3ILOA

Crystal structure of e. coli hppk(d97a) in complex with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLAIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and functional roles of residues D95 and D97 in E. coli HPPK
rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
total genus 46
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3iloA00
3QBCA 3UDEA 3MCOA 3MCMA 5ETMA 4AD6A 1CBKA 3HCXA 3ILOA 3KUEA 5ETVA 4CYUA 3HSZA 3UDVA 4M5IA 1KBRA 1Q0NA 3IP0A 2F65A 4CRJA 3KUHA 5ETRA 5ETOA 1F9HA 1TMMA 1EQMA 3HD1A 1EX8A 1HKAA 1RTZA 4M5LA 3KUGA 3HSGA 5ETKA 1RB0A 1TMJA 4M5GA 4M5MA 3HSDA 1RU1A 1RAOA 4M5KA 4M5NA 4F7VA 3UD5A 4M5JA 3MCNA 1G4CA 1HQ2A 1RU2A 5ETSA 5ETLA 2CG8A 4M5HA 5ETTA 3HT0A 4PZVA 5ETPA 5ETNA 5ETQA 1IM6A 3HD2A 3HSJA 2QX0A 1DY3A 4CYUB 4CWBA 2BMBA 1EQ0A 2F63A 3ILIA 3ILJA 3ILLA
chains in the Genus database with same CATH superfamily
2GHWA 5HMWA 3O6QA 2AJFE 1UJ4A 4U95A 4LFAJ 2UXCJ 1DQ9A 2V0NA 2ZUAA 1RT6A 1KLMA 1RT2B 1YBTA 3BKTA 1TL1B 3SCLE 3MR3A 2W24A 4DV3J 1KLMB 1RT2A 3KG0A 4FPIA 1FDNA 3GV7B 1QJHA 2RKIA 1B7YB 2YWFA 4ZHRB 5LMNF 2HMIB 2UXDF 4EI2A 4OZ5A 3R27A 3BB5A 3DDIA 2LEAA 4NASA 3CO0P 4I1TA 4TY8A 1RBLA 4RW4B 4CLTA 5DG7A 1NKEA 2XZTB 1U48A 4ZJQA 2AKWB 1VK3A 5CYQB 2YKNB 2HNDA 1UPPA 2OPRB 4WIQA 3TJAA 1RT1A 3JSRA 3OUYB 3QRRA 5HI7A 3NMRA 2CG8A 1U02A 3BGFA 3M2RB 2OTJS 3FRYA 2WRMA 3GE9A 4O0NA 2FGCA 2H51B 4EZ9A 1ICEB 1T03B 4IQXA 3K5OA 4YB6A 2RDJA 2AJ1A 3B82A 4MK9A 2J9DA 1GMWD 1P9QC 1DHMA 1Q16B 3BBCA 5BR8J 2R8HA 2YTCA 3OT9A 3FMWA 3VWSA 5LJ5Y 1RLDA 1UMJA 3EDQB 2YNGB 1HQUA 3GJSB 2HNYB 4QIFA 3R97A 5A8KA 3H8YA 5LMUF 2YXLA 1PAUB 5ETRA 5KT4A 2QTWA 3DI6A 4XPCA 3FMBA 4U7UD 2GHVC 2AF6A 5CYQA 5IT0A 4ELUA 1TMJA 3H7HB 4J9UE 1WKKA 5D4PA 5FJ4A 5CYJA 1UA1A 3MAAA 3PRVA 3TJ8A 4PXCA 1ZOTA 3M9OB 5KFAA 1PIEA 1FXRA 3CCMS 2WVBA 1YRUA 2IFXA 1GX6A 1S99A 1VRTB 2LQJA 2LVWA 3QYYA 3MFIA 3FJ2A 4G1QB 5LMUJ 3BBFA 4OYZA 2J7UA 4QYZJ 2IHR1 3NS6A 1DY3A 1S1XB 4OYIA 2R7RA 1NH8A 2Y1IA 2BW7A 2E1MC 1S7HA 1L3SA 4IOAQ 1UP1A 2BRLA 3HZGA 5J2NB 1EKRA 2BBEA 3ZNUA 1XWLA 4LF8J 1C2PA 3FZ2A 2DGQA 4WZQA 1S76D 2W7AA 3ENWA 1JMTA 4HHJA 4KKOA 1OY8A 3T5LA 3C6UB 1RT5B 1RWUA 2A6MA 3ITHB 1V3ZA 3KLEA 4WE1A 2W7PA 2DEIA 1Q8IA 5EX0A 3W8GA 4PXDA 2LQBA 2ZITA 5F8IA 5B0FA 3FCHA 1IR1A 1P8GA 1JJHA 1YJVA 4DCPB 4G3IA 1TKZA 3NL0A 4RNHA 1IR2A 3DOMB 1WC6A 1RXOB 3EGVA 1N34J 4O3SA 3LF0A 4RWWA 2G2YA 3KDOA 4ZKAA 4CCHA 1S1TB 4KAIA 4A46A 4ED1A 1CEZA 2K8GA 2Y1LB 1PCAA 4DSJA 2CA9A 2ZH7A 2RNEA 4KJIA 1R8BA 4DN0A 2MQ8A 4WYWA 1F9EB 3GYGA 4DV2F 1FJGJ 1VRQC 1UVIA 4C8NA 1OYDA 4NXMJ 4O0IA 3KLVA 3J80Y 3CIMA 2CQ3A 3L7UA 4RO0A 5HN0A 1ZETA 4Q0BA 4DV3F 4WKYA 3TA1A 2EWHA 1TP7A 2E5HA 2G0IA 1N5TA 3I96A 3I87A 4ITSA 3W7BA 3OL7A 4ED6A 4ETZA 1JLGB 1V5VA 2CPXA 2NUUG 3BKUA 4ZVRB 2VJVA 2J0WA 1X5TA 2HFVA 1L3VA 2O5DA 3MM8A 4KH1B 3IRXB 4CT8A 4J9LA 2U1AA 3T9NA 3TW0A 4X62J 5CXTA 5D4LA 4KV8B 2R3VA 1WHWA 3DC2A 1RT4B 3CJ8A 3D6MB 5J2QA 1IKXB 3HX9A 4NX9A 2W9AA 3MGJA 2BE7D 3CD7A 4DL0C 4B3SJ 1OSDA 2D9OA 3HHLB 1EJ7L 2HQGA 1K9MT 4ZCMA 3IMQJ 3ADAC 2N7YA 2K7JA 1VR6A 3IGVA 4PR6A 2DH7A 3LOUA 2MDAA 1HQEB 4OHYA 3KNGA 2GS8A 2ASYA 1KFDA 1SI9A 3P96A 1RBAA 1RP5A 3J7A1 1TK0A 1S1WA 4ILMA 3P4UB 2RIJA 2L9NA 2M7SA 3S01A 4USJC 3MMCA 4HDGA 2XB2D 1U4BA 3D1HA 3SYZA 2D41A 2OJ3A 1JWWA 2ZE2A 3IWNC 2EFPA 3QGHA 4YHHJ 4B3OB 1K0VA 2IJRA 3PXGa 1HW8A 1P1LA 3H4BA 3E01B 2MQLA 2EPIA 3DM2B 1S4FA 5ETSA 4NLGA 1ELOA 2ZOFA 4C3MA 4DV7F 3BH6B 4ES2A 1UAWA 1WOPA 3BSNA 2VA3A 3PVXA 4IOCQ 5J2MA 1RHMB 2NQPA 4TYAA 2FC8A 3FRZA 4TN2A 5DQHA 4OMFG 1SKSA 3FBFA 3BDPA 2LFVA 3CJQA 2W2PP 4ZP7A 3A8JA 4ATNA 5C25B 6FDRA 5KG7A 3TAQA 4RW6B 7FD1A 4RW9A 3UO0A 4GKKJ 4M8LA 1JK9B 2CDQA 3OTBA 1RZMA 3MECB 3U1NA 2R7OA 3CMAS 4NRUA 2CPDA 1DRZA 1QM9A 4Q43A 3OUYA 2QJ3A 4LBHA 1RCXB 4ZS6A 4KBIA 1HBUA 4JI2F 2HVEA 3NGDA 1UL3A 3K8WA 2CJ9A 2DNQA 4M5NA 1SC6A 4RR5A 4I2PB 1HBOA 6AT1B 3IXQA 1KVIA 3R7SB 4YR2A 5C2GA 2JC0A 4DUZF 3HPOA 2O66A 2Y1RI 2MLXA 3B78A 4CP5A 5HQ8A 3QRPA 2QYCA 1YSJA 3MPVA 1NJIT 2Q1LA 2YKAA 4WFNQ 3K58A 4ECVA 3TEGA 2A6OA 2CPYA 4X84A 2YKMB 1T11A 4RBUA 1XNQJ 1HBOB 3QLHB 3RG6A 4DI6A 3BKFA 1OMSA 4DUZJ 4H4KA 1Z4UA 2KXHA 2J6SA 2M8HA 1CBKA 2LEPA 3O3LA 2ZOMA 3BZQA 4Q2LA 3QQCD 2FQQB 4WE1B 5E3QA 3THPA 2OMLA 2PFDA 3TZWA 4AE5A 3GIRA 1I5OB 2Z4PA 3CJSA 3DOLA 3KUHA 4UF4A 4C3KA 5K8NA 2B9XA 4U7CA 3O44A 2HBYB 3V6KA 3CGIA 3PY8A 4JI7J 3SEOA 1X9SA 2CJYB 2B7CB 2WZ1A 4M1KA 3V6DB 1YRXA 3FQKA 1FX4A 3DLKA 1FERA 3BBBA 4TQRA 1HBNA 1VS3A 1RWXB 2ILYA 2V67A 3DLKB 1Q8BA 2AEMA 1LWCB 2EFQA 3GP9A 2ZFHA 1AA1B 3NRBA 2Y0BB 3D66A 4URGA 5LJ3Y 4KH0B 1FJGF 2XEXA 2K06A 4NLPA 5DGAA 2VG7A 3JQKA 3KJQB 3P5BP 2FC9A 4LF2A 1JXVA 4C0OC 2Z2LA 2FZCB 2J8SA 3MMAA 4QYRA 5D6GA 5DZ6A 4CYUB 3R5AA 4QWDA 3OTOJ 1WSRA 3GQCA 2PSZA 1RWOB 3ILIA 4ZVPB 2X1GA 4Y2IA 2FJXA 3I82A 1XMQF 4E0DA 1T9TA 2G2ZA 1SC3B 2XHCA 2CJXB 2Z57B 2CZVC 2G9OA 3PJWA 3QAUA 3EM1A 2HNYA 1NNDA 1RWPB 2OPQA 3M8QB 1N56A 2H54B 3MPDA 2BANA 2AD9A 2AJ0A 2MKYA 1E6VA 3RBDA 3P45B 3GV8B 4K4XA 4Q8FA 4JI3F 2GIQA 4HI1A 3I0RA 2ZJPQ 1B0PA 1M1GA 1HWLA 3WIVA 1YHQS 2GMHA 1F0XA 3NCQA 4KGXB 1NDCA 1Y3JA 2KB2A 3PYEA 2BKPA 1R31A 1SV5B 2G1DA 4FS1A 1RA6A 2HNDB 2MKSA 5AE1A 1OY9A 1YTYA 2IM3A 4J7CA 9RUBA 4X2BA 2FY1A 4RW7A 1X4GA 1U0HB 2W2QP 4XK8C 3QBCA 2XZDB 2OEJA 2C2KB 2CQBA 3ENQA 3U1MA 3V2UC 4BLGA 5T14A 1LW0A 3UVJA 5KFKA 4FF3A 2JLGA 5GADU 1ZPVA 4MFBA 2LP4A 3FEZA 2P9EA 3GZ7A 3KWMA 2KH9A 2NXNA 1EARA 1WHYA 4L73A 1GAOA 3TX0A 3IBWA 2MZ1A 4ID8A 5T7LA 3GJTB 3QGGA 4WTOB 1RHJB 1UVKA 5JUMA 4RUBA 1HFEL 2DCUB 4UW2A 1XR6A 3MMCB 2YWGA 4OJHA 4O3PA 3LO3A 4IDKB 3MURP 2E5LF 5E5NA 5F9LA 4PG6A 2LQ9A 1AROP 2DT9A 2NLWA 4X4VA 5F8HA 1VOMA 1TL3A 3Q8YA 2YH1A 1SVDA 1X31C 3AFGA 3EE3A 3OBIA 5JVGQ 2UXBF 1VC6A 1TKZB 2GVDB 2IYGA 1XN9A 4ECYA 2YKOA 1CLFA 3ZXWA 2N4DA 2KG1A 4IFYA 4AL7A 1CJVB 4GVBA 3QZ7A 5HMXA 1KHVA 2B43A 2HFNA 1L5UA 4MMOA 1VQ7S 4CDIA 3G82B 3W66A 3WIUA 3ZZOA 1DBDA 2CUYA 2J9EA 1U6FA 1Z2ZA 4ZPCA 1SKUB 2Q3PA 3IO1A 3VZIA 1DLOB 2BJ8A 2D69A 1JLGA 3D68A 5ADZA 4K0KJ 1DARA 2KI2A 3AB4B 4KFBB 4Y2KA 4ZK7M 1RABB 1VQ6S 4K4UA 1SQFA 4CIOA 1Q53A 2Y1JA 3AOAA 3FSIA 2HK2A 4CO3A 5HBMB 2ZZMA 1HBMB 3SFGA 2AGPA 1SQGA 2R7UA 4IG0B 1D09B 1T02A 2YWKA 3KTQA 1Y10A 2HWIA 1SKWA 4NXNJ 1DAXA 6FD1A 1BC6A 1K0TA 2EEYA 1VI7A 4KQZA 3G82A 2B5JA 3T5KA 3CJ2A 2IRUA 1ZM3A 1NHVA 3OVBA 1QVFR 1GEHA 3DYAA 3M8YA 4DQPA 1Q79A 1RTZA 3KUGA 2BEFA 2JL9A 3VHQA 2A18A 4ALZA 1NDPA 4RNOA 3OSNA 3DLBA 1G1XA 1YJTA 2PD1A 4O4RA 4JV5F 3DKDA 2CQ1A 4DN9A 3MM7B 1MN7A 4FF2A 4K4WA 2DRAA 1V9OA 1MWQA 2PGCA 4P72A 3KK2A 1IJFB 2CQHA 1A6LA 2H5IB 1HHQA 1X5SA 4M5HA 3MTJA 1NEEA 2JRSA 3MM9B 1T94A 3IR5B 2MKHA 3A12A 4I4BA 5HROA 1RAGB 1AB8A 2UUWA 4P2FA 2I5JA 1FT8A 4IH6A 3CW2C 3MAQA 3MR5A 3NKYA 1M1HA 4O23A 4F3QA 4DPXA 1VCTA 3IR7B 1S49A 3I5AA 3SCJE 2RQCA 4EGLA 1VLYA 2NYHA 1JX4A 2R7TA 5KFXA 4B3TJ 3R5DA 4AXJA 4HYKA 4FBUA 2IVMA 5LM7E 1WD6A 3TNVA 4RZRA 3OV7A 5F0WA 4I7FB 4M5JA 3I9ZA 4LRCA 3M32A 3PFEA 4QWCA 3PG9A 4I56A 1FRHA 5IWAF 3BN4A 2WVEA 1K1SA 2XCAA 1P9YA 1HPZB 3W5YA 2ZE2B 4TU7A 4LMZA 4NPOA 3H5SA 4WK1A 3W2WB 1B7FA 3DXBA 2HGLA 2Y8WA 3S7RA 2Q6BA 2NZ4A 1JLBB 1E6VB 5BYQA 5JXSA 3JS9A 4FPRA 3UN2A 4CO0A 2MKKA 4N76A 3D3BJ 1EZZB 3RRKA 2EXUA 1A9NB 2L08A 1H74A 4U8YA 3VALA 1R8HA 1WEXA 3H5UA 2HHXA 2H5JB 3M8RA 4U7UK 3MEKA 1IBCB 5AXMA 1WOSA 2VFRA 2DGSA 2WOMB 4NLRA 1FWKA 4IR1A 1OY6A 3W62A 4ECUA 1YX2A 1KVKA 3KLGB 2H4YB 4NLDA 5IV4A 2RU3A 2X1BA 4ILLA 3TVZA 1GX5A 2XZWA 3ENAA 3KHLA 4ZHRA 2R8GA 4RU9A 2VUGA 2JFKA 5E7OB 4KSEB 5K14B 5KT3A 3UFCX 2XG8A 5B0DA 3RTVA 4OZLA 4Y2AA 3G71S 2LYVA 3SDEB 1LWCA 3UW1A 2QA4G 4JI2J 4C8LA 3SDEA 1VQ8S 2MB0B 1ZAXA 1KTQA 1X4EA 4QJVA 2ZH9A 2CPIA 2MKCA 1EB0A 2HS0A 2N4CA 3DLJA 1W7WA 4IKAA 4Q45A 5D0GA 4DX6A 2VKZG 2GAHC 4PAAA 2ZBRA 1N6QB 2HVZA 3CXCR 3D9BA 1RAIB 3BV8A 3FBCA 4OIXA 1U45A 3CC7S 4Q8EA 2KVQE 1XNRJ 4DCJB 5L39A 1REVB 3GYXB 4HLBA 4ZP6A 2HVIA 2C22A 3MCNA 4F4KA 1VQKS 1Q8KA 1ULRA 3NXZA 4DU7A 3VQTA 2AHOB 1HHSA 2BANB 2WONA 2IBKA 1NSAA 2V69A 4JYAJ 1F5CA 3FVYA 1YJUA 3MEGA 5B0GA 3SXLA 4JI6J 1XK8A 4XTTA 3D4JA 4R8UA 3G6XA 4DF4A 2U2FA 4JI0J 1REVA 3TWZA 2AW0A 2FJVA 4M5DB 3PO5A 5DM6Q 2V50A 1D9FA 1FJEB 2DNPA 4NA2A 1Y9OA 4DX5A 4AL6A 1KWMA 2BE2B 3KMSA 4RW8B 4CRJA 2IMOA 3IBFB 2NS1B 2PMWA 3M32B 3B4MA 3QJJA 1TMMA 3WDOA 3I31A 2KT5A 5D4NA 3P6YC 4Y34A 3VAJA 4HH1A 4DL2A 3TEHB 4IO9Q 1RUSA 1YK9A 2XYPB 4OLPA 1YJ9S 5HMZA 1S59A 5K20B 4LR8A 1PJ5A 5A6PA 5A8WB 3BGRA 4DR2F 3GMGA 3TI0A 3R1LA 3KJVB 2E44A 1WTFA 2I5JB 1HIYA 3T1YJ 5EGYA 2N3OA 5GADI 2HBQB 4G1IA 2ZVSA 2DITA 2R2RA 2VBWA 4DV0J 2HG4A 3MXHP 2WBMA 3KHGA 4KGMA 4QOTA 4W92B 5HSPA 4IO1A 3ZZYA 3LWMA 3GLJA 4ECSA 3EVMA 1Q95G 3GJQB 2GO8A 3DRYA 3X3UA 3H0PA 5I3QA 4ELVA 3TA2A 2GV1A 3JTNA 4MIAA 2KT2A 4EO8A 1UPMB 4WIIA 5L1IA 3V6JA 2XY5A 3R5GA 3AH6A 2FJAB 4UQTA 3CCLS 1U1OA 1FD8A 2G2OA 3JTOA 3S8SA 4OX7A 4ECQA 1ACMB 2AJ2A 2FVRA 5KOWA 4OL8A 1ZS6A 1XQIA 3FK4A 2KXFA 5F3TA 2W9CB 1N54B 2JH3A 4JV1A 1S9FA 3KNAA 2ROEA 4TXSA 2E5IA 2HGNA 2YKQA 4RUCA 2P6SA 5EX3A 5CCMA 3ISZA 1RT4A 3QFWA 4DL6A 5J2QB 1JKHB 4J9QA 3AY0A 3BREA 2G13A 3M2UB 3MECA 4NYZA 2PN6A 2R4FA 5CYMB 5KG6A 2XSJB 5EWFA 3VAFA 4UOCA 2R8JA 2JC1A 4DL3A 4NMXA 2CQ0A 2GIFA 2GQCA 4Z7CA 4F8RA 1JXEA 1HBMA 3HVAA 4DSLA 1KNZA 2XMMA 4EWTA 3H59A 4X66F 2DPJA 4DPUA 4ENOA 4N41A 1FD2A 3OFGA 1RA7A 3HLUA 3HSZA 2B8QA 2NXUA 2QSWA 4RBTA 2Y9HA 1N48A 2XSFA 4F4WA 1QSLA 5F8NA 3WZ0A 1LQ9A 3DRRB 1IWAA 1TKXB 4ZPDA 1DFDA 3CEDA 4DXLA 3HSGA 5HQMA 1TU0B 5IT9U 3M7VA 4WTYA 1TFYA 5HP1A 3NGUA 4H54A 3CDAA 2BJ7A 2WTFA 3UCUP 3Q2TC 1G2EA 2AIRB 5CD4H 4DPYA 3M2UA 3TQEA 4JI1J 1O8BA 3NY0A 2ADCA 3ISND 4HKQA 2VJUA 4R25A 2BUNA 3ZZTA 5B0BA 2DY1A 1OO0B 4L75A 1TKTB 4K4ZA 4C4WA 5BXIA 5IT4A 5D3GA 5F8LA 1BQNA 3A13A 1OS5A 2CJAA 4YQWA 2W4DA 1JIHA 5D3GB 1C1BB 2XO6A 3K0JA 5FIIA 3N4WA 4OFZA 5GAHU 1B70B 2MYFA 1RTDB 1Y7PA 3CIZA 3LAKA 1N8RT 4NRTA 2M0GB 4QW9A 3RRGA 2B4PA 5BR8F 1S0VA 2QL9B 4M63A 4X64J 2ASDA 1RHKB 1Q86T 