1YZNA 3GNTA 3IUQA 3BWDD 3I28A 4C9BA 4RH3A 1S1MA 3ZDRA 2VRWA 3LXRA 1Q7TA 2QJWA 3JQAD 3P9SA 4D0RA 2E1PA 3K9NA 2V4MA 4S1VA 1FB5A 2WWTA 4UTPA 4AKEA 5JAQA 3GLIB 1W4AA 4M9RA 4DRXA 2DH5A 4QYIB 3EF3A 4IDHA 4CQLA 4R3WA 2FDCA 1PYDA 5IWCA 1A9PA 4KDFA 2EXXA 4ZO7A 5BWBA 1RYDA 3MOSA 2EKLA 5JJCA 1XMSA 1XRQA 3GIDA 4TSFD 4CVNA 4IVRA 2E65A 3F5SA 3AEXA 1FMLA 1EA5A 3CEHA 2FP4B 4OJKA 2RH9B 3ZDBA 5AJUA 4JL5A 1DEHA 4RTSA 2QYTA 2QUKA 1A4UA 5L6LB 1IEWA 2J7PD 4AKHA 4YWJA 5L3QB 3ZK8A 1LDGA 3NBAA 1JQBA 1YS6A 3EE6A 1YZHA 3BB1A 2Z0MA 2OKCA 3IUMA 2IYUA 4H6PA 4V0OA 4WZBB 1SNYA 4YDHB 1KQGA 3VBCA 5TT1A 5DX0A 5EMLA 3DNPA 4LECA 1G6HA 3IQWA 2CFRA 1YO6A 1IN6A 2Y76A 4ZQEA 3PITA 4ZHQF 5JZMA 5K8UA 1HR0B 4EX5A 5IVKA 2IUTA 4FYMA 1N3IA 1FVOA 3PQFA 3BGSA 2FE4A 3D6TB 4ER0A 4AJ1A 3LI2A 5E1DA 2QX8A 2XAAA 1JPNA 1WBJB 3K31A 4X8HA 2C2WA 2IBSA 1YFTA 4MVCA 5CAEB 1J0AA 2FKAA 4RELA 2BSXA 4WJLA 4E2FA 4NEHB 3W7VA 1DO2A 4MLCA 2XOKA 5CG2A 2GN0A 3O2QB 4F2GA 3K7EA 1CJMA 1EGVB 4EJ0A 5FWYA 4QUAA 1USKA 5LYJF 2ASEA 3DAFA 4QFMA 4ZOLB 4YI3A 1SXPA 3HDQA 4P38A 3NXKA 4G81A 5C4MA 2C97A 1NBOA 4HAVA 3W1VA 3DWGA 4BBAA 5DCLA 1KO5A 3FDJA 1G8PA 1EHCA 5ALJA 3AY3A 2C98A 2I4LA 1C81A 2NXEA 3P20A 4C22A 5BRNA 4CFZA 4HDMB 1TGYA 2H16A 1UPCA 2Z2IA 2UV8A 3C74A 2FJ0A 4QUKA 5BV7A 5CFRA 4B5KA 2G1PA 1XTQA 1FPQA 4GF5A 4ZFNA 5J4KA 4ZAYA 1JDBC 2AN5A 3IVXA 3P96A 2XADA 1XNQB 3U0VA 1ODTC 4QZVA 5GADl 4BV9A 3P45A 2C8KA 3CO5A 4IQGA 1ESCA 2ZIAA 3WB1A 3F49S 1F9EA 2O8EA 2VRBA 2C20A 3NC0C 3M81A 2YRFA 4CLEA 1S2DA 5ICEA 3LUKA 4ZPXA 3UB4A 4W4TA 3DDWA 4Z9AA 4PIPA 1E63A 2I76A 5CDSA 2ZYVX 2ZRJA 1Z2PX 3PYXA 1Q1NA 3KCNA 3SVZA 3ITDA 4GKKB 1ORHA 2WJHA 3E2PA 1UJ5A 4O33A 5TGDA 1Q17A 3GUZA 3VAYA 5J4VA 3GLHA 3N8HA 2WT9A 3HI6A 4ITVA 3RAPR 3FPAA 3GOQA 2WIAA 1SCUB 1K2WA 1P1KA 1YHNA 4UVHA 5IVPA 4NCAA 1SUPA 3H8VA 4YRMA 3CX8A 4I5FA 3IJPA 1VJGA 2NUTA 4OF4A 4DSAA 1POWA 1NUSA 3AP1A 4DGQA 1ZCBA 3PEWA 3VVCA 1T9AA 3UCXA 1DSSG 1VB3A 4UMDA 4YCAA 4AJ9A 2P9FA 1RC1A 1V4BA 3MJCA 4Z4FA 4J94A 3KOZA 2X6TA 5J5VA 3JTMA 4F6RA 1PL6A 4YPOA 1KZGB 4WFJA 3T1QA 5C31A 2DQZA 3ETCA 4JT8A 5AYVA 4AL4A 4WY2A 3SKXA 1RM4A 1Y5LA 3FDXA 1KGDA 3THWB 2Q0HA 2OC4A 4L95C 4D9IA 4KTTE 4C4PA 1ZIOA 1DI0A 1T13A 3QXXA 4CQMB 2QRMA 4H1VA 1NOJA 1EFRD 1ADBA 1OVMA 1SG6A 3NGLA 1YDEA 3OY7A 2YV2A 4JUAA 1GPJA 1MQ8B 2WTXA 3IT1A 4M7RA 4TVAA 2CHEA 3E35A 3L7YA 3NO4A 5DT2A 4AKTA 1P1RA 5HSGA 3FYSA 1JH9A 1QFZA 2WWVD 4CFYA 3T4EA 3K0SA 3RAEC 2C5SA 4MVJG 3N74A 4CQLB 4K3UA 4OJNA 2BMAA 5G0WA 1I94B 1I3NA 1HDOA 1I1NA 1XRJA 4XEOA 5EJIA 4L08A 1P29A 2KBFA 3PUKA 3NW9A 3DKVA 1MOZA 4MR9B 1Z7WA 2OV2A 3JQ7B 3LHIA 1R5OA 1XJ5A 1T8YA 4LOLA 4UNRA 2XBMA 1VHTA 3DEAA 3DB2A 3TLZA 1E4VA 5KWVA 2AC2A 1QRSA 2FEWB 1QFJA 1VB5A 2DTIA 3IEVA 4IP0A 4ZAFA 4FKMA 3COVA 5CJPA 4HT4A 1BYIA 2GZDA 1P4RA 3ACCA 2NU9A 4KUGA 3N28A 2XMDA 2BHLA 3H1BA 4B3DA 3L4SO 2HEGA 1LVHA 4B82A 2W8ZA 3V3KA 5KU1A 3U1TA 4ZMRA 1NC1A 4GOKA 1DAGA 2FGJA 2HIHA 5IK2A 4KLCA 3VR2A 2GBLA 1C0KA 1R8JA 2N1BA 5IZ4A 3E2IA 5DM0A 4UMEA 1G9SA 2P9CA 2V7QD 3S1AB 2VL7A 4H4CA 2VQ6A 2R7AA 3EIOA 2C4NA 4X3CA 4AYXA 1UC8A 1HG0A 3DZDA 1R00A 3QTCA 2G76A 5ESXA 1E79A 2JVKA 3NHSA 4LV6A 4TV8B 5GAJA 1IOZA 4WL0A 4FOLA 1N2JA 4IGFA 1XRSB 3EVZA 5IP5A 2H4XA 4AZ0B 5AW7A 4M53A 2OBNA 1LPMA 3QUAA 2QRVB 4GP9A 3T9EA 3N2GA 1GFZA 3RU9A 1ZX1A 3JYPA 1NXOA 1VKNA 5HXAA 4J8PA 1ULTA 4EGQA 3GJ0A 5DOVA 3NYQA 3KU4A 3RTDA 1SUCA 4FHGA 3WL4A 4BO5A 2H9AA 2VSYA 3M4XA 4PGFA 4K46A 3GA0A 4TKLA 4UAUA 4ZT4A 1DX9A 1RXYA 1XNJA 1BBUA 1X13A 3TIFA 1TTHA 3SHFA 1X86B 1DXYA 2KE5A 1QFXA 1ZW6A 1YB4A 3AKYA 1J90A 