3IL0A

The crystal structure of the aminopeptidase p,xaa-pro aminopeptidase from streptococcus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
128
structure length
128
Chain Sequence
b'NAMQRRLERFDAKLVQSGLDALLVTGQNNIYYLTDFWGTNATVFITKNRRLFLTDSRYTLIAKQSVHGFDIIESKDPLKDIVKFVEVDKLETIGFDNQVSFAYYQALQAIFEGYTLSPQTNFMEELRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminopeptidase P; XAA-pro aminopeptidase
publication title The crystal structure of the aminopeptidase P,XAA-pro aminopeptidase from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus
molecule tags Hydrolase
total genus 40
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3il0A00
1A16A 2V3ZA 4ZNGA 2BN7A 3OOOA 5E2CA 2IW2A 1WN1A 3CTZA 4S2TP 3CB5A 2HOWA 5FCHA 2BWVA 3IL0A 4S2RP 1WBQA 3RVAA 5CE6A 1WY2A 4QR8A 1WL6A 2V3XA 2BWTA 3L7GA 4S01A 3L24A 5CNXA 5CDVA 3QOCA 4EGEA 2ZSGA 5E5BA 1JAWA 3BIPA 2BWUA 4R60A 4ZWOA 5CDEA 2OKNA 2BWSA 3IG4A 1WL9A 2V3YA 2BWXA 4RGZ1 3PEBA 2BHAA 2BHBA 3OVKA 1CHMA 1WLRA 4RZYA 5CIKA 1KP0A 3PN9A 4RZZA 3Q6DA 4ZWPA 3CB6A 1W7VA 4PV4A 1W2MA 2BWYA 1N51A 4FKCA 2BHDA 3BITA 3BIQA 5FCFA 4S00A 1PV9A 3O5VA 2BHCA 5CDLA 4ZWUA 1M35A 4B28A 3I7MA 2BWWA 2BH3A
chains in the Genus database with same CATH superfamily
1A16A 2V3ZA 4ZNGA 2BN7A 3OOOA 5E2CA 2IW2A 1WN1A 3CTZA 4S2TP 3CB5A 2HOWA 5FCHA 2BWVA 3IL0A 4S2RP 1WBQA 3RVAA 5CE6A 1WY2A 4QR8A 1WL6A 2V3XA 2BWTA 3L7GA 4S01A 3L24A 5CNXA 5CDVA 3QOCA 4EGEA 2ZSGA 5E5BA 1JAWA 3BIPA 2BWUA 4R60A 4ZWOA 5CDEA 2OKNA 2BWSA 3IG4A 1WL9A 2V3YA 2BWXA 4RGZ1 3PEBA 2BHAA 2BHBA 3OVKA 1CHMA 1WLRA 4RZYA 5CIKA 1KP0A 3PN9A 4RZZA 3Q6DA 4ZWPA 3CB6A 1W7VA 4PV4A 1W2MA 2BWYA 1N51A 4FKCA 2BHDA 3BITA 3BIQA 5FCFA 4S00A 1PV9A 3O5VA 2BHCA 5CDLA 4ZWUA 1M35A 4B28A 3I7MA 2BWWA 2BH3A
chains in the Genus database with same CATH topology
1A16A 2V3ZA 4ZNGA 2BN7A 3OOOA 5E2CA 2IW2A 1WN1A 3CTZA 4S2TP 3CB5A 2HOWA 5FCHA 2BWVA 3IL0A 4S2RP 1WBQA 3RVAA 5CE6A 1WY2A 4QR8A 1WL6A 2V3XA 2BWTA 3L7GA 4S01A 3L24A 5CNXA 5CDVA 3QOCA 4EGEA 2ZSGA 5E5BA 1JAWA 3BIPA 2BWUA 4R60A 4ZWOA 5CDEA 2OKNA 2BWSA 3IG4A 1WL9A 2V3YA 2BWXA 4RGZ1 3PEBA 2BHAA 2BHBA 3OVKA 1CHMA 1WLRA 4RZYA 5CIKA 1KP0A 3PN9A 4RZZA 3Q6DA 4ZWPA 3CB6A 1W7VA 4PV4A 1W2MA 2BWYA 1N51A 4FKCA 2BHDA 3BITA 3BIQA 5FCFA 4S00A 1PV9A 3O5VA 2BHCA 5CDLA 4ZWUA 1M35A 4B28A 3I7MA 2BWWA 2BH3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A16 A;  2V3Z A;  4ZNG A;  2BN7 A;  