2B4VA 2R7QA 3EMTA 2AGQA 4JI8J 1MNEA 2DCLA 4LFAF 2OPPA 2JEGA 2OHDA 4ZOSA 3AB2B 5KFOA 5HVGA 3CCSS 1YLXA 5I42A 3GSIA 1FTCA 1GQEA 2R2UA 2ZBCA 3U7JA 2V8VA 1Q5YA 2FHJD 3MEDA 1LW0B 3UVJB 1N33J 4RKUC 1UFKA 1FRIA 1UEVA 2EFGA 3GPAA 1JLFB 3I5CA 3RRHA 3RB3A 1Q5VA 5D78A 1SUQA 1NZ8A 4PKDB 2B3TB 2RS8A 3RGIA 4CQ1A 3GIKA 3HVTB 4ICLB 4DR7J 1HWKA 1X4DA 1QE1A 3DGPB 4PG7A 4LSZB 2OP5A 3JSMB 2IA0A 1AT1B 3CMES 1CJUB 1GFWB 3CTRA 3PRBA 3BYRA 2HHHJ 3BSOA 2XMKA 2PIIA 4B9UA 3NNAA 2O67A 3MUVP 1V3SA 2G1HA 3DLGA 1K44A 3NOCA 4DOZA 3FSYA 1LWFB 1W25A 1T95A 2OD6A 3F73A 2ACYA 3R2CJ 1UJ5A 1O6XA 2FLOA 1UZDA 3EZUA 1IQZA 1N88A 1TELA 2GZOA 2MZTA 4FYYB 2PEHA 4J91A 2QX0A 4GMKA 4DG1A 4YY3F 2GQ2A 2IAJA 2XC9A 3K57A 1T9YA 1MWZA 3KHRA 3G9CA 1HNWF 4PXBA 1YVFA 3MWBA 3IN5A 2A0FB 5BYSA 4DR5J 2DXDA 3JYTB 3BSAA 3B8HA 3FFIB 4HVZA 5KFNA 2XY7A 5H9EK 2XMUA 2VG7B 1L3TA 2XLIA 2HW3A 4PRFA 4G6VB 2ZNZA 1NHUA 1FKPB 1HW9A 2BVZA 2HRUA 2V8GA 3C15A 4P2XA 5GAGU 3M1VB 5F8GA 3KHHA 2O3DA 4PUOB 1RAJA 4ELTA 2ZUGA 1URRA 2XNRA 3O5TB 4OZ0A 4YDDB 2B4OA 5E3RA 1WUUA 2RQMA 3JSYA 4PXEA 4F7VA 2VU5A 1EAYC 2C2NA 2DHAA 2XYHB 2JWNA 1DQ8A 3R3TA 4YR0A 1CJVA 4GVBB 1UWBA 2G0JA 3TJ9A 2QLJB 3FCVA 4HT5A 1VC5A 4NCBA 1F1BB 4DS5A 3QLHA 4FBTA 4DCOB 4CLKA 1ZM9A 2DO4A 1N0VC 1F5BA 1RT3A 5H9FJ 3MEGB 3CMQA 2HZAA 2LDYA 2ZWPA 4YN3B 1S1UB 3SCIE 5KFZA 1RSCA 4BWMA 3CJRA 2K3IA 1YZ6A 2QRRA 5LXRA 4ER8A 2ZDPA 1R27B 3QSYB 3ET6B 5EHHA 2KFZA 1TTHB 2DRDA 1NDLA 2K3KA 4E2FB 4OZ1A 2KYZA 3HHLA 4GO7X 5JVHQ 4GVLA 4J9MA 3WC2A 3AD8C 2HHSA 2I1RA 2AU0A 3NLCA 4O44B 4DQQA 1ZYQA 3T3FA 2QT7A 4LSNA 2VKRA 3EVOA 3CCVS 2VG5A 1AZSA 2K1RB 2E9RX 2KL8A 2PFFB 1FWLA 3CJ0A 1LW2B 4RW9B 4LQ9A 3J81U 1FRLA 2E1CA 4C11A 1S6PA 4A8FA 3OR2B 4MYTA 2BMBA 2B9WA 2D74B 3OHBA 2CZ9A 3R6LB 3EPGA 2BR0A 3IR6B 1S57A 1KDNA 4UZCA 5SZTA 3OTEA 1UVLA 1D8ZA 3HP6A 2UXDJ 4B3RF 3M2VA 3TARA 1XR7A 1X0PA 1H98A 3NS7B 3J7ZT 2CPEA 3G96A 3BQ1A 4DV1J 2E66A 4MAKA 4QWEA 4U9RA 2D1CA 4I67A 1RAOA 3PW4A 2IAJB 3D0GE 4F3MA 1RLCL 3M9NB 4ZPTR 2BKNA 4Q2MA 1QDUB 2XNQA 1TUGB 2B56A 2DY9A 5GMKa 1B64A 1H6KX 4DR4F 2W8KA 1FJCA 2PMZD 1U6BA 2FYXA 1HI1A 1SJRA 5DG8A 3BGOP 3L09A 5DJBA 5LSOA 1J5OA 2A10A 1G3OA 4P7TA 4CLLA 2MJUA 5L46A 5EWGA 1BMQB 2QFJA 1HNZF 3OXLA 3KK3A 2R2SA 4XPEA 4ES3A 4IQMA 4XAKA 1P6TA 3C3LA 1WNEA 4DSKA 2GO9A 3AD7C 4NLQA 2XGQA 2K2PA 1PJ7A 3QNWB 1WC0A 4F2SA 2I6WA 2BE9B 4DR1F 3RAQA 1CG2A 2VG6B 1EQMA 1NKBA 3ISNC 4LFCF 2VB6A 2JVRA 2G4BA 2WB1D 4DV4J 2Q79A 4NZ7A 1UKUA 2R42A 4M5GA 4LSLB 5HK4A 4DL4A 1SL1A 1HWIA 4PG8A 4R5PB 2HHTA 1EKSA 4TYBA 3OD2A 4W98A 1GK8A 3V6DA 1GMWA 4OHXA 1FKPA 1PC4A 3HFZB 1VRTA 4N56A 3H4DA 1HNIA 2IDLA 1S9GA 3VTIA 4ZITA 1TUVA 1NPRA 2CADA 2V9WA 1UA0A 3A1YG 1X9MA 2JVOA 2J9CA 3JAMY 4RNMA 1WI8A 2OFHX 3EVWA 3MTKA 3RW6A 3W64A 4FNHA 4M5DA 2BA9A 4ZVFA 5ETMA 2F4VJ 4QWAA 4C8ZA 2V94A 3OTDA 2B51A 3C14A 2J76E 3MM9A 5F41A 5LSRA 1H2VZ 5A76A 3K7RA 2HQIA 2B6AA 2L41A 3T6BA 1ZA1B 4DUTA 1X4BA 1HYSA 3GILA 3PHEA 3EICA 2M8DB 2B8PA 3JSMA 3M8WA 4W4MA 3DYAB 2EG2A 3KK1B 1VJWA 2PT0A 3Q8QB 2FVQA 3GIMA 3TUPA 4K0KF 4PPZA 1S5ZA 1HPZA 2GA7A 2RRBA 1PO6A 2FJDB 5HQLA 3PR4A 1BD6A 3H40A 4WXWA 1JLCB 2OEKA 3HFVA 2OELA 2AZ1A 2VQEF 4NZ0A 4B3MF 5C7PA 3AOBA 3HI9A 4K4YA 1IR0A 3R1HA 4CTAB 1FESA 3VAIA 1ZH5A 5E3PA 2VOOA 3P8BB 4CM0A 1HMVB 3QT6A 2DIUA 1RTJA 4MTPA 2W8LA 4Z2XA 4K4VA 1FDAA 2LXFA 2Q43A 3O8WA 2KM8C 4EEYA 1SC4B 2FDNA 3TQ1A 2XM3A 2HQ3A 2KDOA 2OUGA 2ZVIA 2YNHB 2CPZA 2C3OA 1YJ7A 3DDKA 4ZLLA 4ANEA 3CWJA 3J81Y 2E1AA 2LQ5A 3W8PA 2M9KA 1C0UB 3US5A 2ROGA 4AFFA 3UCGA 2IYIA 1SIWB 2LU1A 1N5YA 4FXVA 4X4SA 4KYZA 3BF4A 1HARA 2E7WA 3TAMB 1KKHA 1JLCA 3KLFB 3BQ2A 2H48B 2VPXB 3JQMA 4OI1A 1LKZA 3MR7A 1N4LA 2MKJA 4PEOA 2VPYB 2Z2YB 4CM2A 3DOMA 4UY8T 5KG5A 2UXBJ 4B9TA 3EJMA 1U1KA 3L7OA 1M5KC 2B7BB 4DPTA 1AUSL 2CKWA 3Q8SB 3Q24A 4CLPA 4IH7A 3IS9A 4RBVA 2YX1A 3PW7A 3MEEA 2FJWA 1VQ5S 2E5GA 3PYDA 5FD1A 2VV5A 3MUTP 2CQDA 3IRXA 5AXNA 3BO2A 1BUXA 3I4HX 2IC3B 1VGYA 1F3FA 2V4QA 2VOPA 3C16A 2ALYB 2H5EA 3PYGA 2QA2A 3VF0B 4OQJA 4FS2A 1RYRA 3D67A 2HMIA 4WYLA 4PWWA 2BKOA 2BYCA 4ZVHA 4YDXA 3D3CJ 3CF5Q 2H65B 1Y3KA 3T1HF 4L76A 4WBFA 1FE0A 4P52A 4TU8A 4Q0BB 3MM6A 2LKZA 3SIPB 1J27A 3FFIA 5D0RA 3WQPA 4I64A 2OEMA 4R5PA 1RKJA 1GXTA 4BWJA 5GAGI 5HVFA 1I3OB 2CQGA 3FZBA 2OFGX 4MJKA 4QZVB 3R7NB 3QJPA 1T9VA 3ETMA 2EVZA 1TL7B 4C3LA 1WF1A 3I56S 5F3ZA 2HWTA 2Q66A 5GAEI 3IBCB 4NCGB 2VA2A 4NA3A 4OYAA 3CCES 1YJRA 2QG9B 1GH8A 3GFZA 4A8SA 3TANA 2FGOA 3NG8A 2VICA 4PWDA 3UN5A 3FDSA 3AA8A 1FXDA 2DNLA 3ITHA 1RTHA 3V4IA 2C3UA 4S0MA 3JSBA 1XMQJ 4DR1J 3CCJS 1BY9A 3HT3A 4CI0B 4Z37A 1IKYB 1BXNA 4KPCA 4JI7F 3GFHA 1CC7A 1NB2A 4OYBA 4LUBA 4UUXA 5JJBA 3ZZPA 2VHGA 1NZAA 2DNHA 4RL1A 3RBXA 2JHEA 4FYWB 1M5VC 1QUPA 3WX8A 4DV5F 2HWHA 3RW7A 3TUIC 3MR2A 2AJQA 2RQ4A 1UFLA 2F8HA 3F41A 3NGTA 3DCAA 2MSTA 4L3KA 3OR1A 5LMNJ 5D4OA 2ZH5A 1FEHA 3W63A 2BJDA 3MOZA 3DHWC 2QLBB 3ZTOA 3HHEA 5HMYA 5KFHA 2GX8A 3SI8A 1FNMA 1RHUB 4NI2B 2DPIA 1R3NA 2KKHA 5HVHA 1KLNA 4J90A 1VFJA 3N6MA 4USVA 1BQMA 5CYMA 5A6WA 3V4MA 1Y0HA 2DR6A 4D3HA 1IXKA 2PMHA 4O3QA 3N01A 4GC6A 3BR8A 2ASJA 1RGVA 4YUDA 5AE2A 3H5XA 1R0CB 4OYOA 1C4AA 2YKMA 4YB5A 4X4PA 3A3NB 3NNCA 1UETA 2IM1A 1WHVA 2EKYA 1WG1A 3BGLA 4HDHA 4Y2CA 3SBMA 4GC7A 4OJGA 3UI3A 5C42A 3CO9A 1SJFA 3T5HA 4M95A 2GW8A 2OPQB 1F6TA 1R8AA 2Y3YA 3J81j 1C4CA 4EUVA 3HD1A 4B9NA 4ID5B 4B02A 2POKA 4NCAA 1UVJA 4DHVA 2DH9A 2UUTA 1JLAB 3EXCX 3LP0A 3SQGA 4ZVUB 2C1EB 1H2UX 3K2YA 3LPYA 5KG2A 1VMBA 2MPUA 1C0UA 2XI2A 5E3CA 3DU5A 1NLKL 5CHCB 2ZH3A 2BJ3A 1KEKA 2BX6A 3DRRA 2HBRB 4URSA 5AT1B 3S1TA 3RYLA 1QAYA 2RAQA 3VZHA 1N52B 4HHUA 2LA4A 3HMJG 3OL8A 3FGVA 3LH2S 4KT0C 5CAAA 4FZVA 3K5NA 3H98A 1SBRA 1XNRF 3M6WA 2ATCB 1RAFB 1S9EB 1S48A 2BJ9A 3GG1A 5DGBA 3PZPA 4FYVB 3Q8PB 2P9CA 4HTJA 4IRDA 4P71A 1AUDA 3BN7A 3D0IE 3ZZZA 4NLTA 3MFHA 1KC8T 2UU9J 4C9DA 3OJSA 3SQOP 2NREA 3I0RB 2L48A 2OH2A 2R7SA 2XLKA 2ILZA 1V6HA 2WOMA 3C8YA 1JJ2R 2JSXA 4CT9A 4KHPJ 3NGSA 3M05A 4ZVSB 4R8UB 1S6QB 5GMEA 1XMOF 1RTHB 3V4IB 1XIQA 2F5GA 4P6QA 2Q6CA 2IMWP 3DLGB 4FN5A 4HTIA 4LFCJ 1FJ7A 1IKWB 4X65F 4ZPWR 2HLUA 3M8SA 2J6UA 3ILJA 2D3OR 4CLUA 2XTJP 3VV2B 3RBEA 3HCXA 4JP8A 3AT1B 1UJ6A 2DR5A 4JV2A 2DXFA 2UUBF 4DUYJ 4JI4J 2EG1A 1RISA 1I51B 2CPHA 1AYEA 3AJDA 2HRTA 2APOA 2BW2A 2GFFA 3T5JA 1VQ4S 2JLEA 3KKFA 4ZVQB 3MD1A 4HEA9 1QAXA 4OZNA 3OFHA 2V63A 4M5MA 4NA1A 5AXLA 2XMJA 5CH7B 4DV5J 4OZ3A 1NK5A 3FEYB 4C11B 4NXMF 3UWTA 1RADB 1CJTB 4H4OB 4V19X 2NR0A 1U1MA 1MROB 2EKNA 2R9LA 2E7XA 1NHKL 3N79A 2Z2ZA 3QPIA 4KHMA 4WP9A 1SJ4P 4RW8A 4I68A 4KC5A 4DR7F 4EBDA 3GV5B 1U1PA 4C98A 3KG4A 3W60A 4BCAA 1NK4A 5KFJA 1N34F 1FVSA 3CJ3A 2MTLA 3ILOA 3TZYA 1S0OA 2HQDA 2AX1A 4RPFA 5I3UA 1CQNA 3V5RA 1KR4A 3F44A 1NKCA 2E7VA 2E1RA 1K8AT 2HZCA 1IBLF 1FK9A 2YNIA 3LGMA 2YNFA 4RUHA 3H90A 4YP3A 2CQ4A 2HAIA 4WPAA 4EZ6A 2J9DE 5E33A 4B17A 3DRXA 4O3NA 3J80U 3HHKA 2OLWA 4TNOA 4X64F 1Q78A 4J9KA 3HZEA 3A3OB 3HDSA 3D0HE 1G4CA 3HF5A 3N28A 3LP1A 4NE9C 4WP8A 2C42A 2FZGB 2J0XA 1SH3A 4LF4J 3NMAA 4MKAA 1NPPA 4LF7F 2LCWA 4AT1B 1LWEA 3TAMA 1WDTA 3CSKA 5M2UA 4V1Ak 3KDNA 2DXEA 3AA9A 3DRPB 3GCXP 5HP1B 4DS4A 1IBLJ 4RW4A 1J5EF 2F1FA 1LEOA 1VQOS 3OR2A 4ED8A 3Q8UA 2F65A 1TL1A 3M8ZA 3BYPA 1F9FA 1WC1A 2C2MB 3Q89A 4MK7A 1ZAVA 5L38A 4N7TA 3IWXA 4JI1F 3VR1A 1KQKA 1L3KA 5KFSA 1EIYB 4DR6F 5KFBA 3R7BB 4UUWA 3M9MB 4YOEA 5D15A 2GHPA 2V2QA 4CZCA 2NZCA 1LWEB 1SV5A 1PBAA 3NGRA 4R0EA 2VQFF 1S1TA 8RUCA 5A8RA 1W2BR 1WACA 4X62F 3OL6A 1M90T 1RHQB 3FBBA 5ETTA 5K8PA 4BS2A 3N5BA 2B4UA 1NK7A 5C42B 1WC4A 1H7XA 5KFLA 4CH7A 5RUBA 4ECWA 5KFUA 3I0SB 3G6YA 3OFEA 4ECXA 2IRXA 3A8IA 3CB4A 4CNZA 5KFMA 4DL5A 2FJEB 2NSCA 2AYMA 2O01C 3IG1B 4RWXA 3CJKB 1RT7A 3FCWA 4DLEA 1MU2A 2CJKA 1S7IA 4JI5F 4CH0S 3RAXA 4U96A 5C24A 5THWA 2RUGA 1RWMB 2KJVA 2Z58B 4CLYA 3B4DA 2X3GA 4L72B 4EU0A 5KTQA 2GJFA 4YY3J 1NM2A 1D3WA 2E29A 3VAKA 5MAOA 4DLGA 4NL5A 4OYPA 4ZPAA 2FPHX 2AYBA 1M0SA 3F0NA 3FBEA 3LA0A 4FNIA 3KJVA 1KN6A 1XERA 3Q86A 1TZ0A 2W4PA 2W1BA 2WAQD 4ED2A 4PPDA 3QT8A 1YJNS 2DK2A 1SB6A 1MW7A 1S72S 1UW9A 2R8IA 3HO1A 1M1KT 2I38A 2FHMA 1M5HA 2XQCA 2A1BA 2BM0A 1EQ0A 3LUYA 3GWCA 3MAAB 5KFTA 3ELHA 4DV0F 3CC4S 1DURA 5KT6A 5L8RC 4GKKF 5G0RB 5KFDA 1IKYA 1PYOB 2BJ1A 4NMLA 1ZZNA 1LV5A 2LQ8A 1SJQA 2V4JA 4QW8A 4NEZA 2DIVA 3OTCA 1WELA 1R43A 2Z30B 3QWUA 1CQMA 2C3YA 3PO4A 3KK3B 3MMBA 1RT7B 1YG0A 2WW8A 3HSDA 3PEHA 2B9EA 5HJXA 4OZ2A 4LR7A 3RBZA 3TA0A 4ES1A 4HT7A 2AJ4A 3PJ9A 4PYAA 4QIWD 2RF2B 4C0BA 2XBPA 5LT5A 4JI5J 3SSQA 1RU2A 1S97A 1N36F 2WONB 1CJKB 3C6UA 2XS7A 1VBXA 2YBVA 4NYPA 4DV4F 4ICLA 1FRMA 3SZ2A 2IY5B 1RT1B 3MI7X 2ZD1B 2PO4A 3N5FA 4IG3A 3PTWA 4GRSA 4OI2A 5G0RA 4ANDA 5FLXU 2GJIA 2BJEA 3MZIA 4DR3F 1RK8A 2MGZB 4N8NA 3VVUA 4DMZA 1JLFA 1UW4A 3BM7A 3MMAB 4RUAA 1J5EJ 4I0WA 2ZM6J 3UD3P 2BABA 1TKXA 1N32J 3GCWP 3LGNA 3UQSA 3OPKA 3GTYX 1UVNA 2I8EA 3H25A 5IQ6A 3QT5A 4Y3CA 4JYAF 1U1RA 4YMEA 2QV6A 1S9EA 3AXKA 4O3OA 1ZPWX 2HHPA 4ZP8A 4M5KA 2MHNA 2ZHBA 2QE5A 4EFAC 4QU6A 1UZHA 1H73A 3SMZA 2XMTA 5HAOA 5M2PA 4WJBA 2UUAJ 1LNQA 2HNZB 3D6HB 2HRYA 5HO4A 4LSNB 2M52A 2WW4A 1F2HA 2E1PA 4QPTA 4X4TA 2ALZA 5A2QU 5DETA 4ZN1A 2NSBA 4E98A 2WVFA 4USTA 4ZCKA 3ZZ0A 1HNZJ 2UUCJ 2EI5A 2EFOA 5ETVA 4ED4A 4LBIA 3KLHB 1TKTA 4F67A 3W5ZA 2MQOA 3UE2A 4CH1A 1SKRA 2PEBA 1FDBA 4AYBD 1F3VA 4V19J 2WSFC 4DR4J 4F02A 3TOQA 2ADBA 1NPKA 2ZC3A 2R7VA 4I6YA 5I3UB 4KHRA 2A2DA 3C14B 2WSEC 5K5MA 5U47A 1TVRB 2UV8A 4MYUA 2PDAA 2VZ9A 5KFQA 4X4UA 1PILA 1SH0A 3E8OA 1K47A 3W2VA 1OYEA 1W2IA 3UNGC 4NLVA 3R5BA 2GC8A 2YNHA 5KFEA 2J7KA 4BBYA 2W9BA 4EYIB 1S9GB 2IPOB 3RR7A 3H20A 1UEKA 1MROA 3MM8B 5KT5A 2VDIA 5B0AA 1PYTA 3MDFA 3QWPA 3T9ZA 3LW5C 1YBUA 1RTJB 1VDHA 5L9NA 3TZZA 1H38A 1N5QA 1U26A 4Q44A 4AQYF 1HI8A 4ILRA 4UTGA 3DHXA 1NB7A 3DRPA 2YH0A 4ZVOB 5K14A 2RU9A 1S12A 3A8KA 3WHIA 3MD3A 1VRUB 2UUBJ 4JI4F 4M94A 1F9HA 2IRYA 4LT6A 1RTIA 2GGPA 3W2VB 3V81B 1GMVA 4PABA 3Q8RB 3DGVA 1IN0A 3LP0B 3ET6A 5K9FA 2AWZA 1TQLA 3QIPA 2LLZA 2PE8A 4HACA 2OAUA 1HI0P 