4LCBA 1YMVA 1DVRA 3SBEA 2G9VA 1L5OA 5CPFA 3KVVA 2VR1A 4B4VA 1I0ZA 3MWFA 4F3NA 4OFZA 1ZVJA 5DHAA 4EF4A 3IPYA 3JAWA 1BA3A 3A1CA 2Y4NA 4L57A 2B8NA 5DK6A 5AXAA 4JVNA 2J3HA 3FGZA 1GUYA 1M10A 2ZKLA 5I7EA 9GPBA 2AG0A 3E3MA 1ZNYA 1ZXXA 4ND8B 2JZOA 3M6XA 4OBEA 3RJ5A 1YVPA 3E3LA 3LL7A 1JW9B 1TMKA 4JP3A 1Z35A 1E4EB 1JTFA 1JB1A 1QLHA 3A6LA 3VO9A 4OLBA 4HNAB 3O83A 3WKEA 1ZRNA 5G1OA 4WOPA 1EAYA 1R12A 1VGQA 3GGDA 3GK3A 3KQYA 3P8ZA 3GRRA 3M1YA 5D1HA 1BYUA 1SU8A 3ML1A 4B43A 4HGZA 3AVTA 4YO7A 3VYSB 1IXKA 3OOYA 3DZCA 5BP7A 2FZGA 3I04M 5DNAA 4QQ8A 3EIXA 3QLUC 5ALEA 1B6TA 1RWWA 2L82A 3LWNA 1PBTA 3OPNA 1FFAA 1GCOA 4P32A 5M3BA 3UUWA 1TMYA 4AMZA 2DUJA 4XM1A 5CCXA 5BSVA 3AEUA 4EL5A 1V9SA 3IMFA 4D9HA 4HPXB 2HFKA 3KAJA 1E69A 1GY8A 3JWGA 1JQJC 4C29A 3WLRA 3IAM6 4N8SA 4HQ6A 5HE8A 3DLBA 5ALXA 1YJXA 1J9ZA 2I8LA 3KR0A 2VZLA 3KKKA 4L6IA 4CTNA 1HO3A 2HD4A 5EIWA 3ES9A 4OXQA 2CLSA 4N7JA 2GPNA 3BB3A 1A5TA 2IOYA 1KI8A 3PNLA 4J91A 2W9XA 3UJ6A 1F8GA 1ODLA 1YR6A 4KDEA 2ZTVA 2UDPA 5LR6A 5A05A 1LBQA 4WBSA 4D3SA 1EFUA 3DMTA 4TMZA 4DIMA 4L16A 1ZITA 3QU4A 5G3YA 3CJTA 1XEXB 3FFAA 3D8UA 1K7FB 3WL7A 5BR7A 3IOCA 2YHAA 4GMFA 1KZ6A 1N75A 4ZEOA 3UWDA 1TX4B 1KEZA 1Y5MA 3W3AD 1KHTA 5M34A 1P8JA 4J0EA 1GPDG 4FZVA 2PRYA 2DQ0A 1W9MA 4LC1A 3DL2A 3GJYA 4DMLA 2DPXA 4P75C 4MCIA 4U8HA 2QVZX 4E70A 4JSRA 5TVGA 4TS3A 1MRZA 2XUFA 4RDXA 1IPHA 1D2EA 1JEEA 1LPAB 2EL7A 2G4LA 3QU5A 4D9FA 2YZKA 2AJDA 3GEGA 4IG4A 2JJ2D 1FS6A 4ZI7F 1CHNA 4Y67A 5AM0A 5FJJA 4HWPA 3WNVA 3MTAA 3LNTA 3N58A 2HU8A 4RQEA 2A84A 5FB3A 4B7CA 4JI7B 3RRXA 2MSNA 5A6VA 1L4UA 1OWPA 1MAHA 1IY8A 1WHTB 3E0QA 1IY2A 2VHYA 1M6HA 2BAGA 4NDZA 3LUHA 1YB6A 1IJKA 1FFYA 4XPIA 4ZVOA 4E33A 4G84A 1YKSA 3QFTA 2LKCA 1Z5GA 5T67A 5F5NA 5F73A 1B70A 1DU4A 2C54A 2C42A 4YHHB 3RBAA 4Q9NA 1NHWA 4YDRA 4AK9A 5KSPA 1B0AA 3KB8A 1KP9A 5AI0A 4ARZA 2NADA 3NBUA 1U80A 5CEEA 3AEZA 4AKIA 3OWOA 1DFHA 3CLKA 3MFYA 1QX4A 2ZNJA 5DNWA 4CKEB 1YCHA 1YQTA 4XU0A 1RRGA 1U8XX 1XZDA 1F51E 1XTKA 3D0KA 3O4RA 1C14A 1QIIA 4YIHA 1KKLA 3DQZA 5J5CA 2WA2A 1B4DA 1OI2A 2H1HA 2VPZA 4FSHA 4N6OA 3W5DA 3ETJA 2O7RA 4JCCA 4KOEC 3U26A 3OLQA 4B9AA 3TGLA 2IHNA 1MO5A 1XD9A 2O3UA 2ECQA 4EF5A 2HYDA 4EI7A 1CUGA 3I76A 5HQJA 4JQCA 2GFQA 4POOA 2PVSA 1PSDA 4H1WA 1N5JA 1QQTA 2G83A 1NQXA 3IVMA 5JJBA 1I7NA 1NL3A 1GPLA 1KMHA 1H4VB 1EDBA 2FSGA 2X40A 1WQ4A 3B7GA 3CF6R 3EARA 4JLKA 2N47A 2NQTA 4NONA 4OAPA 1QIKA 2H5EA 4OB7A 1UWLA 4YMTA 2IWRA 1R5BA 1G7CA 1J0CA 1U31A 3AKZA 3QSGA 3EDMA 4POAA 4JFRA 5GINE 2RHRA 3KP1A 4PZUA 4AX4A 3HXWA 1CUWA 1NNSA 4KQJA 1IHXA 4RLQA 5DNDA 3BGDA 1X92A 1UXIA 3D3WA 4ODIA 3QO8A 2BKUA 1UWKA 2NSDA 1NQAO 4NZ9A 1Z8HA 3ZIUA 1OE0A 5DX1A 5F2EA 2G9RA 2C7IA 2G36A 2C8MA 4TQGA 5FLEX 4FNGA 4YMHA 2WKQA 1KEKA 1FFWA 4JC0A 3MSXA 1M0WA 3KPJA 5DKFA 1O5TA 3OZUA 1L3CA 4FWIB 4ZOBA 1TM4E 4MHOA 1CP2A 4YT5A 4DV2B 2LP4Y 1GNQA 2J5BA 5HX7A 3DM5A 3W34A 1DBVO 2FW7A 3F2IA 1JRLA 4IG9A 3NDBB 1P6UA 4N7BA 1UJNA 1G5TA 1WABA 2WOOA 3EW9A 1AHPA 3EA5A 2VJBA 3TQRA 3UHOA 3UXMA 2I7CA 3HL4A 8MHTA 3IXMA 4CTMA 1NJ5A 3VTFA 5HGJA 1PK8A 1PO7A 4L2IA 3GUCA 1HM5A 2AYYA 3E03A 4DNFA 5LU9A 2O1EA 3B1VA 2XHEA 4M0KA 2G1JA 4WERA 2FSPA 1DRJA 4GC5A 1TT5B 1EX6A 5KSYA 1H8ED 2B6NA 3P9KA 1J56A 4KR0A 2F3SA 1Q1ZA 4CLDA 4YPVA 4EEXA 3LT1A 3L8FA 3IURA 2A1IA 3RKYA 1XTSA 1GYPA 5CT9A 1V6CA 4LRQA 4MB0A 1D2AA 1MENA 4LE1A 3B2QA 2PZAA 2DZ9A 3I72A 4JEHA 2QRUA 1ORDA 1RPTA 3WQQA 3IBTA 1K9SA 2HX1A 1OV4A 3D8BA 3ZVRA 1R9GA 2HSEA 1U5AA 5ILQA 3D3JA 2RHSA 5AHXA 3CVXA 3TDMA 2QUIA 2OA0A 4A4DA 5C18A 5KBYA 1TLTA 3O2JA 1GAXA 5ESDA 2OMKA 2A58A 3WIBA 