3IL8A

Crystal structure of interleukin 8: symbiosis of nmr and crystallography
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
68
structure length
68
Chain Sequence
LRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of interleukin 8: symbiosis of NMR and crystallography.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords INTERLEUKIN-8
total genus 14
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1990-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00048 IL8 Small cytokines (intecrine/chemokine), interleukin-8 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 3il8A00
1HHVA 1EQTA 2NZ1D 2L9HA 5D14A 1U4RA 5D65A 1RODA 4RAUC 4NW2A 1HUNA 1BO0A 2L1BA 4IUUA 1WTVA 1G91A 5EKIA 1RTNA 1WTOA 3DEOA 1CA5A 1XYIA 1PFBA 5COYA 1SSOA 1IKMA 1J9OA 1WTXA 3GV6A 2HCCA 1TVXA 1F9QA 1HFGA 5EQ0A 4R8IA 1WD0A 1JE4A 2JYOA 4ZLTF 1NCVA 4MHEA 1ZXTA 5JJZA 1PLFA 1AZPA 4MN3A 2EE1A 1NR4A 2L11A 2FJ2A 2KOLA 1KNEA 5T1GA 1JICA 4RWSC 2B2YC 1O80A 1MGSA 1F9SA 3I90A 1X32A 5CORA 2B2UC 2VXWA 4ZKCB 2HDMA 3HP3A 2K1BA 3DEPA 2Q8TA 1HA6A 1HRJA 3MTSA 3IL8A 2BDNA 1B3AA 1EIGA 4HSVA 1B50A 2KEEA 2KECA 4XT3B 5EJWA 2DY7A 2MP1A 3DM1A 1U4LA 1XX8A 3I8ZA 3N52A 1WTWA 5EPKA 1QNKA 2K04A 4IUVA 1WTPA 1S4ZA 2RVLA 4RA8A 2HUGA 2MJ8A 2B2TA 4HAEA 1NAPA 4X3SA 1WD1A 2CVRA 3MWYW 3LWEA 2MGSA 2NWGA 2B2VA 2N55A 4OIKA 5CBAE 2FINB 4X3KA 4CJ1B 5E4WC 3D6WA 2X69A 1QG7A 1M8AA 4QUCA 4X3UA 1J8IA 1U4MA 2N88A 4XDXA 2L12A 1E0BA 1VMPA 4XT1B 2DY8A 2KUMA 1ILQA 1F9RA 2H1EA 1ICWA 1RJTA 2FHTA 2B2WC 2RSOA 4ZAIA 1G6ZA 1MI2A 3FPUB 1X3QA 4HEDA 1GUWA 1ML0D 1PFNA 2X6LA 1EOTA 4CJ2C 3QO2A 1HFNA 3IFDA 5AFWA 2D9UA 5CMDA 1AZQA 5DNFA 1B53A 2X6GA 1HUMA 3H91A 1DOKA 1KNAA 4IUPA 4R9WA 1WTRA 1C8CA 2IL8A 1ILPA 2JP1A 3FDTA 2NYZD 1ESRA 1PDQA 2EOTA 2FMMA 4QUFA 2RA4A 2J7ZA 1PFMA 1O7YA 3ONAB 1SDFA 1O7ZA 3F2UA 1F2LA 4O42A 3TZDA 1VMCA 1Q3LA 1F9PA 2R3ZA 3GV3A 4X3TA 2XIWA 3SVMA 3Q6SA 2HCIA 1BBXC 2B2TC 2MPMA 1IL8A 1G2SA 4IURA 3KBXA 1CM9A 4CJ0B 3G7LA 1RTOA 1LV9A 4DN4M 2RSNA 3R93A 4HCSA 1MSHA 1B4OA 3KUPA 5EPJA 3P7JA 3I91A 3TN2A 1DONA 1BF4A 1DZ1A 2B2WA 1CA6A 4IUTA 4U68A 4ZKBB 2K03A 5T1IA 3I3CA 1QE6A 2L4NA 1IKLA 1BNZA 1DOLA 1MSGA 2Q8RE 4OIJA 4IUQA 4ZK9B 1WTQA 2FFKB 2HDLA 3UI2A 2B2YA 2EPBA 1U4PA 1RHPA 2KEDA 4UAIA 2KVMA 1B2TA 1G2TA 1EL0A 1DOMA 2B2UA 2K05A 5E4XA 2B2VC 5EPLA 1NR2A 2SDFA 4LMQD 1AP0A 5CBEE 2M2LA 2K28A 1WVLA 1EIHA 1SAPA 2K01A 1X3PA 1A15A
chains in the Genus database with same CATH superfamily
5I6WA 2NZ1D 4Y52H 4NW2A 4X66Q 5M5XB 4DF7A 1FGUA 4NXMQ 2UXDQ 3R8BA 1CA5A 4LFAL 1SSOA 1VQ5A 1JE4A 3PF4A 1ZEQX 5FJ8H 4DAVA 2WKDA 1K8OA 2FJ2A 2Q2IA 4JI1L 2E2IB 4RWSC 2IWHA 4HTHA 2VUMB 1ZYRD 3GDEA 3MXUA 5I9OA 4A3KH 4ZUJA 1KLUD 4OXPA 4AYBE 4A3MG 1STBA 2F0MA 1FGBD 1QNKA 3FHWA 3NK9A 2F0FA 2IT1A 4PV1C 1WD1A 2A6EC 4A3MB 1F2YA 4L5QA 3F2DA 3GTLB 1CKNA 3OMGA 3AEVA 1MKHA 5IP7H 5LMNL 1QG7A 4F7XA 1S5CD 2QKIC 2WIIB 4CDCC 1U4MA 2N88A 3NBHB 4HSPA 4RGNA 5CYUA 4G57A 5BN5A 1JWSD 2HQLA 3L7ZC 3M3YH 1MJEA 2B2WC 2RSOA 2PMZB 1TY2A 5TSSA 3HOWB 5CMDA 3S1QH 5BN4A 2NVQB 3MXGA 1S5FD 1F2MA 1LABA 2EVBA 1H9SA 2B8GA 3H6MA 1K9MC 1WCMG 2J7ZA 3IKJA 5JJLA 3CCVA 3T56B 4DV5L 1JB7A 4R8NA 3F2UA 3RZDH 2F0UA 4GN3B 3GQBA 1JORA 4X64Q 3U50C 1BR9A 1Y1WH 1BCPD 5ELBA 3HKZG 3VYUA 4A3GB 2A74C 3KYHC 4IUNA 5DEHA 5C3WA 3T1YL 2YTYA 2PCFB 2K5WA 1BF4A 2RCNA 1JC7A 1Z7TA 2M9VA 1EEFD 4APVA 4U68A 4FYDA 3S2HH 3MHBA 4LUVA 1TWAB 4DUZQ 4ZK9B 1TWGB 4R4IA 1SXTA 2VNUD 2NBFA 2F03A 2RKSA 1KABA 4JK1C 2K05A 1B9MA 1SYDA 4JOIC 4JYAL 2QEJC 4A3KG 4OO1H 3T4AC 1SAPA 1Y1VG 2NVYB 4PMCA 4LFCQ 1YHBA 3TREA 4M1UB 5IT9c 4P75A 2UXCQ 1HUNA 4MTNA 4ILWA 5FJ8G 4HJ9A 2WP8J 1PZKD 3VR2A 1SE8A 3RN5A 1TWCB 3TP7A 4FNFA 2NN6I 2KCMA 2RHQB 1GUNA 3Q24A 4FF2A 1UE5A 3SHLA 2VS1A 4JYAQ 5HURA 4H02A 3HP3A 1I6HB 5M5YH 3GTKH 1HH2P 1ENFA 2AWOA 3IL8A 1PTOB 1B3AA 4FO2A 4C3JH 4LUOA 5IODA 2UUAQ 3FEWX 5IGFA 3PIOA 2F0PA 2QGQA 2XRQD 3GTGB 2RQXA 4OEMB 2R93G 2SNSA 3EROA 4N8FA 1SYGA 1AH9A 4HAEA 1X3GA 4UHVA 1FVIA 5DM63 4LF6Q 2B39A 4CJ1B 2AUJD 4GZYC 1EY8A 4IFDH 4K8IA 3A7LA 3TRZA 1M8AA 2JXMB 3S1NB 4G7OC 1BBWA 3DLLA 2AHOB 2E5LQ 1S5DD 2UUCQ 1QB5D 5C0XH 3RNUA 2E2JH 2JA6B 1BCPC 4DV4L 4JI8Q 2KHJA 4FF4A 3F1ZA 2TSSA 3DWQA 1WTRA 2IL8A 1TWFB 5G3LF 5GAEC 1WFQA 2NYZD 3K5LA 1I50H 3JAME 1N36Q 3H3VI 4JI1Q 1LLRD 2RF4A 1IBKQ 3GV3A 1E24A 1L0XB 2XIWA 3UDFA 1HNWL 1CFMA 4KN7C 2VY3A 2GN5A 4K0KL 2K7VA 2UUAL 2ZXRA 4LNQA 1CQVA 1PRTB 1VQPA 4KLKA 4HCEA 1SYEA 3BDCA 2K03A 2P5ZX 3HOUB 3IFTA 2Q8RE 4K2KA 3ICEA 2Z4IA 2B2YA 2EPBA 2YU9H 1U4PA 4EX5A 3Q8DA 1G2TA 1YVCA 4DV1L 1K0SA 4L5SA 1YITA 1X3PA 2H5XA 1PH8A 1VQKA 1GD7A 4OWTB 3VYRA 5D65A 1M1KC 2MUYA 4MNOA 2A6HC 2ZTCA 1EQQA 3BG3A 3S14B 4JI4Q 2LS01 2CWAA 4RHSA 3VA5A 1LT4D 1VQAA 1PZJD 2JA8G 4R8IA 1VDZA 1V1PA 1C9OA 4NMZA 5JJZA 1ZXTA 4LW1A 4QF4A 3PCOB 4OO1I 2O2LD 3R2TA 4XQJA 4YIJA 2R7ZH 2MHVA 3EFXD 3KJPA 2ZM6Q 3BVGA 3OW2A 4OELB 2HDMA 4A3CG 3C46A 1Q90A 2Y0SB 3HRZC 5FOBB 1UEAB 1EU3A 3R2IA 3T1YQ 3I2ZA 1N32Q 1TWAH 4O2DA 2JE6I 1QOHA 1I94Q 4DGZA 1CQFA 1EU4A 2EXDA 1IYJB 3RD4A 3D6WA 1KL9A 1TT2A 3Q23A 1H9JA 4UDUC 3OSOA 4H7BA 4ME3A 5C0XG 1XXGA 3S1MH 2OT2A 1ICWA 2F4VL 4BBSG 1MI2A 2EYPA 2F0IA 1XNRL 1EOTA 3TZUA 1B7YB 3S15H 1PYWD 1KIXA 1W6JA 3S14H 1UEBA 1D7QA 3F2CA 1BXTA 1ESRA 5KRUA 2JJQA 2G9HD 4DV1Q 1D1IA 1EY9A 1F9PA 2VB2X 5CV6A 2BE5D 1VQCA 4LF9Q 4RG1A 3UDGA 1WJJA 2CWPA 3ZYYX 1LTAD 2XSCA 3CQZH 3DWPA 1B4OA 1E2ZA 2QILA 4JVZA 3K0YA 2R92G 5LHY1 3BVZA 1NNXA 2BH8A 1WTQA 2AQ3B 3UI2A 2EY1A 1LTRD 5IP9G 2A69C 5M3MG 3K7AH 3CMEA 4DK1A 1O78A 4BA2I 1YHQA 1VQIA 1XPUA 2WFWA 2F0WA 1V8QA 2JSOA 2SEBD 4BY7G 3ERSX 3SR1A 1BO0A 2L1BA 3CPFA 1AE3A 2Z6KA 1WTVA 4FXDA 2PNHA 1Y1VH 1R9TH 1NTGA 2DJFC 3OIPA 1IZ6A 2EXZA 1Y8OB 4L6TB 1Y8NB 5M5XH 2JYOA 1VQ6A 1EY5A 3H0GG 4C2MB 4LFBL 4YCUA 1N8RC 3UE0A 4DR5Q 4B3SQ 1FNWA 4DUYQ 4IALA 4DR2L 1EYDA 2L55A 1FJGQ 4RMFA 2KHIA 3OHXC 1SYFA 4ZUIA 5KYIA 4IFDI 4HIDA 2BCOA 5ELOA 3J81i 2RDGA 3HOVG 1D2BA 1WCMH 2AMCB 2NZHA 4RGTA 2OTLA 5K5PA 3EQLC 2Q2UA 1NUCA 1SE4A 4K5VA 1PTOC 3S2DB 1X56A 3NQTA 3E3XA 1Y69U 1W3SA 1SRUA 3PO2H 2PQAB 3DUZA 2EY5A 4HJAA 1Q12A 1CHQD 1ML0D 1ASYA 1VF5C 1KAWA 3S1RB 4K14A 3QG1A 3U4VA 3QR8A 3U9SA 5JPMC 1R4PB 3CPWA 3NPPA 5J39A 3JAMi 1TIID 4DV3L 2NVTB 1AW7A 3RZOH 2F3IA 1G2SA 2F0JA 1PH9A 1RL2A 1LV9A 4A3BB 1PH5A 2IX3A 1X65A 2QDLA 4JI7L 4WJWA 4E6IA 2VQEL 1P16A 3HKSA 3MXNB 1PH1A 4TKOB 3HOXH 4K5XA 3HG9A 1GJXA 1Y1WB 4RH6A 1MSGA 5IYBG 2Z9HA 4IQZA 1Q8KA 1RHPA 3BVMA 1L1OC 2KVMA 2F0OA 2XGTA 2PPBC 4LFBQ 1NR2A 5IGEA 5IOCA 4GNXA 3GTQH 4U673 5C44G 1L1OB 3S17B 2C9OA 5D14A 2K33A 1CKNB 5LMUL 2OEOA 4RAUC 3TEHB 4A3JG 3EIVA 1SE3A 1EQRA 3HOVH 2CFMA 2F4IA 4A3BH 2DN8A 2BA0A 1TS5A 5M3FG 1VQ9A 3PIP3 1YNNC 1SMYC 5EKLA 1WTXA 1V1OA 3L2PA 3JC66 4B9XA 3PIO3 3L9AX 1DGSA 5ELNA 2QA4A 2AWNA 3PF5A 1ASZA 4TSSA 1TQOA 1Z47A 3DWAA 1T9HA 3FKIH 3C1EA 4Y7NH 1STYA 3H0GH 2K1BA 3CC2A 2ZTEA 4KHPL 1B1ZA 3RN2A 1PTOD 3CF5A 3D4RA 1SMXA 4JI8L 5EJWA 1V1QA 1Q1BA 3N52A 2VUMH 2V4DA 1L0YB 1WTPA 4LAAA 2C5CA 2FINB 3E5SA 4GLAC 2SNMA 4OHJA 3I4MG 2NVYH 2N3SA 1KRSA 2G9DA 5IP9H 1YI2A 4HEDA 2F3WA 4C3JG 3QO2A 3F8TA 3K5NA 3OWFA 4ZCKA 2UXDL 1HTLD 1AN8A 1VS0A 2KENA 1QUQA 4I7ZC 4LFAQ 3M4OB 1A63A 2BDOA 2JK8A 4L5RC 4P73A 1PFMA 1PZID 2OTJA 1UE1A 1KRTA 2E2HH 1HQMC 4A3LH 1JOOA 2A73B 2GVAA 4DNTB 3M4OH 4M8AA 1CM9A 2JQOA 5AJ3Q 2E2HB 2Q8IB 3K80C 3TDQA 1YIJA 3HFZB 5CR3A 5J1ZA 3CP0A 4BY1B 4OIJA 3PV0A 3TMEA 2HDLA 4BBSH 1CTMA 1CUKA 2B2UA 3EJIA 3M85A 4IPHA 2K28A 3FPPA 1STGA 1L1OA 3T51B 1MIUA 1JE5A 4JG2A 1K83B 1PXUA 3NXWA 2HCCA 3CRLC 3K0XA 4L63B 1X3FA 5C3XA 1AZPA 3A8KE 4C3HH 3A54A 4KHVA 4JI3Q 4KHZA 2YTVA 2ZXPA 2EYMA 3K58A 2VQFQ 1PH3A 3HGBA 2K5DA 4DV7Q 4A3DG 3M4QA 2RBMA 1IBML 3DEPA 2BE5C 1GXDC 2I5HA 3VA7A 2UUBQ 1Q81C 2MP1A 3G71A 2K04A 4N9TA 1S4ZA 2K52A 2HUGA 4X62Q 3PUZA 4GLVB 4XYOA 4JOIA 4EQOA 3RLNA 2BOSA 1X6OA 4KMUC 1DD2A 4B3TL 1EYAA 5AJ3L 2NVQH 4XT1B 1V43A 3S17H 5LMUQ 4ZAIA 4I7AA 2FXQA 3FPUB 3TS0A 1ET6A 4YHHQ 1YHAA 2ZJQA 2X6LA 5FLXE 4PZ7A 2EJGC 1VQ8A 2JA8B 3CCQA 1QWYA 1E2VA 1PH4A 4QB4A 2NVTH 4H0LC 1PDQA 1DXMA 4IOAA 2F0GA 3URYA 3GTGH 1AEXA 3ONAB 4MTKA 1O7ZA 2KCTA 3CC4A 2R3ZA 2I5LX 5IYCG 3CRKC 3D0FA 4HMIA 1JQYD 5FK9C 4G4KA 3GTKB 4J6HA 1V9PA 4HCSA 5KYLA 1TWHB 1FNVA 3VR5A 2R6GA 2WACA 1X54A 3LX0A 4XXEA 1IBLQ 3CHBD 2Z6KC 5FO9B 3A8IE 4LK1C 3K81C 1XWEA 4WJ4A 1UWVA 1D5MC 1E1TA 2DUDA 4N8X1 4K6LA 2M2LA 1PRTF 5C4JB 4KY6A 3G4SA 1FL0A 1D5ZC 3GTMH 5BR8L 4JI2L 2RDFA 3BYYB 4EGVA 1RTNA 2F0HA 4YWMA 4NPSA 4A3FB 4A3DB 5FKAC 3VR6A 1TVXA 3J7AF 2EYOA 4PMBA 3S2HB 3DXJC 5I6YA 3E6ZX 1TY0A 3M4YA 3TP8A 1F9SA 