3OOO A;  5E2C A;  2IW2 A;  1WN1 A;  3CTZ A;  4S2T P;  3CB5 A;  2HOW A;  5FCH A;  2BWV A;  3IL0 A;  4S2R P;  1WBQ A;  3RVA A;  5CE6 A;  1WY2 A;  4QR8 A;  1WL6 A;  2V3X A;  2BWT A;  3L7G A;  4S01 A;  3L24 A;  5CNX A;  5CDV A;  3QOC A;  4EGE A;  2ZSG A;  5E5B A;  1JAW A;  3BIP A;  2BWU A;  4R60 A;  4ZWO A;  5CDE A;  2OKN A;  2BWS A;  3IG4 A;  1WL9 A;  2V3Y A;  2BWX A;  4RGZ 1;  3PEB A;  2BHA A;  2BHB A;  3OVK A;  1CHM A;  1WLR A;  4RZY A;  5CIK A;  1KP0 A;  3PN9 A;  4RZZ A;  3Q6D A;  4ZWP A;  3CB6 A;  1W7V A;  4PV4 A;  1W2M A;  2BWY A;  1N51 A;  4FKC A;  2BHD A;  3BIT A;  3BIQ A;  5FCF A;  4S00 A;  1PV9 A;  3O5V A;  2BHC A;  5CDL A;  4ZWU A;  1M35 A;  4B28 A;  3I7M A;  2BWW A;  2BH3 A; 
#chains in the Genus database with same CATH topology
 1A16 A;  2V3Z A;  4ZNG A;  2BN7 A;  3OOO A;  5E2C A;  2IW2 A;  1WN1 A;  3CTZ A;  4S2T P;  3CB5 A;  2HOW A;  5FCH A;  2BWV A;  3IL0 A;  4S2R P;  1WBQ A;  3RVA A;  5CE6 A;  1WY2 A;  4QR8 A;  1WL6 A;  2V3X A;  2BWT A;  3L7G A;  4S01 A;  3L24 A;  5CNX A;  5CDV A;  3QOC A;  4EGE A;  2ZSG A;  5E5B A;  1JAW A;  3BIP A;  2BWU A;  4R60 A;  4ZWO A;  5CDE A;  2OKN A;  2BWS A;  3IG4 A;  1WL9 A;  2V3Y A;  2BWX A;  4RGZ 1;  3PEB A;  2BHA A;  2BHB A;  3OVK A;  1CHM A;  1WLR A;  4RZY A;  5CIK A;  1KP0 A;  3PN9 A;  4RZZ A;  3Q6D A;  4ZWP A;  3CB6 A;  1W7V A;  4PV4 A;  1W2M A;  2BWY A;  1N51 A;  4FKC A;  2BHD A;  3BIT A;  3BIQ A;  5FCF A;  4S00 A;  1PV9 A;  3O5V A;  2BHC A;  5CDL A;  4ZWU A;  1M35 A;  4B28 A;  3I7M A;  2BWW A;  2BH3 A; 
#chains in the Genus database with same CATH homology
 1A16 A;  2V3Z A;  4ZNG A;  2BN7 A;  3OOO A;  5E2C A;  2IW2 A;  1WN1 A;  3CTZ A;  4S2T P;  3CB5 A;  2HOW A;  5FCH A;  2BWV A;  3IL0 A;  4S2R P;  1WBQ A;  3RVA A;  5CE6 A;  1WY2 A;  4QR8 A;  1WL6 A;  2V3X A;  2BWT A;  3L7G A;  4S01 A;  3L24 A;  5CNX A;  5CDV A;  3QOC A;  4EGE A;  2ZSG A;  5E5B A;  1JAW A;  3BIP A;  2BWU A;  4R60 A;  4ZWO A;  5CDE A;  2OKN A;  2BWS A;  3IG4 A;  1WL9 A;  2V3Y A;  2BWX A;  4RGZ 1;  3PEB A;  2BHA A;  2BHB A;  3OVK A;  1CHM A;  1WLR A;  4RZY A;  5CIK A;  1KP0 A;  3PN9 A;  4RZZ A;  3Q6D A;  4ZWP A;  3CB6 A;  1W7V A;  4PV4 A;  1W2M A;  2BWY A;  1N51 A;  4FKC A;  2BHD A;  3BIT A;  3BIQ A;  5FCF A;  4S00 A;  1PV9 A;  3O5V A;  2BHC A;  5CDL A;  4ZWU A;  1M35 A;  4B28 A;  3I7M A;  2BWW A;  2BH3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...