1O94D 2DKGA 2P3QA 2Y1XA 4KIFA 4CV1A 1JQ5A 4I1SA 5BVHA 1SOVA 1UXKA 1C1HA 2VJNA 4HBZA 4X63A 3ZWKA 1GO2A 1MGPA 3VNRA 4K86A 3DEZA 4TMXA 1MO6A 4TSKA 4YJ2F 5EHQA 1M1UA 2B7LA 3VPDA 3V55A 1ZH2A 1VPWA 2PUCA 4RMFA 1N0VC 2X9GA 3CT4A 5FYQA 1U9IC 1ZMXA 3NDIA 1ISMA 2JH8A 4HGNA 1B8VA 2FOLA 1USUA 1M34B 2BGTA 5HQ3B 1CLEA 2ZPTX 3AFMA 3JZIA 3OKCA 1I5EA 4L4ZA 1ZH8A 1AMNA 1J97A 4LJRA 2BDEA 3KQTA 3AUFA 1C0AA 1Y1LA 4K05A 2BHTA 3H9JA 1CDDA 3ZNPA 2Q6VA 4BNZA 1BO6A 5BQXA 2P90A 1T9DA 2J3JA 2PSEA 3H2IA 3VJKA 4A2CA 3CTPA 5MFPA 1N9GB 2WMOB 1J2EA 3RS4A 2FEXA 1PNVA 5LZ8A 4A0QA 4XU1A 1NVGA 4IZHA 4IL5A 4WOJA 2VJOA 4R8RA 2A94A 2JLBA 1SBQA 2XQVA 1BMFA 4IIFA 1PUIA 5GM1A 2Y0PA 3ZHOA 4QVIA 1RRCA 1CF4A 4MX8A 4KAAA 3BILA 5E95A 5CA0A 2TS1A 3KQUA 2GM4A 1Q0TA 2NOAA 1KDPA 1U8UA 3K4HA 4LSGA 1M2WA 1FQKA 1SR8A 2YS6A 3C8ZA 3R5TA 4GDMA 5IM4F 2ODEA 3VPAA 2VJYA 2AWNA 3PXGA 2JJ8A 4I6GA 3ZZ0A 4DLNA 3DEYX 2QIPA 3I9V1 2JIMA 4TOIA 3HVIA 1R74A 5NLLA 1N77A 3H1AA 1KSHA 3QKWA 4N0MA 4B9EA 4FQ7A 4HX9A 4GKJB 2Q9UA 5FBZA 1DV1A 1DB3A 4ZCRA 4JFAA 1WY5A 3EIEA 1U9YA 2NP6A 4RAQA 3CTMA 1VHDA 1U1GA 1B23P 2D59A 2XRFA 1LKZA 3GWGA 4HPJB 2ATEA 4F9TA 2H5JA 4NWIA 1WEHA 4DA7A 2I2DA 2OGWA 2O2IA 3BH7A 3BIJA 4JXZA 5AT1A 2AXPA 5KYUA 1KF0A 5D00A 2DU7A 3NOQA 4HWSA 1OBOA 3I52A 2HYIC 1G8FA 1T0HB 2H0RA 2OD2A 1A7UA 2Z08A 3F97A 2OOSA 3RBXA 3AF3A 2QZJA 2G6TA 2HF7A 2XNJA 3W3SA 1YGBA 1BVYF 4ND7A 2I99A 2C57A 1WDMA 3LT0A 3Q5GA 3PRYA 1LQ2A 1Y6RA 5AKZA 4RKFA 4IIDA 1JT2A 1R0RE 4JAVC 1KJNA 1Q7EA 3JD2A 5BR4A 1F4VA 1NVMB 1QBGA 1RZUA 3EXHC 4J2OA 3W4IA 1PJZA 4PLHA 1J2UA 3QIVA 3C3CA 1NDUA 2R3SA 4KN5A 4LF7B 1ID8A 2XHZA 1P9WA 4HLUA 1B16A 4OXNA 3NUGA 1EGMB 4HEJA 3QVTA 1GLNA 2QTNA 3K5WA 5AJWA 4QEDA 4QDJA 3IILA 1MABB 1RT9A 3LBFA 4TMWA 4CXMA 2BSQA 1DXHA 5F4ZA 4LVMA 5B1DA 5IAGA 4P2BA 3UAWA 3MAJA 5KC9A 4F71A 3URKA 2AL7A 1ASYA 5P8WA 3RO7A 3UB2A 4DDMA 5JPIA 2DJZA 1YONA 4Q3AA 3WIEA 3USCS 3N2KA 1IM5A 4YX9A 3EWIA 5CB0A 3B38A 1W36B 4B3RB 4HEHA 3K9WA 4L74A 2GEDA 4YAWA 3RBZA 2H2IA 3HACA 4K0KB 3S4YA 3OM1A 4H7PA 4ZV4A 4C89A 2B3DA 4Q9KA 5JECA 4PN3A 3PD1A 3JQGA 2DT8A 2A5DA 3O0DA 3FOEC 1ZMOA 3PE3A 5C4IA 3ICEA 1V1RA 3BQNB 4QBGB 5JNWA 1UBCA 4U7DA 4OM7A 1EK0A 2W58A 2REOA 3JWJA 1EVZA 1KWGA 1VE9A 3DHEA 2IYPA 4H1HA 4F46A 4DCTA 3KQPA 1K68A 2Z8YA 3HADA 4LJ5A 3R7AA 3C7TA 3IHWA 1N1DA 3EIQA 4XWYA 1JEYA 1WQ7A 2RKBA 3G9TA 2I4MA 1S7CA 2WKSA 2JKZA 3A3KA 4OI2A 4IDQA 4B6GA 2NU6B 1CUSA 4HFJA 4J9UE 1KNXA 3VZSA 1URPA 1HI9A 3DBLB 4KFRA 4W5WA 4P73A 5FX2A 4LX0A 2XWSA 1A5SB 2P0AA 3OE7D 1US8B 3SJBA 1DAHA 2JIRA 3CQ9A 1UAAA 2GBGA 4G1FA 2BGLA 2BJWA 5LUAA 4K0RA 4HAXA 5JEEA 1QYVA 5CBPB 1KQNA 1A9TA 4ZVLA 3DT9A 2O8BA 1X94A 1TZBA 1MH1A 2HMWA 1PLKA 3EPPA 3EXFA 3F4LA 3OMXA 4JLJA 1NMEA 4JOQA 3RHFA 3H4MA 2D3TA 3EVFA 4N5HX 2WSLA 1GZ5A 1I4EB 1O94C 1VOTA 3S5UA 4EUKA 2V0GA 2IOFA 3CONA 3LKDA 3D6NB 1TRHA 3E5RA 3HDYA 4HAYA 4EX6A 4OB8A 1FOEB 5ALGA 1BXKA 3VZCA 1VE1A 4MRAA 2XTMA 4C05A 3CZRA 3DKPA 3WFJA 4BWGA 1MEOA 4BQOA 4ENVA 3U1VA 5I45A 2QGNA 2D2VA 3I7FA 1NMXA 3TQFA 1JDTA 1ND6A 3HP1A 5K8VA 1IY1A 2JJ1D 1KOJA 3EGDA 4RNDB 1MB0A 1TW2A 4AU1A 4MDFA 1H2YA 2XMGA 3IP9A 3NGXA 5EPUA 4CKYA 1T6XA 4YV7A 3THXB 1E9DA 3F5MA 1W5SA 3X44A 3QSYA 2WF9A 1LDBA 1YB1A 3QNUA 2BMDA 4M0EA 4BFLA 4ZDJA 5J2TA 4N41A 5KC8A 4TWZA 3CUKA 2WMDA 3TM5A 3PFNA 5K0CA 5EKDA 2HJVA 2FVYA 1M1NA 2E21A 4PONA 4XD7A 2ZQ5A 4R8SA 5GVRA 3TD2A 1VSVA 3OJ0A 1OIXA 1SVIA 2DWOA 2OFXA 3PQ6A 5EQTA 3OZEA 4EJ2A 5AW8A 1L4HA 3SYTA 2Q0XA 4JI2B 4HBGA 4AWXA 2I6UA 2W6CX 4JYBA 2PBRA 3VMFA 3N5CA 1P7YA 1TA0A 3QEBZ 3QUQA 5H80A 2GVZC 