2A68C 3EBEA 3KJOA 2L5TA 5C4XH 4LF5L 1HNWQ 2F0KA 1EIFA 2Q8TA 2PMZE 1SJED 2AQ2B 1EIGA 2BDNA 1I6VC 1ENCA 1D6EC 2KEEA 3VR4A 3ZJYC 2Z8LA 4AH6A 3S1NH 2PNRC 1S5BD 1U0LA 2NN6H 2CVRA 1IW7C 3HOYH 3A8JE 1FD7D 2JN4A 1VQLA 1ESFA 5L37A 5EBCA 4QUCA 3K5MA 3C2PA 2D5DA 3NTHA 1TXYA 1KD1C 3FRPB 3GTLH 3UDIA 4YWLA 1SR3A 2NZOA 5C6AA 4JI4L 2HQEA 4F88A 2JP1A 1T5EA 4KD3A 2ZJRA 4GN4B 2VZAA 1GUGA 2VB3X 4UP9A 3D4DA 2LXJA 2I07B 3S1RH 4A3JB 1Q3LA 1Y1WG 4Q0FA 4LF5Q 5I2YA 2EIFA 3G7LA 1PH6A 4A3KB 4FDBA 5C0XI 2PO4A 3DHQA 2UUBL 2JA9A 2DJGC 1I4QA 2EYJA 4ZKBB 1IW7D 3I3CA 2CW0D 1O7LA 3AB9A 3KDFB 3SK6A 3GP7A 3TP5A 2EY2A 4JV5L 4CHTB 4DK3C 3HOYB 3F2BA 2RCFA 4HIOA 3AQQA 5LMNQ 3EVQA 2GA4B 3X3MA 3BDLA 1I4XA 3S1MB 2K5QA 1UAPA 2CH4W 5A2QL 2L9HA 2Z1CA 3A0JA 4A75A 3D3RA 2CKZB 2L15A 3R3OA 4FVMA 2O4XA 1CSPA 3K5OA 3BZDB 2AQ1B 2XWBB 1IKMA 3OOCA 2R7ZB 1XMOQ 4JI6L 3BYTB 2EE1A 4GOPC 2MO1A 1XMQL 1K0RA 1MGSA 1EY6A 3HKZE 3M7GA 4DV6L 5GAGC 1X55A 4FF1A 1FNUA 4KY7A 3LWUA 3MTSA 4C56C 4HSVA 4WRDA 3CCUA 2D0PA 2DY7A 3DM1A 1U4LA 3A55A 1IBLL 1JB3A 4OWWB 4A3LG 3SK4A 1U9RA 3VYTA 3OWEB 2EZVA 5HGQA 4JBKA 4QCLA 3MFYA 1M4VA 1IYUA 4GKKQ 1YJWA 1GVPA 2VQFL 1TS4A 3I4OA 1B8AA 3CQZB 3DMUA 1SNDA 4DU9A 4K0KQ 1DM0B 3H0GB 3NWTA 4YY3Q 4JI2Q 1G291 5BR8Q 2QEXA 1Z9FA 1K8GA 4BY7B 4BA1I 4DV2Q 4DPGA 4DAPA 2JA7B 2X6GA 3H91A 4R9WA 5A35A 5C4XG 4EQNA 4A76A 2ASBA 5D3IB 2Z4HA 4O42A 4H44C 4BBRH 3NBIA 4R4QA 1TWFH 4Y7NB 1BCPB 4BBRG 4I65A 1IL8A 2K6AA 3KF6B 4GOPA 4CJ0B 4DV0Q 3H3VH 4KHPQ 1G51A 3L0OA 1N33Q 3U9OA 5M3MB 2PW5A 2ALYB 1F2ZA 1YJ9A 2YV5A 1EIYB 3KBGA 3KLSA 5IGGA 2F1MA 3ULPA 3STBD 4LF6L 3CCLA 1SNQA 4A3IG 3QB3A 3TP6A 5H1SE 5E4XA 1XMQQ 5M3FH 1EIHA 5CBEE 3FP9A 5FO8B 3W1GA 4QL5A 1GUTA 3MXNA 4DAMA 2UUCL 4J15A 3K7AB 1BKBA 1L0WA 4RCNA 1F77A 2WV6D 4ODGA 1HPCA 1CZWA 4B08A 1PFBA 4RGOS 4X62L 4JI0L 4G7ZC 1JJGA 4DR1L 1OO9B 3J81E 1E1OA 3L3OC 5IYCH 1QVFA 1VQBA 4DXFA 4ZLTF 1VQ7A 1PLFA 1NR4A 2RHSB 4WFN3 1QUQB 2I46A 3PUYA 2K5HA 1K3RA 3W5OA 5FLXL 3I7FA 4GS3A 4DNIA 4C3HB 2F4VQ 2A19A 1HRJA 1OXUA 4DR6L 3A5UA 2LFNA 3A5ZB 4P72A 5I4DA 2YU9B 3MWYW 3S16B 5GROA 1NJIC 1GOZA 5FO7B 1VQDA 3PO2B 3RMHA 2IHEA 4F8MA 1A3UA 3J7YW 1LACA 1J8IA 4RGMA 2PI2A 4DR5L 1HZCA 3MXPA 2E76C 4X66L 1MJCA 1LUZA 1EFWA 1VQGA 5AFWA 3CCSA 4A3EG 2OWOA 1B53A 3PSIA 1NMGA 4DUZL 1XMOL 4DKAC 1ILPA 4A3EH 2RA4A 4DFAA 1TR5A 4IPGA 5IIFA 4FXGC 1F2LA 5JEAJ 1PH2A 1IXRA 1SNOA 3Q6SA 2D2CC 2D0OA 1MHWC 2MPMA 4C1NI 1H95A 1TKWB 3J7ZC 5EBDA 4YWKA 1DONA 2O5IC 1RF2D 4JBMA 4IUTA 3J7A5 4IZ8A 1HR0W 3TBIB 3S1QB 2LMCB 2F0DA 2YTXA 1D8LA 4B3RL 2N8NA 3MVVA 1VQMA 2KEDA 2B29A 3J80L 4OWXB 4A3MH 2B2VC 1QZGA 1WVLA 2LY7A 5JVG3 3AU7A 3JAML 2OQ0A 1QVGA 3I72A 4BY7H 5JJIA 5JOBA 1G91A 1QVCA 1EOVA 3HOZB 3DEOA 4DA2A 5M9OA 3V2TA 2JA7H 3T13A 1JCKB 2UU9L 1N36L 1D5XC 2PQAA 3HOZH 2CCZA 2J0TD 1P8LA 2KOLA 3K59A 1KNEA 2R92H 4HIKA 2A6HD 3AFPA 3ND9A 4NKLA 3G6JB 4PZ8A 4DV0L 4LF9L 4X6AH 3OTOL 2DGYA 5DLQE 4IOCA 2OF1A 4BXXH 3J81L 1MBYA 1S72A 1YNJD 2KQ3A 2EDGA 4DXGA 5HGTA 4YCWA 1JMCA 1A3TA 1ZYRC 5EPKA 2ID0A 3I4MH 2B2TA 4OL7A 5D3DA 1UUPA 3OMCA 3BS1A 1NE3A 1TWGH 2NWGA 1H9SB 3MZ5A 5J22A 4A4IA 4CBVA 2A8VA 1JJCB 4HN7A 3PUXA 4C3IH 1OXXK 3HOUG 2N78A 3K8AA 2MO0A 2LKVA 1PVOA 1ILQA 2UXCL 1Q82C 1RJTA 2FHTA 3K6OA 4NXNL 4NP5A 4JPBW 4R4CA 3JAMc 4OGQC 3GTOH 4HR7B 2I5MX 2DNEA 1LTID 1VQHA 1E22A 3RLFA 4B3RQ 1PFSA 3BDOA 3CXCA 2KCCA 4XTCS 1HXYD 1SDFA 2QCPX 2XNAC 2E74C 1C7YA 2RDHA 4V190 4KK7A 4DUYL 5C44B 4B3SL 1H9KA 5IYDG 2EYHA 1Q7YC 4A3CH 1SE2A 2JA6G 1MSHA 1A0IA 1OXVA 4QGUA 1M90C 3I4MB 5LMNW 1QE6A 1BNZA 1DOLA 1KDAA 1E7ZA 3SE0A 4IUQA 1RDPD 2EYLA 3J81c 2ZXOA 2NTTA 2KBNA 1SNCA 1VQNA 1B3QA 3S24A 2ZJPA 3U4ZA 4A3GG 5IYBH 2JEAI 1SYCA 1TS3A 1JT8A 2J4XA 1PMRA 2CQOA 3T1HQ 3GTPH 3PUWA 4AYBG 3NUCA 1OTCA 1GUSA 1WCMB 2A68D 2F0EA 1EZ6A 3WDNA 1JR0D 4PZ6A 4P2CB 3IAYA 3GV6A 3NEMA 1HFGA 4X65L 1I50B 4O1NA 4LJZC 2PQEA 3CD6A 3CCJA 5JJKA 2QW7A 4ZYSA 2PYKA 3HOVB 3MEHA 1OXTA 5C3EH 3VR3A 1C48A 1LTTD 3I90A 3NELA 4JW0A 2MNAA 1XJVA 2E5LL 4DR7Q 5IYDH 4YY3L 3K7UC 5IGCA 4B3MQ 2V1CC 4UPAA 1WTWA 1XX8A 1ONLA 5C3EB 4GOPB 4TQUS 2KA7A 2MJ8A 3E0EA 3I70A 2WAQB 5EKKA 1B44D 2LSSA 3EN2A 2CW0C 1ET9A 2ZT9C 4PNYA 3V96A 2XVSA 5CBAE 3HOWH 1LTGD 4GLXA 4WORA 2X69A 2EJFC 5KNBA 4POGA 1KTKA 1JWMD 4DV7L 1QZHA 1RKNA 2PZWA 3NSWA 4AYBB 3K57A 3MA2B 2C35B 1I6HH 1BOSA 2F0QA 5K36H 3WWVA 1LT5D 4A3FH 1H9MA 1DOKA 4FXKC 1SJHD 2EOTA 1MD2D 3W3AA 2NTSA 2PI2E 3B6YA 4BS9A 1VQEA 4QIWE 1I4RA 2JA5H 4KJNA 2HCIA 3O13A 4LWCA 4ULLA 2KHSA 2EYFA 1EFID 1EY0A 2QF7A 1RTOA 4DN4M 3NTIA 3SEBA 1PRTD 3P7JA 5KEEA 3S9WA 1VQJA 1TWCH 2PW7A 4JBWA 3HS0C 2MQHA 5ISRA 3ER0A 4GN5A 2NN6G 3HOZG 2EJMA 1B2TA 1EL0A 1BBUA 1AP0A 2SDFA 3PUVA 3EA6A 2ZM6L 1NY4A 2K01A 4CDEC 1SFOH 3NE5B 4ALPA 1U4RA 2UXBL 1KDCA 2F3VA 4XQNA 1LT6D 1XNRQ 1HA5A 4NXNQ 4C2MH 3KDFA 3G48A 4QY7A 5CC4A 2VUMG 1OXSC 2B3GA 3WOEA 3GTOB 5IGDA 2EY6A 2JA5G 2OXPA 4C1NK 3D31A 1DCZA 4TRDA 4A93G 2KCNA 3CMAA 3FKIG 1X9NA 4B3TQ 1C4QA 1HZ9A 4KY5A 2B2UC 2CHBD 5CV5A 4IJLA 4A3FG 2LXKA 5K36G 4DR3L 1FYCA 3J81j 3QJYA 3RUZA 4K2LA 1YNXA 2KECA 3NHHA 1XPRA 5IT9L 2JEBI 2SOBA 3LNNA 3HOXB 4DK6C 3FMCA 3D4WA 4B9WA 1NAPA 4KTAA 1JWUD 1VF7A 3IRBA 1DYQA 4PMWA 1JJ2A 4A3JH 3ULJA 1A62A 1ENAA 2YYZA 4OX9L 4DV5Q 3E9HA 3OW7A 1NBWA 1EEID 5DAUA 1S40A 3Q0AA 2R92B 2UXBQ 3T1HL 2OQKA 1XTCD 2E2DC 1EUJA 3C3LA 4ID6A 5C4ZA 1PFNA 3AMUA 3J80E 1GKHA 1XTDA 3HOXG 5DNFA 3H09A 3GD7A 3I4LA 3I56A 1PYSB 4UP7A 1QCBD 2FMMA 4JI6Q 2B63G 3S15B 5C5LA 1DJRD 3CCMA 4BWGB 2HD3A 1CHPD 4KD4A 4LFCL 1YEZA 2XN9C 2F0NA 2B2TC 2NVXB 4XYQA 4DR3Q 1HR0Q 4ME5A 2HHHL 2B63H 3D6CA 1KDBA 3SDZA 3HEJA 5EPJA 4BBSB 3PGZA 4ZRZA 3TN2A 4B3ML 2B2WA 3KF8A 1K8AC 1CA6A 1JOQA 3ITPA 4BY1G 1IKLA 4PQXA 4IFDJ 3J7AV 1VQFA 1BCPF 3T53B 3PO2G 1S5ED 1Q46A 3ND8A 2BA1A 5EPLA 3STBC 4LMQD 4Z9CB 1II3A 3VDYA 1HCZA 1A15A 4GKKL 4TVAB 5M5WB 1HJPA 4A3DH 1BDOA 4EVOA 1Z6HA 4L8JA 4NB3A 1LTSD 1RODA 5GAHC 1S3OA 1A6XA 1D1KA 3G6EA 2EQSA 4IUUA 5CV9A 4YHHL 2B63B 4C3HG 2Y0SG 5E3FA 2A1AA 1K28A 5C4HA 1GM5A 1C0AA 4A3IH 3UDXA 2O5JC 1UE6A 2Q2TA 1N34Q 4POFA 1PTOH 4C3JB 1NCVA 3KFUA 1CZGA 4XIGS 5JEAH 3E9IA 1STHA 3SK8A 1QILA 3T16A 1JICA 1SBBB 4GNXC 3C1FA 2IX0A 3NP8A 4KKTA 1X32A 1LTBD 3H94A 2WB1G 4A93H 2HIVA 1TWHH 3P75A 4J8QA 3NBHA 2R61A 2A5HA 1J5EQ 3I8ZA 3NQIA 3TQYA 3M7NA 5CGKA 3FKIB 4ABNA 4C3IG 2R7FA 1HZBA 4OIKA 3CCEA 1KLGD 4A3IB 4RKLA 1YBYA 2L12A 3W1BA 2DY8A 2HHHQ 4KI0A 2ZTDA 4DR7L 2NUCA 3BZCA 1GUWA 4CJ2C 5ELCA 1EYGA 4LF8L 1HZAA 1A2UA 3A56A 4IUPA 2NB0A 5M3FB 1EZ8A 1TS2A 3I55A 1HNZL 1IYVA 1G6PA 1AE2A 3A7AB 1PHJA 3M9BA 1Y1VB 1SROA 1R9TB 2JA7G 5ELFA 1KHIA 2RSNA 1I4GA 3U58A 5JVH3 3I91A 1BVSA 3DM3A 1ZKOA 4BBRB 5T1IA 3D8GA 2A6ED 2FFKB 4L5TA 3PQIA 4EQPA 4UAIA 3ERQA 4R4TA 5NUCA 1LT3D 5C4XB 4RKBA 2PZUA 2OCEA 4DR4L 1VCIA 3HKZB 1VQ4A 1EQTA 3HOWG 4AIMA 3I4NG 1KQSA 4LF7Q 3RZOB 4ZQ3A 5HY6A 4K5WA 4G7HC 3UE1A 2FMCA 1N32L 5EKIA 5JEAG 2L0CA 4DAYB 2KJXA 4LUZA 1I94L 2CH4A 2IPKD 4AQYL 4V0BA 1PTOF 1GO3E 5GADC 2TMPA 1F9QA 3S2DH 5EQ0A 1WD0A 1WYDA 2WINB 1KAAA 4UY8C 1YNND 4QMGA 4A3BG 2K75A 3MC0B 5IE8A 3FVQA 2ENBA 2B2YC 4K6DA 2R7ZG 4RCOA 5C3EG 5CORA 4HJ8A 2VXWA 1SN8A 1LO5D 4ZKCB 1GHKA 3QIAA 3E0JA 5C44H 4RHRA 2XRSD 3ULLA 2WKCA 1BQQT 1CKOA 5IY0A 1QJOA 2BH2A 4KKUA 3HZXA 2WAQG 1Y14B 4LF4Q 1PYBA 2RVLA 4AQYQ 5CV8A 4BY1H 3LWEA 4DNRB 2B2VA 5IP7G 2VW9A 4X3KA 1SEBD 1N9WA 4JV5Q 3SXHA 1LM0A 3RR5A 4O0AA 2B8FA 1YNJC 4X3UA 1LTLA 4HIMA 4A3GH 1NMFA 5M5WH 5F2DA 4LF7L 1F9RA 1IBMQ 1LYLA 4HMJA 4QJFA 1WOCA 4DR6Q 4KKSA 4K8JA 2WAQE 4C3IB 3IFDA 1HFNA 2D9UA 1W6KA 1XNQL 5CV7A 1QNUA 3RZDB 4NDXA 1HUMA 1G6ZA 3HOYG 2JA6H 2F0VA 4R1JA 5JAVA 1I4PA 1O7YA 2N49A 2UU9Q 1I3QH 4OONA 1STAA 2AKWB 2WB1B 3S16H 1STNA 5E1FA 2ES2A 3I4NB 2E75C 5E7NA 1VQOA 4DV6Q 5KNCA 1BBXC 4IURA 3Q22A 1YZ6A 1KXLA 2HIXA 3KBXA 4CKEA 4MIUA 3OTOQ 3PO3B 4JI5L 3R93A 4NXML 2CQAA 1J5EL 2VL6A 3J80c 3MAQA 1XNQQ 4RFBA 1U5KA 5IWAQ 4DK0A 4IN3A 4QIWB 1SNMA 2XWJB 3AYHB 2PZTA 3GTPB 5M5YB 2ICIA 3HOUH 1T5XD 1R4QB 5IT9E 4CKCA 2E8GA 3CC7A 5EAYA 3CKIB 1SYBA 3PO3H 2R93H 2VQEQ 3TSSA 4DV4Q 1XYIA 3X3NA 5COYA 2E2IH 1STEA 1J9OA 2H4OA 4DAYA 4CDFC 3OYYA 2WB1E 1K83H 3SK5A 4BXXG 1HNZQ 4OX9Q 5DM73 1I3QB 3NENA 4MN3A 1A8VA 3QOJA 2L11A 2AUKA 3J80i 1O80A 5LL6X 1E3PA 2IHFA 1JOKA 3NTKA 5C5MA 3LGJA 4JI5Q 1CK1A 2K50A 2Z0SA 1B50A 5M3MH 3PMFA 3WOFA 4GNXB 1K3BC 5A2QE 1I4HA 4A3EB 4IUVA 1EY7A 2QDBA 3KK7A 4IJHA 1HNXL 4X3SA 1IL2A 2K4KA 1N34L 2K5NA 5E4WC 4DV3Q 4IPCA 5I9PA 4X64L 3GO5A 4DR4Q 1B70B 4OO1G 4XDXA 3H15A 1HR0L 1E0BA 1VMPA 5EGTA 4HJ7A 3GTMB 3P1HA 5FLMH 1A3VA 1UE7A 2IJ0A 5FLXc 1IHZA 3GTJH 2IW3A 4CDDC 1KNAA 4JI0Q 3FDTA 