3OJUA 1FK9B 1RHRB 2J7WA 3NEKA 2GQQA 4PYDA 3G8QA 5IM0B 2VQEJ 4F3OA 2MSSA 2KXNB 2AZ3A 3K8VA 3HD2A 4OYMA 4U6PA 2XLJA 2BV3A 1JQGA 1NK8A 3IM9A 3FSXA 5CABA 3QIPB 2LEBA 3CCWA 4C7QA 1CJUA 4WU3A 1TK5A 2IDEA 1T05B 1WDDA 3ZZUA 3G87A 1WI6A 3CPWR 1VC0A 2GGPB 2LDIA 3V81A 2QZ8A 3RAMA 2H4WB 2MZRA 4OHVA 3W1YC 4LQ3A 2HNZA 2HHUA 1CVJA 2JEIA 1RACB 3M2VB 3KOAA 4XIUA 3TYTA 2M2BA 1GT8A 2C3PA 3PACA 2FJBB 4LREA 4OJ1A 1HLWA 1HBNB 1OPZA 2DNZA 5H9EJ 3TO8A 3R6GB 1J2VA 3CDUA 3KXDA 5C5JA 3BQ0A 4KTQA 1A7GE 3HVRA 1U8WA 2NPIA 3L95X 1I94F 3MM5A 5I42B 1YDLA 3CCRS 2XYGB 1JLQA 2HQFA 1IM6A 1CS4B 1U2RA 1Y4ZB 4WWSA 2PI5A 2RMLA 3OQ2A 3NGKA 9ATCB 2H9ZA 1X7VA 2DR9A 1O0PA 1FX2A 2GIRA 1LXJA 2ZD1A 3GYNA 3QZ8A 1VQMS 1R8CA 5KFWA 4DL7A 1FKAF 4ECRA 3GB0A 3VGUA 3ZTRA 1S1WB 5AJ3J 4X4QA 2XCPA 4YEAA 5GMDA 3KK2B 2EFVA 2OO4A 5D77A 4USMA 3OTOF 2O1PA 2DR8A 3IG1A 1MN9A 3NWRA 5FDLB 2VODA 5D0EA 1KRPA 4I2QA 4O4GB 2AYEA 3PYFA 5E41A 1LK5A 4WFAQ 2DNKA 2C2OB 4NCGA 1TL3B 4F4AA 2UUCF 4LF9J 3TP2A 5L1JA 1R6VA 3CJ4A 4OI3A 4DFMA 4WKRA 1VRUA 5KG1A 2JFDA 3PIOQ 2HKEA 4WFYA 2V34A 1VBZA 4X4NA 4YR3A 3PHTA 4CWBA 4O3RA 4DV2J 1UCNA 4P2SA 4NLYA 2V4RA 2XULA 3BO3A 1A0OB 1KOOA 1IKVB 1X4HA 3ZZRA 2Z8QA 2VPWB 2NYIA 1RAEB 3KJFB 1RCOB 2JDJA 3H2LA 4M5IA 3K89A 4MFBB 4ZDNA 2IVFB 1CPZA 3JTPA 2FHKA 5EDWA 1UFWA 2X7IA 4ZP9A 4F4ZA 4B3OA 3UN3A 4J9NA 4QYZK 1UTAA 4QWBA 1OSCA 5E3AA 2KZMA 1SIZA 3QFHA 3PM9A 2LXIA 5KAKA 3THTA 1HQ2A 2MQNA 2HQCA 3AQOA 4KB7A 4FF4A 1X5PA 2YNGA 3KJNB 1CJKA 4K50A 3A4TA 2C2RA 1BE4A 2KFYA 4JBCA 2HLTA 2IJNA 3MPWA 3E51A 3G2XA 4C2MA 5CQGA 4A4JA 3GIIA 1QAIA 3NS5A 1DTQB 4WZMA 4QR0A 1YWXA 4I69A 2VQFJ 1FNXH 2V9KA 2RS2A 2NUHA 1EETA 1PYSB 3C6TB 4OI4A 1C0TA 2I0XA 2MY8A 2V6AA 1BQMB 3H42A 3HJVA 3QMQA 4FP9A 5J1EA 3KLFA 2ZJRQ 2P5VA 3K5PA 3D1QA 1RB0A 3R5CA 2RJZA 4I7FA 3NBPB 4DFJA 3QGIA 1VYAA 1N5YB 4QIGA 2XMVA 3G86A 4IG0A 2VD3A 4NXNF 3RUBL 2EBGA 2CXEA 4DSFA 1ZM4A 3MM5B 2CNKB 1NMEB 2C3MA 4P7VA 1OWXA 2GNKA 2FTRA 3QRQA 4DV1F 3EDRB 4I6AA 3CDBA 4IR9A 2NXCA 2F9DA 3GU0A 4TY9A 2BQRA 4MK8A 4ZJLA 2IC3A 1VQYA 2QLWA 1T9XA 3NAHA 2HFZA 4ZN3A 1H2TZ 3JXOA 1E6YB 3HHNB 4PG4A 2V8PA 1H7WA 4DQRA 3T1YF 4F25A 1VBKA 1S1VA 4G1PA 4ANCA 4O4GA 1U2FA 4ZVGA 5IV3A 1TKDA 1BQNB 1K73T 5IC4B 2GVDA 2B6AB 2HSEB 1SPBP 1WHXA 4MKBA 3M8QA 1XJWB 1T03A 1QE1B 2VFVA 1DJ0A 2YX7A 2ZH4A 1QLNA 2YVSA 2BACA 4F36A 1TL7A 2GAGC 3I32A 2HHWA 2DBBA 1Q8LA 1JB0C 1EP4A 3HSJA 5LL6d 4F0KA 1SJ1A 4KGVB 3AJ2A 2A3JA 2FLNA 2KJWA 1XTZA 3PW2A 1HL6A 1RQ0A 4LIRA 2ZNYA 3D54A 2Y8YA 1N6QA 2X3DA 2OTLS 4DZDA 1QSSA 4P74A 5K8MA 4Q7AA 3BPDA 3CDEA 3SV3A 1MLAA 4EK2A 8ATCB 1Q7YT 1KVJA 3C46A 4DPWA 3PX0A 4LSLA 4IFVA 1B0TA 1H0HB 1S6PB 3VGVA 4K8RA 2XS5A 2OD4A 2VH7A 1FRKA 2DGUA 4CO1A 1YBAA 1TV6A 1WF2A 1GTHA 2D7SA 3QO9B 1RI7A 5J1PA 5H1SV 4EYHB 1DQAA 4JI0F 3C6TA 3ZO7A 4I6WA 2I2YA 4NLUA 5T41A 4LF6J 2FLLA 4Z7YA 2ZC4A 1Y00A 3IS9B 3SQGB 1KD1T 3OXFA 4UT4A 1HD0A 1T3OA 2YPZA 3AOCA 3NCRA 4LF1A 4CLZA 3HM9A 4I2QB 4ETXA 5DDOC 2DTJA 2KG0A 5DDQC 2YNFB 1KOHA 2J0QD 2QA4S 2VFTA 4IOBA 3OFFA 3W61A 3Q23A 4EBEA 1FFSB 1IWGA 1D0EA 3LTOA 2W7OA 2CDRB 4Y0FA 2KO1A 4OYXA 4QBUA 3VAMA 1WSVA 2UU9F 1NK6A 3TRGA 1RWWB 4USUA 1I94J 1VBYA 2M3DA 1KQGB 2ZOGA 2AX0A 2KVIA 2DHHA 2J0SD 1Y5IB 3RR8A 1RWNB 2W2NP 5ETLA 4C97A 1R0AB 2QN6B 2WSCC 4WP3A 4J9RA 2CPFA 5DM7Q 3AAWB 4UOHA 2KT3A 2VDHA 4D3GA 1PGZA 2EFNA 2HYIB 1GNKA 2HBZB 5E0OA 4P9SA 2OSQA 3ZTPA 3UR0A 1KBRA 1Q0NA 3IP0A 4LRDA 4DBQA 3LWLA 4RU2A 2OIHA 3HVWA 2G0CA 3KLIA 1N33F 1PAEX 2YWEA 2HEKA 1B0VA 1S6OA 4ZCIA 3EPIA 5E2QA 3NCPA 4N47A 5B09A 3SSRA 1VK8A 1JJ4A 4YHHF 2YX4A 4NWBA 2CJQA 3MCSA 2QO3A 1ZTWA 1T0TV 4H4MB 4MIWA 4OHWA 4QCLA 4KE5A 4ZPVR 3OVSA 4H4MA 2OPSA 2BOPA 4OYWA 4PWDB 4A8YA 3FQLA 3G8TA 2JOQA 3SV4A 1X4FA 3V6HA 2CRLA 2M4MA 1F60B 2I9SA 4BHQA 4IRKA 3M8PA 5KFGA 3MCOA 2YWWA 1RWVB 1HBUB 1KSPA 1IKXA 4CYUA 4JOUA 3RB6A 1PSDA 1X8DA 1M5SA 1ZAWA 2ZHOA 4KKOB 4K5SA 1NJZA 1SQEA 4LF5J 4NZ6A 1X60A 5A8WA 3W9IA 4P75A 3CUNA 1Y5LB 4J9VA 2V2VA 2ZKUA 3ETOA 3M30B 3HFKA 3QT7A 4RW6A 5DQIA 2UVWA 1NDKA 2CWKA 3A8EA 2W25A 2BOAA 4OLOA 2ZKTA 5DRKA 4YB1P 3L3CA 5IT9Y 1VJQA 3HK2A 2GJ2A 5J2MB 1FRJA 2DJWA 4Y28C 2ZZTA 4DR2J 1AZSB 2K1RA 1NAQA 1JNZB 1FRXA 2HS3A 1L3UA 4F0MA 4A8XA 1HR0F 5L9XA 2AEJA 3DLHA 1NXIA 2DGXA 3D1OA 5KFRA 3HULA 2MXYA 3UDEA 3MHYA 5IXUA 4UY85 4DG1B 1Q1KA 4NLWA 5IZHA 3I55S 1U1QA 3DMJB 4EO6A 1D1UA 1WWHA 4OX8A 2BDPA 4WCEQ 2OPSB 5C24B 1IM4A 3MR6A 1H3DA 3DRSA 2IJFA 4NLOA 4DSIA 3FEXB 1G7CB 4P10A 3EZOA 1BHNA 2HHVA 1FFGB 4LF6F 2DNRA 5KFIA 5KFVA 5KFPA 3AODA 2RVJA 3ZFVA 4UZBA 2C2DA 4DEZA 2XO7A 3DOKA 2DGTA 1FF2A 3U02A 2CVEA 2ZEJA 5D0HA 2GMJA 1MMNA 2GMLA 3M2RA 5MLCV 5IOLA 4KV8A 1LFWA 3CNQP 2HURA 4XO0A 4KY3A 1F5AA 3FC9A 4AUKA 1SUQB 1QAJA 2MQMA 3PRDA 1R7IA 4ED5A 2RHQB 4F2RA 3MAHA 3N9UC 2CNNB 4YB7A 5T7LB 5C25A 4DR5F 3MM6B 3O2IA 3RB4A 1T8EA 1SL2A 1N0UA 2RKIB 4FKXA 4NOHA 3D7SB 1C1CB 1KFSA 5KOXA 1IUJA 1C1CA 2EBEA 2A2CA 3D6FB 3J7YI 3JB9k 2JEFA 3GR1A 5BJRA 1FE4A 2Y0SD 3HHLD 4HH0A 4KRWA 1VQPS 2BRKA 1FA0A 2M88A 3NOGA 3D6TB 2AGOA 2VFSA 2V8DA 5CD4A 4A8KA 2JEJA 2MGZA 2L9DA 3HKZD 5A0YB 1BLUA 3PX6A 2BZ2A 4GKJJ 2VBZA 5BYRA 3LP2A 5JMNA 2ZH1A 1SL0A 1R89A 3BPSP 3PW5A 1CULA 3FUYA 3KLGA 2FIUA 1XBWA 4IFYB 1JNRB 1KTVA 1NO8A 1OPIA 1YGYA 1S1UA 2DNNA 2PI4A 2DR7A 4A8OA 1U24A 5C2CA 3I5BA 2KRBA 5F9NA 1SC1B 4J9PA 1HYSB 4FF1A 2VBXA 4CO2A 1XEZA 2B9YA 2V8HA 1UWAA 5HJYA 3WBZA 2N7CA 1CC8A 1ZM2A 3DGPA 1YKWA 2C2ZB 2GVZB 3QGPA 4N77A 4NYOA 1RT5A 3KLEB 4LJMA 4F4XA 4GKJF 2CG4A 2JX2A 2V4JB 4IDKA 2D9PA 2MQPA 1WF0A 2B5JB 5A0YA 2WB4A 4RNFA 4WFBQ 3PV8A 1FXLA 4W90B 5SUHA 3LGHA 2LMIA 4JI8F 1YRTA 7FDRA 4IFVB 2OSRA 2FVPA 1DZ5A 3NAIA 1JJCB 1XMBA 3M1VA 3IRWP 2P9GA 3GSDA 5D8HB 5F8MA 5HLFA 1HNVA 2F3JA 4TVAB 4OZJA 3CCTA 4OI6A 4LF7J 1WG5A 2VFUA 4RX6A 4LFBF 1RKIA 1U1LA 2L9WA 2FVCA 4TLQA 2F63A 2C2EA 4L6V3 2HZVA 4KGZB 4DR6J 5I3PA 2KFNA 2QGFB 1KQSR 2XSJA 3CJ5A 1X5OA 3C66A 4OX6A 4DU8A 5HROB 4JI3J 4LF8F 1EP4B 1PJ6A 3CD6S 4Q5VA 2DHSA 1RBOB 2MZJA 3K5LA 4PQUB 2KHDA 1C0TB 3DI6B 4JUZA 2HAFA 1O5JA 1YZ7A 2UVRA 1N32F 1AFJA 1FWPA 1MMLA 3GG0A 2RF2A 2JJ4D 1WKLA 1REGX 2VL1A 2WCXA 3JQJA 3KG1A 2UV8G 1U49A 3L9ZA 4QIVA 4LFBJ 2DD8S 2ATLA 1J5OB 5F8JA 1WC5A 1YQHA 1Y5NB 1W26A 2YNIB 2MHEA 4XDCA 3UD5A 5LXYA 3CC2S 4ED3A 3THVA 2IBOA 3VQSA 3DRSB 3IFEA 4AL5A 1Q81T 2BM1A 3RZAA 3GFXA 3M4XA 4UOGA 3Q0AA 2VPZB 2KU7A 2ZH2A 3X1LB 2E5JA 4AQYJ 3HHLC 2EC0A 4F4YA 2OMOA 1X4AA 2M5YA 5J2NA 4MT1A 2KHCA 2RUSA 3UDLA 3VCDA 2ZM6F 4MKYA 1ITPA 4TY8B 2MKIA 1JLQB 3EGNA 3N0VA 3OXGA 1RDRA 3HHDA 1HNVB 4B08A 4ZJOA 1U47A 4C8YA 1HA1A 5ETOA 2V2KA 1GXUA 1RE1B 4DR3J 1EX8A 3PX4A 1RT6B 1U0SA 1VIXA 5J2PB 4IUFA 2HS4A 2NCKL 4KFBA 2QIFA 2UZAA 3U1LA 4X66J 5I4MA 3TAPA 3T19A 2DVIA 1YIJS 2DNYA 4FKYA 4ED0A 2ZH8A 4FDFA 2VONA 2Z2MA 3I9V9 2QYGA 4KPYA 5DDRC 1FO1A 2D3O1 3IA0A 3Q22A 1U7LA 1QD1A 1RAAB 1Z1ZA 2WHOA 2YQ1A 3B54A 1XNQF 1U25A 2J5AA 3CCZA 4DQSA 4TKTA 3TUZC 4USKA 3SSSA 1C1BA 2CFXA 4NLXA 2Z0GA 1V3RA 4USIA 3UR3C 1YI2S 2F8MA 3IAS9 4MKVA 5G4DA 2UXCF 4JB8B 3PIPQ 4N8OA 4DX7A 4ZA1A 2BQ3A 1FTRA 5AJ3F 2YQ0A 2COLA 5IWAJ 4ZPBA 1S6QA 3Q8VA 1WORA 2CPJA 3LP2B 5IQQA 1OQ6A 1Q7LB 2FB0A 2FD2A 3T6JA 1T3NA 4B3MJ 1VHFA 5J1NA 3G8SA 4FYDA 2YY3A 2F4FA 2RHSB 3QO9A 4LR9A 2WVCA 4FYXB 4QIEA 5LOQA 1R8PA 4P2MA 3EYZA 3POTA 3QSIA 3ZTQA 3W9JA 4F50A 2M70A 3IC1A 4NI2A 1CJTA 4H4OA 4C6AA 1B99A 2W01A 3LALA 3IWLA 3PW0A 2UP1A 2QMUB 2XGPA 2RB7A 3D28A 2MJNA 3OR1B 4L74A 3G4SS 4PUOA 2CVIA 2HIYA 5KT7A 4UQGA 1HNXF 5AXKA 4A8WA 4CO4A 4CLSA 4WFZA 4DV7J 2RRNA 1WJ9A 2VG5B 4K59A 3VGTA 2CJBA 1U2CA 3E01A 5LSLA 2ZHAA 2R7WA 1SXLA 2UVUA 4LVOP 3AD9C 4YS2A 2DH8A 2DISA 1CSJA 1YJWS 5DDPC 3Q2SC 2VASA 1T9WA 3SFUA 1TL4A 3VVTA 3KK1A 3N6NA 1MMDA 1TVRA 4EMDA 2OI2A 3OSPA 3D5MA 1RYSA 3CJTA 1APSA 1N5SA 3SCKE 2DYAA 4ID5A 2HFUA 3LANA 1TUWA 3BR9A 2R8KA 4C8MA 4TU9A 3W3SA 4WU2A 3RJMB 1AXQA 1LWFA 5B0EA 5DQGA 1FKOB 3W9HA 3UD4P 4B3SF 1G6BA 4U8VA 3NWGA 4K2JA 1JLBA 1DTTB 1MG7A 3DMJA 1HNXJ 2CQIA 3Q83A 3MMBB 4KR0B 2AV5A 1XC9A 4FXDA 5CA5A 1ZBTA 1XR5A 2VC1A 2AEFA 3DN9A 4AD6A 3KUEA 1D9AA 8AT1B 1IVZA 1U6ZA 1TK8A 1E6YA 5KG4A 5IFMA 1V5IB 2FHOB 2P6TA 3CVKA 3QAEA 3OHAA 4QU7A 1WEZA 1TV6B 7AT1B 3M6UA 2N3LA 3CDWA 4G65A 1UEUA 1Z2LA 4M5LA 4QQBA 2D3ZA 5EN1A 4H4KC 4KIAA 1RU1A 2MY7A 4WK3A 3CCUS 1QVGR 2AYGA 2E5LJ 1WG4A 5KFCA 3HXMA 5HBMA 5GAEU 3J7AN 4G1QA 3EXYA 3MPYA 3C15B 2E9TA 1NK9A 5DO2A 2J8AA 2VG6A 2X1AA 3HT0A 4DFPA 3DOLB 5ETQA 1HHTP 4F0HA 3RB0A 3L7PA 2DGWA 4RNNA 2IM0A 3TVYA 4TQSA 2PA3A 3M6VA 2CQ2A 1NBEB 1TFWA 2QC3A 3GFYA 2W2OP 2OGUA 3BEGB 3MCMA 2CNOB 2V2ZA 1WC3A 2FUG9 3O1LA 3CT9A 4QR1A 1IQTA 2EW9A 1VQSA 3PFOA 4OV1A 1RAHB 2NXEA 2KM8B 2GVZA 1R0BG 4XDDA 4C48A 4Y00A 1VHIA 3LPEA 1MU2B 3ZNJ1 2E9ZA 2RDIA 1I6JA 4BDPA 3KLHA 1ZA2B 2DNGA 4Y65A 3BJYA 1LK7A 4B3RJ 1SCJB 3PCOB 5KT2A 2ZBIA 4QPXA 1KQFB 3M6XA 3I0SA 2OKQA 3AJ1A 4LRAA 2PA8D 3UCZP 1RTIB 5A8RB 4F26A 3IM8A 4CO5A 1WKJA 2YPYA 3DLEB 2WBRA 3A3PB 3DXSX 1T7PA 2JLFA 2MLYA 3P5TL 4PQAA 2FY8A 2ZZNA 2QMXA 1HD1A 1KONA 3R9LA 3CULA 2QL7B 5H9FK 1GTEA 1BQXA 2HPUA 3ULHA 5K8OA 3BDEA 3C19A 3QIDA 1QTMA 1FEEA 2DKOB 3DFEA 4UOFA 4C0HA 2DHGA 1X4CA 2DNOA 1FI4A 3B6BA 3POTB 5ITHA 3J7Z5 3GIJA 3IGNA 3E2EA 2W9BB 1IKVA 4DWIA 1KHWA 3DM2A 1NSQA 4F04B 3UDCA 1NSPA 2QSFA 3EUNA 2ZBQA 4QR2A 2IIHA 4CTAA 5AE3A 1PKUA 4RW7B 2QFIA 2CQPA 4BC7A 4ZLNA 4GO5X 3DLLQ 2UUAF 2V68A 4DSEA 3DLEA 4PCQA 4IG3B 5IC6B 3S6EA 4ECZA 2F8EX 3H2VE 4AXIA 5KG3A 2R7XA 1MWYA 1F2GA 4K5RA 4OJ3A 3MMJA 1RTDA 1OQ3A 3DDNA 1NJXA 3AXMA 2VBYA 2XMWA 4NEYA 2IA6A 3PKMA 2W9CA 3F56A 1UVMA 5M2RA 5EWEA 4KGKA 1IJEB 2RH3A 4DPOA 4JV5J 1AW0A 2QLFB 3CD0A 4B9MA 3R2DJ 2B0GA 2K7KA 2ZWOA 1ZZFA 2NXJA 3FNNA 1S79A 3ZTSA 1FDDA 2SXLA 4HL9A 1B4SA 1HKAA 2MZQA 2EC2A 1NSKL 2OPRA 2XWYA 4DZ6A 2XHWA 2KTQA 2LA6A 2WK4A 3GR0A 3TX8A 4K4TA 2VF3A 4JV0A 2ZJQQ 2FHJA 1NJYA 1NUEA 1YITS 1HNIB 3OL9A 2QLXA 3T1AA 4DUYF 4NLSA 2DO0A 3K17A 3NNHA 4CLWA 4FVCA 3QJLA 1X0FA 3OVAA 3TR5A 4J9OA 2IM2A 4K4SA 4ZVEA 1S10A 3ONQA 