1ADFA 2Q3JA 4U7WA 1GPBA 3W3ZB 1Z8NA 1CY6A 4LE0A 1K7YA 3M2PA 1E1QA 1XD2A 5EUBA 1JQKA 4I1PA 1ZUNA 3EG9A 5AKKA 4CS2A 3K8YA 1NXQA 4ER5A 5JAZA 1E1KA 1WZ2A 5H5JA 2IYLD 4EYOA 4XTVA 3PGLA 4QYSA 4RZSA 3I12A 4XGKA 1Y48E 3PPXA 4M1OA 3UATA 1BVHA 4MV5A 1TOAA 3FWHA 4XVRA 4JLOA 1F0NA 2JFUA 1W0KA 4REQB 1XTRA 1DWOA 4LY0A 3PXAA 4NZNA 1YQQA 4INPA 2YXNA 3KJHA 3U31A 4O2BB 3U7JA 4D79A 1JAXA 4E5DA 3WY9A 3EXFB 2PMFA 2UYQA 2QJOA 2WFAA 3E61A 5JRZA 2H9IA 4FI3F 3OU6A 2ZBVA 4M1EA 4U7TB 3PKJA 3GLVA 3TSWA 5ED4A 3HGQA 3JAKA 1KJWA 4DSZA 1NWHA 1QKIA 3DBHB 4O4LA 1MUUA 2AR0A 1BHO1 4IIGA 3W4JA 2Y1EA 3AKDA 5LB4A 3GCDA 4TT8A 1A72A 1KQPA 4PR3A 3M4YA 1PG5A 4HYQA 3F5DA 1LI5A 1TM7E 4PHFA 3AESA 3S7TA 2F1JA 1A9SA 3IMKA 3O47A 1SQFA 1T0JB 1JV2B 1MQAA 2XIJA 3DOOA 4X1KB 3SZ3A 3TD6A 4BNYA 2C5BA 3R3YA 5FI3A 2F9LA 3UWMA 3UJ7A 1C29B 2AZDA 3OQBA 1DC6A 1K4YA 4IWYA 4W63A 3WRWA 3KHTA 4E46A 4IS3A 4KBYA 1BHJA 1EH5A 2C7GA 2PT6A 5BWCA 4FYJA 5CLFA 4G25A 1VCOA 2ZIEA 1ZMTA 1NP3A 2QSUA 3O93A 1BKYA 4JJEA 4MH0R 4E2WA 3MMPA 1UR5A 2DXTA 1B1CA 3H17A 2I4OA 1G63A 3FPHA 1J24A 1PYGA 2IU6A 4RM3A 5JC8A 1NF3A 3FJPA 2D8MA 3W8EA 3OQPA 3WOVA 4BRUA 4BS9A 5FAKA 1Z6ZA 1XHEA 5LXTB 4YC7A 2C5FA 1YR2A 1G20E 1O95C 4UP9A 1Q15A 3TIVA 3G2JA 5AJHA 2IX9A 4JJZA 1TI7A 4DQVA 2W11A 1E9EA 1X14A 3V7RA 2ZIOA 2YUIA 5ELOA 2HJHA 3F47A 3P4XA 5GY7A 4B74A 3SHQA 4DNOA 5A0VA 3M4PA 5ALZA 4MWDA 2F43B 3JZMA 4QYXA 3WE7A 1D7OA 2HHLA 4DLXA 5CM8B 3EUWA 5KKNB 3LHFA 2CXPA 1T2VA 2XYRA 4ZT2A 7ADHA 2CL5A 4TYYA 2FI1A 4FYHA 1E1RA 4GP7A 4QXPA 4F2WA 1D3AA 4TM7A 4BYGA 1GZSA 1D0IA 2GNOA 2C5GA 4FONA 3WG9A 2CNDA 3DMYA 1LF0A 2LDXA 4RX1A 4DC9A 4X00A 1QF9A 3JPYA 4GOOD 4OUDA 2R8RA 3SSMA 4F60A 2VDPB 2LPMA 2XUKA 5D3KA 2ORVA 3LM8A 1W36D 2PLWA 1VKJA 1QP8A 2WHPB 2AN4A 1GN9A 2FWJA 2PR7A 1UMBA 4UZFA 5BNWA 1XB2A 2Q8QA 3L8MA 3LT5A 3OCWA 3BGOS 4B3SB 3IODA 3M1IA 1VLQA 1RXCA 3EJ6A 2YNMC 1X77A 3C15C 4FC7A 4R0VA 1Q7CA 4PTZA 4XIGS 3I0ZA 4QWMA 5HIJA 5LC1A 2G9NA 4EYSA 1YJBA 4UQPA 1XPOA 2VP9A 3AO0B 3LCUA 2UUPA 4E21A 1TK2A 2GZ2A 1VMDA 4HP8A 3ZW8A 3RU3A 3EDQA 1XMQB 1L5YA 1VPTA 1J21A 4FGSA 4PVDA 3TOXA 5DGIA 4QL3A 3AOEA 3BN3A 1H5NA 1SHLA 2X0JA 4S0XA 3BT7A 2GOYA 4I5IA 1P81A 4J07A 4NYIQ 1Q0PA 2GZRA 1VJDA 3AR4A 3JRWA 4IJMA 2HXSA 3P0FA 4NPHA 4L28A 4ZEMA 2WLSA 2HRRA 4LG1A 1ODJA 3AFOA 2YDXA 1L7NA 2ZIVB 1H8HD 5K0FA 3SS8A 3DDUA 1N7GA 5KYNA 1KO4A 3KJZA 5DNEA 3MUEA 1GNLA 2PR2A 5J63A 3MINB 1EJ2A 1SIUA 2Y05A 5K3DA 5K3SA 3ZWVA 1EESA 1UODA 2GEKA 5J40A 5CA1B 4S04A 5KHAA 1ML4A 1KPIA 4KQWA 4TZKA 1OAKA 4WADA 5GIOE 2ZTHA 3CKYA 2C4HA 2WAXA 2I8CA 3OX3A 2P9ZA 1Q0HA 2WD8A 1Q0ZA 3H65A 4P4SA 4PG4A 4X61A 3RYHA 4EGSA 2VTEA 2FN3A 3A1VA 3C1UA 4GRAA 4MLPA 4G8JA 2FZCA 2WTMA 2VUSA 2IKQA 2VDWB 3AQ4A 3AK4A 3NPMA 3PNKA 3B3FA 3QXJA 4OQXA 1UBKS 4MV0A 4HRXA 2HHHB 2CUTA 3EW7A 3SICE 2AVNA 3CX3A 5FAXA 2AXNA 1MZVA 1A4IA 1XP8A 4LEIA 1EQUA 1OPRA 2GXUA 3HQ4O 3VR6H 1TECE 4CG0A 5F51A 1QV9A 2GETA 4RYDA 1Z4LA 3LBAA 4A8JA 1WUTA 4N5LA 4PRYA 3AZPA 1TQ4A 3IERA 2W6PA 3MCUA 4GD3Q 2YVLA 4Y2YA 2BHNA 5CH5A 4ETWA 4G0UA 1LDEA 1SO8A 4J29A 2FXIA 4AT1A 1V39A 4L8GA 1EXWA 1QO0A 1CY8A 1N5IA 2VF4X 4ZOAA 1JKJB 3WLQA 3NHWA 5A5GA 3ENKA 4YXFA 3CS3A 1RI5A 4KNWA 4BEJA 3LX8A 3NTQA 3LC7O 2Z6UA 3VSCA 4X44A 3OX4A 3KFXA 5SY9A 1HK7A 2N1MA 5TB5A 5IJ0A 3K70B 5EUCA 4KE6A 1I5OA 1C0PA 1JWBB 4BNMA 4NULA 4BO1A 4E03A 1TZKA 2HCTA 4KGVA 3GLGB 1XJ0A 1XALA 3NQ41 1AVTA 4GDFA 2IA5A 4HXFB 1EXDA 3HB0A 2OECA 1P1JA 2SCUA 2YZMA 3IEPA 3GUUA 3PGA1 4URZR 5FP0A 1OLXA 2MCFA 4W9MC 1TTTA 4QTTB 3GI1A 2Z9BA 4B7XA 3A70A 1FJHA 1KK3A 1NVWQ 1AUPA 3CZQA 