1HNXQ 4S3SA 4QUFA 5ELDA 1KC8C 1SMYD 1CKMA 1K73C 3H3VC 3M3YB 3QWNA 2ICEC 1EWIA 4CKBA 5C4JH 3KOJA 1Q1EA 4IPDA 4PG3A 3SVMA 1GUOA 1EWCA 1PRTC 1CSQA 1UNSA 3KLWA 2Z6BA 1SLJA 5KNDA 1FJGL 3OPOA 2F0LA 3P20A 5LL6S 4XQQA 1EQVA 3TS2A 4R4OA 1BUVT 2I0QA 2K5VA 4LF8Q 5KGUA 3VYSA 2L4NA 4WJ3M 3GTJB 2DNCA 5C0XJ 1Y8PB 1Q86C 3KF6A 3CAMA 1IBKL 1J6QA 1B9NA 4H13C 1HHVA 4YCVA 4FF3A 4GKJL 1CT1D 3I4NH 5BN3A 1N33L 1RD9D 2E2JB 1RIPA 3GTQB 3V05A 3I73A 1WTOA 2Y0SE 4KJOA 2A69D 3KLRA 1PH7A 2JA8H 1PA6A 3PIPA 4JCVE 1YJNA 3BU2A 4MHEA 1WI5A 3KLSX 3BJUA 3CW2C 3CCRA 5T1GA 1W2BA 1PV4A 5ELEA 3MFGA 1EWHA 1AFPA 2NVXH 5IGBA 4HJ5A 5G3LD 4QQBX 2G5DA 1ICFB 1O7IA 1HA6A 1GHJA 2GVBA 4MZ9A 4JI7Q 2K14A 4UP8A 1SFOB 4XT3B 3N6RA 1L2FA 5FLMG 1G8ZD 2M00A 3AFQA 4RA8A 3M4PA 5IWAL 2R93B 2MFIA 4JC0A 4Q5VA 1K8MA 4KN4C 1I5FA 4X65Q 2MGSA 2N55A 3KF8B 4KV6A 1HQRD 1HTPA 1WTHA 4JI3L 3SGIA 1EYCA 4GKJQ 2R7DA 3MEFA 2ATWA 2KUMA 2F0TA 2H1EA 3A74A 5CV4A 4A93B 3QOLA 1V1PB 1X3QA 1X3EA 4JBJA 2IX1A 3NWSA 2JA5B 5JPNC 4P74A 1AZQA 1TU2B 2F52A 1CI3M 5KIXA 1EY4A 1C8CA 4LF4L 3W2DA 4CGYB 1RCVD 5J3BA 4IO9A 1NSNS 2HT1A 2Q2HA 2D62A 4EQ5A 3TZDA 5I2XA 1VMCA 4X3TA 2F0SA 1A2TA 4N9PA 4J1MA 1Q8IA 1H9RA 3CU7A 3PO3G 1SNPA 3KUPA 4DR2Q 4IFDG 1DZ1A 4P71A 1FR3A 4DV2L 4DR1Q 3RLOA 1E2WA 4FP5D 4F87A 2K32A 1DOMA 2XTIA 3BZKA 1XPOA 3OIQA 2IY5B 5GQOA
chains in the Genus database with same CATH topology
5I6WA 2NZ1D 4NW2A 5M5XB 4DF7A 3R8BA 1CA5A 1SSOA 1JE4A 1ZEQX 4DAVA 2WKDA 1K8OA 2FJ2A 2E2IB 4RWSC 2IWHA 4HTHA 2VUMB 1ZYRD 3MXUA 5I9OA 4ZUJA 1KLUD 1STBA 2F0MA 1FGBD 1QNKA 3NK9A 2F0FA 2IT1A 4PV1C 1WD1A 2A6EC 4A3MB 1F2YA 3GTLB 3OMGA 1QG7A 4F7XA 1S5CD 2QKIC 2WIIB 1U4MA 2N88A 4HSPA 4RGNA 5CYUA 4G57A 5BN5A 1JWSD 3L7ZC 2B2WC 2RSOA 2PMZB 1TY2A 5TSSA 3HOWB 5CMDA 5BN4A 2NVQB 3MXGA 1S5FD 1F2MA 1LABA 2EVBA 1H9SA 2B8GA 3H6MA 3IKJA 2J7ZA 3T56B 4R8NA 3F2UA 2F0UA 3GQBA 1JORA 1BR9A 1BCPD 5ELBA 3VYUA 4A3GB 2A74C 4IUNA 5DEHA 5C3WA 2PCFB 2K5WA 1BF4A 1JC7A 1Z7TA 2M9VA 1EEFD 4U68A 4FYDA 3MHBA 1TWAB 4ZK9B 1TWGB 1SXTA 2VNUD 2NBFA 2F03A 2RKSA 1KABA 4JK1C 2K05A 1B9MA 1SYDA 4OO1H 2QEJC 3T4AC 1SAPA 2NVYB 4PMCA 4M1UB 1HUNA 4ILWA 2WP8J 1PZKD 3VR2A 1TWCB 3TP7A 4FNFA 2NN6I 1GUNA 4FF2A 3Q24A 3SHLA 5HURA 1I6HB 3HP3A 1ENFA 2AWOA 3IL8A 1PTOB 1B3AA 4FO2A 5IODA 3FEWX 5IGFA 2F0PA 2XRQD 3GTGB 2RQXA 2SNSA 3EROA 1SYGA 4HAEA 5DM63 2B39A 4CJ1B 2AUJD 4GZYC 1EY8A 4IFDH 4K8IA 3A7LA 1M8AA 2JXMB 3S1NB 4G7OC 1S5DD 1QB5D 5C0XH 2JA6B 1BCPC 4FF4A 2TSSA 1WTRA 3DWQA 2IL8A 1TWFB 5G3LF 2NYZD 3K5LA 3JAME 1LLRD 3GV3A 1L0XB 2XIWA 1CFMA 4KN7C 2K7VA 2ZXRA 1CQVA 1PRTB 4HCEA 1SYEA 3BDCA 2K03A 3HOUB 3IFTA 2Q8RE 4K2KA 2Z4IA 2B2YA 2EPBA 1U4PA 1G2TA 1X3PA 3VYRA 5D65A 2MUYA 2A6HC 3BG3A 3S14B 2LS01 4RHSA 3VA5A 1LT4D 1PZJD 4R8IA 1VDZA 1V1PA 4NMZA 5JJZA 1ZXTA 4QF4A 4OO1I 2O2LD 3R2TA 4XQJA 4YIJA 2MHVA 3EFXD 3BVGA 2HDMA 3C46A 1Q90A 2Y0SB 3HRZC 5FOBB 1UEAB 1EU3A 3R2IA 2JE6I 1QOHA 4DGZA 1CQFA 1EU4A 3RD4A 3D6WA 1TT2A 3Q23A 1H9JA 4UDUC 3OSOA 4H7BA 5C0XG 1XXGA 2OT2A 1ICWA 1MI2A 2EYPA 2F0IA 1EOTA 3TZUA 1PYWD 1W6JA 5KRUA 1ESRA 1BXTA 2G9HD 1D1IA 1EY9A 1F9PA 2VB2X 5CV6A 2BE5D 3ZYYX 1LTAD 2XSCA 3DWPA 1B4OA 1E2ZA 2QILA 3K0YA 5LHY1 3BVZA 1WTQA 2AQ3B 3UI2A 2EY1A 1LTRD 2A69C 4DK1A 1O78A 4BA2I 2F0WA 1V8QA 2JSOA 2SEBD 3SR1A 1BO0A 2L1BA 1WTVA 4FXDA 3OIPA 2EXZA 1Y8OB 4L6TB 1Y8NB 2JYOA 1EY5A 4C2MB 1FNWA 4IALA 1EYDA 2L55A 3OHXC 1SYFA 4ZUIA 5KYIA 4IFDI 2BCOA 2RDGA 1D2BA 4RGTA 5K5PA 3EQLC 1NUCA 1SE4A 4K5VA 1PTOC 3S2DB 3NQTA 1Y69U 3DUZA 2EY5A 1CHQD 1Q12A 1ML0D 1VF5C 3S1RB 4K14A 3QG1A 3U9SA 5JPMC 1R4PB 3NPPA 5J39A 1TIID 2NVTB 1AW7A 1G2SA 2F0JA 1LV9A 4A3BB 2IX3A 4WJWA 4E6IA 4TKOB 4K5XA 3HG9A 1GJXA 1Y1WB 4RH6A 1MSGA 4IQZA 1RHPA 3BVMA 2KVMA 2F0OA 2PPBC 1NR2A 5IGEA 5IOCA 4U673 3S17B 2C9OA 5D14A 2K33A 2OEOA 4RAUC 1SE3A 2F4IA 2DN8A 2BA0A 1TS5A 3PIP3 1YNNC 1SMYC 5EKLA 1WTXA 1V1OA 4B9XA 3PIO3 3L9AX 2AWNA 4TSSA 1TQOA 1Z47A 3DWAA 3C1EA 1STYA 2K1BA 1B1ZA 1PTOD 3D4RA 5EJWA 3N52A 1Q1BA 2V4DA 1L0YB 1WTPA 4LAAA 2C5CA 2FINB 3E5SA 2SNMA 4OHJA 2G9DA 4HEDA 2F3WA 4C3JG 3QO2A 3K5NA 3OWFA 1HTLD 1AN8A 4I7ZC 3M4OB 2BDOA 1PFMA 1PZID 1HQMC 1JOOA 2A73B 4DNTB 4M8AA 1CM9A 2E2HB 2Q8IB 3TDQA 5CR3A 5J1ZA 4BY1B 4OIJA 3PV0A 3TMEA 2HDLA 1CTMA 2B2UA 3EJIA 3M85A 2K28A 3FPPA 1STGA 3T51B 1K83B 1PXUA 3NXWA 2HCCA 3CRLC 4L63B 5C3XA 1AZPA 3A8KE 3A54A 4KHVA 4KHZA 2ZXPA 2EYMA 3K58A 3HGBA 2K5DA 2RBMA 3DEPA 2BE5C 1GXDC 3VA7A 2MP1A 2K04A 4N9TA 1S4ZA 2HUGA 3PUZA 4XYOA 4EQOA 2BOSA 4KMUC 1DD2A 1EYAA 4XT1B 1V43A 4ZAIA 3FPUB 1ET6A 2X6LA 5FLXE 2EJGC 2JA8B 1QWYA 1E2VA 4QB4A 4H0LC 1PDQA 1DXMA 2F0GA 3URYA 1AEXA 3ONAB 1O7ZA 2R3ZA 3CRKC 4HMIA 1JQYD 5FK9C 4G4KA 3GTKB 4J6HA 4HCSA 5KYLA 1TWHB 1FNVA 3VR5A 2R6GA 2WACA 3LX0A 4XXEA 3CHBD 5FO9B 3A8IE 4LK1C 1XWEA 1D5MC 4K6LA 2M2LA 1PRTF 5C4JB 4KY6A 1D5ZC 2RDFA 3BYYB 4EGVA 1RTNA 2F0HA 4A3FB 4A3DB 5FKAC 3VR6A 1TVXA 3J7AF 2EYOA 4PMBA 3S2HB 3DXJC 5I6YA 3E6ZX 1TY0A 3M4YA 3TP8A 1F9SA 2A68C 2L5TA 2F0KA 2Q8TA 1SJED 2AQ2B 1EIGA 2BDNA 1I6VC 1ENCA 1D6EC 2KEEA 3VR4A 2Z8LA 2PNRC 1S5BD 2NN6H 2CVRA 1IW7C 3A8JE 1FD7D 1ESFA 5EBCA 4QUCA 3K5MA 3C2PA 2D5DA 3NTHA 3FRPB 5C6AA 2HQEA 4F88A 2JP1A 1T5EA 4KD3A 1GUGA 2VB3X 3D4DA 2I07B 4A3JB 1Q3LA 4Q0FA 5I2YA 3G7LA 4A3KB 5C0XI 2PO4A 3DHQA 1I4QA 2EYJA 4ZKBB 1IW7D 3I3CA 2CW0D 1O7LA 3AB9A 3SK6A 3GP7A 3TP5A 2EY2A 4CHTB 3HOYB 3EVQA 2GA4B 3X3MA 3BDLA 1I4XA 3S1MB 2K5QA 1UAPA 5A2QL 2L9HA 2Z1CA 3D3RA 3R3OA 4FVMA 2O4XA 3K5OA 3BZDB 2AQ1B 2XWBB 1IKMA 3OOCA 2R7ZB 3BYTB 2EE1A 1MGSA 1EY6A 3M7GA 4FF1A 1FNUA 4KY7A 3LWUA 3MTSA 4C56C 4HSVA 4WRDA 2DY7A 3DM1A 1U4LA 3A55A 1JB3A 3SK4A 1U9RA 3VYTA 3OWEB 2EZVA 4QCLA 3MFYA 1M4VA 1IYUA 1TS4A 3CQZB 3DMUA 1SNDA 4DU9A 1DM0B 3H0GB 3NWTA 1G291 4BY7B 4BA1I 4DAPA 2JA7B 2X6GA 3H91A 4R9WA 5A35A 4EQNA 5D3IB 2Z4HA 4O42A 4H44C 3NBIA 4Y7NB 1BCPB 4I65A 1IL8A 2K6AA 4CJ0B 3U9OA 5M3MB 2PW5A 1F2ZA 3KBGA 3KLSA 5IGGA 2F1MA 1SNQA 3QB3A 3TP6A 5E4XA 1EIHA 5CBEE 5FO8B 1GUTA 3MXNA 3K7AB 4RCNA 1F77A 2WV6D 4ODGA 1HPCA 1CZWA 4B08A 1PFBA 4RGOS 4G7ZC 1OO9B 3J81E 3L3OC 4DXFA 4ZLTF 1PLFA 1NR4A 4WFN3 2I46A 3PUYA 5FLXL 4C3HB 1HRJA 1OXUA 2LFNA 5I4DA 2YU9B 3MWYW 3S16B 1GOZA 5FO7B 3PO2B 3RMHA 4F8MA 1A3UA 3J7YW 1LACA 1J8IA 4RGMA 3MXPA 2E76C 5AFWA 1B53A 1ILPA 2RA4A 4DFAA 1TR5A 5IIFA 4FXGC 1F2LA 5JEAJ 1SNOA 3Q6SA 2D2CC 2MPMA 4C1NI 1TKWB 5EBDA 1DONA 2O5IC 1RF2D 4IUTA 4IZ8A 3TBIB 3S1QB 2LMCB 2F0DA 3MVVA 2KEDA 3J80L 2B2VC 1WVLA 2LY7A 5JVG3 3AU7A 3JAML 3I72A 5JOBA 1G91A 3HOZB 3DEOA 4DA2A 5M9OA 3V2TA 3T13A 1JCKB 1D5XC 2J0TD 2KOLA 3K59A 1KNEA 2A6HD 3ND9A 4NKLA 3G6JB 2OF1A 3J81L 1MBYA 1YNJD 2KQ3A 2EDGA 4DXGA 5HGTA 1A3TA 1ZYRC 5EPKA 2ID0A 2B2TA 4OL7A 5D3DA 1UUPA 3OMCA 3BS1A 2NWGA 1H9SB 3MZ5A 5J22A 4CBVA 4HN7A 3PUXA 1OXXK 2LKVA 1ILQA 1RJTA 2FHTA 3K6OA 4NP5A 4OGQC 4HR7B 2DNEA 1LTID 3RLFA 3BDOA 2KCCA 4XTCS 1HXYD 1SDFA 2QCPX 2XNAC 2E74C 2RDHA 4V190 4KK7A 5C44B 1H9KA 2EYHA 1SE2A 1MSHA 1OXVA 3I4MB 1QE6A 1BNZA 1DOLA 1KDAA 3SE0A 4IUQA 1RDPD 2EYLA 2ZXOA 2NTTA 1SNCA 2JEAI 1SYCA 1TS3A 2J4XA 1PMRA 3PUWA 3NUCA 1GUSA 1WCMB 2A68D 2F0EA 1EZ6A 3WDNA 1JR0D 4P2CB 3IAYA 3GV6A 1HFGA 1I50B 4O1NA 4LJZC 2PQEA 4ZYSA 2PYKA 3HOVB 3MEHA 1OXTA 3VR3A 1C48A 1LTTD 3I90A 5IGCA 1WTWA 1XX8A 1ONLA 5C3EB 4TQUS 2KA7A 2MJ8A 3I70A 2WAQB 5EKKA 1B44D 2CW0C 1ET9A 2ZT9C 4PNYA 3V96A 2XVSA 5CBAE 1LTGD 4WORA 2X69A 2EJFC 5KNBA 1KTKA 1JWMD 1RKNA 2PZWA 3NSWA 4AYBB 3K57A 3MA2B 1BOSA 2F0QA 5K36H 1LT5D 1H9MA 1DOKA 4FXKC 1SJHD 2EOTA 1MD2D 2NTSA 3W3AA 4BS9A 1I4RA 4KJNA 2HCIA 3O13A 4ULLA 2KHSA 2EYFA 1EFID 1EY0A 2QF7A 1RTOA 4DN4M 3NTIA 3SEBA 1PRTD 3P7JA 5KEEA 3S9WA 2PW7A 4JBWA 3HS0C 5ISRA 2NN6G 2EJMA 1B2TA 1EL0A 1AP0A 2SDFA 3PUVA 3EA6A 2K01A 3NE5B 1U4RA 1KDCA 2F3VA 4XQNA 1LT6D 1HA5A 5CC4A 1OXSC 3WOEA 3GTOB 5IGDA 2EY6A 2OXPA 4C1NK 3D31A 1DCZA 4TRDA 2KCNA 1C4QA 4KY5A 2B2UC 2CHBD 5CV5A 5K36G 1FYCA 3QJYA 3RUZA 4K2LA 2KECA 3NHHA 5IT9L 2JEBI 2SOBA 3LNNA 3HOXB 3FMCA 3D4WA 4B9WA 1NAPA 4KTAA 1JWUD 1VF7A 4PMWA 1DYQA 1ENAA 2YYZA 3OW7A 1EEID 5DAUA 3Q0AA 2R92B 1XTCD 2E2DC 3C3LA 4ID6A 5C4ZA 1PFNA 3AMUA 3J80E 5DNFA 3H09A 3GD7A 3I4LA 1QCBD 2FMMA 3S15B 5C5LA 1DJRD 4BWGB 1CHPD 4KD4A 2XN9C 2F0NA 2B2TC 2NVXB 4XYQA 4ME5A 3D6CA 1KDBA 3SDZA 3HEJA 5EPJA 4BBSB 4ZRZA 3TN2A 2B2WA 3KF8A 1CA6A 1JOQA 3ITPA 1IKLA 4PQXA 4IFDJ 3J7AV 1BCPF 3T53B 1S5ED 3ND8A 2BA1A 5EPLA 4LMQD 4Z9CB 1II3A 1HCZA 1A15A 5M5WB 1BDOA 4EVOA 1Z6HA 4L8JA 1LTSD 1RODA 1A6XA 1D1KA 4IUUA 5CV9A 2B63B 4C3HG 5E3FA 5C4HA 2O5JC 1PTOH 4C3JB 1NCVA 1CZGA 4XIGS 5JEAH 1STHA 3SK8A 1QILA 3T16A 1JICA 1SBBB 3C1FA 2IX0A 3NP8A 4KKTA 1X32A 1LTBD 3H94A 