3G6VA 1S4EA 1M5PC 2CZ4A 3C16B 3H2UB 3I6PA 3ILLA 4IYQA 5J2PA 3NBPA 1Q82T 1IBMJ 1B3TA 1IBMF 1JLEA 4B9LA 1R6YA 4CLFA 2RDDA 5KFYA 2LXUA 4WF9Q 1EETB 1VQLS 3MEEB 1HQUB 5A8KB 1PBUA 1I1GA 3M8PB 4USHA 5ETKA 5CCLA 5L1KA 2F40A 2DB1A 4A47A 2CWXA 3PEJA 4IRCA 1DTTA 2HVDA 3ICLA 3PJXA 3T41A 1OIAA 1S1VB 1U09A 2F4VF 3NP5A 2KRRA 3QATA 2DRBA 5DG9A 5IM0A 3W65A 2GCFA 1WEYA 1QTNB 2PC6A 2XWXA 2YQ3A 3HVTA 3MPUB 3MOJB 4J5OA 3UNYA 2YKNA 2Z56B 4HR2A 2RE1A 2RILA 4A48A 2RT3A 1QSYA 2QA1A 1S1XA 2L3MA 1BWEA 3PDNA 1GMUA 2HGMA 2WVDA 4PG5A 1KS2A 3BGRB 3MEDB 2KZZA 2RQKA 1S0NA 1TAUA 5CZVA 2XY6A 1P1TA 2HIQA 4ZVTB 2ZBPA 2VIHA 1BGXT 1O51A 2JNJA 5A2QY 2CAJA 2OPPB 1D9DA 1HMVA 2MMYA 1VQ9S 1NJWA 4DX8H 5EUHA 2DGVA 4ZIWA 1U0HA 3I4PA 1LW2A 1SJ3P 2BXJA 2QMWA 2DEJA 3K59A 3E3XA 1PG5B 3EGZA 1MSWD 1FHTA 1LWXA 1FFWB 5J1EB 1R0AA 4LF4F 4PZVA 1D8YA 1JKHA 2BE2A 4URQU 2X51A 4HHHA 2N82B 1S0MA 3R5JB 1NU4A 4WXOA 3LP1B 3D2WA 2FVSA 4OHZA 4OX9J 5F0UA 5DS7A 4FXWA 1QY7A 2VC0A 3DOKB 2ABYA 4ZCLA 2EK6A 1ROFA 3R8YA 4PWUA 3TZXA 3J7YU 2XI3A 2RRAA 2UVVA 3PR5B 4IH5A 1FKOA 4WFXA 2DNMA 4A8QA 4ECTA 2JZ5A 4X4OA 1WOOA 5B0CA 3HKWA 4HACB 3OLAA 1RT3B 4OI0A 3OLBA 1HWJA 2J6TA 1N5VA 1S6UA 4B9VA 3OW2R 5IS2A 3P3DA 4A8MP 3LAMA 1FVQA 4LRFA 3DNCA 3KFWX 5KFFA 4YFUA 1IBKJ 4DDFA 2ACMA 1NH7A 4LVNP 2DGOA 3CCQS 3LQVA 4ED7A 2ZDOA 4HI2A 1P27B 4ZIVA 3PKYA 4LF5F 2H1YA 1TR0A 5L1LA 4E8UA 2AT1B 2AP6A 1LXNA 1T9UA 4OV6A 5FLXY 3EGWB 2XMAA 2V5HG 1BWVA 4KO0A 3TVKA 3JAMU 1H72C 4DV6J 4ZLJA 5HL7Q 4KO0B 3WC0A 4DV6F 2ROPA 3EZ5A 1PC5A 3KYLA 4LF9F 3UDVA 5HANA 1Q4RA 2ZH6A 1EHWA 1TL5A 2C28A 3CE8A 3JYTA 3RU0A 1AFIA 2KN4A 1SH2A 5DZ7A 5GVQA 5B08A 3BO4A 2QEXS 1LFPA 1IBKF 4C8KA 3KMQA 2W4CA 2ASLA 3MUMP 4X65J 4B3TF 4MIBA 5FDLA 1VQNS 4EBCA 4B9SA 2W2MP 3BH7B 4K2XA 3ZC4A 4N5SA 2YKPA 1JXLA 2HK3A 1VIOA 2CYYA 2DHXA 3TUJC 2R2TA 1HQEA 4OX9F 1U8SA 2AQ4A 2CIMA 3HJFA 4JI6F 3FKBA 3AQPA 4DQIA 5DLFA 4C8OA 4L3NA 2X1FA 2F9JA 1HWUA 1QUVA 4Y6IA 1UWBB 4LRBA 4R0JA 4RLEA 1U1NA 1XMOJ 1FCAA 4P73A 2D3UA 1CS4A 3WX4A 2BQUA 4KHPF 1URNA 3T1HJ 2AMCB 3UPFA 2HVHA 4USWA 3W5XA 4DJBA 3VAHA 2HFOA 1VLOA 2LU2A 4BC9A 4CNYA 3EWGA 3K5MA 4LIWA 1TAQA 3IAM9 3VAGA 1NCLA 2P8IA 4MH8A 2LECA 1K1QA 3BS9A 3M30A 2F7VA 5HLFB 3VGSA 5HATA 3GONA 1Y11A 3GJRB 2CQCA 2H3EB 5B7WA 2HFSA 5DLGA 5ETNA 2KYXA 3EX7B 3P49B 3G6ES 4U67Q 4O44A 1DLOA 2CNLB 3BSCA 1T05A 2MZSA 1VISA 3H5YA 3C2PA 2XS2A 1HNWJ 2NPFA 4DFKA 3AHPA 1RJJA 2MEWA 2HHQA 3BGUA 4J9SA 1JLAA 1N36J 3DU6A 1IKWA 2MLZA 4LBPA 2EK1A 3N6LA 4PQUA 2QL5B 4ERDA 1GXLA 1X9WA 1FNOA 1DTQA 2IVYA 1HR0J 1OJ4A 1KP6A 3MM7A 3CJKA 4Y2MA 4DF8A 3MF5A 2FLPA 4I2PA 2HHHF 4ZMMA 5CZXA 4RJVA 3U27A 3W2WA 2MQQA 2P2CB 3KLIB 1CULB 2RD5C 3ENVA 3PNIA 2YWHA 4TLRA 1RWKB 2FZKB 1JLEB 4FVMA 1NRKA 5ETPA 1WTBA 5KG0A 5GAHI 4ZLPA 1M5OC 4X4RA 2ERRA 4J37A 2RSQA 1S77D 1LOUA 1NK0A 4K7QA 3CD5A 1ZTTA 3L4BC
chains in the Genus database with same CATH topology
3QBCA 3UDEA 3MCOA 3MCMA 5ETMA 4AD6A 1CBKA 3HCXA 3ILOA 3KUEA 5ETVA 4CYUA 3HSZA 3UDVA 4M5IA 1KBRA 1Q0NA 3IP0A 2F65A 4CRJA 3KUHA 5ETRA 5ETOA 1F9HA 1TMMA 1EQMA 3HD1A 1EX8A 1HKAA 1RTZA 4M5LA 3KUGA 3HSGA 5ETKA 1RB0A 1TMJA 4M5GA 4M5MA 3HSDA 1RU1A 1RAOA 4M5KA 4M5NA 4F7VA 3UD5A 4M5JA 3MCNA 1G4CA 1HQ2A 1RU2A 5ETSA 5ETLA 2CG8A 4M5HA 5ETTA 3HT0A 4PZVA 5ETPA 5ETNA 5ETQA 1IM6A 3HD2A 3HSJA 2QX0A 1DY3A 4CYUB 4CWBA 2BMBA 1EQ0A 2F63A 3ILIA 3ILJA 3ILLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3QBC A;  3UDE A;  3MCO A;  3MCM A;  5ETM A;  4AD6 A;  1CBK A;  3HCX A;  3ILO A;  3KUE A;  5ETV A;  4CYU A;  3HSZ A;  3UDV A;  4M5I A;  1KBR A;  1Q0N A;  3IP0 A;  2F65 A;  4CRJ A;  3KUH A;  5ETR A;  5ETO A;  1F9H A;  1TMM A;  1EQM A;  3HD1 A;  1EX8 A;  1HKA A;  1RTZ A;  4M5L A;  3KUG A;  3HSG A;  5ETK A;  1RB0 A;  1TMJ A;  4M5G A;  4M5M A;  3HSD A;  1RU1 A;  1RAO A;  4M5K A;  4M5N A;  4F7V A;  3UD5 A;  4M5J A;  3MCN A;  1G4C A;  1HQ2 A;  1RU2 A;  5ETS A;  5ETL A;  2CG8 A;  4M5H A;  5ETT A;  3HT0 A;  4PZV A;  5ETP A;  5ETN A;  5ETQ A;  1IM6 A;  3HD2 A;  3HSJ A;  2QX0 A;  1DY3 A;  4CYU B;  4CWB A;  2BMB A;  1EQ0 A;  2F63 A;  3ILI A;  3ILJ A;  3ILL A; 
#chains in the Genus database with same CATH topology
 2GHW A;  5HMW A;  3O6Q A;  2AJF E;  1UJ4 A;  4U95 A;  4LFA J;  2UXC J;  1DQ9 A;  2V0N A;  2ZUA A;  1RT6 A;  1KLM A;  1RT2 B;  1YBT A;  3BKT A;  1TL1 B;  3SCL E;  3MR3 A;  2W24 A;  4DV3 J;  1KLM B;  1RT2 A;  3KG0 A;  4FPI A;  1FDN A;  3GV7 B;  1QJH A;  2RKI A;  1B7Y B;  2YWF A;  4ZHR B;  5LMN F;  2HMI B;  2UXD F;  4EI2 A;  4OZ5 A;  3R27 A;  3BB5 A;  3DDI A;  2LEA A;  4NAS A;  3CO0 P;  4I1T A;  4TY8 A;  1RBL A;  4RW4 B;  4CLT A;  5DG7 A;  1NKE A;  2XZT B;  1U48 A;  4ZJQ A;  2AKW B;  1VK3 A;  5CYQ B;  2YKN B;  2HND A;  1UPP A;  2OPR B;  4WIQ A;  3TJA A;  1RT1 A;  3JSR A;  3OUY B;  3QRR A;  5HI7 A;  3NMR A;  2CG8 A;  1U02 A;  3BGF A;  3M2R B;  2OTJ S;  3FRY A;  2WRM A;  3GE9 A;  4O0N A;  2FGC A;  2H51 B;  4EZ9 A;  1ICE B;  1T03 B;  4IQX A;  3K5O A;  4YB6 A;  2RDJ A;  2AJ1 A;  3B82 A;  4MK9 A;  2J9D A;  1GMW D;  1P9Q C;  1DHM A;  1Q16 B;  3BBC A;  5BR8 J;  2R8H A;  2YTC A;  3OT9 A;  3FMW A;  3VWS A;  5LJ5 Y;  1RLD A;  1UMJ A;  3EDQ B;  2YNG B;  1HQU A;  3GJS B;  2HNY B;  4QIF A;  3R97 A;  5A8K A;  3H8Y A;  5LMU F;  2YXL A;  1PAU B;  5ETR A;  5KT4 A;  2QTW A;  3DI6 A;  4XPC A;  3FMB A;  4U7U D;  2GHV C;  2AF6 A;  5CYQ A;  5IT0 A;  4ELU A;  1TMJ A;  3H7H B;  4J9U E;  1WKK A;  5D4P A;  5FJ4 A;  5CYJ A;  1UA1 A;  3MAA A;  3PRV A;  3TJ8 A;  4PXC A;  1ZOT A;  3M9O B;  5KFA A;  1PIE A;  1FXR A;  3CCM S;  2WVB A;  1YRU A;  2IFX A;  1GX6 A;  1S99 A;  1VRT B;  2LQJ A;  2LVW A;  3QYY A;  3MFI A;  3FJ2 A;  4G1Q B;  5LMU J;  3BBF A;  4OYZ A;  2J7U A;  4QYZ J;  2IHR 1;  3NS6 A;  1DY3 A;  1S1X B;  4OYI A;  2R7R A;  1NH8 A;  2Y1I A;  2BW7 A;  2E1M C;  1S7H A;  1L3S A;  4IOA Q;  1UP1 A;  2BRL A;  3HZG A;  5J2N B;  1EKR A;  2BBE A;  3ZNU A;  1XWL A;  4LF8 J;  1C2P A;  3FZ2 A;  2DGQ A;  4WZQ A;  1S76 D;  2W7A A;  3ENW A;  1JMT A;  4HHJ A;  4KKO A;  1OY8 A;  3T5L A;  3C6U B;  1RT5 B;  1RWU A;  2A6M A;  3ITH B;  1V3Z A;  3KLE A;  4WE1 A;  2W7P A;  2DEI A;  1Q8I A;  5EX0 A;  3W8G A;  4PXD A;  2LQB A;  2ZIT A;  5F8I A;  5B0F A;  3FCH A;  1IR1 A;  1P8G A;  1JJH A;  1YJV A;  4DCP B;  4G3I A;  1TKZ A;  3NL0 A;  4RNH A;  1IR2 A;  3DOM B;  1WC6 A;  1RXO B;  3EGV A;  1N34 J;  4O3S A;  3LF0 A;  4RWW A;  2G2Y A;  3KDO A;  4ZKA A;  4CCH A;  1S1T B;  4KAI A;  4A46 A;  4ED1 A;  1CEZ A;  2K8G A;  2Y1L B;  1PCA A;  4DSJ A;  2CA9 A;  2ZH7 A;  2RNE A;  4KJI A;  1R8B A;  4DN0 A;  2MQ8 A;  4WYW A;  1F9E B;  3GYG A;  4DV2 F;  1FJG J;  1VRQ C;  1UVI A;  4C8N A;  1OYD A;  4NXM J;  4O0I A;  3KLV A;  3J80 Y;  3CIM A;  2CQ3 A;  3L7U A;  4RO0 A;  5HN0 A;  1ZET A;  4Q0B A;  4DV3 F;  4WKY A;  3TA1 A;  2EWH A;  1TP7 A;  2E5H A;  2G0I A;  1N5T A;  3I96 A;  3I87 A;  4ITS A;  3W7B A;  3OL7 A;  4ED6 A;  4ETZ A;  1JLG B;  1V5V A;  2CPX A;  2NUU G;  3BKU A;  4ZVR B;  2VJV A;  2J0W A;  1X5T A;  2HFV A;  1L3V A;  2O5D A;  3MM8 A;  4KH1 B;  3IRX B;  4CT8 A;  4J9L A;  2U1A A;  3T9N A;  3TW0 A;  4X62 J;  5CXT A;  5D4L A;  4KV8 B;  2R3V A;  1WHW A;  3DC2 A;  1RT4 B;  3CJ8 A;  3D6M B;  5J2Q A;  1IKX B;  3HX9 A;  4NX9 A;  2W9A A;  3MGJ A;  2BE7 D;  3CD7 A;  4DL0 C;  4B3S J;  1OSD A;  2D9O A;  3HHL B;  1EJ7 L;  2HQG A;  1K9M T;  4ZCM A;  3IMQ J;  3ADA C;  2N7Y A;  2K7J A;  1VR6 A;  3IGV A;  4PR6 A;  2DH7 A;  3LOU A;  2MDA A;  1HQE B;  4OHY A;  3KNG A;  2GS8 A;  2ASY A;  1KFD A;  1SI9 A;  3P96 A;  1RBA A;  1RP5 A;  3J7A 1;  1TK0 A;  1S1W A;  4ILM A;  3P4U B;  2RIJ A;  2L9N A;  2M7S A;  3S01 A;  4USJ C;  3MMC A;  4HDG A;  2XB2 D;  1U4B A;  3D1H A;  3SYZ A;  2D41 A;  2OJ3 A;  1JWW A;  2ZE2 A;  3IWN C;  2EFP A;  3QGH A;  4YHH J;  4B3O B;  1K0V A;  2IJR A;  3PXG a;  1HW8 A;  1P1L A;  3H4B A;  3E01 B;  2MQL A;  2EPI A;  3DM2 B;  1S4F A;  5ETS A;  4NLG A;  1ELO A;  2ZOF A;  4C3M A;  4DV7 F;  3BH6 B;  4ES2 A;  1UAW A;  1WOP A;  3BSN A;  2VA3 A;  3PVX A;  4IOC Q;  5J2M A;  1RHM B;  2NQP A;  4TYA A;  2FC8 A;  3FRZ A;  4TN2 A;  5DQH A;  4OMF G;  1SKS A;  3FBF A;  3BDP A;  2LFV A;  3CJQ A;  2W2P P;  4ZP7 A;  3A8J A;  4ATN A;  5C25 B;  6FDR A;  5KG7 A;  3TAQ A;  4RW6 B;  7FD1 A;  4RW9 A;  3UO0 A;  4GKK J;  4M8L A;  1JK9 B;  2CDQ A;  3OTB A;  1RZM A;  3MEC B;  3U1N A;  2R7O A;  3CMA S;  4NRU A;  2CPD A;  1DRZ A;  1QM9 A;  4Q43 A;  3OUY A;  2QJ3 A;  4LBH A;  1RCX B;  4ZS6 A;  4KBI A;  1HBU A;  4JI2 F;  2HVE A;  3NGD A;  1UL3 A;  3K8W A;  2CJ9 A;  2DNQ A;  4M5N A;  1SC6 A;  4RR5 A;  4I2P B;  1HBO A;  6AT1 B;  3IXQ A;  1KVI A;  3R7S B;  4YR2 A;  5C2G A;  2JC0 A;  4DUZ F;  3HPO A;  2O66 A;  2Y1R I;  2MLX A;  3B78 A;  4CP5 A;  5HQ8 A;  3QRP A;  2QYC A;  1YSJ A;  3MPV A;  1NJI T;  2Q1L A;  2YKA A;  4WFN Q;  3K58 A;  4ECV A;  3TEG A;  2A6O A;  2CPY A;  4X84 A;  2YKM B;  1T11 A;  4RBU A;  1XNQ J;  1HBO B;  3QLH B;  3RG6 A;  4DI6 A;  3BKF A;  1OMS A;  4DUZ J;  4H4K A;  1Z4U A;  2KXH A;  2J6S A;  2M8H A;  1CBK A;  2LEP A;  3O3L A;  2ZOM A;  3BZQ A;  4Q2L A;  3QQC D;  2FQQ B;  4WE1 B;  5E3Q A;  3THP A;  2OML A;  2PFD A;  3TZW A;  4AE5 A;  3GIR A;  1I5O B;  2Z4P A;  3CJS A;  3DOL A;  3KUH A;  4UF4 A;  4C3K A;  5K8N A;  2B9X A;  4U7C A;  3O44 A;  2HBY B;  3V6K A;  3CGI A;  3PY8 A;  4JI7 J;  3SEO A;  1X9S A;  2CJY B;  2B7C B;  2WZ1 A;  4M1K A;  3V6D B;  1YRX A;  3FQK A;  1FX4 A;  3DLK A;  1FER A;  3BBB A;  4TQR A;  1HBN A;  1VS3 A;  1RWX B;  2ILY A;  2V67 A;  3DLK B;  1Q8B A;  2AEM A;  1LWC B;  2EFQ A;  3GP9 A;  2ZFH A;  1AA1 B;  3NRB A;  2Y0B B;  3D66 A;  4URG A;  5LJ3 Y;  4KH0 B;  1FJG F;  2XEX A;  2K06 A;  4NLP A;  5DGA A;  2VG7 A;  3JQK A;  3KJQ B;  3P5B P;  2FC9 A;  4LF2 A;  1JXV A;  4C0O C;  2Z2L A;  2FZC B;  2J8S A;  3MMA A;  4QYR A;  5D6G A;  5DZ6 A;  