4IFBA 4RLSA 3COZA 4UCFA 3UAXA 1M8JA 4CL3A 2V3CC 2H11A 3A6PC 4OHKA 4CEJB 4YRNA 2GS9A 3ZW7A 1HYGA 1SELA 4LOKA 3NHYA 4UNIA 4EWLA 2FMXA 2J31A 2O4CA 3KOWA 3LLCA 5SY6A 1GAWA 2H2AA 3STHA 2JW5A 4DYHA 3KQNA 4UATA 2CLLB 2E4XA 2QPAA 1FE8A 3SSNA 2NO5A 1JE0A 5EZYB 5IT4A 4CMCA 2O8VA 5J3JA 3T1HB 4GBED 3L7IA 1PU2A 3LZCA 2H51A 3NFRA 4KLAA 4OQDA 1Q7GA 4QELA 4TS4A 4Y2TA 3V4OA 1MT3A 1X8JA 4PINA 3TUIC 4A73A 4CLRA 5JCZA 5IANA 1JA0A 2IHZA 5FUWA 3ZV3A 2H8KA 3K0FA 3ZE0B 1W96A 3LCMA 3RYCA 1LBTA 3OM9A 3HFZA 2XKJE 4NS1A 1O2DA 3HRIA 3PJGA 4X1IB 3GNLA 4Y2RA 1O6ZA 1U7PA 2ZRKA 2CXUA 3B9PA 2E89A 4N5IX 2ID4A 3SQNA 1X2BA 1VPVA 2GRUA 2ZEJA 4BB9A 4KNYA 2EHDA 3H04A 3NIGB 1XMPA 1KDVA 4OSOA 5EIFA 4L9RA 3ZWCA 2OHFA 1JUDA 4TVBA 2F8TA 3BTVA 3KQVA 1ZMBA 1NU6A 4MVJD 3UUFA 2BGWA 1W5EA 3TAXA 2XOXA 2I0FA 2PQ2A 4YXWA 2WTNA 1NLYA 4MRPA 4RWZA 3UJCA 5ITZB 3WXMA 1IOWA 4G0NA 1U7ZA 2AFRA 5JO9A 1XZLA 2FGKA 4H6XA 3WJ1A 2ZBGA 3MEYA 5B5SA 5TPWA 1YRBA 5C8YB 3NGMA 4P4LA 4W5NA 4PIVA 4MQ4A 1M6EX 3AHDA 1EGQA 1PJTA 3V33A 2FWIA 4OHXA 5JDCC 4AN0A 2FDXA 1J20A 3WGUA 4BGIA 1CRPA 4FMCB 3CN7A 2A88A 4GI2A 1PWXA 2AOVA 2WZBA 4LXYA 4G8BA 4WBNF 5BSFA 4JQOA 4IGIA 3E05A 4P7KA 4RF2A 5LLDA 3WK9A 1XHLA 3FWYA 3ELYA 3VNVA 5LCXA 2PH5A 1WAMA 1DX6A 1KP2A 1PJLA 3L1JA 3OESA 5CCEA 5CW2A 2GWHA 4TWJA 2G80A 3OCVA 3SIXA 3EQ9A 3UOWA 1YIDA 2IH5A 4RZHA 4PRLA 3RVJA 5ALFA 4MJ3A 3E9IA 2C95A 1KMIY 4MW0A 1CERA 4TL9A 5DLEA 1K4MA 3UJBA 4B3MB 5AM1A 4RTJA 4CH3A 4OLFA 4LQCA 2EGHA 1TM5E 4U02A 1BDMA 2E41A 4R2LA 2C7BA 2P68A 3ZD8A 4CUKA 3E9RA 2OFOA 3RFXA 4BJHB 1TKAA 3U44A 1KI1A 3HCRA 1NXXA 3HJBA 5C37A 4C1NA 5AW4A 4CLRB 3IBCA 4JR1A 1Z16A 2NIPA 1FSGA 3L8HA 3BORA 3UAZA 1E92A 2QV0A 4Q4JA 2HA0A 1Y7HA 1P0FA 1ZD5A 1ZIYA 2P78A 3A25A 2H54A 1UIMA 4HA8A 1ZG3A 3D6JA 3QG1A 4RETA 4UP7A 2DYKA 2JFXA 2R48A 3KIPA 4CLHA 4JT9A 3RE1A 4EUEA 1A2KC 5HOQA 2FA9A 1LK0A 3IE1A 4EPWA 5LD2B 2RHCA 2ZDQA 4H7KA 1JN0A 4OHPA 5KYTA 3EB9A 5IS2A 3D8TA 4MRSA 2YKGA 5HW0A 3H1EA 2Q2VA 2YV5A 2FPUA 2QHXA 3DVLA 3H8WA 3KZ1E 3M5CA 4F4IA 3L4BC 1ZGZA 5A9RA 3OVMA 4JVSB 4L4UA 2EW2A 4OLHA 1MA3A 4UCQA 3BC1A 3JYLA 3F7MA 1UH5A 2Q8NA 2RHWA 3PNBA 4F2HA 2GVDC 5DV9A 2QY6A 1ZGGA 2ZWPA 4LF4B 4Y9TA 3RS8A 3JD1A 3HSSA 1L7DA 4Y1GA 5C1BA 4BNHA 3N0XA 4JT2A 1M1ZA 5JSYA 4JJ8A 2EFJA 3DTVB 1OLSA 2FUKA 5EHZA 5KTYA 4QO7A 4UJ3A 1JG4A 3CVVA 1I2BA 2VT6A 4UBOA 5FO0A 4D45A 5M04A 4TTQA 1UMCB 4AAYA 1VLLA 3BMCB 1PZNA 4M9UA 2GSWA 1CJBA 2I6QA 3OIGA 3V8LA 1A71A 1YR9A 1SRYA 5CT4A 2JVJA 2QHVA 2ZS7A 4RQUA 2ES4A 2YHBA 4GKVA 2PT9A 2QG9A 4PPNA 1G3QA 1RPJA 4TLBA 3OEWA 1ZK4A 5LYJA 3H9EO 3QX7A 2NYUA 1A7AA 2VDRB 4Q4LA 4DJAA 1SQ0A 1TAGA 4JBLA 1KAHA 2A3NA 3CF4A 3HNPA 5CR9A 1ZUWA 3ZXUB 3PTZA 2W6MA 3SZRA 5IAJA 4DNQA 3UTCA 1E1LA 5IEJA 4FFSA 1CJSA 2GCOB 1GP2A 5EJ4A 2WB2A 5B30A 2NTVA 2QEQA 1F3LA 1IN7A 2BGJA 2V97A 3VR2D 1RFLA 3TIXB 2ANCA 4B1FA 2FH5B 4IVPA 3RSCA 1NATA 4M9SA 2EAUA 4ZA2A 4RD0A 1YQ9A 2IYZA 2V9PA 1XF1A 2IF2A 3G0GA 2WNHA 3NHZA 1KQFA 3RROA 4AJEA 2BGGA 5HUQA 4FFDA 4IEEA 4YQYA 5TX7A 4JI5B 3MWYW 4RHEA 3LQFA 1AQJA 3RAJA 4TVSA 4ZVQA 1SOUA 2HGZA 3VOTA 4ZQBA 1RBMA 2J5RA 2VXBA 3FNFA 4GZ5A 3FOZA 3THWA 1VJ0A 2CKDA 2O8BB 4KQ2A 1H2FA 2OHGA 3C45A 1QANA 4ZOLA 5BUZA 2PUEA 2OCPA 2PFGA 1N33B 5DULA 1CUYA 2GXQA 3FJYA 4KJZA 3PNVA 2Q1SA 4MHSA 2HCJB 4C6TA 1M1YE 2QZ4A 4G4JA 2E4YA 4XCVA 2CVFA 3GW8A 4RPGA 2PUBA 4HLNA 5D6OA 3K09C 2FCRA 1PR9A 1HFKA 4NU6A 1DEOA 1EWKA 2CCGA 4BVKA 1JIIA 1NV9A 2NZWA 1WZNA 1AZSC 2FV8A 1EOVA 1WIWA 2C2OA 2JFVA 2P9JA 2XD4A 3GAMA 3HP4A 3RWMB 1J5PA 1GL3A 4RKEA 3ZCTA 1Y8ZA 3ZDCA 4OB6A 1V7CA 3SIRA 5MF6A 