3P75A 4J8QA 3NBHA 2R61A 2A5HA 3I8ZA 3NQIA 3M7NA 5CGKA 3FKIB 4ABNA 4C3IG 4OIKA 1KLGD 4A3IB 4RKLA 2L12A 2DY8A 4KI0A 2NUCA 1GUWA 4CJ2C 5ELCA 1A2UA 3A56A 4IUPA 2NB0A 5M3FB 1EZ8A 1TS2A 1IYVA 3A7AB 1Y1VB 1R9TB 5ELFA 2RSNA 1I4GA 5JVH3 3I91A 1ZKOA 4BBRB 5T1IA 3D8GA 2A6ED 2FFKB 4EQPA 4UAIA 3ERQA 5NUCA 1LT3D 5C4XB 4RKBA 2PZUA 1VCIA 3HKZB 1EQTA 3RZOB 4ZQ3A 4K5WA 4G7HC 2FMCA 5EKIA 5JEAG 2L0CA 2KJXA 2IPKD 4V0BA 1PTOF 2TMPA 1F9QA 5EQ0A 1WD0A 2WINB 1KAAA 1YNND 4QMGA 3MC0B 3FVQA 2ENBA 2B2YC 4K6DA 4RCOA 5CORA 2VXWA 4ZKCB 1LO5D 1GHKA 3QIAA 3E0JA 4RHRA 2XRSD 2WKCA 1BQQT 1QJOA 4KKUA 3HZXA 2RVLA 5CV8A 3LWEA 4DNRB 2B2VA 4X3KA 1SEBD 3SXHA 2B8FA 1YNJC 4X3UA 5F2DA 1F9RA 4HMJA 4KKSA 4K8JA 4C3IB 1HFNA 3IFDA 2D9UA 1W6KA 5CV7A 1QNUA 3RZDB 4NDXA 1HUMA 1G6ZA 2F0VA 5JAVA 1I4PA 1O7YA 1STAA 2WB1B 1STNA 5E1FA 3I4NB 2E75C 5KNCA 1BBXC 4IURA 3Q22A 3KBXA 4CKEA 4MIUA 3PO3B 3R93A 2CQAA 3MAQA 4RFBA 4DK0A 4IN3A 4QIWB 1SNMA 2XWJB 2PZTA 3GTPB 5M5YB 2ICIA 1T5XD 1R4QB 5IT9E 4CKCA 3CKIB 1SYBA 1XYIA 3TSSA 3X3NA 5COYA 1STEA 1J9OA 2H4OA 4DAYA 3SK5A 5DM73 1I3QB 4MN3A 3QOJA 2L11A 2AUKA 1O80A 5LL6X 1JOKA 3NTKA 5C5MA 1CK1A 1B50A 3PMFA 3WOFA 5A2QE 4A3EB 1I4HA 4IUVA 1EY7A 2QDBA 3KK7A 4X3SA 5E4WC 5I9PA 3GO5A 4OO1G 4XDXA 1E0BA 1VMPA 5EGTA 3GTMB 3P1HA 1A3VA 2IJ0A 1IHZA 2IW3A 1KNAA 3FDTA 4S3SA 4QUFA 5ELDA 1SMYD 3H3VC 3M3YB 3QWNA 2ICEC 4CKBA 1Q1EA 3SVMA 1GUOA 1EWCA 1PRTC 1UNSA 5KNDA 3OPOA 2F0LA 3P20A 5LL6S 4XQQA 1EQVA 1BUVT 5KGUA 3VYSA 2L4NA 3GTJB 2DNCA 5C0XJ 1Y8PB 1B9NA 4H13C 1HHVA 4FF3A 1CT1D 5BN3A 2E2JB 1RD9D 3GTQB 3V05A 3I73A 1WTOA 4KJOA 2A69D 3KLRA 4MHEA 3KLSX 5T1GA 5ELEA 3MFGA 1EWHA 1AFPA 5IGBA 5G3LD 1HA6A 1GHJA 1SFOB 4XT3B 3N6RA 1G8ZD 2M00A 4RA8A 2R93B 4Q5VA 1K8MA 4KN4C 2MGSA 2N55A 4KV6A 1HQRD 1HTPA 1EYCA 2KUMA 2F0TA 2H1EA 5CV4A 4A93B 3QOLA 1V1PB 1X3QA 2IX1A 3NWSA 2JA5B 5JPNC 1AZQA 1TU2B 5KIXA 1CI3M 1EY4A 1C8CA 3W2DA 4CGYB 1RCVD 1NSNS 2D62A 3TZDA 5I2XA 1VMCA 4X3TA 2F0SA 1A2TA 4N9PA 4J1MA 1Q8IA 1H9RA 3CU7A 1SNPA 3KUPA 4IFDG 1DZ1A 1FR3A 1E2WA 4FP5D 4F87A 2K32A 1DOMA 3OIQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HHV A;  1EQT A;  2NZ1 D;  2L9H A;  5D14 A;  1U4R A;  5D65 A;  1ROD A;  4RAU C;  4NW2 A;  1HUN A;  1BO0 A;  2L1B A;  4IUU A;  1WTV A;  1G91 A;  5EKI A;  1RTN A;  1WTO A;  3DEO A;  1CA5 A;  1XYI A;  1PFB A;  5COY A;  1SSO A;  1IKM A;  1J9O A;  1WTX A;  3GV6 A;  2HCC A;  1TVX A;  1F9Q A;  1HFG A;  5EQ0 A;  4R8I A;  1WD0 A;  1JE4 A;  2JYO A;  4ZLT F;  1NCV A;  4MHE A;  1ZXT A;  5JJZ A;  1PLF A;  1AZP A;  4MN3 A;  2EE1 A;  1NR4 A;  2L11 A;  2FJ2 A;  2KOL A;  1KNE A;  5T1G A;  1JIC A;  4RWS C;  2B2Y C;  1O80 A;  1MGS A;  1F9S A;  3I90 A;  1X32 A;  5COR A;  2B2U C;  2VXW A;  4ZKC B;  2HDM A;  3HP3 A;  2K1B A;  3DEP A;  2Q8T A;  1HA6 A;  1HRJ A;  3MTS A;  3IL8 A;  2BDN A;  1B3A A;  1EIG A;  4HSV A;  1B50 A;  2KEE A;  2KEC A;  4XT3 B;  5EJW A;  2DY7 A;  2MP1 A;  3DM1 A;  1U4L A;  1XX8 A;  3I8Z A;  3N52 A;  1WTW A;  5EPK A;  1QNK A;  2K04 A;  4IUV A;  1WTP A;  1S4Z A;  2RVL A;  4RA8 A;  2HUG A;  2MJ8 A;  2B2T A;  4HAE A;  1NAP A;  4X3S A;  1WD1 A;  2CVR A;  3MWY W;  3LWE A;  2MGS A;  2NWG A;  2B2V A;  2N55 A;  4OIK A;  5CBA E;  2FIN B;  4X3K A;  4CJ1 B;  5E4W C;  3D6W A;  2X69 A;  1QG7 A;  1M8A A;  4QUC A;  4X3U A;  1J8I A;  1U4M A;  2N88 A;  4XDX A;  2L12 A;  1E0B A;  1VMP A;  4XT1 B;  2DY8 A;  2KUM A;  1ILQ A;  1F9R A;  2H1E A;  1ICW A;  1RJT A;  2FHT A;  2B2W C;  2RSO A;  4ZAI A;  1G6Z A;  1MI2 A;  3FPU B;  1X3Q A;  4HED A;  1GUW A;  1ML0 D;  1PFN A;  2X6L A;  1EOT A;  4CJ2 C;  3QO2 A;  1HFN A;  3IFD A;  5AFW A;  2D9U A;  5CMD A;  1AZQ A;  5DNF A;  1B53 A;  2X6G A;  1HUM A;  3H91 A;  1DOK A;  1KNA A;  4IUP A;  4R9W A;  1WTR A;  1C8C A;  2IL8 A;  1ILP A;  2JP1 A;  3FDT A;  2NYZ D;  1ESR A;  1PDQ A;  2EOT A;  2FMM A;  4QUF A;  2RA4 A;  2J7Z A;  1PFM A;  1O7Y A;  3ONA B;  1SDF A;  1O7Z A;  3F2U A;  1F2L A;  4O42 A;  3TZD A;  1VMC A;  1Q3L A;  1F9P A;  2R3Z A;  3GV3 A;  4X3T A;  2XIW A;  3SVM A;  3Q6S A;  2HCI A;  1BBX C;  2B2T C;  2MPM A;  1IL8 A;  1G2S A;  4IUR A;  3KBX A;  1CM9 A;  4CJ0 B;  3G7L A;  1RTO A;  1LV9 A;  4DN4 M;  2RSN A;  3R93 A;  4HCS A;  1MSH A;  1B4O A;  3KUP A;  5EPJ A;  3P7J A;  3I91 A;  3TN2 A;  1DON A;  1BF4 A;  1DZ1 A;  2B2W A;  1CA6 A;  4IUT A;  4U68 A;  4ZKB B;  2K03 A;  5T1I A;  3I3C A;  1QE6 A;  2L4N A;  1IKL A;  1BNZ A;  1DOL A;  1MSG A;  2Q8R E;  4OIJ A;  4IUQ A;  4ZK9 B;  1WTQ A;  2FFK B;  2HDL A;  3UI2 A;  2B2Y A;  2EPB A;  1U4P A;  1RHP A;  2KED A;  4UAI A;  2KVM A;  1B2T A;  1G2T A;  1EL0 A;  1DOM A;  2B2U A;  2K05 A;  5E4X A;  2B2V C;  5EPL A;  1NR2 A;  2SDF A;  4LMQ D;  1AP0 A;  5CBE E;  2M2L A;  2K28 A;  1WVL A;  1EIH A;  1SAP A;  2K01 A;  1X3P A;  1A15 A; 
#chains in the Genus database with same CATH topology
 5I6W A;  2NZ1 D;  4Y52 H;  4NW2 A;  4X66 Q;  5M5X B;  4DF7 A;  1FGU A;  4NXM Q;  2UXD Q;  3R8B A;  1CA5 A;  4LFA L;  1SSO A;  1VQ5 A;  1JE4 A;  3PF4 A;  1ZEQ X;  5FJ8 H;  4DAV A;  2WKD A;  1K8O A;  2FJ2 A;  2Q2I A;  4JI1 L;  2E2I B;  4RWS C;  2IWH A;  4HTH A;  2VUM B;  1ZYR D;  3GDE A;  3MXU A;  5I9O A;  4A3K H;  4ZUJ A;  1KLU D;  4OXP A;  4AYB E;  4A3M G;  1STB A;  2F0M A;  1FGB D;  1QNK A;  3FHW A;  3NK9 A;  2F0F A;  2IT1 A;  4PV1 C;  1WD1 A;  2A6E C;  4A3M B;  1F2Y A;  4L5Q A;  3F2D A;  3GTL B;  1CKN A;  3OMG A;  3AEV A;  1MKH A;  5IP7 H;  5LMN L;  1QG7 A;  4F7X A;  1S5C D;  2QKI C;  2WII B;  4CDC C;  1U4M A;  2N88 A;  3NBH B;  4HSP A;  4RGN A;  5CYU A;  4G57 A;  5BN5 A;  1JWS D;  2HQL A;  3L7Z C;  3M3Y H;  1MJE A;  2B2W C;  2RSO A;  2PMZ B;  1TY2 A;  5TSS A;  3HOW B;  5CMD A;  3S1Q H;  5BN4 A;  2NVQ B;  3MXG A;  1S5F D;  1F2M A;  1LAB A;  2EVB A;  1H9S A;  2B8G A;  3H6M A;  1K9M C;  1WCM G;  2J7Z A;  3IKJ A;  5JJL A;  3CCV A;  3T56 B;  4DV5 L;  1JB7 A;  4R8N A;  3F2U A;  3RZD H;  2F0U A;  4GN3 B;  3GQB A;  1JOR A;  4X64 Q;  3U50 C;  1BR9 A;  1Y1W H;  1BCP D;  5ELB A;  3HKZ G;  3VYU A;  4A3G B;  2A74 C;  3KYH C;  4IUN A;  5DEH A;  5C3W A;  3T1Y L;  2YTY A;  2PCF B;  2K5W A;  1BF4 A;  2RCN A;  1JC7 A;  1Z7T A;  2M9V A;  1EEF D;  4APV A;  4U68 A;  4FYD A;  3S2H H;  3MHB A;  4LUV A;  1TWA B;  4DUZ Q;  4ZK9 B;  1TWG B;  4R4I A;  1SXT A;  2VNU D;  2NBF A;  2F03 A;  2RKS A;  1KAB A;  4JK1 C;  2K05 A;  1B9M A;  1SYD A;  4JOI C;  4JYA L;  2QEJ C;  4A3K G;  4OO1 H;  3T4A C;  1SAP A;  1Y1V G;  2NVY B;  4PMC A;  4LFC Q;  1YHB A;  3TRE A;  4M1U B;  5IT9 c;  4P75 A;  2UXC Q;  1HUN A;  4MTN A;  4ILW A;  5FJ8 G;  4HJ9 A;  2WP8 J;  1PZK D;  3VR2 A;  1SE8 A;  3RN5 A;  1TWC B;  3TP7 A;  4FNF A;  2NN6 I;  2KCM A;  2RHQ B;  1GUN A;  3Q24 A;  4FF2 A;  1UE5 A;  3SHL A;  2VS1 A;  4JYA Q;  5HUR A;  4H02 A;  3HP3 A;  1I6H B;  5M5Y H;  3GTK H;  1HH2 P;  1ENF A;  2AWO A;  3IL8 A;  1PTO B;  1B3A A;  4FO2 A;  4C3J H;  4LUO A;  5IOD A;  2UUA Q;  3FEW X;  5IGF A;  3PIO A;  2F0P A;  2QGQ A;  2XRQ D;  3GTG B;  2RQX A;  4OEM B;  2R93 G;  2SNS A;  3ERO A;  4N8F A;  1SYG A;  1AH9 A;  4HAE A;  1X3G A;  4UHV A;  1FVI A;  5DM6 3;  4LF6 Q;  2B39 A;  4CJ1 B;  2AUJ D;  4GZY C;  1EY8 A;  4IFD H;  4K8I A;  3A7L A;  3TRZ A;  1M8A A;  2JXM B;  3S1N B;  4G7O C;  1BBW A;  3DLL A;  2AHO B;  2E5L Q;  1S5D D;  2UUC Q;  1QB5 D;  5C0X H;  3RNU A;  2E2J H;  2JA6 B;  1BCP C;  4DV4 L;  4JI8 Q;  2KHJ A;  4FF4 A;  3F1Z A;  2TSS A;  3DWQ A;  1WTR A;  2IL8 A;  1TWF B;  5G3L F;  5GAE C;  1WFQ A;  2NYZ D;  3K5L A;  1I50 H;  3JAM E;  1N36 Q;  3H3V I;  4JI1 Q;  1LLR D;  2RF4 A;  1IBK Q;  3GV3 A;  1E24 A;  1L0X B;  2XIW A;  3UDF A;  1HNW L;  1CFM A;  4KN7 C;  2VY3 A;  2GN5 A;  4K0K L;  2K7V A;  2UUA L;  2ZXR A;  4LNQ A;  1CQV A;  1PRT B;  1VQP A;  4KLK A;  4HCE A;  1SYE A;  3BDC A;  2K03 A;  2P5Z X;  3HOU B;  3IFT A;  2Q8R E;  4K2K A;  3ICE A;  2Z4I A;  2B2Y A;  2EPB A;  2YU9 H;  1U4P A;  4EX5 A;  3Q8D A;  1G2T A;  1YVC A;  4DV1 L;  1K0S A;  4L5S A;  1YIT A;  1X3P A;  2H5X A;  1PH8 A;  1VQK A;  1GD7 A;  4OWT B;  3VYR A;  5D65 A;  1M1K C;  2MUY A;  4MNO A;  2A6H C;  2ZTC A;  1EQQ A;  3BG3 A;  3S14 B;  4JI4 Q;  2LS0 1;  2CWA A;  4RHS A;  3VA5 A;  1LT4 D;  1VQA A;  1PZJ D;  2JA8 G;  4R8I A;  1VDZ A;  1V1P A;  1C9O A;  4NMZ A;  5JJZ A;  1ZXT A;  4LW1 A;  4QF4 A;  3PCO B;  4OO1 I;  2O2L D;  3R2T A;  4XQJ A;  4YIJ A;  2R7Z H;  2MHV A;  3EFX D;  3KJP A;  2ZM6 Q;  3BVG A;  3OW2 A;  4OEL B;  2HDM A;  4A3C G;  3C46 A;  1Q90 A;  2Y0S B;  3HRZ C;  5FOB B;  1UEA B;  