3IL0A

The crystal structure of the aminopeptidase p,xaa-pro aminopeptidase from streptococcus thermophilus
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
128
structure length
128
Chain Sequence
NAMQRRLERFDAKLVQSGLDALLVTGQNNIYYLTDFWGTNATVFITKNRRLFLTDSRYTLIAKQSVHGFDIIESKDPLKDIVKFVEVDKLETIGFDNQVSFAYYQALQAIFEGYTLSPQTNFMEELRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of the aminopeptidase P,XAA-pro aminopeptidase from Streptococcus thermophilus
rcsb
source organism Streptococcus thermophilus
molecule tags Hydrolase
molecule keywords Aminopeptidase P; XAA-pro aminopeptidase
total genus 40
structure length 128
sequence length 128
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01321 Creatinase_N Creatinase/Prolidase N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.350.10 Alpha Beta 3-Layer(aba) Sandwich Creatine Amidinohydrolase; Chain A, domain 1 Creatinase/prolidase N-terminal domain 3il0A00
2BHBA 3CB5A 4RGZ1 1WBQA 5FCHA 3CTZA 4PV4A 4ZWOA 2BWTA 4S01A 3IG4A 1WN1A 3OOOA 2HOWA 3BITA 4R60A 4S2TP 5CDVA 1WL9A 2BHCA 4QR8A 5E2CA 5CDEA 5CIKA 1W7VA 4S00A 4RZYA 4ZWUA 5CNXA 4ZWPA 3CB6A 3IL0A 4EGEA 1JAWA 3I7MA 4RZZA 2BWSA 1A16A 4ZNGA 4B28A 1PV9A 1KP0A 1W2MA 5CE6A 1N51A 2ZSGA 2BWUA 2V3ZA 2BHAA 3PN9A 1WLRA 3Q6DA 2BH3A 3BIPA 2IW2A 2OKNA 4S2RP 1CHMA 5CDLA 2BN7A 3L24A 1M35A 2BWWA 4FKCA 3RVAA 3L7GA 3QOCA 2BHDA 2BWVA 2V3XA 2BWXA 1WL6A 2BWYA 3PEBA 5FCFA 2V3YA 5E5BA 3O5VA 3BIQA 3OVKA 1WY2A
chains in the Genus database with same CATH superfamily
2BHBA 3CB5A 4RGZ1 1WBQA 5FCHA 3CTZA 4PV4A 4ZWOA 2BWTA 4S01A 3IG4A 1WN1A 3OOOA 2HOWA 3BITA 4R60A 4S2TP 5CDVA 1WL9A 2BHCA 4QR8A 5E2CA 5CDEA 5CIKA 1W7VA 4S00A 4RZYA 4ZWUA 5CNXA 4ZWPA 3CB6A 3IL0A 4EGEA 1JAWA 3I7MA 4RZZA 2BWSA 1A16A 4ZNGA 4B28A 1PV9A 1KP0A 1W2MA 5CE6A 1N51A 2ZSGA 2BWUA 2V3ZA 2BHAA 3PN9A 1WLRA 3Q6DA 2BH3A 3BIPA 2IW2A 2OKNA 4S2RP 1CHMA 5CDLA 2BN7A 3L24A 1M35A 2BWWA 4FKCA 3RVAA 3L7GA 3QOCA 2BHDA 2BWVA 2V3XA 2BWXA 1WL6A 2BWYA 3PEBA 5FCFA 2V3YA 5E5BA 3O5VA 3BIQA 3OVKA 1WY2A
chains in the Genus database with same CATH topology
2BHBA 3CB5A 4RGZ1 1WBQA 5FCHA 3CTZA 4PV4A 4ZWOA 2BWTA 4S01A 3IG4A 1WN1A 3OOOA 2HOWA 3BITA 4R60A 4S2TP 5CDVA 1WL9A 2BHCA 4QR8A 5E2CA 5CDEA 5CIKA 1W7VA 4S00A 4RZYA 4ZWUA 5CNXA 4ZWPA 3CB6A 3IL0A 4EGEA 1JAWA 3I7MA 4RZZA 2BWSA 1A16A 4ZNGA 4B28A 1PV9A 1KP0A 1W2MA 5CE6A 1N51A 2ZSGA 2BWUA 2V3ZA 2BHAA 3PN9A 1WLRA 3Q6DA 2BH3A 3BIPA 2IW2A 2OKNA 4S2RP 1CHMA 5CDLA 2BN7A 3L24A 1M35A 2BWWA 4FKCA 3RVAA 3L7GA 3QOCA 2BHDA 2BWVA 2V3XA 2BWXA 1WL6A 2BWYA 