3AXSA 3FGPA 4ZAGA 1JU3A 1T25A 1F8XA 1ZONA 5BN4A 2R751 4UTZA 3MJFA 1HG1A 5I4BA 1D9XA 1YGPA 3IESA 4BO8A 2IPOA 1SIOA 1NPYA 4L07A 3W78A 2XB4A 3ROMA 4YMSA 2GO7A 4BP8A 1YRLA 3OZRA 3QLTA 1H1DA 1CNFA 3NALA 3DVAA 4DQDA 2WSMA 3L05A 4NCIA 1N5LA 1RBYA 4LNUB 4RVGA 5TF0A 4RD1A 4WJ3M 2O2EA 4RXMA 4X24A 3S1SA 3P2YA 3Q3IA 2VK8A 3W5UA 1T3GA 1IBMB 3ET4A 1UDXA 4IUYA 5DP2A 2G1UA 3WLPA 1TKBA 2XMCA 2EWNA 1H6DA 2NG1A 4Y98A 5BVHB 4URWR 4LDRA 3H2HA 4Z0NA 5C32A 3FMFA 1GU7A 4EKNB 1G8YA 3CNLA 4M9CA 4MUNA 5ALIA 2UZ3A 4C04A 1L4MA 2I2XB 3ITKA 3UHAA 4KDRA 5A62A 2DT5A 1XDWA 5JOQA 5K09A 4A0RA 4CN9A 1JJFA 2HFJA 1E3JA 1E6KA 3ASZA 3TD9A 2FR0A 1S8OA 2YY6A 3CWZA 3L8GA 5THKA 4LHVA 3UY4A 4ENRA 4KP7A 2DF8A 3EGCA 1Y81A 3R7LA 2F67A 3NDJA 4F6CA 3V4RA 4PFJA 2WTAA 4QJ5A 4MJXA 4D02A 5TXGA 3I05A 4XIJA 4O2DA 4L8VA 1X7DA 3O73A 2AFVA 4UEQA 2FE1A 3M6IA 3NRBA 5C1DA 5F5LA 4Q82A 2B4YA 3R7FA 5LP6A 3TQTA 3A7DA 1E0AA 1E5VA 1OFUA 4KODA 4QT4A 1CUFA 3OFKA 3I83A 3ZIAA 2WP8J 2DTDA 5JYEA 4YJFB 3HFRA 4EB0A 4X65B 2DPMA 1I3CA 3FTFA 1H2HA 4DJDC 1ZCZA 1KY4A 2O8CB 2EZ9A 2FQXA 3MQ4A 2BT4A 3KEOA 5EWLA 1T0PA 4X71A 1PLLA 3ORSA 4B46A 4O4LF 3UK7A 4XQGA 1LZKA 1Z6YA 3GEMA 5CVEA 4B4OA 2VNKA 5KWSA 1WDLA 2YZ2A 1F17A 3KVYA 4HI0E 2UYYA 2R6FA 2JANA 1B2RA 1WULS 5KPDA 5HBGA 5UKDA 5DRTA 3CGGA 4ATNA 1E9CA 1SEPA 2NTYC 2YR0A 5I47A 2CSXA 4AXBA 3JQ6A 5BN4B 1KH3A 1P80A 5HFNA 4EB8A 1W35A 4HNGA 4WV3A 1T5BA 2ALJA 4HZUB 3QU7A 3SSOA 4D8VA 2P6NA 2K5UA 3LOPA 5HIIA 3EY9A 3H1GA 4H7DA 3CGWA 4J0HA 1XQ6A 3GPCA 1ORIA 1PFWA 4MVJA 4YGYA 1YIAA 2O50A 5CX1B 3TRDA 2HA7A 3HXQA 5C8XA 1JSLA 2DTHA 1ABEA 3GO4A 1HFEL 4IIJF 1MB3A 5D8DA 3JVUA 2FFQA 3ZGNA 2DKNA 3R5SA 2LCQA 1U0LA 3CZ5A 4ZOLF 2YH2A 1G9XA 1UUFA 4CH4A 2Q0QA 3TLMA 3R3UA 3V4LA 1FUUA 3JYHA 5FFMA 5EA2A 4D96A 1RCUA 2J30A 2XW6A 4R8KA 5A4JA 3T1YB 4N3GA 4MWBA 3KLBA 1BGWA 1GSAA 2EZUA 3P94A 1DQNA 5BYJA 3V8KA 1E6UA 1WW8A 1VKRA 1T0BA 4TL6A 4CQJA 1R0YA 1DC3A 1XEFA 3AHEA 1G18A 3PYMA 1I32A 5KAMA 3ET5A 4GI1A 4WVFA 3P0RA 5C51B 3PV0A 5EIXA 2F00A 4HB4A 1RKVA 4JJKA 3CJRA 1E9FA 1SVMA 1Y5RA 1Y9EA 2IGBA 3PFHA 2ZG6A 3P52A 4IIYA 5WRFA 3F98A 4UTXA 1W88A 4URUR 3J81k 1HEIA 3A4MA 2VQFB 4WF2A 2AS0A 1J5XA 1OZHA 1V7ZA 2JKVA 3RK4A 2HK6A 3OUUA 4MZDA 3ORHA 4ZKEA 3ZGLA 1A96A 1YJQA 5TV2A 4QPZA 1QDUA 4CKWA 1N25A 4HYTA 4RF4A 7REQB 3LGXA 3JQAA 1WX1A 1HOXA 1CSEE 1QYCA 1MX5A 2FPXA 3VHXA 5KEIA 4HNVA 4XWGA 4C5CA 4MUEA 4Q1AA 4OLJA 4H2XB 4US1R 1GZ7A 4LVUA 2VJDA 4IO1A 4LHXA 4A8JB 1U0JA 2UZ1A 2ZZFA 4L50A 1DCTA 4UM7A 3CYFA 1MJNA 3HPRA 1YBAA 3W5AA 3L1AA 1RRFA 3KEMA 1RS0A 1E1DA 4GVPA 1SH7A 3NPAA 1KL7A 4PQGA 2ZIMA 1W73A 2MYTA 3D7NA 1Y7IA 2WG2A 4YUXA 1KPGA 4OQYA 3ZHTA 2GB4A 3B8HA 1MOQA 1P5HA 4TMVA 3U7RA 3IL2A 2KSQA 3OP1A 3PQ3A 3QWHA 2G5CA 1V0JA 4IMRA 1DXOA 4HDKB 1OXUA 1YUBA 2R62A 4JGBA 2JH3A 4O4HB 4HDNA 1YIOA 4MB6A 2Y6VA 1DKQA 4NV0A 2ZJZA 2PMEA 2NUBA 1U7HA 3T9AA 1JAYA 3FE2A 2ACKA 3H05A 4PVCA 2QI9C 1V5EA 1Y1KE 5F21A 4MYRA 3ENVA 2V7PA 4H7EA 4YEDA 4IGEA 3ETLA 2X1LA 1KEWA 5LA6F 1CQIB 1EKXA 1RFGE 1T8SA 3ILHA 3FVVA 3RVOA 4DA9A 3A3PA 3EOBI 1J2TA 3L0SA 1ORRA 4I2VA 1IBCA 3ECCA 3DCJA 4HTAA 4IIVA 4IXMA 2V3WA 2IBMA 3SBXA 3ZU2A 1AS0A 1UZLA 3BHMA 4Z8YA 3UGKA 5I4KA 2C7PA 3MVEA 4DDHA 4P4SB 4XOIA 5JZSA 1MQ9A 1ZVMA 4TVYA 4ZIRA 3O26A 3I2HA 4QYWA 1D4FA 1QP4A 4PGMA 2ZZKA 4MUXA 2VCHA 3WBJA 4FFBB 5I51A 3GZNB 1YZFA 3LRPA 3NVDA 3PQDA 5E1BA 2WM8A 4FE7A 4O5OA 2CJ9A 2JASA 1Q0SA 3DAGA 1NLFA 5IBCA 1RQGA 5CPBA 2HPHA 1A9OA 1ZINA 1IUNA 2GBPA 2XVZA 4NG4A 2CLHB 2CUZA 5YASA 1YZLA 1TUBA 5CVTA 2Y9PB 2EP8A 4WXRA 2FZKA 4YJ3A 1JFFA 3NH9A 3QLVA 