3IL0A

The crystal structure of the aminopeptidase p,xaa-pro aminopeptidase from streptococcus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
128
structure length
128
Chain Sequence
NAMQRRLERFDAKLVQSGLDALLVTGQNNIYYLTDFWGTNATVFITKNRRLFLTDSRYTLIAKQSVHGFDIIESKDPLKDIVKFVEVDKLETIGFDNQVSFAYYQALQAIFEGYTLSPQTNFMEELRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase P; XAA-pro aminopeptidase
publication title The crystal structure of the aminopeptidase P,XAA-pro aminopeptidase from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus
molecule tags Hydrolase
total genus 40
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3il0A00
5E2CA 2BWWA 1WBQA 1KP0A 2BWUA 3O5VA 3IG4A 2BWVA 4RZYA 3BIQA 4RZZA 3OOOA 4QR8A 4EGEA 1W2MA 3PEBA 4ZWOA 3L7GA 2BH3A 2BHAA 4S2TP 2V3XA 3BITA 3I7MA 1JAWA 2ZSGA 4PV4A 2V3YA 2V3ZA 5CE6A 1M35A 1WL9A 5CIKA 2BWYA 3OVKA 1N51A 3PN9A 3CB5A 4S00A 4ZNGA 3QOCA 5CNXA 1W7VA 5CDLA 4B28A 3BIPA 4S01A 1WL6A 4ZWPA 1WLRA 2BN7A 2BHBA 2IW2A 2BWXA 4ZWUA 1A16A 1PV9A 2BHDA 3Q6DA 5CDEA 5FCHA 4RGZ1 5FCFA 1CHMA 3IL0A 3CB6A 1WN1A 2OKNA 5E5BA 4S2RP 4FKCA 2HOWA 5CDVA 2BWTA 2BWSA 2BHCA 3RVAA 3L24A 1WY2A 3CTZA 4R60A
chains in the Genus database with same CATH superfamily
5E2CA 2BWWA 1WBQA 1KP0A 2BWUA 3O5VA 3IG4A 2BWVA 4RZYA 3BIQA 4RZZA 3OOOA 4QR8A 4EGEA 1W2MA 3PEBA 4ZWOA 3L7GA 2BH3A 2BHAA 4S2TP 2V3XA 3BITA 3I7MA 1JAWA 2ZSGA 4PV4A 2V3YA 2V3ZA 5CE6A 1M35A 1WL9A 5CIKA 2BWYA 3OVKA 1N51A 3PN9A 3CB5A 4S00A 4ZNGA 3QOCA 5CNXA 1W7VA 5CDLA 4B28A 3BIPA 4S01A 1WL6A 4ZWPA 1WLRA 2BN7A 2BHBA 2IW2A 2BWXA 4ZWUA 1A16A 1PV9A 2BHDA 3Q6DA 5CDEA 5FCHA 4RGZ1 5FCFA 1CHMA 3IL0A 3CB6A 1WN1A 2OKNA 5E5BA 4S2RP 4FKCA 2HOWA 5CDVA 2BWTA 2BWSA 2BHCA 3RVAA 3L24A 1WY2A 3CTZA 4R60A
chains in the Genus database with same CATH topology
5E2CA 2BWWA 1WBQA 1KP0A 2BWUA 3O5VA 3IG4A 2BWVA 4RZYA 3BIQA 4RZZA 3OOOA 4QR8A 4EGEA 1W2MA 3PEBA 4ZWOA 3L7GA 2BH3A 2BHAA 4S2TP 2V3XA 3BITA 3I7MA 1JAWA 2ZSGA 4PV4A 2V3YA 2V3ZA 5CE6A 1M35A 1WL9A 5CIKA 2BWYA 3OVKA 1N51A 3PN9A 3CB5A 4S00A 4ZNGA 3QOCA 5CNXA 1W7VA 5CDLA 4B28A 3BIPA 4S01A 1WL6A 4ZWPA 1WLRA 2BN7A 2BHBA 2IW2A 2BWXA 4ZWUA 1A16A 1PV9A 2BHDA 3Q6DA 5CDEA 5FCHA 4RGZ1 5FCFA 1CHMA 3IL0A 3CB6A 1WN1A 2OKNA 5E5BA 4S2RP 4FKCA 2HOWA 5CDVA 2BWTA 2BWSA 2BHCA 3RVAA 3L24A 1WY2A 3CTZA 4R60A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E2C A;  2BWW A;  1WBQ A;  1KP0 A;  2BWU