4CYU B;  3R5A A;  4QWD A;  3OTO J;  1WSR A;  3GQC A;  2PSZ A;  1RWO B;  3ILI A;  4ZVP B;  2X1G A;  4Y2I A;  2FJX A;  3I82 A;  1XMQ F;  4E0D A;  1T9T A;  2G2Z A;  1SC3 B;  2XHC A;  2CJX B;  2Z57 B;  2CZV C;  2G9O A;  3PJW A;  3QAU A;  3EM1 A;  2HNY A;  1NND A;  1RWP B;  2OPQ A;  3M8Q B;  1N56 A;  2H54 B;  3MPD A;  2BAN A;  2AD9 A;  2AJ0 A;  2MKY A;  1E6V A;  3RBD A;  3P45 B;  3GV8 B;  4K4X A;  4Q8F A;  4JI3 F;  2GIQ A;  4HI1 A;  3I0R A;  2ZJP Q;  1B0P A;  1M1G A;  1HWL A;  3WIV A;  1YHQ S;  2GMH A;  1F0X A;  3NCQ A;  4KGX B;  1NDC A;  1Y3J A;  2KB2 A;  3PYE A;  2BKP A;  1R31 A;  1SV5 B;  2G1D A;  4FS1 A;  1RA6 A;  2HND B;  2MKS A;  5AE1 A;  1OY9 A;  1YTY A;  2IM3 A;  4J7C A;  9RUB A;  4X2B A;  2FY1 A;  4RW7 A;  1X4G A;  1U0H B;  2W2Q P;  4XK8 C;  3QBC A;  2XZD B;  2OEJ A;  2C2K B;  2CQB A;  3ENQ A;  3U1M A;  3V2U C;  4BLG A;  5T14 A;  1LW0 A;  3UVJ A;  5KFK A;  4FF3 A;  2JLG A;  5GAD U;  1ZPV A;  4MFB A;  2LP4 A;  3FEZ A;  2P9E A;  3GZ7 A;  3KWM A;  2KH9 A;  2NXN A;  1EAR A;  1WHY A;  4L73 A;  1GAO A;  3TX0 A;  3IBW A;  2MZ1 A;  4ID8 A;  5T7L A;  3GJT B;  3QGG A;  4WTO B;  1RHJ B;  1UVK A;  5JUM A;  4RUB A;  1HFE L;  2DCU B;  4UW2 A;  1XR6 A;  3MMC B;  2YWG A;  4OJH A;  4O3P A;  3LO3 A;  4IDK B;  3MUR P;  2E5L F;  5E5N A;  5F9L A;  4PG6 A;  2LQ9 A;  1ARO P;  2DT9 A;  2NLW A;  4X4V A;  5F8H A;  1VOM A;  1TL3 A;  3Q8Y A;  2YH1 A;  1SVD A;  1X31 C;  3AFG A;  3EE3 A;  3OBI A;  5JVG Q;  2UXB F;  1VC6 A;  1TKZ B;  2GVD B;  2IYG A;  1XN9 A;  4ECY A;  2YKO A;  1CLF A;  3ZXW A;  2N4D A;  2KG1 A;  4IFY A;  4AL7 A;  1CJV B;  4GVB A;  3QZ7 A;  5HMX A;  1KHV A;  2B43 A;  2HFN A;  1L5U A;  4MMO A;  1VQ7 S;  4CDI A;  3G82 B;  3W66 A;  3WIU A;  3ZZO A;  1DBD A;  2CUY A;  2J9E A;  1U6F A;  1Z2Z A;  4ZPC A;  1SKU B;  2Q3P A;  3IO1 A;  3VZI A;  1DLO B;  2BJ8 A;  2D69 A;  1JLG A;  3D68 A;  5ADZ A;  4K0K J;  1DAR A;  2KI2 A;  3AB4 B;  4KFB B;  4Y2K A;  4ZK7 M;  1RAB B;  1VQ6 S;  4K4U A;  1SQF A;  4CIO A;  1Q53 A;  2Y1J A;  3AOA A;  3FSI A;  2HK2 A;  4CO3 A;  5HBM B;  2ZZM A;  1HBM B;  3SFG A;  2AGP A;  1SQG A;  2R7U A;  4IG0 B;  1D09 B;  1T02 A;  2YWK A;  3KTQ A;  1Y10 A;  2HWI A;  1SKW A;  4NXN J;  1DAX A;  6FD1 A;  1BC6 A;  1K0T A;  2EEY A;  1VI7 A;  4KQZ A;  3G82 A;  2B5J A;  3T5K A;  3CJ2 A;  2IRU A;  1ZM3 A;  1NHV A;  3OVB A;  1QVF R;  1GEH A;  3DYA A;  3M8Y A;  4DQP A;  1Q79 A;  1RTZ A;  3KUG A;  2BEF A;  2JL9 A;  3VHQ A;  2A18 A;  4ALZ A;  1NDP A;  4RNO A;  3OSN A;  3DLB A;  1G1X A;  1YJT A;  2PD1 A;  4O4R A;  4JV5 F;  3DKD A;  2CQ1 A;  4DN9 A;  3MM7 B;  1MN7 A;  4FF2 A;  4K4W A;  2DRA A;  1V9O A;  1MWQ A;  2PGC A;  4P72 A;  3KK2 A;  1IJF B;  2CQH A;  1A6L A;  2H5I B;  1HHQ A;  1X5S A;  4M5H A;  3MTJ A;  1NEE A;  2JRS A;  3MM9 B;  1T94 A;  3IR5 B;  2MKH A;  3A12 A;  4I4B A;  5HRO A;  1RAG B;  1AB8 A;  2UUW A;  4P2F A;  2I5J A;  1FT8 A;  4IH6 A;  3CW2 C;  3MAQ A;  3MR5 A;  3NKY A;  1M1H A;  4O23 A;  4F3Q A;  4DPX A;  1VCT A;  3IR7 B;  1S49 A;  3I5A A;  3SCJ E;  2RQC A;  4EGL A;  1VLY A;  2NYH A;  1JX4 A;  2R7T A;  5KFX A;  4B3T J;  3R5D A;  4AXJ A;  4HYK A;  4FBU A;  2IVM A;  5LM7 E;  1WD6 A;  3TNV A;  4RZR A;  3OV7 A;  5F0W A;  4I7F B;  4M5J A;  3I9Z A;  4LRC A;  3M32 A;  3PFE A;  4QWC A;  3PG9 A;  4I56 A;  1FRH A;  5IWA F;  3BN4 A;  2WVE A;  1K1S A;  2XCA A;  1P9Y A;  1HPZ B;  3W5Y A;  2ZE2 B;  4TU7 A;  4LMZ A;  4NPO A;  3H5S A;  4WK1 A;  3W2W B;  1B7F A;  3DXB A;  2HGL A;  2Y8W A;  3S7R A;  2Q6B A;  2NZ4 A;  1JLB B;  1E6V B;  5BYQ A;  5JXS A;  3JS9 A;  4FPR A;  3UN2 A;  4CO0 A;  2MKK A;  4N76 A;  3D3B J;  1EZZ B;  3RRK A;  2EXU A;  1A9N B;  2L08 A;  1H74 A;  4U8Y A;  3VAL A;  1R8H A;  1WEX A;  3H5U A;  2HHX A;  2H5J B;  3M8R A;  4U7U K;  3MEK A;  1IBC B;  5AXM A;  1WOS A;  2VFR A;  2DGS A;  2WOM B;  4NLR A;  1FWK A;  4IR1 A;  1OY6 A;  3W62 A;  4ECU A;  1YX2 A;  1KVK A;  3KLG B;  2H4Y B;  4NLD A;  5IV4 A;  2RU3 A;  2X1B A;  4ILL A;  3TVZ A;  1GX5 A;  2XZW A;  3ENA A;  3KHL A;  4ZHR A;  2R8G A;  4RU9 A;  2VUG A;  2JFK A;  5E7O B;  4KSE B;  5K14 B;  5KT3 A;  3UFC X;  2XG8 A;  5B0D A;  3RTV A;  4OZL A;  4Y2A A;  3G71 S;  2LYV A;  3SDE B;  1LWC A;  3UW1 A;  2QA4 G;  4JI2 J;  4C8L A;  3SDE A;  1VQ8 S;  2MB0 B;  1ZAX A;  1KTQ A;  1X4E A;  4QJV A;  2ZH9 A;  2CPI A;  2MKC A;  1EB0 A;  2HS0 A;  2N4C A;  3DLJ A;  1W7W A;  4IKA A;  4Q45 A;  5D0G A;  4DX6 A;  2VKZ G;  2GAH C;  4PAA A;  2ZBR A;  1N6Q B;  2HVZ A;  3CXC R;  3D9B A;  1RAI B;  3BV8 A;  3FBC A;  4OIX A;  1U45 A;  3CC7 S;  4Q8E A;  2KVQ E;  1XNR J;  4DCJ B;  5L39 A;  1REV B;  3GYX B;  4HLB A;  4ZP6 A;  2HVI A;  2C22 A;  3MCN A;  4F4K A;  1VQK S;  1Q8K A;  1ULR A;  3NXZ A;  4DU7 A;  3VQT A;  2AHO B;  1HHS A;  2BAN B;  2WON A;  2IBK A;  1NSA A;  2V69 A;  4JYA J;  1F5C A;  3FVY A;  1YJU A;  3MEG A;  5B0G A;  3SXL A;  4JI6 J;  1XK8 A;  4XTT A;  3D4J A;  4R8U A;  3G6X A;  4DF4 A;  2U2F A;  4JI0 J;  1REV A;  3TWZ A;  2AW0 A;  2FJV A;  4M5D B;  3PO5 A;  5DM6 Q;  2V50 A;  1D9F A;  1FJE B;  2DNP A;  4NA2 A;  1Y9O A;  4DX5 A;  4AL6 A;  1KWM A;  2BE2 B;  3KMS A;  4RW8 B;  4CRJ A;  2IMO A;  3IBF B;  2NS1 B;  2PMW A;  3M32 B;  3B4M A;  3QJJ A;  1TMM A;  3WDO A;  3I31 A;  2KT5 A;  5D4N A;  3P6Y C;  4Y34 A;  3VAJ A;  4HH1 A;  4DL2 A;  3TEH B;  4IO9 Q;  1RUS A;  1YK9 A;  2XYP B;  4OLP A;  1YJ9 S;  5HMZ A;  1S59 A;  5K20 B;  4LR8 A;  1PJ5 A;  5A6P A;  5A8W B;  3BGR A;  4DR2 F;  3GMG A;  3TI0 A;  3R1L A;  3KJV B;  2E44 A;  1WTF A;  2I5J B;  1HIY A;  3T1Y J;  5EGY A;  2N3O A;  5GAD I;  2HBQ B;  4G1I A;  2ZVS A;  2DIT A;  2R2R A;  2VBW A;  4DV0 J;  2HG4 A;  3MXH P;  2WBM A;  3KHG A;  4KGM A;  4QOT A;  4W92 B;  5HSP A;  4IO1 A;  3ZZY A;  3LWM A;  3GLJ A;  4ECS A;  3EVM A;  1Q95 G;  3GJQ B;  2GO8 A;  3DRY A;  3X3U A;  3H0P A;  5I3Q A;  4ELV A;  3TA2 A;  2GV1 A;  3JTN A;  4MIA A;  2KT2 A;  4EO8 A;  1UPM B;  4WII A;  5L1I A;  3V6J A;  2XY5 A;  3R5G A;  3AH6 A;  2FJA B;  4UQT A;  3CCL S;  1U1O A;  1FD8 A;  2G2O A;  3JTO A;  3S8S A;  4OX7 A;  4ECQ A;  1ACM B;  2AJ2 A;  2FVR A;  5KOW A;  4OL8 A;  1ZS6 A;  1XQI A;  3FK4 A;  2KXF A;  5F3T A;  2W9C B;  1N54 B;  2JH3 A;  4JV1 A;  1S9F A;  3KNA A;  2ROE A;  4TXS A;  2E5I A;  2HGN A;  2YKQ A;  4RUC A;  2P6S A;  5EX3 A;  5CCM A;  3ISZ A;  1RT4 A;  3QFW A;  4DL6 A;  5J2Q B;  1JKH B;  4J9Q A;  3AY0 A;  3BRE A;  2G13 A;  3M2U B;  3MEC A;  4NYZ A;  2PN6 A;  2R4F A;  5CYM B;  5KG6 A;  2XSJ B;  5EWF A;  3VAF A;  4UOC A;  2R8J A;  2JC1 A;  4DL3 A;  4NMX A;  2CQ0 A;  2GIF A;  2GQC A;  4Z7C A;  4F8R A;  1JXE A;  1HBM A;  3HVA A;  4DSL A;  1KNZ A;  2XMM A;  4EWT A;  3H59 A;  4X66 F;  2DPJ A;  4DPU A;  4ENO A;  4N41 A;  1FD2 A;  3OFG A;  1RA7 A;  3HLU A;  3HSZ A;  2B8Q A;  2NXU A;  2QSW A;  4RBT A;  2Y9H A;  1N48 A;  2XSF A;  4F4W A;  1QSL A;  5F8N A;  3WZ0 A;  1LQ9 A;  3DRR B;  1IWA A;  1TKX B;  4ZPD A;  1DFD A;  3CED A;  4DXL A;  3HSG A;  5HQM A;  1TU0 B;  5IT9 U;  3M7V A;  4WTY A;  1TFY A;  5HP1 A;  3NGU A;  4H54 A;  3CDA A;  2BJ7 A;  2WTF A;  3UCU P;  3Q2T C;  1G2E A;  2AIR B;  5CD4 H;  4DPY A;  3M2U A;  3TQE A;  4JI1 J;  1O8B A;  3NY0 A;  2ADC A;  3ISN D;  4HKQ A;  2VJU A;  4R25 A;  2BUN A;  3ZZT A;  5B0B A;  2DY1 A;  1OO0 B;  4L75 A;  1TKT B;  4K4Z A;  4C4W A;  5BXI A;  5IT4 A;  5D3G A;  5F8L A;  1BQN A;  3A13 A;  1OS5 A;  2CJA A;  4YQW A;  2W4D A;  1JIH A;  5D3G B;  1C1B B;  2XO6 A;  3K0J A;  5FII A;  3N4W A;  4OFZ A;  5GAH U;  1B70 B;  2MYF A;  1RTD B;  1Y7P A;  3CIZ A;  3LAK A;  1N8R T;  4NRT A;  2M0G B;  4QW9 A;  3RRG A;  2B4P A;  5BR8 F;  1S0V A;  2QL9 B;  4M63 A;  4X64 J;  2ASD A;  1RHK B;  1Q86 T;  2B4V A;  2R7Q A;  3EMT A;  2AGQ A;  4JI8 J;  1MNE A;  2DCL A;  4LFA F;  2OPP A;  2JEG A;  2OHD A;  4ZOS A;  3AB2 B;  5KFO A;  5HVG A;  3CCS S;  1YLX A;  5I42 A;  3GSI A;  1FTC A;  1GQE A;  2R2U A;  2ZBC A;  3U7J A;  2V8V A;  1Q5Y A;  2FHJ D;  3MED A;  1LW0 B;  3UVJ B;  1N33 J;  4RKU C;  1UFK A;  1FRI A;  1UEV A;  2EFG A;  3GPA A;  1JLF B;  3I5C A;  3RRH A;  3RB3 A;  1Q5V A;  5D78 A;  1SUQ A;  1NZ8 A;  4PKD B;  2B3T B;  2RS8 A;  3RGI A;  4CQ1 A;  3GIK A;  3HVT B;  4ICL B;  4DR7 J;  1HWK A;  1X4D A;  1QE1 A;  3DGP B;  4PG7 A;  4LSZ B;  2OP5 A;  3JSM B;  2IA0 A;  1AT1 B;  3CME S;  1CJU B;  1GFW B;  3CTR A;  3PRB A;  3BYR A;  2HHH J;  3BSO A;  2XMK A;  2PII A;  4B9U A;  3NNA A;  2O67 A;  3MUV P;  1V3S A;  2G1H A;  3DLG A;  1K44 A;  3NOC A;  4DOZ A;  3FSY A;  1LWF B;  1W25 A;  1T95 A;  2OD6 A;  3F73 A;  2ACY A;  3R2C J;  1UJ5 A;  1O6X A;  2FLO A;  1UZD A;  3EZU A;  1IQZ A;  1N88 A;  1TEL A;  2GZO A;  2MZT A;  4FYY B;  2PEH A;  4J91 A;  2QX0 A;  4GMK A;  4DG1 A;  4YY3 F;  2GQ2 A;  2IAJ A;  2XC9 A;  3K57 A;  1T9Y A;  1MWZ A;  3KHR A;  3G9C A;  1HNW F;  4PXB A;  1YVF A;  3MWB A;  3IN5 A;  2A0F B;  5BYS A;  4DR5 J;  2DXD A;  3JYT B;  3BSA A;  3B8H A;  3FFI B;  4HVZ A;  5KFN A;  2XY7 A;  5H9E K;  2XMU A;  2VG7 B;  1L3T A;  2XLI A;  2HW3 A;  4PRF A;  4G6V B;  2ZNZ A;  1NHU A;  1FKP B;  1HW9 A;  2BVZ A;  2HRU A;  2V8G A;  3C15 A;  4P2X A;  5GAG U;  3M1V B;  5F8G A;  3KHH A;  2O3D A;  4PUO B;  1RAJ A;  4ELT A;  2ZUG A;  1URR A;  2XNR A;  3O5T B;  4OZ0 A;  4YDD B;  2B4O A;  5E3R A;  1WUU A;  2RQM A;  3JSY A;  4PXE A;  4F7V A;  2VU5 A;  1EAY C;  2C2N A;  2DHA A;  2XYH B;  2JWN A;  1DQ8 A;  3R3T A;  4YR0 A;  1CJV A;  4GVB B;  1UWB A;  2G0J A;  3TJ9 A;  2QLJ B;  3FCV A;  4HT5 A;  1VC5 A;  4NCB A;  1F1B B;  4DS5 A;  3QLH A;  4FBT A;  4DCO B;  4CLK A;  1ZM9 A;  2DO4 A;  1N0V C;  1F5B A;  1RT3 A;  5H9F J;  3MEG B;  3CMQ A;  2HZA A;  2LDY A;  2ZWP A;  4YN3 B;  1S1U B;  3SCI E;  5KFZ A;  1RSC A;  4BWM A;  3CJR A;  2K3I A;  1YZ6 A;  2QRR A;  5LXR A;  4ER8 A;  2ZDP A;  1R27 B;  3QSY B;  3ET6 B;  