1EU3 A;  3R2I A;  3T1Y Q;  3I2Z A;  1N32 Q;  1TWA H;  4O2D A;  2JE6 I;  1QOH A;  1I94 Q;  4DGZ A;  1CQF A;  1EU4 A;  2EXD A;  1IYJ B;  3RD4 A;  3D6W A;  1KL9 A;  1TT2 A;  3Q23 A;  1H9J A;  4UDU C;  3OSO A;  4H7B A;  4ME3 A;  5C0X G;  1XXG A;  3S1M H;  2OT2 A;  1ICW A;  2F4V L;  4BBS G;  1MI2 A;  2EYP A;  2F0I A;  1XNR L;  1EOT A;  3TZU A;  1B7Y B;  3S15 H;  1PYW D;  1KIX A;  1W6J A;  3S14 H;  1UEB A;  1D7Q A;  3F2C A;  1BXT A;  1ESR A;  5KRU A;  2JJQ A;  2G9H D;  4DV1 Q;  1D1I A;  1EY9 A;  1F9P A;  2VB2 X;  5CV6 A;  2BE5 D;  1VQC A;  4LF9 Q;  4RG1 A;  3UDG A;  1WJJ A;  2CWP A;  3ZYY X;  1LTA D;  2XSC A;  3CQZ H;  3DWP A;  1B4O A;  1E2Z A;  2QIL A;  4JVZ A;  3K0Y A;  2R92 G;  5LHY 1;  3BVZ A;  1NNX A;  2BH8 A;  1WTQ A;  2AQ3 B;  3UI2 A;  2EY1 A;  1LTR D;  5IP9 G;  2A69 C;  5M3M G;  3K7A H;  3CME A;  4DK1 A;  1O78 A;  4BA2 I;  1YHQ A;  1VQI A;  1XPU A;  2WFW A;  2F0W A;  1V8Q A;  2JSO A;  2SEB D;  4BY7 G;  3ERS X;  3SR1 A;  1BO0 A;  2L1B A;  3CPF A;  1AE3 A;  2Z6K A;  1WTV A;  4FXD A;  2PNH A;  1Y1V H;  1R9T H;  1NTG A;  2DJF C;  3OIP A;  1IZ6 A;  2EXZ A;  1Y8O B;  4L6T B;  1Y8N B;  5M5X H;  2JYO A;  1VQ6 A;  1EY5 A;  3H0G G;  4C2M B;  4LFB L;  4YCU A;  1N8R C;  3UE0 A;  4DR5 Q;  4B3S Q;  1FNW A;  4DUY Q;  4IAL A;  4DR2 L;  1EYD A;  2L55 A;  1FJG Q;  4RMF A;  2KHI A;  3OHX C;  1SYF A;  4ZUI A;  5KYI A;  4IFD I;  4HID A;  2BCO A;  5ELO A;  3J81 i;  2RDG A;  3HOV G;  1D2B A;  1WCM H;  2AMC B;  2NZH A;  4RGT A;  2OTL A;  5K5P A;  3EQL C;  2Q2U A;  1NUC A;  1SE4 A;  4K5V A;  1PTO C;  3S2D B;  1X56 A;  3NQT A;  3E3X A;  1Y69 U;  1W3S A;  1SRU A;  3PO2 H;  2PQA B;  3DUZ A;  2EY5 A;  4HJA A;  1Q12 A;  1CHQ D;  1ML0 D;  1ASY A;  1VF5 C;  1KAW A;  3S1R B;  4K14 A;  3QG1 A;  3U4V A;  3QR8 A;  3U9S A;  5JPM C;  1R4P B;  3CPW A;  3NPP A;  5J39 A;  3JAM i;  1TII D;  4DV3 L;  2NVT B;  1AW7 A;  3RZO H;  2F3I A;  1G2S A;  2F0J A;  1PH9 A;  1RL2 A;  1LV9 A;  4A3B B;  1PH5 A;  2IX3 A;  1X65 A;  2QDL A;  4JI7 L;  4WJW A;  4E6I A;  2VQE L;  1P16 A;  3HKS A;  3MXN B;  1PH1 A;  4TKO B;  3HOX H;  4K5X A;  3HG9 A;  1GJX A;  1Y1W B;  4RH6 A;  1MSG A;  5IYB G;  2Z9H A;  4IQZ A;  1Q8K A;  1RHP A;  3BVM A;  1L1O C;  2KVM A;  2F0O A;  2XGT A;  2PPB C;  4LFB Q;  1NR2 A;  5IGE A;  5IOC A;  4GNX A;  3GTQ H;  4U67 3;  5C44 G;  1L1O B;  3S17 B;  2C9O A;  5D14 A;  2K33 A;  1CKN B;  5LMU L;  2OEO A;  4RAU C;  3TEH B;  4A3J G;  3EIV A;  1SE3 A;  1EQR A;  3HOV H;  2CFM A;  2F4I A;  4A3B H;  2DN8 A;  2BA0 A;  1TS5 A;  5M3F G;  1VQ9 A;  3PIP 3;  1YNN C;  1SMY C;  5EKL A;  1WTX A;  1V1O A;  3L2P A;  3JC6 6;  4B9X A;  3PIO 3;  3L9A X;  1DGS A;  5ELN A;  2QA4 A;  2AWN A;  3PF5 A;  1ASZ A;  4TSS A;  1TQO A;  1Z47 A;  3DWA A;  1T9H A;  3FKI H;  3C1E A;  4Y7N H;  1STY A;  3H0G H;  2K1B A;  3CC2 A;  2ZTE A;  4KHP L;  1B1Z A;  3RN2 A;  1PTO D;  3CF5 A;  3D4R A;  1SMX A;  4JI8 L;  5EJW A;  1V1Q A;  1Q1B A;  3N52 A;  2VUM H;  2V4D A;  1L0Y B;  1WTP A;  4LAA A;  2C5C A;  2FIN B;  3E5S A;  4GLA C;  2SNM A;  4OHJ A;  3I4M G;  2NVY H;  2N3S A;  1KRS A;  2G9D A;  5IP9 H;  1YI2 A;  4HED A;  2F3W A;  4C3J G;  3QO2 A;  3F8T A;  3K5N A;  3OWF A;  4ZCK A;  2UXD L;  1HTL D;  1AN8 A;  1VS0 A;  2KEN A;  1QUQ A;  4I7Z C;  4LFA Q;  3M4O B;  1A63 A;  2BDO A;  2JK8 A;  4L5R C;  4P73 A;  1PFM A;  1PZI D;  2OTJ A;  1UE1 A;  1KRT A;  2E2H H;  1HQM C;  4A3L H;  1JOO A;  2A73 B;  2GVA A;  4DNT B;  3M4O H;  4M8A A;  1CM9 A;  2JQO A;  5AJ3 Q;  2E2H B;  2Q8I B;  3K80 C;  3TDQ A;  1YIJ A;  3HFZ B;  5CR3 A;  5J1Z A;  3CP0 A;  4BY1 B;  4OIJ A;  3PV0 A;  3TME A;  2HDL A;  4BBS H;  1CTM A;  1CUK A;  2B2U A;  3EJI A;  3M85 A;  4IPH A;  2K28 A;  3FPP A;  1STG A;  1L1O A;  3T51 B;  1MIU A;  1JE5 A;  4JG2 A;  1K83 B;  1PXU A;  3NXW A;  2HCC A;  3CRL C;  3K0X A;  4L63 B;  1X3F A;  5C3X A;  1AZP A;  3A8K E;  4C3H H;  3A54 A;  4KHV A;  4JI3 Q;  4KHZ A;  2YTV A;  2ZXP A;  2EYM A;  3K58 A;  2VQF Q;  1PH3 A;  3HGB A;  2K5D A;  4DV7 Q;  4A3D G;  3M4Q A;  2RBM A;  1IBM L;  3DEP A;  2BE5 C;  1GXD C;  2I5H A;  3VA7 A;  2UUB Q;  1Q81 C;  2MP1 A;  3G71 A;  2K04 A;  4N9T A;  1S4Z A;  2K52 A;  2HUG A;  4X62 Q;  3PUZ A;  4GLV B;  4XYO A;  4JOI A;  4EQO A;  3RLN A;  2BOS A;  1X6O A;  4KMU C;  1DD2 A;  4B3T L;  1EYA A;  5AJ3 L;  2NVQ H;  4XT1 B;  1V43 A;  3S17 H;  5LMU Q;  4ZAI A;  4I7A A;  2FXQ A;  3FPU B;  3TS0 A;  1ET6 A;  4YHH Q;  1YHA A;  2ZJQ A;  2X6L A;  5FLX E;  4PZ7 A;  2EJG C;  1VQ8 A;  2JA8 B;  3CCQ A;  1QWY A;  1E2V A;  1PH4 A;  4QB4 A;  2NVT H;  4H0L C;  1PDQ A;  1DXM A;  4IOA A;  2F0G A;  3URY A;  3GTG H;  1AEX A;  3ONA B;  4MTK A;  1O7Z A;  2KCT A;  3CC4 A;  2R3Z A;  2I5L X;  5IYC G;  3CRK C;  3D0F A;  4HMI A;  1JQY D;  5FK9 C;  4G4K A;  3GTK B;  4J6H A;  1V9P A;  4HCS A;  5KYL A;  1TWH B;  1FNV A;  3VR5 A;  2R6G A;  2WAC A;  1X54 A;  3LX0 A;  4XXE A;  1IBL Q;  3CHB D;  2Z6K C;  5FO9 B;  3A8I E;  4LK1 C;  3K81 C;  1XWE A;  4WJ4 A;  1UWV A;  1D5M C;  1E1T A;  2DUD A;  4N8X 1;  4K6L A;  2M2L A;  1PRT F;  5C4J B;  4KY6 A;  3G4S A;  1FL0 A;  1D5Z C;  3GTM H;  5BR8 L;  4JI2 L;  2RDF A;  3BYY B;  4EGV A;  1RTN A;  2F0H A;  4YWM A;  4NPS A;  4A3F B;  4A3D B;  5FKA C;  3VR6 A;  1TVX A;  3J7A F;  2EYO A;  4PMB A;  3S2H B;  3DXJ C;  5I6Y A;  3E6Z X;  1TY0 A;  3M4Y A;  3TP8 A;  1F9S A;  2A68 C;  3EBE A;  3KJO A;  2L5T A;  5C4X H;  4LF5 L;  1HNW Q;  2F0K A;  1EIF A;  2Q8T A;  2PMZ E;  1SJE D;  2AQ2 B;  1EIG A;  2BDN A;  1I6V C;  1ENC A;  1D6E C;  2KEE A;  3VR4 A;  3ZJY C;  2Z8L A;  4AH6 A;  3S1N H;  2PNR C;  1S5B D;  1U0L A;  2NN6 H;  2CVR A;  1IW7 C;  3HOY H;  3A8J E;  1FD7 D;  2JN4 A;  1VQL A;  1ESF A;  5L37 A;  5EBC A;  4QUC A;  3K5M A;  3C2P A;  2D5D A;  3NTH A;  1TXY A;  1KD1 C;  3FRP B;  3GTL H;  3UDI A;  4YWL A;  1SR3 A;  2NZO A;  5C6A A;  4JI4 L;  2HQE A;  4F88 A;  2JP1 A;  1T5E A;  4KD3 A;  2ZJR A;  4GN4 B;  2VZA A;  1GUG A;  2VB3 X;  4UP9 A;  3D4D A;  2LXJ A;  2I07 B;  3S1R H;  4A3J B;  1Q3L A;  1Y1W G;  4Q0F A;  4LF5 Q;  5I2Y A;  2EIF A;  3G7L A;  1PH6 A;  4A3K B;  4FDB A;  5C0X I;  2PO4 A;  3DHQ A;  2UUB L;  2JA9 A;  2DJG C;  1I4Q A;  2EYJ A;  4ZKB B;  1IW7 D;  3I3C A;  2CW0 D;  1O7L A;  3AB9 A;  3KDF B;  3SK6 A;  3GP7 A;  3TP5 A;  2EY2 A;  4JV5 L;  4CHT B;  4DK3 C;  3HOY B;  3F2B A;  2RCF A;  4HIO A;  3AQQ A;  5LMN Q;  3EVQ A;  2GA4 B;  3X3M A;  3BDL A;  1I4X A;  3S1M B;  2K5Q A;  1UAP A;  2CH4 W;  5A2Q L;  2L9H A;  2Z1C A;  3A0J A;  4A75 A;  3D3R A;  2CKZ B;  2L15 A;  3R3O A;  4FVM A;  2O4X A;  1CSP A;  3K5O A;  3BZD B;  2AQ1 B;  2XWB B;  1IKM A;  3OOC A;  2R7Z B;  1XMO Q;  4JI6 L;  3BYT B;  2EE1 A;  4GOP C;  2MO1 A;  1XMQ L;  1K0R A;  1MGS A;  1EY6 A;  3HKZ E;  3M7G A;  4DV6 L;  5GAG C;  1X55 A;  4FF1 A;  1FNU A;  4KY7 A;  3LWU A;  3MTS A;  4C56 C;  4HSV A;  4WRD A;  3CCU A;  2D0P A;  2DY7 A;  3DM1 A;  1U4L A;  3A55 A;  1IBL L;  1JB3 A;  4OWW B;  4A3L G;  3SK4 A;  1U9R A;  3VYT A;  3OWE B;  2EZV A;  5HGQ A;  4JBK A;  4QCL A;  3MFY A;  1M4V A;  1IYU A;  4GKK Q;  1YJW A;  1GVP A;  2VQF L;  1TS4 A;  3I4O A;  1B8A A;  3CQZ B;  3DMU A;  1SND A;  4DU9 A;  4K0K Q;  1DM0 B;  3H0G B;  3NWT A;  4YY3 Q;  4JI2 Q;  1G29 1;  5BR8 Q;  2QEX A;  1Z9F A;  1K8G A;  4BY7 B;  4BA1 I;  4DV2 Q;  4DPG A;  4DAP A;  2JA7 B;  2X6G A;  3H91 A;  4R9W A;  5A35 A;  5C4X G;  4EQN A;  4A76 A;  2ASB A;  5D3I B;  2Z4H A;  4O42 A;  4H44 C;  4BBR H;  3NBI A;  4R4Q A;  1TWF H;  4Y7N B;  1BCP B;  4BBR G;  4I65 A;  1IL8 A;  2K6A A;  3KF6 B;  4GOP A;  4CJ0 B;  4DV0 Q;  3H3V H;  4KHP Q;  1G51 A;  3L0O A;  1N33 Q;  3U9O A;  5M3M B;  2PW5 A;  2ALY B;  1F2Z A;  1YJ9 A;  2YV5 A;  1EIY B;  3KBG A;  3KLS A;  5IGG A;  2F1M A;  3ULP A;  3STB D;  4LF6 L;  3CCL A;  1SNQ A;  4A3I G;  3QB3 A;  3TP6 A;  5H1S E;  5E4X A;  1XMQ Q;  5M3F H;  1EIH A;  5CBE E;  3FP9 A;  5FO8 B;  3W1G A;  4QL5 A;  1GUT A;  3MXN A;  4DAM A;  2UUC L;  4J15 A;  3K7A B;  1BKB A;  1L0W A;  4RCN A;  1F77 A;  2WV6 D;  4ODG A;  1HPC A;  1CZW A;  4B08 A;  1PFB A;  4RGO S;  4X62 L;  4JI0 L;  4G7Z C;  1JJG A;  4DR1 L;  1OO9 B;  3J81 E;  1E1O A;  3L3O C;  5IYC H;  1QVF A;  1VQB A;  4DXF A;  4ZLT F;  1VQ7 A;  1PLF A;  1NR4 A;  2RHS B;  4WFN 3;  1QUQ B;  2I46 A;  3PUY A;  2K5H A;  1K3R A;  3W5O A;  5FLX L;  3I7F A;  4GS3 A;  4DNI A;  4C3H B;  2F4V Q;  2A19 A;  1HRJ A;  1OXU A;  4DR6 L;  3A5U A;  2LFN A;  3A5Z B;  4P72 A;  5I4D A;  2YU9 B;  3MWY W;  3S16 B;  5GRO