3IL0A

The crystal structure of the aminopeptidase p,xaa-pro aminopeptidase from streptococcus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
128
structure length
128
Chain Sequence
NAMQRRLERFDAKLVQSGLDALLVTGQNNIYYLTDFWGTNATVFITKNRRLFLTDSRYTLIAKQSVHGFDIIESKDPLKDIVKFVEVDKLETIGFDNQVSFAYYQALQAIFEGYTLSPQTNFMEELRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase P; XAA-pro aminopeptidase
publication title The crystal structure of the aminopeptidase P,XAA-pro aminopeptidase from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus
molecule tags Hydrolase
total genus 40
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3il0A00
2BN7A 4RGZ1 2BWUA 3QOCA 2BWYA 5CDEA 4ZWPA 3L24A 2BWTA 4RZYA 2V3XA 1N51A 3BIPA 5CDLA 2HOWA 3CB6A 3L7GA 4FKCA 5E5BA 4ZWUA 5CDVA 4S00A 1WY2A 1PV9A 5E2CA 2BH3A 1CHMA 2BHBA 2BWVA 5CIKA 1M35A 3CB5A 1W7VA 5CE6A 3RVAA 4RZZA 2IW2A 3OVKA 2OKNA 4ZNGA 4R60A 1WBQA 1WL6A 3PEBA 4ZWOA 3IG4A 1WN1A 3OOOA 4EGEA 4S01A 3PN9A 3BIQA 3BITA 3IL0A 3Q6DA 1KP0A 4QR8A 1WLRA 2BHAA 2BWWA 5FCFA 3CTZA 1A16A 2V3YA 4PV4A 5CNXA 2V3ZA 1W2MA 2BHDA 1WL9A 2BHCA 3I7MA 5FCHA 3O5VA 2BWXA 1JAWA 4S2RP 4S2TP 2BWSA 2ZSGA 4B28A
chains in the Genus database with same CATH superfamily
2BN7A 4RGZ1 2BWUA 3QOCA 2BWYA 5CDEA 4ZWPA 3L24A 2BWTA 4RZYA 2V3XA 1N51A 3BIPA 5CDLA 2HOWA 3CB6A 3L7GA 4FKCA 5E5BA 4ZWUA 5CDVA 4S00A 1WY2A 1PV9A 5E2CA 2BH3A 1CHMA 2BHBA 2BWVA 5CIKA 1M35A 3CB5A 1W7VA 5CE6A 3RVAA 4RZZA 2IW2A 3OVKA 2OKNA 4ZNGA 4R60A 1WBQA 1WL6A 3PEBA 4ZWOA 3IG4A 1WN1A 3OOOA 4EGEA 4S01A 3PN9A 3BIQA 3BITA 3IL0A 3Q6DA 1KP0A 4QR8A 1WLRA 2BHAA 2BWWA 5FCFA 3CTZA 1A16A 2V3YA 4PV4A 5CNXA 2V3ZA 1W2MA 2BHDA 1WL9A 2BHCA 3I7MA 5FCHA 3O5VA 2BWXA 1JAWA 4S2RP 4S2TP 2BWSA 2ZSGA 4B28A
chains in the Genus database with same CATH topology
2BN7A 4RGZ1 2BWUA 3QOCA 2BWYA 5CDEA 4ZWPA 3L24A 2BWTA 4RZYA 2V3XA 1N51A 3BIPA 5CDLA 2HOWA 3CB6A 3L7GA 4FKCA 5E5BA 4ZWUA 5CDVA 4S00A 1WY2A 1PV9A 5E2CA 2BH3A 1CHMA 2BHBA 2BWVA 5CIKA 1M35A 3CB5A 1W7VA 5CE6A 3RVAA 4RZZA 2IW2A 3OVKA 2OKNA 4ZNGA 4R60A 1WBQA 1WL6A 3PEBA 4ZWOA 3IG4A 1WN1A 3OOOA 4EGEA 4S01A 3PN9A 3BIQA 3BITA 3IL0A 3Q6DA 1KP0A 4QR8A 1WLRA 2BHAA 2BWWA 5FCFA 3CTZA 1A16A 2V3YA 4PV4A 5CNXA 2V3ZA 1W2MA 2BHDA 1WL9A 2BHCA 3I7MA 5FCHA 3O5VA 2BWXA 1JAWA 4S2RP 4S2TP 2BWSA 2ZSGA 4B28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BN7 A;  4RGZ 1;  2BWU A;  3QOC A;  2BWY