5EHH A;  2KFZ A;  1TTH B;  2DRD A;  1NDL A;  2K3K A;  4E2F B;  4OZ1 A;  2KYZ A;  3HHL A;  4GO7 X;  5JVH Q;  4GVL A;  4J9M A;  3WC2 A;  3AD8 C;  2HHS A;  2I1R A;  2AU0 A;  3NLC A;  4O44 B;  4DQQ A;  1ZYQ A;  3T3F A;  2QT7 A;  4LSN A;  2VKR A;  3EVO A;  3CCV S;  2VG5 A;  1AZS A;  2K1R B;  2E9R X;  2KL8 A;  2PFF B;  1FWL A;  3CJ0 A;  1LW2 B;  4RW9 B;  4LQ9 A;  3J81 U;  1FRL A;  2E1C A;  4C11 A;  1S6P A;  4A8F A;  3OR2 B;  4MYT A;  2BMB A;  2B9W A;  2D74 B;  3OHB A;  2CZ9 A;  3R6L B;  3EPG A;  2BR0 A;  3IR6 B;  1S57 A;  1KDN A;  4UZC A;  5SZT A;  3OTE A;  1UVL A;  1D8Z A;  3HP6 A;  2UXD J;  4B3R F;  3M2V A;  3TAR A;  1XR7 A;  1X0P A;  1H98 A;  3NS7 B;  3J7Z T;  2CPE A;  3G96 A;  3BQ1 A;  4DV1 J;  2E66 A;  4MAK A;  4QWE A;  4U9R A;  2D1C A;  4I67 A;  1RAO A;  3PW4 A;  2IAJ B;  3D0G E;  4F3M A;  1RLC L;  3M9N B;  4ZPT R;  2BKN A;  4Q2M A;  1QDU B;  2XNQ A;  1TUG B;  2B56 A;  2DY9 A;  5GMK a;  1B64 A;  1H6K X;  4DR4 F;  2W8K A;  1FJC A;  2PMZ D;  1U6B A;  2FYX A;  1HI1 A;  1SJR A;  5DG8 A;  3BGO P;  3L09 A;  5DJB A;  5LSO A;  1J5O A;  2A10 A;  1G3O A;  4P7T A;  4CLL A;  2MJU A;  5L46 A;  5EWG A;  1BMQ B;  2QFJ A;  1HNZ F;  3OXL A;  3KK3 A;  2R2S A;  4XPE A;  4ES3 A;  4IQM A;  4XAK A;  1P6T A;  3C3L A;  1WNE A;  4DSK A;  2GO9 A;  3AD7 C;  4NLQ A;  2XGQ A;  2K2P A;  1PJ7 A;  3QNW B;  1WC0 A;  4F2S A;  2I6W A;  2BE9 B;  4DR1 F;  3RAQ A;  1CG2 A;  2VG6 B;  1EQM A;  1NKB A;  3ISN C;  4LFC F;  2VB6 A;  2JVR A;  2G4B A;  2WB1 D;  4DV4 J;  2Q79 A;  4NZ7 A;  1UKU A;  2R42 A;  4M5G A;  4LSL B;  5HK4 A;  4DL4 A;  1SL1 A;  1HWI A;  4PG8 A;  4R5P B;  2HHT A;  1EKS A;  4TYB A;  3OD2 A;  4W98 A;  1GK8 A;  3V6D A;  1GMW A;  4OHX A;  1FKP A;  1PC4 A;  3HFZ B;  1VRT A;  4N56 A;  3H4D A;  1HNI A;  2IDL A;  1S9G A;  3VTI A;  4ZIT A;  1TUV A;  1NPR A;  2CAD A;  2V9W A;  1UA0 A;  3A1Y G;  1X9M A;  2JVO A;  2J9C A;  3JAM Y;  4RNM A;  1WI8 A;  2OFH X;  3EVW A;  3MTK A;  3RW6 A;  3W64 A;  4FNH A;  4M5D A;  2BA9 A;  4ZVF A;  5ETM A;  2F4V J;  4QWA A;  4C8Z A;  2V94 A;  3OTD A;  2B51 A;  3C14 A;  2J76 E;  3MM9 A;  5F41 A;  5LSR A;  1H2V Z;  5A76 A;  3K7R A;  2HQI A;  2B6A A;  2L41 A;  3T6B A;  1ZA1 B;  4DUT A;  1X4B A;  1HYS A;  3GIL A;  3PHE A;  3EIC A;  2M8D B;  2B8P A;  3JSM A;  3M8W A;  4W4M A;  3DYA B;  2EG2 A;  3KK1 B;  1VJW A;  2PT0 A;  3Q8Q B;  2FVQ A;  3GIM A;  3TUP A;  4K0K F;  4PPZ A;  1S5Z A;  1HPZ A;  2GA7 A;  2RRB A;  1PO6 A;  2FJD B;  5HQL A;  3PR4 A;  1BD6 A;  3H40 A;  4WXW A;  1JLC B;  2OEK A;  3HFV A;  2OEL A;  2AZ1 A;  2VQE F;  4NZ0 A;  4B3M F;  5C7P A;  3AOB A;  3HI9 A;  4K4Y A;  1IR0 A;  3R1H A;  4CTA B;  1FES A;  3VAI A;  1ZH5 A;  5E3P A;  2VOO A;  3P8B B;  4CM0 A;  1HMV B;  3QT6 A;  2DIU A;  1RTJ A;  4MTP A;  2W8L A;  4Z2X A;  4K4V A;  1FDA A;  2LXF A;  2Q43 A;  3O8W A;  2KM8 C;  4EEY A;  1SC4 B;  2FDN A;  3TQ1 A;  2XM3 A;  2HQ3 A;  2KDO A;  2OUG A;  2ZVI A;  2YNH B;  2CPZ A;  2C3O A;  1YJ7 A;  3DDK A;  4ZLL A;  4ANE A;  3CWJ A;  3J81 Y;  2E1A A;  2LQ5 A;  3W8P A;  2M9K A;  1C0U B;  3US5 A;  2ROG A;  4AFF A;  3UCG A;  2IYI A;  1SIW B;  2LU1 A;  1N5Y A;  4FXV A;  4X4S A;  4KYZ A;  3BF4 A;  1HAR A;  2E7W A;  3TAM B;  1KKH A;  1JLC A;  3KLF B;  3BQ2 A;  2H48 B;  2VPX B;  3JQM A;  4OI1 A;  1LKZ A;  3MR7 A;  1N4L A;  2MKJ A;  4PEO A;  2VPY B;  2Z2Y B;  4CM2 A;  3DOM A;  4UY8 T;  5KG5 A;  2UXB J;  4B9T A;  3EJM A;  1U1K A;  3L7O A;  1M5K C;  2B7B B;  4DPT A;  1AUS L;  2CKW A;  3Q8S B;  3Q24 A;  4CLP A;  4IH7 A;  3IS9 A;  4RBV A;  2YX1 A;  3PW7 A;  3MEE A;  2FJW A;  1VQ5 S;  2E5G A;  3PYD A;  5FD1 A;  2VV5 A;  3MUT P;  2CQD A;  3IRX A;  5AXN A;  3BO2 A;  1BUX A;  3I4H X;  2IC3 B;  1VGY A;  1F3F A;  2V4Q A;  2VOP A;  3C16 A;  2ALY B;  2H5E A;  3PYG A;  2QA2 A;  3VF0 B;  4OQJ A;  4FS2 A;  1RYR A;  3D67 A;  2HMI A;  4WYL A;  4PWW A;  2BKO A;  2BYC A;  4ZVH A;  4YDX A;  3D3C J;  3CF5 Q;  2H65 B;  1Y3K A;  3T1H F;  4L76 A;  4WBF A;  1FE0 A;  4P52 A;  4TU8 A;  4Q0B B;  3MM6 A;  2LKZ A;  3SIP B;  1J27 A;  3FFI A;  5D0R A;  3WQP A;  4I64 A;  2OEM A;  4R5P A;  1RKJ A;  1GXT A;  4BWJ A;  5GAG I;  5HVF A;  1I3O B;  2CQG A;  3FZB A;  2OFG X;  4MJK A;  4QZV B;  3R7N B;  3QJP A;  1T9V A;  3ETM A;  2EVZ A;  1TL7 B;  4C3L A;  1WF1 A;  3I56 S;  5F3Z A;  2HWT A;  2Q66 A;  5GAE I;  3IBC B;  4NCG B;  2VA2 A;  4NA3 A;  4OYA A;  3CCE S;  1YJR A;  2QG9 B;  1GH8 A;  3GFZ A;  4A8S A;  3TAN A;  2FGO A;  3NG8 A;  2VIC A;  4PWD A;  3UN5 A;  3FDS A;  3AA8 A;  1FXD A;  2DNL A;  3ITH A;  1RTH A;  3V4I A;  2C3U A;  4S0M A;  3JSB A;  1XMQ J;  4DR1 J;  3CCJ S;  1BY9 A;  3HT3 A;  4CI0 B;  4Z37 A;  1IKY B;  1BXN A;  4KPC A;  4JI7 F;  3GFH A;  1CC7 A;  1NB2 A;  4OYB A;  4LUB A;  4UUX A;  5JJB A;  3ZZP A;  2VHG A;  1NZA A;  2DNH A;  4RL1 A;  3RBX A;  2JHE A;  4FYW B;  1M5V C;  1QUP A;  3WX8 A;  4DV5 F;  2HWH A;  3RW7 A;  3TUI C;  3MR2 A;  2AJQ A;  2RQ4 A;  1UFL A;  2F8H A;  3F41 A;  3NGT A;  3DCA A;  2MST A;  4L3K A;  3OR1 A;  5LMN J;  5D4O A;  2ZH5 A;  1FEH A;  3W63 A;  2BJD A;  3MOZ A;  3DHW C;  2QLB B;  3ZTO A;  3HHE A;  5HMY A;  5KFH A;  2GX8 A;  3SI8 A;  1FNM A;  1RHU B;  4NI2 B;  2DPI A;  1R3N A;  2KKH A;  5HVH A;  1KLN A;  4J90 A;  1VFJ A;  3N6M A;  4USV A;  1BQM A;  5CYM A;  5A6W A;  3V4M A;  1Y0H A;  2DR6 A;  4D3H A;  1IXK A;  2PMH A;  4O3Q A;  3N01 A;  4GC6 A;  3BR8 A;  2ASJ A;  1RGV A;  4YUD A;  5AE2 A;  3H5X A;  1R0C B;  4OYO A;  1C4A A;  2YKM A;  4YB5 A;  4X4P A;  3A3N B;  3NNC A;  1UET A;  2IM1 A;  1WHV A;  2EKY A;  1WG1 A;  3BGL A;  4HDH A;  4Y2C A;  3SBM A;  4GC7 A;  4OJG A;  3UI3 A;  5C42 A;  3CO9 A;  1SJF A;  3T5H A;  4M95 A;  2GW8 A;  2OPQ B;  1F6T A;  1R8A A;  2Y3Y A;  3J81 j;  1C4C A;  4EUV A;  3HD1 A;  4B9N A;  4ID5 B;  4B02 A;  2POK A;  4NCA A;  1UVJ A;  4DHV A;  2DH9 A;  2UUT A;  1JLA B;  3EXC X;  3LP0 A;  3SQG A;  4ZVU B;  2C1E B;  1H2U X;  3K2Y A;  3LPY A;  5KG2 A;  1VMB A;  2MPU A;  1C0U A;  2XI2 A;  5E3C A;  3DU5 A;  1NLK L;  5CHC B;  2ZH3 A;  2BJ3 A;  1KEK A;  2BX6 A;  3DRR A;  2HBR B;  4URS A;  5AT1 B;  3S1T A;  3RYL A;  1QAY A;  2RAQ A;  3VZH A;  1N52 B;  4HHU A;  2LA4 A;  3HMJ G;  3OL8 A;  3FGV A;  3LH2 S;  4KT0 C;  5CAA A;  4FZV A;  3K5N A;  3H98 A;  1SBR A;  1XNR F;  3M6W A;  2ATC B;  1RAF B;  1S9E B;  1S48 A;  2BJ9 A;  3GG1 A;  5DGB A;  3PZP A;  4FYV B;  3Q8P B;  2P9C A;  4HTJ A;  4IRD A;  4P71 A;  1AUD A;  3BN7 A;  3D0I E;  3ZZZ A;  4NLT A;  3MFH A;  1KC8 T;  2UU9 J;  4C9D A;  3OJS A;  3SQO P;  2NRE A;  3I0R B;  2L48 A;  2OH2 A;  2R7S A;  2XLK A;  2ILZ A;  1V6H A;  2WOM A;  3C8Y A;  1JJ2 R;  2JSX A;  4CT9 A;  4KHP J;  3NGS A;  3M05 A;  4ZVS B;  4R8U B;  1S6Q B;  5GME A;  1XMO F;  1RTH B;  3V4I B;  1XIQ A;  2F5G A;  4P6Q A;  2Q6C A;  2IMW P;  3DLG B;  4FN5 A;  4HTI A;  4LFC J;  1FJ7 A;  1IKW B;  4X65 F;  4ZPW R;  2HLU A;  3M8S A;  2J6U A;  3ILJ A;  2D3O R;  4CLU A;  2XTJ P;  3VV2 B;  3RBE A;  3HCX A;  4JP8 A;  3AT1 B;  1UJ6 A;  2DR5 A;  4JV2 A;  2DXF A;  2UUB F;  4DUY J;  4JI4 J;  2EG1 A;  1RIS A;  1I51 B;  2CPH A;  1AYE A;  3AJD A;  2HRT A;  2APO A;  2BW2 A;  2GFF A;  3T5J A;  1VQ4 S;  2JLE A;  3KKF A;  4ZVQ B;  3MD1 A;  4HEA 9;  1QAX A;  4OZN A;  3OFH A;  2V63 A;  4M5M A;  4NA1 A;  5AXL A;  2XMJ A;  5CH7 B;  4DV5 J;  4OZ3 A;  1NK5 A;  3FEY B;  4C11 B;  4NXM F;  3UWT A;  1RAD B;  1CJT B;  4H4O B;  4V19 X;  2NR0 A;  1U1M A;  1MRO B;  2EKN A;  2R9L A;  2E7X A;  1NHK L;  3N79 A;  2Z2Z A;  3QPI A;  4KHM A;  4WP9 A;  1SJ4 P;  4RW8 A;  4I68 A;  4KC5 A;  4DR7 F;  4EBD A;  3GV5 B;  1U1P A;  4C98 A;  3KG4 A;  3W60 A;  4BCA A;  1NK4 A;  5KFJ A;  1N34 F;  1FVS A;  3CJ3 A;  2MTL A;  3ILO A;  3TZY A;  1S0O A;  2HQD A;  2AX1 A;  4RPF A;  5I3U A;  1CQN A;  3V5R A;  1KR4 A;  3F44 A;  1NKC A;  2E7V A;  2E1R A;  1K8A T;  2HZC A;  1IBL F;  1FK9 A;  2YNI A;  3LGM A;  2YNF A;  4RUH A;  3H90 A;  4YP3 A;  2CQ4 A;  2HAI A;  4WPA A;  4EZ6 A;  2J9D E;  5E33 A;  4B17 A;  3DRX A;  4O3N A;  3J80 U;  3HHK A;  2OLW A;  4TNO A;  4X64 F;  1Q78 A;  4J9K A;  3HZE A;  3A3O B;  3HDS A;  3D0H E;  1G4C A;  3HF5 A;  3N28 A;  3LP1 A;  4NE9 C;  4WP8 A;  2C42 A;  2FZG B;  2J0X A;  1SH3 A;  4LF4 J;  3NMA A;  4MKA A;  1NPP A;  4LF7 F;  2LCW A;  4AT1 B;  1LWE A;  3TAM A;  1WDT A;  3CSK A;  5M2U A;  4V1A k;  3KDN A;  2DXE A;  3AA9 A;  3DRP B;  3GCX P;  5HP1 B;  4DS4 A;  1IBL J;  4RW4 A;  1J5E F;  2F1F A;  1LEO A;  1VQO S;  3OR2 A;  4ED8 A;  3Q8U A;  2F65 A;  1TL1 A;  3M8Z A;  3BYP A;  1F9F A;  1WC1 A;  2C2M B;  3Q89 A;  4MK7 A;  1ZAV A;  5L38 A;  4N7T A;  3IWX A;  4JI1 F;  3VR1 A;  1KQK A;  1L3K A;  5KFS A;  1EIY B;  4DR6 F;  5KFB A;  3R7B B;  4UUW A;  3M9M B;  4YOE A;  5D15 A;  2GHP A;  2V2Q A;  4CZC A;  2NZC A;  1LWE B;  1SV5 A;  1PBA A;  3NGR A;  4R0E A;  2VQF F;  1S1T A;  8RUC A;  5A8R A;  1W2B R;  1WAC A;  4X62 F;  3OL6 A;  1M90 T;  1RHQ B;  3FBB A;  5ETT A;  5K8P A;  4BS2 A;  3N5B A;  2B4U A;  1NK7 A;  5C42 B;  1WC4 A;  1H7X A;  5KFL A;  4CH7 A;  5RUB A;  4ECW A;  5KFU A;  3I0S B;  3G6Y A;  3OFE A;  4ECX A;  2IRX A;  3A8I A;  3CB4 A;  4CNZ A;  5KFM A;  4DL5 A;  2FJE B;  2NSC A;  2AYM A;  2O01 C;  3IG1 B;  4RWX A;  3CJK B;  1RT7 A;  3FCW A;  4DLE A;  1MU2 A;  2CJK A;  1S7I A;  4JI5 F;  4CH0 S;  3RAX A;  4U96 A;  5C24 A;  5THW A;  2RUG A;  1RWM B;  2KJV A;  2Z58 B;  4CLY A;  3B4D A;  2X3G A;  4L72 B;  4EU0 A;  5KTQ A;  2GJF A;  4YY3 J;  1NM2 A;  1D3W A;  2E29 A;  3VAK A;  5MAO A;  4DLG A;  4NL5 A;  4OYP A;  4ZPA A;  2FPH X;  2AYB A;  1M0S A;  3F0N A;  3FBE A;  3LA0 A;  4FNI A;  3KJV A;  1KN6 A;  1XER A;  3Q86 A;  1TZ0 A;  2W4P A;  2W1B A;  2WAQ D;  4ED2 A;  4PPD A;  3QT8 A;  1YJN S;  2DK2 A;  1SB6 A;  1MW7 A;  1S72 S;  1UW9 A;  2R8I A;  3HO1 A;  1M1K T;  2I38 A;  2FHM A;  1M5H