A;  1NJI C;  1GOZ A;  5FO7 B;  1VQD A;  3PO2 B;  3RMH A;  2IHE A;  4F8M A;  1A3U A;  3J7Y W;  1LAC A;  1J8I A;  4RGM A;  2PI2 A;  4DR5 L;  1HZC A;  3MXP A;  2E76 C;  4X66 L;  1MJC A;  1LUZ A;  1EFW A;  1VQG A;  5AFW A;  3CCS A;  4A3E G;  2OWO A;  1B53 A;  3PSI A;  1NMG A;  4DUZ L;  1XMO L;  4DKA C;  1ILP A;  4A3E H;  2RA4 A;  4DFA A;  1TR5 A;  4IPG A;  5IIF A;  4FXG C;  1F2L A;  5JEA J;  1PH2 A;  1IXR A;  1SNO A;  3Q6S A;  2D2C C;  2D0O A;  1MHW C;  2MPM A;  4C1N I;  1H95 A;  1TKW B;  3J7Z C;  5EBD A;  4YWK A;  1DON A;  2O5I C;  1RF2 D;  4JBM A;  4IUT A;  3J7A 5;  4IZ8 A;  1HR0 W;  3TBI B;  3S1Q B;  2LMC B;  2F0D A;  2YTX A;  1D8L A;  4B3R L;  2N8N A;  3MVV A;  1VQM A;  2KED A;  2B29 A;  3J80 L;  4OWX B;  4A3M H;  2B2V C;  1QZG A;  1WVL A;  2LY7 A;  5JVG 3;  3AU7 A;  3JAM L;  2OQ0 A;  1QVG A;  3I72 A;  4BY7 H;  5JJI A;  5JOB A;  1G91 A;  1QVC A;  1EOV A;  3HOZ B;  3DEO A;  4DA2 A;  5M9O A;  3V2T A;  2JA7 H;  3T13 A;  1JCK B;  2UU9 L;  1N36 L;  1D5X C;  2PQA A;  3HOZ H;  2CCZ A;  2J0T D;  1P8L A;  2KOL A;  3K59 A;  1KNE A;  2R92 H;  4HIK A;  2A6H D;  3AFP A;  3ND9 A;  4NKL A;  3G6J B;  4PZ8 A;  4DV0 L;  4LF9 L;  4X6A H;  3OTO L;  2DGY A;  5DLQ E;  4IOC A;  2OF1 A;  4BXX H;  3J81 L;  1MBY A;  1S72 A;  1YNJ D;  2KQ3 A;  2EDG A;  4DXG A;  5HGT A;  4YCW A;  1JMC A;  1A3T A;  1ZYR C;  5EPK A;  2ID0 A;  3I4M H;  2B2T A;  4OL7 A;  5D3D A;  1UUP A;  3OMC A;  3BS1 A;  1NE3 A;  1TWG H;  2NWG A;  1H9S B;  3MZ5 A;  5J22 A;  4A4I A;  4CBV A;  2A8V A;  1JJC B;  4HN7 A;  3PUX A;  4C3I H;  1OXX K;  3HOU G;  2N78 A;  3K8A A;  2MO0 A;  2LKV A;  1PVO A;  1ILQ A;  2UXC L;  1Q82 C;  1RJT A;  2FHT A;  3K6O A;  4NXN L;  4NP5 A;  4JPB W;  4R4C A;  3JAM c;  4OGQ C;  3GTO H;  4HR7 B;  2I5M X;  2DNE A;  1LTI D;  1VQH A;  1E22 A;  3RLF A;  4B3R Q;  1PFS A;  3BDO A;  3CXC A;  2KCC A;  4XTC S;  1HXY D;  1SDF A;  2QCP X;  2XNA C;  2E74 C;  1C7Y A;  2RDH A;  4V19 0;  4KK7 A;  4DUY L;  5C44 B;  4B3S L;  1H9K A;  5IYD G;  2EYH A;  1Q7Y C;  4A3C H;  1SE2 A;  2JA6 G;  1MSH A;  1A0I A;  1OXV A;  4QGU A;  1M90 C;  3I4M B;  5LMN W;  1QE6 A;  1BNZ A;  1DOL A;  1KDA A;  1E7Z A;  3SE0 A;  4IUQ A;  1RDP D;  2EYL A;  3J81 c;  2ZXO A;  2NTT A;  2KBN A;  1SNC A;  1VQN A;  1B3Q A;  3S24 A;  2ZJP A;  3U4Z A;  4A3G G;  5IYB H;  2JEA I;  1SYC A;  1TS3 A;  1JT8 A;  2J4X A;  1PMR A;  2CQO A;  3T1H Q;  3GTP H;  3PUW A;  4AYB G;  3NUC A;  1OTC A;  1GUS A;  1WCM B;  2A68 D;  2F0E A;  1EZ6 A;  3WDN A;  1JR0 D;  4PZ6 A;  4P2C B;  3IAY A;  3GV6 A;  3NEM A;  1HFG A;  4X65 L;  1I50 B;  4O1N A;  4LJZ C;  2PQE A;  3CD6 A;  3CCJ A;  5JJK A;  2QW7 A;  4ZYS A;  2PYK A;  3HOV B;  3MEH A;  1OXT A;  5C3E H;  3VR3 A;  1C48 A;  1LTT D;  3I90 A;  3NEL A;  4JW0 A;  2MNA A;  1XJV A;  2E5L L;  4DR7 Q;  5IYD H;  4YY3 L;  3K7U C;  5IGC A;  4B3M Q;  2V1C C;  4UPA A;  1WTW A;  1XX8 A;  1ONL A;  5C3E B;  4GOP B;  4TQU S;  2KA7 A;  2MJ8 A;  3E0E A;  3I70 A;  2WAQ B;  5EKK A;  1B44 D;  2LSS A;  3EN2 A;  2CW0 C;  1ET9 A;  2ZT9 C;  4PNY A;  3V96 A;  2XVS A;  5CBA E;  3HOW H;  1LTG D;  4GLX A;  4WOR A;  2X69 A;  2EJF C;  5KNB A;  4POG A;  1KTK A;  1JWM D;  4DV7 L;  1QZH A;  1RKN A;  2PZW A;  3NSW A;  4AYB B;  3K57 A;  3MA2 B;  2C35 B;  1I6H H;  1BOS A;  2F0Q A;  5K36 H;  3WWV A;  1LT5 D;  4A3F H;  1H9M A;  1DOK A;  4FXK C;  1SJH D;  2EOT A;  1MD2 D;  3W3A A;  2NTS A;  2PI2 E;  3B6Y A;  4BS9 A;  1VQE A;  4QIW E;  1I4R A;  2JA5 H;  4KJN A;  2HCI A;  3O13 A;  4LWC A;  4ULL A;  2KHS A;  2EYF A;  1EFI D;  1EY0 A;  2QF7 A;  1RTO A;  4DN4 M;  3NTI A;  3SEB A;  1PRT D;  3P7J A;  5KEE A;  3S9W A;  1VQJ A;  1TWC H;  2PW7 A;  4JBW A;  3HS0 C;  2MQH A;  5ISR A;  3ER0 A;  4GN5 A;  2NN6 G;  3HOZ G;  2EJM A;  1B2T A;  1EL0 A;  1BBU A;  1AP0 A;  2SDF A;  3PUV A;  3EA6 A;  2ZM6 L;  1NY4 A;  2K01 A;  4CDE C;  1SFO H;  3NE5 B;  4ALP A;  1U4R A;  2UXB L;  1KDC A;  2F3V A;  4XQN A;  1LT6 D;  1XNR Q;  1HA5 A;  4NXN Q;  4C2M H;  3KDF A;  3G48 A;  4QY7 A;  5CC4 A;  2VUM G;  1OXS C;  2B3G A;  3WOE A;  3GTO B;  5IGD A;  2EY6 A;  2JA5 G;  2OXP A;  4C1N K;  3D31 A;  1DCZ A;  4TRD A;  4A93 G;  2KCN A;  3CMA A;  3FKI G;  1X9N A;  4B3T Q;  1C4Q A;  1HZ9 A;  4KY5 A;  2B2U C;  2CHB D;  5CV5 A;  4IJL A;  4A3F G;  2LXK A;  5K36 G;  4DR3 L;  1FYC A;  3J81 j;  3QJY A;  3RUZ A;  4K2L A;  1YNX A;  2KEC A;  3NHH A;  1XPR A;  5IT9 L;  2JEB I;  2SOB A;  3LNN A;  3HOX B;  4DK6 C;  3FMC A;  3D4W A;  4B9W A;  1NAP A;  4KTA A;  1JWU D;  1VF7 A;  3IRB A;  1DYQ A;  4PMW A;  1JJ2 A;  4A3J H;  3ULJ A;  1A62 A;  1ENA A;  2YYZ A;  4OX9 L;  4DV5 Q;  3E9H A;  3OW7 A;  1NBW A;  1EEI D;  5DAU A;  1S40 A;  3Q0A A;  2R92 B;  2UXB Q;  3T1H L;  2OQK A;  1XTC D;  2E2D C;  1EUJ A;  3C3L A;  4ID6 A;  5C4Z A;  1PFN A;  3AMU A;  3J80 E;  1GKH A;  1XTD A;  3HOX G;  5DNF A;  3H09 A;  3GD7 A;  3I4L A;  3I56 A;  1PYS B;  4UP7 A;  1QCB D;  2FMM A;  4JI6 Q;  2B63 G;  3S15 B;  5C5L A;  1DJR D;  3CCM A;  4BWG B;  2HD3 A;  1CHP D;  4KD4 A;  4LFC L;  1YEZ A;  2XN9 C;  2F0N A;  2B2T C;  2NVX B;  4XYQ A;  4DR3 Q;  1HR0 Q;  4ME5 A;  2HHH L;  2B63 H;  3D6C A;  1KDB A;  3SDZ A;  3HEJ A;  5EPJ A;  4BBS B;  3PGZ A;  4ZRZ A;  3TN2 A;  4B3M L;  2B2W A;  3KF8 A;  1K8A C;  1CA6 A;  1JOQ A;  3ITP A;  4BY1 G;  1IKL A;  4PQX A;  4IFD J;  3J7A V;  1VQF A;  1BCP F;  3T53 B;  3PO2 G;  1S5E D;  1Q46 A;  3ND8 A;  2BA1 A;  5EPL A;  3STB C;  4LMQ D;  4Z9C B;  1II3 A;  3VDY A;  1HCZ A;  1A15 A;  4GKK L;  4TVA B;  5M5W B;  1HJP A;  4A3D H;  1BDO A;  4EVO A;  1Z6H A;  4L8J A;  4NB3 A;  1LTS D;  1ROD A;  5GAH C;  1S3O A;  1A6X A;  1D1K A;  3G6E A;  2EQS A;  4IUU A;  5CV9 A;  4YHH L;  2B63 B;  4C3H G;  2Y0S G;  5E3F A;  2A1A A;  1K28 A;  5C4H A;  1GM5 A;  1C0A A;  4A3I H;  3UDX A;  2O5J C;  1UE6 A;  2Q2T A;  1N34 Q;  4POF A;  1PTO H;  4C3J B;  1NCV A;  3KFU A;  1CZG A;  4XIG S;  5JEA H;  3E9I A;  1STH A;  3SK8 A;  1QIL A;  3T16 A;  1JIC A;  1SBB B;  4GNX C;  3C1F A;  2IX0 A;  3NP8 A;  4KKT A;  1X32 A;  1LTB D;  3H94 A;  2WB1 G;  4A93 H;  2HIV A;  1TWH H;  3P75 A;  4J8Q A;  3NBH A;  2R61 A;  2A5H A;  1J5E Q;  3I8Z A;  3NQI A;  3TQY A;  3M7N A;  5CGK A;  3FKI B;  4ABN A;  4C3I G;  2R7F A;  1HZB A;  4OIK A;  3CCE A;  1KLG D;  4A3I B;  4RKL A;  1YBY A;  2L12 A;  3W1B A;  2DY8 A;  2HHH Q;  4KI0 A;  2ZTD A;  4DR7 L;  2NUC A;  3BZC A;  1GUW A;  4CJ2 C;  5ELC A;  1EYG A;  4LF8 L;  1HZA A;  1A2U A;  3A56 A;  4IUP A;  2NB0 A;  5M3F B;  1EZ8 A;  1TS2 A;  3I55 A;  1HNZ L;  1IYV A;  1G6P A;  1AE2 A;  3A7A B;  1PHJ A;  3M9B A;  1Y1V B;  1SRO A;  1R9T B;  2JA7 G;  5ELF A;  1KHI A;  2RSN A;  1I4G A;  3U58 A;  5JVH 3;  3I91 A;  1BVS A;  3DM3 A;  1ZKO A;  4BBR B;  5T1I A;  3D8G A;  2A6E D;  2FFK B;  4L5T A;  3PQI A;  4EQP A;  4UAI A;  3ERQ A;  4R4T A;  5NUC A;  1LT3 D;  5C4X B;  4RKB A;  2PZU A;  2OCE A;  4DR4 L;  1VCI A;  3HKZ B;  1VQ4 A;  1EQT A;  3HOW G;  4AIM A;  3I4N G;  1KQS A;  4LF7 Q;  3RZO B;  4ZQ3 A;  5HY6 A;  4K5W A;  4G7H C;  3UE1 A;  2FMC A;  1N32 L;  5EKI A;  5JEA G;  2L0C A;  4DAY B;  2KJX A;  4LUZ A;  1I94 L;  2CH4 A;  2IPK D;  4AQY L;  4V0B A;  1PTO F;  1GO3 E;  5GAD C;  2TMP A;  1F9Q A;  3S2D H;  5EQ0 A;  1WD0 A;  1WYD A;  2WIN B;  1KAA A;  4UY8 C;  1YNN D;  4QMG A;  4A3B G;  2K75 A;  3MC0 B;  5IE8 A;  3FVQ A;  2ENB A;  2B2Y C;  4K6D A;  2R7Z G;  4RCO A;  5C3E G;  5COR A;  4HJ8 A;  2VXW A;  1SN8 A;  1LO5 D;  4ZKC B;  1GHK A;  3QIA A;  3E0J A;  5C44 H;  4RHR A;  2XRS D;  3ULL A;  2WKC A;  1BQQ T;  1CKO A;  5IY0 A;  1QJO A;  2BH2 A;  4KKU A;  3HZX A;  2WAQ G;  1Y14 B;  4LF4 Q;  1PYB A;  2RVL A;  4AQY Q;  5CV8 A;  4BY1 H;  3LWE A;  4DNR B;  2B2V A;  5IP7 G;  2VW9 A;  4X3K A;  1SEB D;  1N9W A;  4JV5 Q;  3SXH A;  1LM0 A;  3RR5 A;  4O0A A;  2B8F A;  1YNJ C;  4X3U A;  1LTL A;  4HIM A;  4A3G H;  1NMF A;  5M5W H;  5F2D A;  4LF7 L;  1F9R A;  1IBM Q;  1LYL A;  4HMJ A;  4QJF A;  1WOC A;  4DR6 Q;  4KKS A;  4K8J A;  2WAQ E;  4C3I B;  3IFD A;  1HFN A;  2D9U A;  1W6K A;  1XNQ L;  5CV7 A;  1QNU A;  3RZD B;  4NDX A;  1HUM A;  1G6Z A;  3HOY G;  2JA6 H;  2F0V A;  4R1J A;  5JAV A;  1I4P A;  1O7Y A;  2N49 A;  2UU9 Q;  1I3Q H;  4OON A;  1STA A;  2AKW B;  2WB1 B;  3S16 H;  1STN A;  5E1F A;  2ES2 A;  3I4N B;  2E75 C;  5E7N A;  1VQO A;  4DV6 Q;  5KNC A;  1BBX C;  4IUR A;  3Q22 A;  1YZ6 A;  1KXL A;  2HIX A;  3KBX A;  4CKE A;  4MIU A;  3OTO Q;  3PO3 B;  4JI5 L;  3R93 A;  4NXM L;  2CQA A;  1J5E L;  2VL6 