3PEBA 5FCFA 2V3YA 5E5BA 3O5VA 3BIQA 3OVKA 1WY2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2BHB A;  3CB5 A;  4RGZ 1;  1WBQ A;  5FCH A;  3CTZ A;  4PV4 A;  4ZWO A;  2BWT A;  4S01 A;  3IG4 A;  1WN1 A;  3OOO A;  2HOW A;  3BIT A;  4R60 A;  4S2T P;  5CDV A;  1WL9 A;  2BHC A;  4QR8 A;  5E2C A;  5CDE A;  5CIK A;  1W7V A;  4S00 A;  4RZY A;  4ZWU A;  5CNX A;  4ZWP A;  3CB6 A;  3IL0 A;  4EGE A;  1JAW A;  3I7M A;  4RZZ A;  2BWS A;  1A16 A;  4ZNG A;  4B28 A;  1PV9 A;  1KP0 A;  1W2M A;  5CE6 A;  1N51 A;  2ZSG A;  2BWU A;  2V3Z A;  2BHA A;  3PN9 A;  1WLR A;  3Q6D A;  2BH3 A;  3BIP A;  2IW2 A;  2OKN A;  4S2R P;  1CHM A;  5CDL A;  2BN7 A;  3L24 A;  1M35 A;  2BWW A;  4FKC A;  3RVA A;  3L7G A;  3QOC A;  2BHD A;  2BWV A;  2V3X A;  2BWX A;  1WL6 A;  2BWY A;  3PEB A;  5FCF A;  2V3Y A;  5E5B A;  3O5V A;  3BIQ A;  3OVK A;  1WY2 A; 
#chains in the Genus database with same CATH topology
 2BHB A;  3CB5 A;  4RGZ 1;  1WBQ A;  5FCH A;  3CTZ A;  4PV4 A;  4ZWO A;  2BWT A;  4S01 A;  3IG4 A;  1WN1 A;  3OOO A;  2HOW A;  3BIT A;  4R60 A;  4S2T P;  5CDV A;  1WL9 A;  2BHC A;  4QR8 A;  5E2C A;  5CDE A;  5CIK A;  1W7V A;  4S00 A;  4RZY A;  4ZWU A;  5CNX A;  4ZWP A;  3CB6 A;  3IL0 A;  4EGE A;  1JAW A;  3I7M A;  4RZZ A;  2BWS A;  1A16 A;  4ZNG A;  4B28 A;  1PV9 A;  1KP0 A;  1W2M A;  5CE6 A;  1N51 A;  2ZSG A;  2BWU A;  2V3Z A;  2BHA A;  3PN9 A;  1WLR A;  3Q6D A;  2BH3 A;  3BIP A;  2IW2 A;  2OKN A;  4S2R P;  1CHM A;  5CDL A;  2BN7 A;  3L24 A;  1M35 A;  2BWW A;  4FKC A;  3RVA A;  3L7G A;  3QOC A;  2BHD A;  2BWV A;  2V3X A;  2BWX A;  1WL6 A;  2BWY A;  3PEB A;  5FCF A;  2V3Y A;  5E5B A;  3O5V A;  3BIQ A;  3OVK A;  1WY2 A; 
#chains in the Genus database with same CATH homology
 2BHB A;  3CB5 A;  4RGZ 1;  1WBQ A;  5FCH A;  3CTZ A;  4PV4 A;  4ZWO A;  2BWT A;  4S01 A;  3IG4 A;  1WN1 A;  3OOO A;  2HOW A;  3BIT A;  4R60 A;  4S2T P;  5CDV A;  1WL9 A;  2BHC A;  4QR8 A;  5E2C A;  5CDE A;  5CIK A;  1W7V A;  4S00 A;  4RZY A;  4ZWU A;  5CNX A;  4ZWP A;  3CB6 A;  3IL0 A;  4EGE A;  1JAW A;  3I7M A;  4RZZ A;  2BWS A;  1A16 A;  4ZNG A;  4B28 A;  1PV9 A;  1KP0 A;  1W2M A;  5CE6 A;  1N51 A;  2ZSG A;  2BWU A;  2V3Z A;  2BHA A;  3PN9 A;  1WLR A;  3Q6D A;  2BH3 A;  3BIP A;  2IW2 A;  2OKN A;  4S2R P;  1CHM A;  5CDL A;  2BN7 A;  3L24 A;  1M35 A;  2BWW A;  4FKC A;  3RVA A;  3L7G A;  3QOC A;  2BHD A;  2BWV A;  2V3X A;  2BWX A;  1WL6 A;  2BWY A;  3PEB A;  5FCF A;  2V3Y A;  5E5B A;  3O5V A;  3BIQ A;  3OVK A;  1WY2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...