A;  2XQC A;  2A1B A;  2BM0 A;  1EQ0 A;  3LUY A;  3GWC A;  3MAA B;  5KFT A;  3ELH A;  4DV0 F;  3CC4 S;  1DUR A;  5KT6 A;  5L8R C;  4GKK F;  5G0R B;  5KFD A;  1IKY A;  1PYO B;  2BJ1 A;  4NML A;  1ZZN A;  1LV5 A;  2LQ8 A;  1SJQ A;  2V4J A;  4QW8 A;  4NEZ A;  2DIV A;  3OTC A;  1WEL A;  1R43 A;  2Z30 B;  3QWU A;  1CQM A;  2C3Y A;  3PO4 A;  3KK3 B;  3MMB A;  1RT7 B;  1YG0 A;  2WW8 A;  3HSD A;  3PEH A;  2B9E A;  5HJX A;  4OZ2 A;  4LR7 A;  3RBZ A;  3TA0 A;  4ES1 A;  4HT7 A;  2AJ4 A;  3PJ9 A;  4PYA A;  4QIW D;  2RF2 B;  4C0B A;  2XBP A;  5LT5 A;  4JI5 J;  3SSQ A;  1RU2 A;  1S97 A;  1N36 F;  2WON B;  1CJK B;  3C6U A;  2XS7 A;  1VBX A;  2YBV A;  4NYP A;  4DV4 F;  4ICL A;  1FRM A;  3SZ2 A;  2IY5 B;  1RT1 B;  3MI7 X;  2ZD1 B;  2PO4 A;  3N5F A;  4IG3 A;  3PTW A;  4GRS A;  4OI2 A;  5G0R A;  4AND A;  5FLX U;  2GJI A;  2BJE A;  3MZI A;  4DR3 F;  1RK8 A;  2MGZ B;  4N8N A;  3VVU A;  4DMZ A;  1JLF A;  1UW4 A;  3BM7 A;  3MMA B;  4RUA A;  1J5E J;  4I0W A;  2ZM6 J;  3UD3 P;  2BAB A;  1TKX A;  1N32 J;  3GCW P;  3LGN A;  3UQS A;  3OPK A;  3GTY X;  1UVN A;  2I8E A;  3H25 A;  5IQ6 A;  3QT5 A;  4Y3C A;  4JYA F;  1U1R A;  4YME A;  2QV6 A;  1S9E A;  3AXK A;  4O3O A;  1ZPW X;  2HHP A;  4ZP8 A;  4M5K A;  2MHN A;  2ZHB A;  2QE5 A;  4EFA C;  4QU6 A;  1UZH A;  1H73 A;  3SMZ A;  2XMT A;  5HAO A;  5M2P A;  4WJB A;  2UUA J;  1LNQ A;  2HNZ B;  3D6H B;  2HRY A;  5HO4 A;  4LSN B;  2M52 A;  2WW4 A;  1F2H A;  2E1P A;  4QPT A;  4X4T A;  2ALZ A;  5A2Q U;  5DET A;  4ZN1 A;  2NSB A;  4E98 A;  2WVF A;  4UST A;  4ZCK A;  3ZZ0 A;  1HNZ J;  2UUC J;  2EI5 A;  2EFO A;  5ETV A;  4ED4 A;  4LBI A;  3KLH B;  1TKT A;  4F67 A;  3W5Z A;  2MQO A;  3UE2 A;  4CH1 A;  1SKR A;  2PEB A;  1FDB A;  4AYB D;  1F3V A;  4V19 J;  2WSF C;  4DR4 J;  4F02 A;  3TOQ A;  2ADB A;  1NPK A;  2ZC3 A;  2R7V A;  4I6Y A;  5I3U B;  4KHR A;  2A2D A;  3C14 B;  2WSE C;  5K5M A;  5U47 A;  1TVR B;  2UV8 A;  4MYU A;  2PDA A;  2VZ9 A;  5KFQ A;  4X4U A;  1PIL A;  1SH0 A;  3E8O A;  1K47 A;  3W2V A;  1OYE A;  1W2I A;  3UNG C;  4NLV A;  3R5B A;  2GC8 A;  2YNH A;  5KFE A;  2J7K A;  4BBY A;  2W9B A;  4EYI B;  1S9G B;  2IPO B;  3RR7 A;  3H20 A;  1UEK A;  1MRO A;  3MM8 B;  5KT5 A;  2VDI A;  5B0A A;  1PYT A;  3MDF A;  3QWP A;  3T9Z A;  3LW5 C;  1YBU A;  1RTJ B;  1VDH A;  5L9N A;  3TZZ A;  1H38 A;  1N5Q A;  1U26 A;  4Q44 A;  4AQY F;  1HI8 A;  4ILR A;  4UTG A;  3DHX A;  1NB7 A;  3DRP A;  2YH0 A;  4ZVO B;  5K14 A;  2RU9 A;  1S12 A;  3A8K A;  3WHI A;  3MD3 A;  1VRU B;  2UUB J;  4JI4 F;  4M94 A;  1F9H A;  2IRY A;  4LT6 A;  1RTI A;  2GGP A;  3W2V B;  3V81 B;  1GMV A;  4PAB A;  3Q8R B;  3DGV A;  1IN0 A;  3LP0 B;  3ET6 A;  5K9F A;  2AWZ A;  1TQL A;  3QIP A;  2LLZ A;  2PE8 A;  4HAC A;  2OAU A;  1HI0 P;  3OJU A;  1FK9 B;  1RHR B;  2J7W A;  3NEK A;  2GQQ A;  4PYD A;  3G8Q A;  5IM0 B;  2VQE J;  4F3O A;  2MSS A;  2KXN B;  2AZ3 A;  3K8V A;  3HD2 A;  4OYM A;  4U6P A;  2XLJ A;  2BV3 A;  1JQG A;  1NK8 A;  3IM9 A;  3FSX A;  5CAB A;  3QIP B;  2LEB A;  3CCW A;  4C7Q A;  1CJU A;  4WU3 A;  1TK5 A;  2IDE A;  1T05 B;  1WDD A;  3ZZU A;  3G87 A;  1WI6 A;  3CPW R;  1VC0 A;  2GGP B;  2LDI A;  3V81 A;  2QZ8 A;  3RAM A;  2H4W B;  2MZR A;  4OHV A;  3W1Y C;  4LQ3 A;  2HNZ A;  2HHU A;  1CVJ A;  2JEI A;  1RAC B;  3M2V B;  3KOA A;  4XIU A;  3TYT A;  2M2B A;  1GT8 A;  2C3P A;  3PAC A;  2FJB B;  4LRE A;  4OJ1 A;  1HLW A;  1HBN B;  1OPZ A;  2DNZ A;  5H9E J;  3TO8 A;  3R6G B;  1J2V A;  3CDU A;  3KXD A;  5C5J A;  3BQ0 A;  4KTQ A;  1A7G E;  3HVR A;  1U8W A;  2NPI A;  3L95 X;  1I94 F;  3MM5 A;  5I42 B;  1YDL A;  3CCR S;  2XYG B;  1JLQ A;  2HQF A;  1IM6 A;  1CS4 B;  1U2R A;  1Y4Z B;  4WWS A;  2PI5 A;  2RML A;  3OQ2 A;  3NGK A;  9ATC B;  2H9Z A;  1X7V A;  2DR9 A;  1O0P A;  1FX2 A;  2GIR A;  1LXJ A;  2ZD1 A;  3GYN A;  3QZ8 A;  1VQM S;  1R8C A;  5KFW A;  4DL7 A;  1FKA F;  4ECR A;  3GB0 A;  3VGU A;  3ZTR A;  1S1W B;  5AJ3 J;  4X4Q A;  2XCP A;  4YEA A;  5GMD A;  3KK2 B;  2EFV A;  2OO4 A;  5D77 A;  4USM A;  3OTO F;  2O1P A;  2DR8 A;  3IG1 A;  1MN9 A;  3NWR A;  5FDL B;  2VOD A;  5D0E A;  1KRP A;  4I2Q A;  4O4G B;  2AYE A;  3PYF A;  5E41 A;  1LK5 A;  4WFA Q;  2DNK A;  2C2O B;  4NCG A;  1TL3 B;  4F4A A;  2UUC F;  4LF9 J;  3TP2 A;  5L1J A;  1R6V A;  3CJ4 A;  4OI3 A;  4DFM A;  4WKR A;  1VRU A;  5KG1 A;  2JFD A;  3PIO Q;  2HKE A;  4WFY A;  2V34 A;  1VBZ A;  4X4N A;  4YR3 A;  3PHT A;  4CWB A;  4O3R A;  4DV2 J;  1UCN A;  4P2S A;  4NLY A;  2V4R A;  2XUL A;  3BO3 A;  1A0O B;  1KOO A;  1IKV B;  1X4H A;  3ZZR A;  2Z8Q A;  2VPW B;  2NYI A;  1RAE B;  3KJF B;  1RCO B;  2JDJ A;  3H2L A;  4M5I A;  3K89 A;  4MFB B;  4ZDN A;  2IVF B;  1CPZ A;  3JTP A;  2FHK A;  5EDW A;  1UFW A;  2X7I A;  4ZP9 A;  4F4Z A;  4B3O A;  3UN3 A;  4J9N A;  4QYZ K;  1UTA A;  4QWB A;  1OSC A;  5E3A A;  2KZM A;  1SIZ A;  3QFH A;  3PM9 A;  2LXI A;  5KAK A;  3THT A;  1HQ2 A;  2MQN A;  2HQC A;  3AQO A;  4KB7 A;  4FF4 A;  1X5P A;  2YNG A;  3KJN B;  1CJK A;  4K50 A;  3A4T A;  2C2R A;  1BE4 A;  2KFY A;  4JBC A;  2HLT A;  2IJN A;  3MPW A;  3E51 A;  3G2X A;  4C2M A;  5CQG A;  4A4J A;  3GII A;  1QAI A;  3NS5 A;  1DTQ B;  4WZM A;  4QR0 A;  1YWX A;  4I69 A;  2VQF J;  1FNX H;  2V9K A;  2RS2 A;  2NUH A;  1EET A;  1PYS B;  3C6T B;  4OI4 A;  1C0T A;  2I0X A;  2MY8 A;  2V6A A;  1BQM B;  3H42 A;  3HJV A;  3QMQ A;  4FP9 A;  5J1E A;  3KLF A;  2ZJR Q;  2P5V A;  3K5P A;  3D1Q A;  1RB0 A;  3R5C A;  2RJZ A;  4I7F A;  3NBP B;  4DFJ A;  3QGI A;  1VYA A;  1N5Y B;  4QIG A;  2XMV A;  3G86 A;  4IG0 A;  2VD3 A;  4NXN F;  3RUB L;  2EBG A;  2CXE A;  4DSF A;  1ZM4 A;  3MM5 B;  2CNK B;  1NME B;  2C3M A;  4P7V A;  1OWX A;  2GNK A;  2FTR A;  3QRQ A;  4DV1 F;  3EDR B;  4I6A A;  3CDB A;  4IR9 A;  2NXC A;  2F9D A;  3GU0 A;  4TY9 A;  2BQR A;  4MK8 A;  4ZJL A;  2IC3 A;  1VQY A;  2QLW A;  1T9X A;  3NAH A;  2HFZ A;  4ZN3 A;  1H2T Z;  3JXO A;  1E6Y B;  3HHN B;  4PG4 A;  2V8P A;  1H7W A;  4DQR A;  3T1Y F;  4F25 A;  1VBK A;  1S1V A;  4G1P A;  4ANC A;  4O4G A;  1U2F A;  4ZVG A;  5IV3 A;  1TKD A;  1BQN B;  1K73 T;  5IC4 B;  2GVD A;  2B6A B;  2HSE B;  1SPB P;  1WHX A;  4MKB A;  3M8Q A;  1XJW B;  1T03 A;  1QE1 B;  2VFV A;  1DJ0 A;  2YX7 A;  2ZH4 A;  1QLN A;  2YVS A;  2BAC A;  4F36 A;  1TL7 A;  2GAG C;  3I32 A;  2HHW A;  2DBB A;  1Q8L A;  1JB0 C;  1EP4 A;  3HSJ A;  5LL6 d;  4F0K A;  1SJ1 A;  4KGV B;  3AJ2 A;  2A3J A;  2FLN A;  2KJW A;  1XTZ A;  3PW2 A;  1HL6 A;  1RQ0 A;  4LIR A;  2ZNY A;  3D54 A;  2Y8Y A;  1N6Q A;  2X3D A;  2OTL S;  4DZD A;  1QSS A;  4P74 A;  5K8M A;  4Q7A A;  3BPD A;  3CDE A;  3SV3 A;  1MLA A;  4EK2 A;  8ATC B;  1Q7Y T;  1KVJ A;  3C46 A;  4DPW A;  3PX0 A;  4LSL A;  4IFV A;  1B0T A;  1H0H B;  1S6P B;  3VGV A;  4K8R A;  2XS5 A;  2OD4 A;  2VH7 A;  1FRK A;  2DGU A;  4CO1 A;  1YBA A;  1TV6 A;  1WF2 A;  1GTH A;  2D7S A;  3QO9 B;  1RI7 A;  5J1P A;  5H1S V;  4EYH B;  1DQA A;  4JI0 F;  3C6T A;  3ZO7 A;  4I6W A;  2I2Y A;  4NLU A;  5T41 A;  4LF6 J;  2FLL A;  4Z7Y A;  2ZC4 A;  1Y00 A;  3IS9 B;  3SQG B;  1KD1 T;  3OXF A;  4UT4 A;  1HD0 A;  1T3O A;  2YPZ A;  3AOC A;  3NCR A;  4LF1 A;  4CLZ A;  3HM9 A;  4I2Q B;  4ETX A;  5DDO C;  2DTJ A;  2KG0 A;  5DDQ C;  2YNF B;  1KOH A;  2J0Q D;  2QA4 S;  2VFT A;  4IOB A;  3OFF A;  3W61 A;  3Q23 A;  4EBE A;  1FFS B;  1IWG A;  1D0E A;  3LTO A;  2W7O A;  2CDR B;  4Y0F A;  2KO1 A;  4OYX A;  4QBU A;  3VAM A;  1WSV A;  2UU9 F;  1NK6 A;  3TRG A;  1RWW B;  4USU A;  1I94 J;  1VBY A;  2M3D A;  1KQG B;  2ZOG A;  2AX0 A;  2KVI A;  2DHH A;  2J0S D;  1Y5I B;  3RR8 A;  1RWN B;  2W2N P;  5ETL A;  4C97 A;  1R0A B;  2QN6 B;  2WSC C;  4WP3 A;  4J9R A;  2CPF A;  5DM7 Q;  3AAW B;  4UOH A;  2KT3 A;  2VDH A;  4D3G A;  1PGZ A;  2EFN A;  2HYI B;  1GNK A;  2HBZ B;  5E0O A;  4P9S A;  2OSQ A;  3ZTP A;  3UR0 A;  1KBR A;  1Q0N A;  3IP0 A;  4LRD A;  4DBQ A;  3LWL A;  4RU2 A;  2OIH A;  3HVW A;  2G0C A;  3KLI A;  1N33 F;  1PAE X;  2YWE A;  2HEK A;  1B0V A;  1S6O A;  4ZCI A;  3EPI A;  5E2Q A;  3NCP A;  4N47 A;  5B09 A;  3SSR A;  1VK8 A;  1JJ4 A;  4YHH F;  2YX4 A;  4NWB A;  2CJQ A;  3MCS A;  2QO3 A;  1ZTW A;  1T0T V;  4H4M B;  4MIW A;  4OHW A;  4QCL A;  4KE5 A;  4ZPV R;  3OVS A;  4H4M A;  2OPS A;  2BOP A;  4OYW A;  4PWD B;  4A8Y A;  3FQL A;  3G8T A;  2JOQ A;  3SV4 A;  1X4F A;  3V6H A;  2CRL A;  2M4M A;  1F60 B;  2I9S A;  4BHQ A;  4IRK A;  3M8P A;  5KFG A;  3MCO A;  2YWW A;  1RWV B;  1HBU B;  1KSP A;  1IKX A;  4CYU A;  4JOU A;  3RB6 A;  1PSD A;  1X8D A;  1M5S A;  1ZAW A;  2ZHO A;  4KKO B;  4K5S A;  1NJZ A;  1SQE A;  4LF5 J;  4NZ6 A;  1X60 A;  5A8W A;  3W9I A;  4P75 A;  3CUN A;  1Y5L B;  4J9V A;  2V2V A;  2ZKU A;  3ETO A;  3M30 B;  3HFK A;  3QT7 A;  4RW6 A;  5DQI A;  2UVW A;  1NDK A;  2CWK A;  3A8E A;  2W25 A;  2BOA A;  4OLO A;  2ZKT A;  5DRK A;  4YB1 P;  3L3C A;  5IT9 Y;  1VJQ A;  3HK2 A;  2GJ2 A;  5J2M B;  1FRJ A;  2DJW A;  4Y28 C;  2ZZT A;  4DR2 J;  1AZS B;  2K1R A;  1NAQ A;  1JNZ B;  1FRX A;  2HS3 A;  1L3U A;  4F0M A;  4A8X A;  1HR0 F;  5L9X A;  2AEJ A;  3DLH A;  1NXI A;  2DGX A;  3D1O A;  5KFR A;  3HUL A;  2MXY A;  3UDE A;  3MHY A;  5IXU A;  4UY8 5;  4DG1 B;  1Q1K A;  4NLW A;  5IZH A;  3I55 S;  1U1Q A;  3DMJ B;  4EO6 A;  1D1U A;  1WWH A;  4OX8 A;  2BDP A;  4WCE Q;  2OPS B;  5C24 B;  1IM4 A;  3MR6 A;  1H3D A;  3DRS A;  2IJF A;  4NLO A;  4DSI A;  3FEX B;  1G7C B;  4P10 A;  3EZO A;  1BHN A;  2HHV A;  1FFG B;  4LF6 F;  2DNR A;  5KFI A;  5KFV A;  5KFP A;  3AOD A;  2RVJ A;  3ZFV A;  4UZB A;  2C2D A;  4DEZ A;  2XO7 A;  3DOK A;  2DGT A;  1FF2 A;  3U02 A;  2CVE A;  2ZEJ A;  5D0H A;  2GMJ A;  1MMN A;  2GML A;  3M2R A;  5MLC V;  5IOL A;  4KV8 A;  1LFW A;  3CNQ P;  2HUR A;  4XO0 A;  4KY3 A;  1F5A A;  3FC9 A;  4AUK A;  1SUQ B;  1QAJ A;  2MQM A;  3PRD A;  1R7I A;  4ED5 