A;  3O5V A;  3IG4 A;  2BWV A;  4RZY A;  3BIQ A;  4RZZ A;  3OOO A;  4QR8 A;  4EGE A;  1W2M A;  3PEB A;  4ZWO A;  3L7G A;  2BH3 A;  2BHA A;  4S2T P;  2V3X A;  3BIT A;  3I7M A;  1JAW A;  2ZSG A;  4PV4 A;  2V3Y A;  2V3Z A;  5CE6 A;  1M35 A;  1WL9 A;  5CIK A;  2BWY A;  3OVK A;  1N51 A;  3PN9 A;  3CB5 A;  4S00 A;  4ZNG A;  3QOC A;  5CNX A;  1W7V A;  5CDL A;  4B28 A;  3BIP A;  4S01 A;  1WL6 A;  4ZWP A;  1WLR A;  2BN7 A;  2BHB A;  2IW2 A;  2BWX A;  4ZWU A;  1A16 A;  1PV9 A;  2BHD A;  3Q6D A;  5CDE A;  5FCH A;  4RGZ 1;  5FCF A;  1CHM A;  3IL0 A;  3CB6 A;  1WN1 A;  2OKN A;  5E5B A;  4S2R P;  4FKC A;  2HOW A;  5CDV A;  2BWT A;  2BWS A;  2BHC A;  3RVA A;  3L24 A;  1WY2 A;  3CTZ A;  4R60 A; 
#chains in the Genus database with same CATH topology
 5E2C A;  2BWW A;  1WBQ A;  1KP0 A;  2BWU A;  3O5V A;  3IG4 A;  2BWV A;  4RZY A;  3BIQ A;  4RZZ A;  3OOO A;  4QR8 A;  4EGE A;  1W2M A;  3PEB A;  4ZWO A;  3L7G A;  2BH3 A;  2BHA A;  4S2T P;  2V3X A;  3BIT A;  3I7M A;  1JAW A;  2ZSG A;  4PV4 A;  2V3Y A;  2V3Z A;  5CE6 A;  1M35 A;  1WL9 A;  5CIK A;  2BWY A;  3OVK A;  1N51 A;  3PN9 A;  3CB5 A;  4S00 A;  4ZNG A;  3QOC A;  5CNX A;  1W7V A;  5CDL A;  4B28 A;  3BIP A;  4S01 A;  1WL6 A;  4ZWP A;  1WLR A;  2BN7 A;  2BHB A;  2IW2 A;  2BWX A;  4ZWU A;  1A16 A;  1PV9 A;  2BHD A;  3Q6D A;  5CDE A;  5FCH A;  4RGZ 1;  5FCF A;  1CHM A;  3IL0 A;  3CB6 A;  1WN1 A;  2OKN A;  5E5B A;  4S2R P;  4FKC A;  2HOW A;  5CDV A;  2BWT A;  2BWS A;  2BHC A;  3RVA A;  3L24 A;  1WY2 A;  3CTZ A;  4R60 A; 
#chains in the Genus database with same CATH homology
 5E2C A;  2BWW A;  1WBQ A;  1KP0 A;  2BWU A;  3O5V A;  3IG4 A;  2BWV A;  4RZY A;  3BIQ A;  4RZZ A;  3OOO A;  4QR8 A;  4EGE A;  1W2M A;  3PEB A;  4ZWO A;  3L7G A;  2BH3 A;  2BHA A;  4S2T P;  2V3X A;  3BIT A;  3I7M A;  1JAW A;  2ZSG A;  4PV4 A;  2V3Y A;  2V3Z A;  5CE6 A;  1M35 A;  1WL9 A;  5CIK A;  2BWY A;  3OVK A;  1N51 A;  3PN9 A;  3CB5 A;  4S00 A;  4ZNG A;  3QOC A;  5CNX A;  1W7V A;  5CDL A;  4B28 A;  3BIP A;  4S01 A;  1WL6 A;  4ZWP A;  1WLR A;  2BN7 A;  2BHB A;  2IW2 A;  2BWX A;  4ZWU A;  1A16 A;  1PV9 A;  2BHD A;  3Q6D A;  5CDE A;  5FCH A;  4RGZ 1;  5FCF A;  1CHM A;  3IL0 A;  3CB6 A;  1WN1 A;  2OKN A;  5E5B A;  4S2R P;  4FKC A;  2HOW A;  5CDV A;  2BWT A;  2BWS A;  2BHC A;  3RVA A;  3L24 A;  1WY2 A;  3CTZ A;  4R60 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...