A;  3J80 c;  3MAQ A;  1XNQ Q;  4RFB A;  1U5K A;  5IWA Q;  4DK0 A;  4IN3 A;  4QIW B;  1SNM A;  2XWJ B;  3AYH B;  2PZT A;  3GTP B;  5M5Y B;  2ICI A;  3HOU H;  1T5X D;  1R4Q B;  5IT9 E;  4CKC A;  2E8G A;  3CC7 A;  5EAY A;  3CKI B;  1SYB A;  3PO3 H;  2R93 H;  2VQE Q;  3TSS A;  4DV4 Q;  1XYI A;  3X3N A;  5COY A;  2E2I H;  1STE A;  1J9O A;  2H4O A;  4DAY A;  4CDF C;  3OYY A;  2WB1 E;  1K83 H;  3SK5 A;  4BXX G;  1HNZ Q;  4OX9 Q;  5DM7 3;  1I3Q B;  3NEN A;  4MN3 A;  1A8V A;  3QOJ A;  2L11 A;  2AUK A;  3J80 i;  1O80 A;  5LL6 X;  1E3P A;  2IHF A;  1JOK A;  3NTK A;  5C5M A;  3LGJ A;  4JI5 Q;  1CK1 A;  2K50 A;  2Z0S A;  1B50 A;  5M3M H;  3PMF A;  3WOF A;  4GNX B;  1K3B C;  5A2Q E;  1I4H A;  4A3E B;  4IUV A;  1EY7 A;  2QDB A;  3KK7 A;  4IJH A;  1HNX L;  4X3S A;  1IL2 A;  2K4K A;  1N34 L;  2K5N A;  5E4W C;  4DV3 Q;  4IPC A;  5I9P A;  4X64 L;  3GO5 A;  4DR4 Q;  1B70 B;  4OO1 G;  4XDX A;  3H15 A;  1HR0 L;  1E0B A;  1VMP A;  5EGT A;  4HJ7 A;  3GTM B;  3P1H A;  5FLM H;  1A3V A;  1UE7 A;  2IJ0 A;  5FLX c;  1IHZ A;  3GTJ H;  2IW3 A;  4CDD C;  1KNA A;  4JI0 Q;  3FDT A;  1HNX Q;  4S3S A;  4QUF A;  5ELD A;  1KC8 C;  1SMY D;  1CKM A;  1K73 C;  3H3V C;  3M3Y B;  3QWN A;  2ICE C;  1EWI A;  4CKB A;  5C4J H;  3KOJ A;  1Q1E A;  4IPD A;  4PG3 A;  3SVM A;  1GUO A;  1EWC A;  1PRT C;  1CSQ A;  1UNS A;  3KLW A;  2Z6B A;  1SLJ A;  5KND A;  1FJG L;  3OPO A;  2F0L A;  3P20 A;  5LL6 S;  4XQQ A;  1EQV A;  3TS2 A;  4R4O A;  1BUV T;  2I0Q A;  2K5V A;  4LF8 Q;  5KGU A;  3VYS A;  2L4N A;  4WJ3 M;  3GTJ B;  2DNC A;  5C0X J;  1Y8P B;  1Q86 C;  3KF6 A;  3CAM A;  1IBK L;  1J6Q A;  1B9N A;  4H13 C;  1HHV A;  4YCV A;  4FF3 A;  4GKJ L;  1CT1 D;  3I4N H;  5BN3 A;  1N33 L;  1RD9 D;  2E2J B;  1RIP A;  3GTQ B;  3V05 A;  3I73 A;  1WTO A;  2Y0S E;  4KJO A;  2A69 D;  3KLR A;  1PH7 A;  2JA8 H;  1PA6 A;  3PIP A;  4JCV E;  1YJN A;  3BU2 A;  4MHE A;  1WI5 A;  3KLS X;  3BJU A;  3CW2 C;  3CCR A;  5T1G A;  1W2B A;  1PV4 A;  5ELE A;  3MFG A;  1EWH A;  1AFP A;  2NVX H;  5IGB A;  4HJ5 A;  5G3L D;  4QQB X;  2G5D A;  1ICF B;  1O7I A;  1HA6 A;  1GHJ A;  2GVB A;  4MZ9 A;  4JI7 Q;  2K14 A;  4UP8 A;  1SFO B;  4XT3 B;  3N6R A;  1L2F A;  5FLM G;  1G8Z D;  2M00 A;  3AFQ A;  4RA8 A;  3M4P A;  5IWA L;  2R93 B;  2MFI A;  4JC0 A;  4Q5V A;  1K8M A;  4KN4 C;  1I5F A;  4X65 Q;  2MGS A;  2N55 A;  3KF8 B;  4KV6 A;  1HQR D;  1HTP A;  1WTH A;  4JI3 L;  3SGI A;  1EYC A;  4GKJ Q;  2R7D A;  3MEF A;  2ATW A;  2KUM A;  2F0T A;  2H1E A;  3A74 A;  5CV4 A;  4A93 B;  3QOL A;  1V1P B;  1X3Q A;  1X3E A;  4JBJ A;  2IX1 A;  3NWS A;  2JA5 B;  5JPN C;  4P74 A;  1AZQ A;  1TU2 B;  2F52 A;  1CI3 M;  5KIX A;  1EY4 A;  1C8C A;  4LF4 L;  3W2D A;  4CGY B;  1RCV D;  5J3B A;  4IO9 A;  1NSN S;  2HT1 A;  2Q2H A;  2D62 A;  4EQ5 A;  3TZD A;  5I2X A;  1VMC A;  4X3T A;  2F0S A;  1A2T A;  4N9P A;  4J1M A;  1Q8I A;  1H9R A;  3CU7 A;  3PO3 G;  1SNP A;  3KUP A;  4DR2 Q;  4IFD G;  1DZ1 A;  4P71 A;  1FR3 A;  4DV2 L;  4DR1 Q;  3RLO A;  1E2W A;  4FP5 D;  4F87 A;  2K32 A;  1DOM A;  2XTI A;  3BZK A;  1XPO A;  3OIQ A;  2IY5 B;  5GQO A; 
#chains in the Genus database with same CATH homology
 5I6W A;  2NZ1 D;  4NW2 A;  5M5X B;  4DF7 A;  3R8B A;  1CA5 A;  1SSO A;  1JE4 A;  1ZEQ X;  4DAV A;  2WKD A;  1K8O A;  2FJ2 A;  2E2I B;  4RWS C;  2IWH A;  4HTH A;  2VUM B;  1ZYR D;  3MXU A;  5I9O A;  4ZUJ A;  1KLU D;  1STB A;  2F0M A;  1FGB D;  1QNK A;  3NK9 A;  2F0F A;  2IT1 A;  4PV1 C;  1WD1 A;  2A6E C;  4A3M B;  1F2Y A;  3GTL B;  3OMG A;  1QG7 A;  4F7X A;  1S5C D;  2QKI C;  2WII B;  1U4M A;  2N88 A;  4HSP A;  4RGN A;  5CYU A;  4G57 A;  5BN5 A;  1JWS D;  3L7Z C;  2B2W C;  2RSO A;  2PMZ B;  1TY2 A;  5TSS A;  3HOW B;  5CMD A;  5BN4 A;  2NVQ B;  3MXG A;  1S5F D;  1F2M A;  1LAB A;  2EVB A;  1H9S A;  2B8G A;  3H6M A;  3IKJ A;  2J7Z A;  3T56 B;  4R8N A;  3F2U A;  2F0U A;  3GQB A;  1JOR A;  1BR9 A;  1BCP D;  5ELB A;  3VYU A;  4A3G B;  2A74 C;  4IUN A;  5DEH A;  5C3W A;  2PCF B;  2K5W A;  1BF4 A;  1JC7 A;  1Z7T A;  2M9V A;  1EEF D;  4U68 A;  4FYD A;  3MHB A;  1TWA B;  4ZK9 B;  1TWG B;  1SXT A;  2VNU D;  2NBF A;  2F03 A;  2RKS A;  1KAB A;  4JK1 C;  2K05 A;  1B9M A;  1SYD A;  4OO1 H;  2QEJ C;  3T4A C;  1SAP A;  2NVY B;  4PMC A;  4M1U B;  1HUN A;  4ILW A;  2WP8 J;  1PZK D;  3VR2 A;  1TWC B;  3TP7 A;  4FNF A;  2NN6 I;  1GUN A;  4FF2 A;  3Q24 A;  3SHL A;  5HUR A;  1I6H B;  3HP3 A;  1ENF A;  2AWO A;  3IL8 A;  1PTO B;  1B3A A;  4FO2 A;  5IOD A;  3FEW X;  5IGF A;  2F0P A;  2XRQ D;  3GTG B;  2RQX A;  2SNS A;  3ERO A;  1SYG A;  4HAE A;  5DM6 3;  2B39 A;  4CJ1 B;  2AUJ D;  4GZY C;  1EY8 A;  4IFD H;  4K8I A;  3A7L A;  1M8A A;  2JXM B;  3S1N B;  4G7O C;  1S5D D;  1QB5 D;  5C0X H;  2JA6 B;  1BCP C;  4FF4 A;  2TSS A;  1WTR A;  3DWQ A;  2IL8 A;  1TWF B;  5G3L F;  2NYZ D;  3K5L A;  3JAM E;  1LLR D;  3GV3 A;  1L0X B;  2XIW A;  1CFM A;  4KN7 C;  2K7V A;  2ZXR A;  1CQV A;  1PRT B;  4HCE A;  1SYE A;  3BDC A;  2K03 A;  3HOU B;  3IFT A;  2Q8R E;  4K2K A;  2Z4I A;  2B2Y A;  2EPB A;  1U4P A;  1G2T A;  1X3P A;  3VYR A;  5D65 A;  2MUY A;  2A6H C;  3BG3 A;  3S14 B;  2LS0 1;  4RHS A;  3VA5 A;  1LT4 D;  1PZJ D;  4R8I A;  1VDZ A;  1V1P A;  4NMZ A;  5JJZ A;  1ZXT A;  4QF4 A;  4OO1 I;  2O2L D;  3R2T A;  4XQJ A;  4YIJ A;  2MHV A;  3EFX D;  3BVG A;  2HDM A;  3C46 A;  1Q90 A;  2Y0S B;  3HRZ C;  5FOB B;  1UEA B;  1EU3 A;  3R2I A;  2JE6 I;  1QOH A;  4DGZ A;  1CQF A;  1EU4 A;  3RD4 A;  3D6W A;  1TT2 A;  3Q23 A;  1H9J A;  4UDU C;  3OSO A;  4H7B A;  5C0X G;  1XXG A;  2OT2 A;  1ICW A;  1MI2 A;  2EYP A;  2F0I A;  1EOT A;  3TZU A;  1PYW D;  1W6J A;  5KRU A;  1ESR A;  1BXT A;  2G9H D;  1D1I A;  1EY9 A;  1F9P A;  2VB2 X;  5CV6 A;  2BE5 D;  3ZYY X;  1LTA D;  2XSC A;  3DWP A;  1B4O A;  1E2Z A;  2QIL A;  3K0Y A;  5LHY 1;  3BVZ A;  1WTQ A;  2AQ3 B;  3UI2 A;  2EY1 A;  1LTR D;  2A69 C;  4DK1 A;  1O78 A;  4BA2 I;  2F0W A;  1V8Q A;  2JSO A;  2SEB D;  3SR1 A;  1BO0 A;  2L1B A;  1WTV A;  4FXD A;  3OIP A;  2EXZ A;  1Y8O B;  4L6T B;  1Y8N B;  2JYO A;  1EY5 A;  4C2M B;  1FNW A;  4IAL A;  1EYD A;  2L55 A;  3OHX C;  1SYF A;  4ZUI A;  5KYI A;  4IFD I;  2BCO A;  2RDG A;  1D2B A;  4RGT A;  5K5P A;  3EQL C;  1NUC A;  1SE4 A;  4K5V A;  1PTO C;  3S2D B;  3NQT A;  1Y69 U;  3DUZ A;  2EY5 A;  1CHQ D;  1Q12 A;  1ML0 D;  1VF5 C;  3S1R B;  4K14 A;  3QG1 A;  3U9S A;  5JPM C;  1R4P B;  3NPP A;  5J39 A;  1TII D;  2NVT B;  1AW7 A;  1G2S A;  2F0J A;  1LV9 A;  4A3B B;  2IX3 A;  4WJW A;  4E6I A;  4TKO B;  4K5X A;  3HG9 A;  1GJX A;  1Y1W B;  4RH6 A;  1MSG A;  4IQZ A;  1RHP A;  3BVM A;  2KVM A;  2F0O A;  2PPB C;  1NR2 A;  5IGE A;  5IOC A;  4U67 3;  3S17 B;  2C9O A;  5D14 A;  2K33 A;  2OEO A;  4RAU C;  1SE3 A;  2F4I A;  2DN8 A;  2BA0 A;  1TS5 A;  3PIP 3;  1YNN C;  1SMY C;  5EKL A;  1WTX A;  1V1O A;  4B9X A;  3PIO 3;  3L9A X;  2AWN A;  4TSS A;  1TQO A;  1Z47 A;  3DWA A;  3C1E A;  1STY A;  2K1B A;  1B1Z A;  1PTO D;  3D4R A;  5EJW A;  3N52 A;  1Q1B A;  2V4D A;  1L0Y B;  1WTP A;  4LAA A;  2C5C A;  2FIN B;  3E5S A;  2SNM A;  4OHJ A;  2G9D A;  4HED A;  2F3W A;  4C3J G;  3QO2 A;  3K5N A;  3OWF A;  1HTL D;  1AN8 A;  4I7Z C;  3M4O B;  2BDO A;  1PFM A;  1PZI D;  1HQM C;  1JOO A;  2A73 B;  4DNT B;  4M8A A;  1CM9 A;  2E2H B;  2Q8I B;  3TDQ A;  5CR3 A;  5J1Z A;  4BY1 B;  4OIJ A;  3PV0 A;  3TME A;  2HDL A;  1CTM A;  2B2U A;  3EJI A;  3M85 A;  2K28 A;  3FPP A;  1STG A;  3T51 B;  1K83 B;  1PXU A;  3NXW A;  2HCC A;  3CRL C;  4L63 B;  5C3X A;  1AZP A;  3A8K E;  3A54 A;  4KHV A;  4KHZ A;  2ZXP A;  2EYM A;  3K58 A;  3HGB A;  2K5D A;  2RBM A;  3DEP A;  2BE5 C;  1GXD C;  3VA7 A;  2MP1 A;  2K04 A;  4N9T A;  1S4Z A;  2HUG A;  3PUZ A;  4XYO A;  4EQO A;  2BOS A;  4KMU C;  1DD2 A;  1EYA A;  4XT1 B;  1V43 A;  4ZAI A;  3FPU B;  1ET6 A;  2X6L A;  5FLX E;  2EJG C;  2JA8 B;  1QWY A;  1E2V A;  4QB4 A;  4H0L C;  1PDQ A;  1DXM A;  2F0G A;  3URY A;  1AEX A;  3ONA B;  1O7Z A;  2R3Z A;  3CRK C;  4HMI A;  1JQY D;  5FK9 C;  4G4K A;  3GTK B;  4J6H A;  4HCS A;  5KYL A;  1TWH B;  1FNV A;  3VR5 A;  2R6G A;  2WAC A;  3LX0 A;  4XXE A;  3CHB D;  5FO9 B;  3A8I E;  4LK1 C;  1XWE A;  1D5M C;  4K6L A;  2M2L A;  1PRT F;  5C4J B;  4KY6 A;  1D5Z C;  2RDF A;  3BYY B;  4EGV A;  1RTN A;  2F0H A;  4A3F B;  4A3D B;  5FKA C;  3VR6 A;  1TVX A;  3J7A F;  2EYO A;  4PMB A;  3S2H B;  3DXJ C;  5I6Y A;  3E6Z X;  1TY0 A;  3M4Y A;  3TP8 A;  1F9S A;  2A68 C;  2L5T A;  2F0K A;  2Q8T A;  