3DE5X 1LW7A 2E7ZA 4XR9A 1QIMA 4ZGGA 4W5QA 3GBPA 4YRCA 3AWDA 3UBTA 3QP9A 3W1EA 3VPBA 5A1JA 1PX0A 1YMQA 3U3KA 5MGNA 3U7QA 2QD1A 5IKXA 4PM4A 3DPSA 2QQ0A 2QN8A 1NMSA 3IIJA 3K5HA 4UNPA 4EMUA 5IVHA 1J33A 2I29A 3EEQA 3ZS9A 1UC9A 4NBVA 5I9IA 2QTFA 2MMGA 3PC7A 1DCFA 1N2CE 4XKJA 1OFGA 2P40A 1EP9A 4OGLA 2GPSA 4ZJPA 5I5EA 3CSUA 5DMXA 2FNAA 1P61B 4YCVA 1FX1A 3LVBA 2ZBPA 4EMSA 1G42A 1Q2UA 2ECKA 4EW3A 2JHGA 3DE4X 1N2BA 1I6MA 3AV0B 4LK2A 4DNXA 5J43A 4ILKA 3KKZA 2C77A 2CMHA 4IJKA 1G55A 4HDKA 3AL3A 2AQHA 2Q49A 2Z57A 4NJEA 1FW6A 3QA9A 4UBNA 4BPRA 1I3OA 1JZQA 4N5DA 4V0SA 1GLGA 3EMBA 4IDCA 4M36A 3G9ZA 4UUPA 3OU7A 1SXJA 1VMAA 3JZFA 4X97A 3WADA 3VI4B 4EHLA 4R98A 3WGJA 1QVVA 1MCZA 3U16A 1P4HA 2AA3A 2ZRHA 1FVXA 4BX8A 3HWWA 5HRAA 3D7SA 1IZ7A 2SECE 1KO8A 3GFFA 1KZHA 2OZLB 1BMQA 1KZYC 2IP4A 2O7NA 1YDWA 1E5DA 2DUUA 2PS3A 4P3NA 4L5CA 5IVIA 2RGDA 2P5IA 2F64A 3NYRA 4RFLA 2HBYA 1V11B 2XGOA 4DMUB 3R7NA 1UT5A 5LBUA 5CG1A 4HZGA 4BUCA 2PS1A 2WIBA 3MGCA 5AOBA 3WKDA 3DEIA 1LBSA 2EYQA 4RNCA 1G21E 3PPYA 1Z4OA 1HDCA 4TRJA 2D1TA 4KRXA 2LBPA 1A9QA 3MJRA 4EFLA 4D4JA 3IA7A 4YRFA 4UUBA 4QSMA 4Z6KA 2OV8A 2FN9A 1ZGJA 3CE6A 2ZUCA 3CT6A 2GRAA 2IXTA 1XXHB 4TTVA 4MYUA 3ZUPA 4KQKA 4UHBA 3RS9A 4TYWA 1GL9B 5HA5A 4PX2A 3OQNA 1VRVA 4L4XA 3E3AA 4ZAXA 2X5OA 4KI7A 1JJVA 3G1WA 1XVTA 2EYUA 3DFIA 4G67A 4HDSB 2V3VA 3ASYA 3T5TA 1QGED 1L0WA 1CUEA 1VBKA 3RTGA 1WF6A 1BJTA 4ZT3A 3Q9NA 3D3WB 4LXUA 2DG2A 1JZTA 3GR6A 3HWRA 3A5YA 1A9XB 2O0LA 3O84A 3MWEB 5KVQA 6YASA 4P71A 2FFJA 2HBQA 3LWDA 4U7GA 4U9UA 3QVXA 4QOIA 3UWOA 3VO8A 1OYWA 3G2PA 4FEYA 1CY1A 1VPDA 4AIIA 3JYNA 4BWYA 2RHDA 2XNHA 3CXUA 3K53A 3MMZA 3LPMA 4II7A 1RQ7A 1Y7PA 3FRJA 1GYQA 3ODGA 5EJ5A 1ZNXA 1K3FA 3P0HA 2PO5A 3D7RA 2DKOA 5LDHA 3VHLB 1EJ0A 1MNAA 2OZKA 4JKOA 1CUUA 3BICA 1CUHA 1JAZA 2CIMA 1UJBA 2JK1A 2Z98A 3IJEB 4PRKA 5T6BA 2XT9A 3TEFA 2GAFA 2Y1OA 4E32A 1KY5A 5J4LA 1T8TA 4KMOA 3CVWA 1L4FA 2PBFA 3JRXA 1SMKA 3LRTA 4YRBA 3NAQA 5LXTA 1CUJA 3D8RA 2IXAA 2V5UA 4IZ6A 3VZQA 1DINA 2EIHA 3M3DA 5FDFA 3AR2A 1JEDA 1N4AA 3CSDA 3O91A 3SQXA 3FFTA 4TZ0A 4PZDA 3SHVA 2IYEA 2RH5A 3ZLVA 3JQDA 1QHHA 4ZALA 5K4AA 4O4JF 4O1MA 3SC2B 3F4KA 1SVWA 2YWFA 3T99A 4LHWA 4OQQA 4BVJA 2XVYA 3QPCA 2WNIA 4C08A 3EYAA 3A7AA 1DQRA 1QH0A 4RHXA 4CM8B 3DGFC 3C4QA 4M1KA 3VKUA 2PO7A 1NIJA 4Y6QA 3V1KA 4LTMA 1G38A 1FMFA 1WBDA 4IXNA 4BNJA 2ZQZA 2IYRA 3WLJA 1LY1A 2XDQA 3FWNA 3SR3A 4PNEA 1K86A 1AN0A 1IB0A 5G40A 2YBEA 3HCEA 3T12A 1SZPA 1NKTA 1UANA 4YP1A 3VKGA 5FV4A 1D4ZA 5IVDA 4Y7DA 3MN1A 3WBKA 4BRZA 4DAOA 2WJJA 2CLDX 5BRAA 3E5NA 3IDFA 4UAVA 3EULA 2VZ8A 2PVCA 2B6HA 3DE7X 5CXUA 3C4VA 4IIHA 1GQFA 4U7FA 5CLGA 5G0VA 4AMGA 4RIGA 1SB8A 2RB4A 4CEIB 3E9DA 1JFLA 3Q6NA 2DETA 1Z7GA 2CFSA 3F6EX 1RXSA 3BSYA 2CKMA 2HB6A 2G06A 4RVOA 3T95A 3OICA 2IS2A 1WSWA 3FF1A 3VR4H 3KHUA 1JI3A 2EKPA 4ME6A 3RTEA 3CEPB 5BRJA 4P3PA 4V1CB 5BQ5A 1P4JA 4YR7A 1JNYA 5AVKA 5L3VA 5AHRA 2BI4A 3ZQKA 2HIMA 1I1OA 1R0XA 4PYMA 3F71A 3BWBA 4I9HA 1OLUB 1XTIA 2FW6A 3K1YA 4IDAA 4OUKX 4PZEA 4D82A 1ONBA 3SX4A 1OLOA 5EP1A 2TSYB 3TXXA 1H2WA 1NI4B 1QHYA 5JAUA 4HL6A 1YB5A 4V0QA 1CT9A 1NBEA 1BVRA 3JWHA 4M49A 5FORA 4DE5A 2H0AA 3UH0A 3NJRA 2ADMA 4UTNA 3GG9A 2EFGA 3DV9A 1K3UB 1TVKA 3F6SA 3GEDA 1RAHA 4GMHA 4R84A 5CGZA 3NETA 1LK5A 5ED0A 4AG3A 2IYWA 4ZYZA 5CA0B 4R2JA 4KZPA 1F60A 1ZVQA 2CHGA 2DGDA 3CH4B 4R6WA 4AJPA 4ZP1A 5IC4A 4LX8A 3B1KA 2EW8A 1NE7A 2E4ZA 4XTYA 1HMYA 3ESYA 3SX0A 4JB3A 1RYBA 4I9NA 2FN4A 2A14A 3U4IA 1T5OA 4K6HA 3EDOA 3T4UA 1E2JA 4P2GA 3CPSA 2GJAA 2N75A 2ZI3A 2VLIA 2IDJA 4MSUA 1ULUA 4BVLA 4GPBA 2O0JA 4PC2A 