A;  5CDE A;  4ZWP A;  3L24 A;  2BWT A;  4RZY A;  2V3X A;  1N51 A;  3BIP A;  5CDL A;  2HOW A;  3CB6 A;  3L7G A;  4FKC A;  5E5B A;  4ZWU A;  5CDV A;  4S00 A;  1WY2 A;  1PV9 A;  5E2C A;  2BH3 A;  1CHM A;  2BHB A;  2BWV A;  5CIK A;  1M35 A;  3CB5 A;  1W7V A;  5CE6 A;  3RVA A;  4RZZ A;  2IW2 A;  3OVK A;  2OKN A;  4ZNG A;  4R60 A;  1WBQ A;  1WL6 A;  3PEB A;  4ZWO A;  3IG4 A;  1WN1 A;  3OOO A;  4EGE A;  4S01 A;  3PN9 A;  3BIQ A;  3BIT A;  3IL0 A;  3Q6D A;  1KP0 A;  4QR8 A;  1WLR A;  2BHA A;  2BWW A;  5FCF A;  3CTZ A;  1A16 A;  2V3Y A;  4PV4 A;  5CNX A;  2V3Z A;  1W2M A;  2BHD A;  1WL9 A;  2BHC A;  3I7M A;  5FCH A;  3O5V A;  2BWX A;  1JAW A;  4S2R P;  4S2T P;  2BWS A;  2ZSG A;  4B28 A; 
#chains in the Genus database with same CATH topology
 2BN7 A;  4RGZ 1;  2BWU A;  3QOC A;  2BWY A;  5CDE A;  4ZWP A;  3L24 A;  2BWT A;  4RZY A;  2V3X A;  1N51 A;  3BIP A;  5CDL A;  2HOW A;  3CB6 A;  3L7G A;  4FKC A;  5E5B A;  4ZWU A;  5CDV A;  4S00 A;  1WY2 A;  1PV9 A;  5E2C A;  2BH3 A;  1CHM A;  2BHB A;  2BWV A;  5CIK A;  1M35 A;  3CB5 A;  1W7V A;  5CE6 A;  3RVA A;  4RZZ A;  2IW2 A;  3OVK A;  2OKN A;  4ZNG A;  4R60 A;  1WBQ A;  1WL6 A;  3PEB A;  4ZWO A;  3IG4 A;  1WN1 A;  3OOO A;  4EGE A;  4S01 A;  3PN9 A;  3BIQ A;  3BIT A;  3IL0 A;  3Q6D A;  1KP0 A;  4QR8 A;  1WLR A;  2BHA A;  2BWW A;  5FCF A;  3CTZ A;  1A16 A;  2V3Y A;  4PV4 A;  5CNX A;  2V3Z A;  1W2M A;  2BHD A;  1WL9 A;  2BHC A;  3I7M A;  5FCH A;  3O5V A;  2BWX A;  1JAW A;  4S2R P;  4S2T P;  2BWS A;  2ZSG A;  4B28 A; 
#chains in the Genus database with same CATH homology
 2BN7 A;  4RGZ 1;  2BWU A;  3QOC A;  2BWY A;  5CDE A;  4ZWP A;  3L24 A;  2BWT A;  4RZY A;  2V3X A;  1N51 A;  3BIP A;  5CDL A;  2HOW A;  3CB6 A;  3L7G A;  4FKC A;  5E5B A;  4ZWU A;  5CDV A;  4S00 A;  1WY2 A;  1PV9 A;  5E2C A;  2BH3 A;  1CHM A;  2BHB A;  2BWV A;  5CIK A;  1M35 A;  3CB5 A;  1W7V A;  5CE6 A;  3RVA A;  4RZZ A;  2IW2 A;  3OVK A;  2OKN A;  4ZNG A;  4R60 A;  1WBQ A;  1WL6 A;  3PEB A;  4ZWO A;  3IG4 A;  1WN1 A;  3OOO A;  4EGE A;  4S01 A;  3PN9 A;  3BIQ A;  3BIT A;  3IL0 A;  3Q6D A;  1KP0 A;  4QR8 A;  1WLR A;  2BHA A;  2BWW A;  5FCF A;  3CTZ A;  1A16 A;  2V3Y A;  4PV4 A;  5CNX A;  2V3Z A;  1W2M A;  2BHD A;  1WL9 A;  2BHC A;  3I7M A;  5FCH A;  3O5V A;  2BWX A;  1JAW A;  4S2R P;  4S2T P;  2BWS A;  2ZSG A;  4B28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...