1SJE D;  2AQ2 B;  1EIG A;  2BDN A;  1I6V C;  1ENC A;  1D6E C;  2KEE A;  3VR4 A;  2Z8L A;  2PNR C;  1S5B D;  2NN6 H;  2CVR A;  1IW7 C;  3A8J E;  1FD7 D;  1ESF A;  5EBC A;  4QUC A;  3K5M A;  3C2P A;  2D5D A;  3NTH A;  3FRP B;  5C6A A;  2HQE A;  4F88 A;  2JP1 A;  1T5E A;  4KD3 A;  1GUG A;  2VB3 X;  3D4D A;  2I07 B;  4A3J B;  1Q3L A;  4Q0F A;  5I2Y A;  3G7L A;  4A3K B;  5C0X I;  2PO4 A;  3DHQ A;  1I4Q A;  2EYJ A;  4ZKB B;  1IW7 D;  3I3C A;  2CW0 D;  1O7L A;  3AB9 A;  3SK6 A;  3GP7 A;  3TP5 A;  2EY2 A;  4CHT B;  3HOY B;  3EVQ A;  2GA4 B;  3X3M A;  3BDL A;  1I4X A;  3S1M B;  2K5Q A;  1UAP A;  5A2Q L;  2L9H A;  2Z1C A;  3D3R A;  3R3O A;  4FVM A;  2O4X A;  3K5O A;  3BZD B;  2AQ1 B;  2XWB B;  1IKM A;  3OOC A;  2R7Z B;  3BYT B;  2EE1 A;  1MGS A;  1EY6 A;  3M7G A;  4FF1 A;  1FNU A;  4KY7 A;  3LWU A;  3MTS A;  4C56 C;  4HSV A;  4WRD A;  2DY7 A;  3DM1 A;  1U4L A;  3A55 A;  1JB3 A;  3SK4 A;  1U9R A;  3VYT A;  3OWE B;  2EZV A;  4QCL A;  3MFY A;  1M4V A;  1IYU A;  1TS4 A;  3CQZ B;  3DMU A;  1SND A;  4DU9 A;  1DM0 B;  3H0G B;  3NWT A;  1G29 1;  4BY7 B;  4BA1 I;  4DAP A;  2JA7 B;  2X6G A;  3H91 A;  4R9W A;  5A35 A;  4EQN A;  5D3I B;  2Z4H A;  4O42 A;  4H44 C;  3NBI A;  4Y7N B;  1BCP B;  4I65 A;  1IL8 A;  2K6A A;  4CJ0 B;  3U9O A;  5M3M B;  2PW5 A;  1F2Z A;  3KBG A;  3KLS A;  5IGG A;  2F1M A;  1SNQ A;  3QB3 A;  3TP6 A;  5E4X A;  1EIH A;  5CBE E;  5FO8 B;  1GUT A;  3MXN A;  3K7A B;  4RCN A;  1F77 A;  2WV6 D;  4ODG A;  1HPC A;  1CZW A;  4B08 A;  1PFB A;  4RGO S;  4G7Z C;  1OO9 B;  3J81 E;  3L3O C;  4DXF A;  4ZLT F;  1PLF A;  1NR4 A;  4WFN 3;  2I46 A;  3PUY A;  5FLX L;  4C3H B;  1HRJ A;  1OXU A;  2LFN A;  5I4D A;  2YU9 B;  3MWY W;  3S16 B;  1GOZ A;  5FO7 B;  3PO2 B;  3RMH A;  4F8M A;  1A3U A;  3J7Y W;  1LAC A;  1J8I A;  4RGM A;  3MXP A;  2E76 C;  5AFW A;  1B53 A;  1ILP A;  2RA4 A;  4DFA A;  1TR5 A;  5IIF A;  4FXG C;  1F2L A;  5JEA J;  1SNO A;  3Q6S A;  2D2C C;  2MPM A;  4C1N I;  1TKW B;  5EBD A;  1DON A;  2O5I C;  1RF2 D;  4IUT A;  4IZ8 A;  3TBI B;  3S1Q B;  2LMC B;  2F0D A;  3MVV A;  2KED A;  3J80 L;  2B2V C;  1WVL A;  2LY7 A;  5JVG 3;  3AU7 A;  3JAM L;  3I72 A;  5JOB A;  1G91 A;  3HOZ B;  3DEO A;  4DA2 A;  5M9O A;  3V2T A;  3T13 A;  1JCK B;  1D5X C;  2J0T D;  2KOL A;  3K59 A;  1KNE A;  2A6H D;  3ND9 A;  4NKL A;  3G6J B;  2OF1 A;  3J81 L;  1MBY A;  1YNJ D;  2KQ3 A;  2EDG A;  4DXG A;  5HGT A;  1A3T A;  1ZYR C;  5EPK A;  2ID0 A;  2B2T A;  4OL7 A;  5D3D A;  1UUP A;  3OMC A;  3BS1 A;  2NWG A;  1H9S B;  3MZ5 A;  5J22 A;  4CBV A;  4HN7 A;  3PUX A;  1OXX K;  2LKV A;  1ILQ A;  1RJT A;  2FHT A;  3K6O A;  4NP5 A;  4OGQ C;  4HR7 B;  2DNE A;  1LTI D;  3RLF A;  3BDO A;  2KCC A;  4XTC S;  1HXY D;  1SDF A;  2QCP X;  2XNA C;  2E74 C;  2RDH A;  4V19 0;  4KK7 A;  5C44 B;  1H9K A;  2EYH A;  1SE2 A;  1MSH A;  1OXV A;  3I4M B;  1QE6 A;  1BNZ A;  1DOL A;  1KDA A;  3SE0 A;  4IUQ A;  1RDP D;  2EYL A;  2ZXO A;  2NTT A;  1SNC A;  2JEA I;  1SYC A;  1TS3 A;  2J4X A;  1PMR A;  3PUW A;  3NUC A;  1GUS A;  1WCM B;  2A68 D;  2F0E A;  1EZ6 A;  3WDN A;  1JR0 D;  4P2C B;  3IAY A;  3GV6 A;  1HFG A;  1I50 B;  4O1N A;  4LJZ C;  2PQE A;  4ZYS A;  2PYK A;  3HOV B;  3MEH A;  1OXT A;  3VR3 A;  1C48 A;  1LTT D;  3I90 A;  5IGC A;  1WTW A;  1XX8 A;  1ONL A;  5C3E B;  4TQU S;  2KA7 A;  2MJ8 A;  3I70 A;  2WAQ B;  5EKK A;  1B44 D;  2CW0 C;  1ET9 A;  2ZT9 C;  4PNY A;  3V96 A;  2XVS A;  5CBA E;  1LTG D;  4WOR A;  2X69 A;  2EJF C;  5KNB A;  1KTK A;  1JWM D;  1RKN A;  2PZW A;  3NSW A;  4AYB B;  3K57 A;  3MA2 B;  1BOS A;  2F0Q A;  5K36 H;  1LT5 D;  1H9M A;  1DOK A;  4FXK C;  1SJH D;  2EOT A;  1MD2 D;  2NTS A;  3W3A A;  4BS9 A;  1I4R A;  4KJN A;  2HCI A;  3O13 A;  4ULL A;  2KHS A;  2EYF A;  1EFI D;  1EY0 A;  2QF7 A;  1RTO A;  4DN4 M;  3NTI A;  3SEB A;  1PRT D;  3P7J A;  5KEE A;  3S9W A;  2PW7 A;  4JBW A;  3HS0 C;  5ISR A;  2NN6 G;  2EJM A;  1B2T A;  1EL0 A;  1AP0 A;  2SDF A;  3PUV A;  3EA6 A;  2K01 A;  3NE5 B;  1U4R A;  1KDC A;  2F3V A;  4XQN A;  1LT6 D;  1HA5 A;  5CC4 A;  1OXS C;  3WOE A;  3GTO B;  5IGD A;  2EY6 A;  2OXP A;  4C1N K;  3D31 A;  1DCZ A;  4TRD A;  2KCN A;  1C4Q A;  4KY5 A;  2B2U C;  2CHB D;  5CV5 A;  5K36 G;  1FYC A;  3QJY A;  3RUZ A;  4K2L A;  2KEC A;  3NHH A;  5IT9 L;  2JEB I;  2SOB A;  3LNN A;  3HOX B;  3FMC A;  3D4W A;  4B9W A;  1NAP A;  4KTA A;  1JWU D;  1VF7 A;  4PMW A;  1DYQ A;  1ENA A;  2YYZ A;  3OW7 A;  1EEI D;  5DAU A;  3Q0A A;  2R92 B;  1XTC D;  2E2D C;  3C3L A;  4ID6 A;  5C4Z A;  1PFN A;  3AMU A;  3J80 E;  5DNF A;  3H09 A;  3GD7 A;  3I4L A;  1QCB D;  2FMM A;  3S15 B;  5C5L A;  1DJR D;  4BWG B;  1CHP D;  4KD4 A;  2XN9 C;  2F0N A;  2B2T C;  2NVX B;  4XYQ A;  4ME5 A;  3D6C A;  1KDB A;  3SDZ A;  3HEJ A;  5EPJ A;  4BBS B;  4ZRZ A;  3TN2 A;  2B2W A;  3KF8 A;  1CA6 A;  1JOQ A;  3ITP A;  1IKL A;  4PQX A;  4IFD J;  3J7A V;  1BCP F;  3T53 B;  1S5E D;  3ND8 A;  2BA1 A;  5EPL A;  4LMQ D;  4Z9C B;  1II3 A;  1HCZ A;  1A15 A;  5M5W B;  1BDO A;  4EVO A;  1Z6H A;  4L8J A;  1LTS D;  1ROD A;  1A6X A;  1D1K A;  4IUU A;  5CV9 A;  2B63 B;  4C3H G;  5E3F A;  5C4H A;  2O5J C;  1PTO H;  4C3J B;  1NCV A;  1CZG A;  4XIG S;  5JEA H;  1STH A;  3SK8 A;  1QIL A;  3T16 A;  1JIC A;  1SBB B;  3C1F A;  2IX0 A;  3NP8 A;  4KKT A;  1X32 A;  1LTB D;  3H94 A;  3P75 A;  4J8Q A;  3NBH A;  2R61 A;  2A5H A;  3I8Z A;  3NQI A;  3M7N A;  5CGK A;  3FKI B;  4ABN A;  4C3I G;  4OIK A;  1KLG D;  4A3I B;  4RKL A;  2L12 A;  2DY8 A;  4KI0 A;  2NUC A;  1GUW A;  4CJ2 C;  5ELC A;  1A2U A;  3A56 A;  4IUP A;  2NB0 A;  5M3F B;  1EZ8 A;  1TS2 A;  1IYV A;  3A7A B;  1Y1V B;  1R9T B;  5ELF A;  2RSN A;  1I4G A;  5JVH 3;  3I91 A;  1ZKO A;  4BBR B;  5T1I A;  3D8G A;  2A6E D;  2FFK B;  4EQP A;  4UAI A;  3ERQ A;  5NUC A;  1LT3 D;  5C4X B;  4RKB A;  2PZU A;  1VCI A;  3HKZ B;  1EQT A;  3RZO B;  4ZQ3 A;  4K5W A;  4G7H C;  2FMC A;  5EKI A;  5JEA G;  2L0C A;  2KJX A;  2IPK D;  4V0B A;  1PTO F;  2TMP A;  1F9Q A;  5EQ0 A;  1WD0 A;  2WIN B;  1KAA A;  1YNN D;  4QMG A;  3MC0 B;  3FVQ A;  2ENB A;  2B2Y C;  4K6D A;  4RCO A;  5COR A;  2VXW A;  4ZKC B;  1LO5 D;  1GHK A;  3QIA A;  3E0J A;  4RHR A;  2XRS D;  2WKC A;  1BQQ T;  1QJO A;  4KKU A;  3HZX A;  2RVL A;  5CV8 A;  3LWE A;  4DNR B;  2B2V A;  4X3K A;  1SEB D;  3SXH A;  2B8F A;  1YNJ C;  4X3U A;  5F2D A;  1F9R A;  4HMJ A;  4KKS A;  4K8J A;  4C3I B;  1HFN A;  3IFD A;  2D9U A;  1W6K A;  5CV7 A;  1QNU A;  3RZD B;  4NDX A;  1HUM A;  1G6Z A;  2F0V A;  5JAV A;  1I4P A;  1O7Y A;  1STA A;  2WB1 B;  1STN A;  5E1F A;  3I4N B;  2E75 C;  5KNC A;  1BBX C;  4IUR A;  3Q22 A;  3KBX A;  4CKE A;  4MIU A;  3PO3 B;  3R93 A;  2CQA A;  3MAQ A;  4RFB A;  4DK0 A;  4IN3 A;  4QIW B;  1SNM A;  2XWJ B;  2PZT A;  3GTP B;  5M5Y B;  2ICI A;  1T5X D;  1R4Q B;  5IT9 E;  4CKC A;  3CKI B;  1SYB A;  1XYI A;  3TSS A;  3X3N A;  5COY A;  1STE A;  1J9O A;  2H4O A;  4DAY A;  3SK5 A;  5DM7 3;  1I3Q B;  4MN3 A;  3QOJ A;  2L11 A;  2AUK A;  1O80 A;  5LL6 X;  1JOK A;  3NTK A;  5C5M A;  1CK1 A;  1B50 A;  3PMF A;  3WOF A;  5A2Q E;  4A3E B;  1I4H A;  4IUV A;  1EY7 A;  2QDB A;  3KK7 A;  4X3S A;  5E4W C;  5I9P A;  3GO5 A;  4OO1 G;  4XDX A;  1E0B A;  1VMP A;  5EGT A;  3GTM B;  3P1H A;  1A3V A;  2IJ0 A;  1IHZ A;  2IW3 A;  1KNA A;  3FDT A;  4S3S A;  4QUF A;  5ELD A;  1SMY D;  3H3V C;  3M3Y B;  3QWN A;  2ICE C;  4CKB A;  1Q1E A;  3SVM A;  1GUO A;  1EWC A;  1PRT C;  1UNS A;  5KND A;  3OPO A;  2F0L A;  3P20 A;  5LL6 S;  4XQQ A;  1EQV A;  1BUV T;  5KGU A;  3VYS A;  2L4N A;  3GTJ B;  2DNC A;  5C0X J;  1Y8P B;  1B9N A;  4H13 C;  1HHV A;  4FF3 A;  1CT1 D;  5BN3 A;  2E2J B;  1RD9 D;  3GTQ B;  3V05 A;  3I73 A;  1WTO A;  4KJO A;  2A69 D;  3KLR A;  4MHE A;  3KLS X;  5T1G A;  5ELE A;  3MFG A;  1EWH A;  1AFP A;  5IGB A;  5G3L D;  1HA6 A;  1GHJ A;  1SFO B;  4XT3 B;  3N6R A;  1G8Z D;  2M00 A;  4RA8 A;  2R93 B;  4Q5V A;  1K8M A;  4KN4 C;  2MGS A;  2N55 A;  4KV6 A;  1HQR D;  1HTP A;  1EYC A;  2KUM A;  2F0T A;  2H1E A;  5CV4 A;  4A93 B;  3QOL A;  1V1P B;  1X3Q A;  2IX1 A;  3NWS A;  2JA5 B;  5JPN C;  1AZQ A;  1TU2 B;  5KIX A;  1CI3 M;  1EY4 A;  1C8C A;  3W2D A;  4CGY B;  1RCV D;  1NSN S;  2D62 A;  3TZD A;  5I2X A;  1VMC A;  4X3T A;  2F0S A;  1A2T A;  4N9P A;  4J1M A;  1Q8I A;  1H9R A;  3CU7 A;  1SNP A;  3KUP A;  4IFD G;  1DZ1 A;  1FR3 A;  1E2W A;  4FP5 D;  4F87 A;  2K32 A;  1DOM A;  3OIQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...