4IDNA 3D7LA 3O2NA 3K9LA 2YXLA 1ABBA 1GG9A 2NVOA 1ZL0A 2NT4A 3QMMA 2W6IA 1YRHA 2ZRPA 1HNWB 4PTLA 3SX2A 4B0PA 2GJSA 2FP3A 4H3KB 4QLBA 3ZGYA 4L0DA 1K08A 1ZESA 1WBBA 1ZI9A 5JADA 4LC0A 4UD6A 3V4FA 1HBJA 1OFUX 4IQ0A 2OV4A 3RVLA 2I2FA 3D2LA 1PJ8A 3IDZA 3GH1A 1TM3E 5A71A 3PR1A 3VU3A 2JCVA 4F5WA 3R7SA 1F7UA 4P4NA 1DBQA 3ZDZB 3RRMA 4E2ZA 2P5YA 2HHJA 4GPTA 2VSOA 3IBFA 1T4DA 4L6CA 4L75A 1KR2A 5TS2A 3KFVA 3UCEA 1DOZA 3V5NA 3QE3A 4WEOA 4A5OA 1PJRA 3NVAA 1PRYA 2WIJA 4U0KA 4BKPA 3HJTA 4CKXA 3NWJA 2FPGB 4RSGA 3QVGB 1FP4A 3LOUA 1TZJA 4IJVA 4IDOA 5HRUA 1J6UA 1FYEA 2FU5C 2HPAA 3CW9A 4LC9A 4O5AA 4BV8A 5JAHA 3T5AA 2GXAA 2XUHA 3A0UA 5CVDA 3HM2A 1G7RA 2H65A 3K0BA 3T9BA 4ED9A 1X1AA 4XU2A 4FUQA 2I6XA 4G4SO 4UPEA 1R4MA 5C5DA 2VJMB 2QN6A 3EZ7A 16PKA 3ZIAD 1GGNA 1XZBA 1E1CB 1GGJA 1OX5A 3RV4A 4GI3A 1Z47A 3TIIA 1WOYA 3TSZA 3FSRA 2ERXA 3E82A 5LZ4A 1R2QA 2C88A 3LFHA 4V39A 2MHCA 2I91A 4HY3A 3A04A 5G4KB 1Y1TA 1OZFA 1I1QB 1PS0A 3CRRA 4JLPA 4TTIA 4YCWA 3TOZA 3ZYZA 4CM9D 2X41A 1II8A 3M34A 4OQMA 4G0ZA 5EWMA 5AW2A 2WM3A 2QQFA 4O29A 5JT1A 5F9HA 3T3HA 3KJXA 3WHLA 2PGIA 2OSBA 3GPBA 1OQAA 3K9CA 4U9HS 5CFMA 5ALSA 3WBBA 5AKEA 5I9NA 3VQTA 4R71A 4WESA 3WGZA 3ND9A 1FDRA 1Z0KA 2NYVA 3I9KA 4MPJA 1VIMA 2Z2ZA 5CT6A 5ALOA 4U3JB 2VP4A 1MTZA 4DIFA 3ERRA 1DT3A 3GDGA 4Y1RB 4IUCS 1UOPA 2VQ3A 5K4GA 1JF8A 4BEVA 1JTEA 3DBVO 3QXSA 1W5BA 3I2KA 4NMHA 4PSVA 3GLHB 5SICE 2QVCA 4EPXA 2F7SA 3GFTA 4IHQA 1RTKA 3OKPA 3FOAA 4NY1A 5K51A 5D5HA 1QPGA 1OXXK 2HDWA 2NU8A 2HU5A 2C4VA 2RK6A 4J6FA 5BV1A 4IEIA 2FMFA 5CHEA 4RQAA 4NK4A 1DIRA 2CMFA 2ZIUB 3I1YA 5I6DA 4JDUA 4KN8A 4Q34A 1DBSA 3L6OO 3F73A 1ZVVA 1ZRMA 4F6RB 4MV9A 3GPDG 1N2ZA 2ODQA 1BCRA 3GRPA 3IDSA 4P3OA 3D2CA 2C2ZA 2F8LA 3TMAA 1J9GA 1E94E 3OJWA 2HSJA 3G0CA 1UBGA 3CLTD 2WEKA 5JR3A 3P9XA 2OPBA 2BRUA 4ZT5A 1LRLA 1NI4A 1V7PC 1BEUB 2W4IA 3T5MA 2D0OB 2WJZB 1XRMA 2WB4A 3C87A 2UKDA 2XCLA 4JA0A 4BQSA 5C7IO 4D8UA 3PP8A 2XYHA 3H13A 5FOWA 2XZDA 3TLKA 2Q46A 3G2HA 5TNXA 4LFCB 1FFXA 1P31A 3H75A 2OHJA 1TU4A 4I66A 4I9GA 4ARIA 4OH7A 1FA9A 3THRA 3AESB 3WYCA 3OKAA 4EW6A 4AQ7A 4UHDA 3LLUA 1QO7A 1JDNA 4LZLA 1E64A 1HZZC 1KTIA 3FUTA 3U7EB 2OQRA 1FYWA 1M7BA 3UENA 1GQOA 1AZTA 5ALRA 1T5SA 2KWIA 2X4GA 2XTJA 4HGRA 1U0RA 2JLQA 4N18A 4AECA 3F90A 4YLGA 4BGEA 5K45A 3HM9A 4YVFA 1IWBB 2GZAA 2P9GA 3NBFA 1O08A 2BN4A 2P77A 1EB8A 1F2UA 1JQAA 1U0NA 1XA0A 1EWYA 2D7CA 2J32A 3L07A 4TROA 3M83A 4IUDS 2V7QA 5LDGA 3RJ9A 2JIZD 5CB8A 2AC7A 3AEKB 1YQUA 3QENA 4G4GA 4M0DA 5KOJB 3QPDA 3NDRA 3S0JA 2OILA 5KYKA 2DPLA 5DM60 1SUEA 4MDEA 1RJ9B 4LXQA 2HSDA 4P53A 2QLNA 4H2WA 2HRQA 3EVCA 3PXBA 1FFDA 2P65A 1O9HA 1XVIA 4NJMA 3WVNA 3ZEIA 3TOCA 1VHJA 5F98A 2PZKA 5B3KA 2PT7A 2ACVA 2J07A 1C2TA 2WK1A 3ABQB 4LNHA 3OF5A 3HV2A 1ZRHA 1N6LA 3ZIDA 1Y42X 4LOIA 4AG5A 4F45A 1L7PA 2ZRMA 2VEDA 4HATA 4GHWA 3V2GA 3CPHA 2ONCA 1FYFA 3OJOA 1J07A 2GYUA 1TNDA 2YV4A 1NBMA 4HX2A 1IOVA 1CHDA 1Y7TA 1ZNQO 3GZNA 2HSZA 1ONSA 2D1RA 2FRDA 4MS1B 1IFXA 4DABA 3ZJUA 5SY4A 3INRA 4I4IA 1KC1A 4MTCA 5EMKA 4R4JA 5F9FA 1P60A 2AGVA 4N5NA 3VR4D 2QPOA 1NXTA 2QUJA 4P0QB 2XE7A 1XCBA 3CH6A 2EJWA 2MMCA 7ABPA 1P5RA 2QI9F 3E3OA 3LYHA 5F78A 2ZJ5A 1CUBA 2YFYA 3L49A 4QUIA 3MK31 2H57A 2KPOA 3K05A 3N8NA 1KK2A 1QQ7A 4KB5A 1XEWY 2GCGA 2I1LA 1CVIA 3LNCA 1E7WA 4MNTA 1NFRA 3PTLA 5FPTA 1SHJA 1R37A 1J2JA 1E3TA 2WRZA 3ZV5A 4TLLB 2ETVA 2C8VA 2QU7A 4YFVA 4FGUA 3SEQA 4EHFA 2BI7A 5EKUA 1ZXLA 5BSMA 5ARBA 3FYTA 3X2FA 2X3UA 1BXGB 2H1RA 2XODA 5H0IA 3VDNB 2HL6A 4AUNA 3L4JA 3EYWA 3GV0A 2CL6X 4O4HA 3WB9A 3IE2A 5JNSA 2IFTA 2MYNA 2X8JB 2ZWIA 4JV5B 4BFYA