A;  2RHQ B;  4F2R A;  3MAH A;  3N9U C;  2CNN B;  4YB7 A;  5T7L B;  5C25 A;  4DR5 F;  3MM6 B;  3O2I A;  3RB4 A;  1T8E A;  1SL2 A;  1N0U A;  2RKI B;  4FKX A;  4NOH A;  3D7S B;  1C1C B;  1KFS A;  5KOX A;  1IUJ A;  1C1C A;  2EBE A;  2A2C A;  3D6F B;  3J7Y I;  3JB9 k;  2JEF A;  3GR1 A;  5BJR A;  1FE4 A;  2Y0S D;  3HHL D;  4HH0 A;  4KRW A;  1VQP S;  2BRK A;  1FA0 A;  2M88 A;  3NOG A;  3D6T B;  2AGO A;  2VFS A;  2V8D A;  5CD4 A;  4A8K A;  2JEJ A;  2MGZ A;  2L9D A;  3HKZ D;  5A0Y B;  1BLU A;  3PX6 A;  2BZ2 A;  4GKJ J;  2VBZ A;  5BYR A;  3LP2 A;  5JMN A;  2ZH1 A;  1SL0 A;  1R89 A;  3BPS P;  3PW5 A;  1CUL A;  3FUY A;  3KLG A;  2FIU A;  1XBW A;  4IFY B;  1JNR B;  1KTV A;  1NO8 A;  1OPI A;  1YGY A;  1S1U A;  2DNN A;  2PI4 A;  2DR7 A;  4A8O A;  1U24 A;  5C2C A;  3I5B A;  2KRB A;  5F9N A;  1SC1 B;  4J9P A;  1HYS B;  4FF1 A;  2VBX A;  4CO2 A;  1XEZ A;  2B9Y A;  2V8H A;  1UWA A;  5HJY A;  3WBZ A;  2N7C A;  1CC8 A;  1ZM2 A;  3DGP A;  1YKW A;  2C2Z B;  2GVZ B;  3QGP A;  4N77 A;  4NYO A;  1RT5 A;  3KLE B;  4LJM A;  4F4X A;  4GKJ F;  2CG4 A;  2JX2 A;  2V4J B;  4IDK A;  2D9P A;  2MQP A;  1WF0 A;  2B5J B;  5A0Y A;  2WB4 A;  4RNF A;  4WFB Q;  3PV8 A;  1FXL A;  4W90 B;  5SUH A;  3LGH A;  2LMI A;  4JI8 F;  1YRT A;  7FDR A;  4IFV B;  2OSR A;  2FVP A;  1DZ5 A;  3NAI A;  1JJC B;  1XMB A;  3M1V A;  3IRW P;  2P9G A;  3GSD A;  5D8H B;  5F8M A;  5HLF A;  1HNV A;  2F3J A;  4TVA B;  4OZJ A;  3CCT A;  4OI6 A;  4LF7 J;  1WG5 A;  2VFU A;  4RX6 A;  4LFB F;  1RKI A;  1U1L A;  2L9W A;  2FVC A;  4TLQ A;  2F63 A;  2C2E A;  4L6V 3;  2HZV A;  4KGZ B;  4DR6 J;  5I3P A;  2KFN A;  2QGF B;  1KQS R;  2XSJ A;  3CJ5 A;  1X5O A;  3C66 A;  4OX6 A;  4DU8 A;  5HRO B;  4JI3 J;  4LF8 F;  1EP4 B;  1PJ6 A;  3CD6 S;  4Q5V A;  2DHS A;  1RBO B;  2MZJ A;  3K5L A;  4PQU B;  2KHD A;  1C0T B;  3DI6 B;  4JUZ A;  2HAF A;  1O5J A;  1YZ7 A;  2UVR A;  1N32 F;  1AFJ A;  1FWP A;  1MML A;  3GG0 A;  2RF2 A;  2JJ4 D;  1WKL A;  1REG X;  2VL1 A;  2WCX A;  3JQJ A;  3KG1 A;  2UV8 G;  1U49 A;  3L9Z A;  4QIV A;  4LFB J;  2DD8 S;  2ATL A;  1J5O B;  5F8J A;  1WC5 A;  1YQH A;  1Y5N B;  1W26 A;  2YNI B;  2MHE A;  4XDC A;  3UD5 A;  5LXY A;  3CC2 S;  4ED3 A;  3THV A;  2IBO A;  3VQS A;  3DRS B;  3IFE A;  4AL5 A;  1Q81 T;  2BM1 A;  3RZA A;  3GFX A;  3M4X A;  4UOG A;  3Q0A A;  2VPZ B;  2KU7 A;  2ZH2 A;  3X1L B;  2E5J A;  4AQY J;  3HHL C;  2EC0 A;  4F4Y A;  2OMO A;  1X4A A;  2M5Y A;  5J2N A;  4MT1 A;  2KHC A;  2RUS A;  3UDL A;  3VCD A;  2ZM6 F;  4MKY A;  1ITP A;  4TY8 B;  2MKI A;  1JLQ B;  3EGN A;  3N0V A;  3OXG A;  1RDR A;  3HHD A;  1HNV B;  4B08 A;  4ZJO A;  1U47 A;  4C8Y A;  1HA1 A;  5ETO A;  2V2K A;  1GXU A;  1RE1 B;  4DR3 J;  1EX8 A;  3PX4 A;  1RT6 B;  1U0S A;  1VIX A;  5J2P B;  4IUF A;  2HS4 A;  2NCK L;  4KFB A;  2QIF A;  2UZA A;  3U1L A;  4X66 J;  5I4M A;  3TAP A;  3T19 A;  2DVI A;  1YIJ S;  2DNY A;  4FKY A;  4ED0 A;  2ZH8 A;  4FDF A;  2VON A;  2Z2M A;  3I9V 9;  2QYG A;  4KPY A;  5DDR C;  1FO1 A;  2D3O 1;  3IA0 A;  3Q22 A;  1U7L A;  1QD1 A;  1RAA B;  1Z1Z A;  2WHO A;  2YQ1 A;  3B54 A;  1XNQ F;  1U25 A;  2J5A A;  3CCZ A;  4DQS A;  4TKT A;  3TUZ C;  4USK A;  3SSS A;  1C1B A;  2CFX A;  4NLX A;  2Z0G A;  1V3R A;  4USI A;  3UR3 C;  1YI2 S;  2F8M A;  3IAS 9;  4MKV A;  5G4D A;  2UXC F;  4JB8 B;  3PIP Q;  4N8O A;  4DX7 A;  4ZA1 A;  2BQ3 A;  1FTR A;  5AJ3 F;  2YQ0 A;  2COL A;  5IWA J;  4ZPB A;  1S6Q A;  3Q8V A;  1WOR A;  2CPJ A;  3LP2 B;  5IQQ A;  1OQ6 A;  1Q7L B;  2FB0 A;  2FD2 A;  3T6J A;  1T3N A;  4B3M J;  1VHF A;  5J1N A;  3G8S A;  4FYD A;  2YY3 A;  2F4F A;  2RHS B;  3QO9 A;  4LR9 A;  2WVC A;  4FYX B;  4QIE A;  5LOQ A;  1R8P A;  4P2M A;  3EYZ A;  3POT A;  3QSI A;  3ZTQ A;  3W9J A;  4F50 A;  2M70 A;  3IC1 A;  4NI2 A;  1CJT A;  4H4O A;  4C6A A;  1B99 A;  2W01 A;  3LAL A;  3IWL A;  3PW0 A;  2UP1 A;  2QMU B;  2XGP A;  2RB7 A;  3D28 A;  2MJN A;  3OR1 B;  4L74 A;  3G4S S;  4PUO A;  2CVI A;  2HIY A;  5KT7 A;  4UQG A;  1HNX F;  5AXK A;  4A8W A;  4CO4 A;  4CLS A;  4WFZ A;  4DV7 J;  2RRN A;  1WJ9 A;  2VG5 B;  4K59 A;  3VGT A;  2CJB A;  1U2C A;  3E01 A;  5LSL A;  2ZHA A;  2R7W A;  1SXL A;  2UVU A;  4LVO P;  3AD9 C;  4YS2 A;  2DH8 A;  2DIS A;  1CSJ A;  1YJW S;  5DDP C;  3Q2S C;  2VAS A;  1T9W A;  3SFU A;  1TL4 A;  3VVT A;  3KK1 A;  3N6N A;  1MMD A;  1TVR A;  4EMD A;  2OI2 A;  3OSP A;  3D5M A;  1RYS A;  3CJT A;  1APS A;  1N5S A;  3SCK E;  2DYA A;  4ID5 A;  2HFU A;  3LAN A;  1TUW A;  3BR9 A;  2R8K A;  4C8M A;  4TU9 A;  3W3S A;  4WU2 A;  3RJM B;  1AXQ A;  1LWF A;  5B0E A;  5DQG A;  1FKO B;  3W9H A;  3UD4 P;  4B3S F;  1G6B A;  4U8V A;  3NWG A;  4K2J A;  1JLB A;  1DTT B;  1MG7 A;  3DMJ A;  1HNX J;  2CQI A;  3Q83 A;  3MMB B;  4KR0 B;  2AV5 A;  1XC9 A;  4FXD A;  5CA5 A;  1ZBT A;  1XR5 A;  2VC1 A;  2AEF A;  3DN9 A;  4AD6 A;  3KUE A;  1D9A A;  8AT1 B;  1IVZ A;  1U6Z A;  1TK8 A;  1E6Y A;  5KG4 A;  5IFM A;  1V5I B;  2FHO B;  2P6T A;  3CVK A;  3QAE A;  3OHA A;  4QU7 A;  1WEZ A;  1TV6 B;  7AT1 B;  3M6U A;  2N3L A;  3CDW A;  4G65 A;  1UEU A;  1Z2L A;  4M5L A;  4QQB A;  2D3Z A;  5EN1 A;  4H4K C;  4KIA A;  1RU1 A;  2MY7 A;  4WK3 A;  3CCU S;  1QVG R;  2AYG A;  2E5L J;  1WG4 A;  5KFC A;  3HXM A;  5HBM A;  5GAE U;  3J7A N;  4G1Q A;  3EXY A;  3MPY A;  3C15 B;  2E9T A;  1NK9 A;  5DO2 A;  2J8A A;  2VG6 A;  2X1A A;  3HT0 A;  4DFP A;  3DOL B;  5ETQ A;  1HHT P;  4F0H A;  3RB0 A;  3L7P A;  2DGW A;  4RNN A;  2IM0 A;  3TVY A;  4TQS A;  2PA3 A;  3M6V A;  2CQ2 A;  1NBE B;  1TFW A;  2QC3 A;  3GFY A;  2W2O P;  2OGU A;  3BEG B;  3MCM A;  2CNO B;  2V2Z A;  1WC3 A;  2FUG 9;  3O1L A;  3CT9 A;  4QR1 A;  1IQT A;  2EW9 A;  1VQS A;  3PFO A;  4OV1 A;  1RAH B;  2NXE A;  2KM8 B;  2GVZ A;  1R0B G;  4XDD A;  4C48 A;  4Y00 A;  1VHI A;  3LPE A;  1MU2 B;  3ZNJ 1;  2E9Z A;  2RDI A;  1I6J A;  4BDP A;  3KLH A;  1ZA2 B;  2DNG A;  4Y65 A;  3BJY A;  1LK7 A;  4B3R J;  1SCJ B;  3PCO B;  5KT2 A;  2ZBI A;  4QPX A;  1KQF B;  3M6X A;  3I0S A;  2OKQ A;  3AJ1 A;  4LRA A;  2PA8 D;  3UCZ P;  1RTI B;  5A8R B;  4F26 A;  3IM8 A;  4CO5 A;  1WKJ A;  2YPY A;  3DLE B;  2WBR A;  3A3P B;  3DXS X;  1T7P A;  2JLF A;  2MLY A;  3P5T L;  4PQA A;  2FY8 A;  2ZZN A;  2QMX A;  1HD1 A;  1KON A;  3R9L A;  3CUL A;  2QL7 B;  5H9F K;  1GTE A;  1BQX A;  2HPU A;  3ULH A;  5K8O A;  3BDE A;  3C19 A;  3QID A;  1QTM A;  1FEE A;  2DKO B;  3DFE A;  4UOF A;  4C0H A;  2DHG A;  1X4C A;  2DNO A;  1FI4 A;  3B6B A;  3POT B;  5ITH A;  3J7Z 5;  3GIJ A;  3IGN A;  3E2E A;  2W9B B;  1IKV A;  4DWI A;  1KHW A;  3DM2 A;  1NSQ A;  4F04 B;  3UDC A;  1NSP A;  2QSF A;  3EUN A;  2ZBQ A;  4QR2 A;  2IIH A;  4CTA A;  5AE3 A;  1PKU A;  4RW7 B;  2QFI A;  2CQP A;  4BC7 A;  4ZLN A;  4GO5 X;  3DLL Q;  2UUA F;  2V68 A;  4DSE A;  3DLE A;  4PCQ A;  4IG3 B;  5IC6 B;  3S6E A;  4ECZ A;  2F8E X;  3H2V E;  4AXI A;  5KG3 A;  2R7X A;  1MWY A;  1F2G A;  4K5R A;  4OJ3 A;  3MMJ A;  1RTD A;  1OQ3 A;  3DDN A;  1NJX A;  3AXM A;  2VBY A;  2XMW A;  4NEY A;  2IA6 A;  3PKM A;  2W9C A;  3F56 A;  1UVM A;  5M2R A;  5EWE A;  4KGK A;  1IJE B;  2RH3 A;  4DPO A;  4JV5 J;  1AW0 A;  2QLF B;  3CD0 A;  4B9M A;  3R2D J;  2B0G A;  2K7K A;  2ZWO A;  1ZZF A;  2NXJ A;  3FNN A;  1S79 A;  3ZTS A;  1FDD A;  2SXL A;  4HL9 A;  1B4S A;  1HKA A;  2MZQ A;  2EC2 A;  1NSK L;  2OPR A;  2XWY A;  4DZ6 A;  2XHW A;  2KTQ A;  2LA6 A;  2WK4 A;  3GR0 A;  3TX8 A;  4K4T A;  2VF3 A;  4JV0 A;  2ZJQ Q;  2FHJ A;  1NJY A;  1NUE A;  1YIT S;  1HNI B;  3OL9 A;  2QLX A;  3T1A A;  4DUY F;  4NLS A;  2DO0 A;  3K17 A;  3NNH A;  4CLW A;  4FVC A;  3QJL A;  1X0F A;  3OVA A;  3TR5 A;  4J9O A;  2IM2 A;  4K4S A;  4ZVE A;  1S10 A;  3ONQ A;  3G6V A;  1S4E A;  1M5P C;  2CZ4 A;  3C16 B;  3H2U B;  3I6P A;  3ILL A;  4IYQ A;  5J2P A;  3NBP A;  1Q82 T;  1IBM J;  1B3T A;  1IBM F;  1JLE A;  4B9L A;  1R6Y A;  4CLF A;  2RDD A;  5KFY A;  2LXU A;  4WF9 Q;  1EET B;  1VQL S;  3MEE B;  1HQU B;  5A8K B;  1PBU A;  1I1G A;  3M8P B;  4USH A;  5ETK A;  5CCL A;  5L1K A;  2F40 A;  2DB1 A;  4A47 A;  2CWX A;  3PEJ A;  4IRC A;  1DTT A;  2HVD A;  3ICL A;  3PJX A;  3T41 A;  1OIA A;  1S1V B;  1U09 A;  2F4V F;  3NP5 A;  2KRR A;  3QAT A;  2DRB A;  5DG9 A;  5IM0 A;  3W65 A;  2GCF A;  1WEY A;  1QTN B;  2PC6 A;  2XWX A;  2YQ3 A;  3HVT A;  3MPU B;  3MOJ B;  4J5O A;  3UNY A;  2YKN A;  2Z56 B;  4HR2 A;  2RE1 A;  2RIL A;  4A48 A;  2RT3 A;  1QSY A;  2QA1 A;  1S1X A;  2L3M A;  1BWE A;  3PDN A;  1GMU A;  2HGM A;  2WVD A;  4PG5 A;  1KS2 A;  3BGR B;  3MED B;  2KZZ A;  2RQK A;  1S0N A;  1TAU A;  5CZV A;  2XY6 A;  1P1T A;  2HIQ A;  4ZVT B;  2ZBP A;  2VIH A;  1BGX T;  1O51 A;  2JNJ A;  5A2Q Y;  2CAJ A;  2OPP B;  1D9D A;  1HMV A;  2MMY A;  1VQ9 S;  1NJW A;  4DX8 H;  5EUH A;  2DGV A;  4ZIW A;  1U0H A;  3I4P A;  1LW2 A;  1SJ3 P;  2BXJ A;  2QMW A;  2DEJ A;  3K59 A;  3E3X A;  1PG5 B;  3EGZ A;  1MSW D;  1FHT A;  1LWX A;  1FFW B;  5J1E B;  1R0A A;  4LF4 F;  4PZV A;  1D8Y A;  1JKH A;  2BE2 A;  4URQ U;  2X51 A;  4HHH A;  2N82 B;  1S0M A;  3R5J B;  1NU4 A;  4WXO A;  3LP1 B;  3D2W A;  2FVS A;  4OHZ A;  4OX9 J;  5F0U A;  5DS7 A;  4FXW A;  1QY7 A;  2VC0 A;  3DOK B;  2ABY A;  4ZCL A;  2EK6 A;  1ROF A;  3R8Y A;  4PWU A;  3TZX A;  3J7Y U;  2XI3 A;  2RRA A;  2UVV A;  3PR5 B;  4IH5 A;  1FKO A;  4WFX A;  2DNM A;  4A8Q A;  4ECT A;  2JZ5 A;  4X4O A;  1WOO A;  5B0C A;  3HKW A;  4HAC B;  3OLA A;  1RT3 B;  4OI0 A;  3OLB A;  1HWJ A;  2J6T A;  1N5V A;  1S6U A;  4B9V A;  3OW2 R;  5IS2 A;  3P3D A;  4A8M P;  3LAM A;  1FVQ A;  4LRF A;  3DNC A;  3KFW X;  5KFF A;  4YFU A;  1IBK J;  4DDF A;  2ACM A;  1NH7 A;  4LVN P;  2DGO A;  3CCQ S;  3LQV A;  4ED7 A;  2ZDO A;  4HI2 A;  1P27 B;  4ZIV A;  3PKY A;  4LF5 F;  2H1Y A;  1TR0 A;  5L1L A;  4E8U A;  2AT1 B;  2AP6 A;  1LXN A;  1T9U A;  4OV6 A;  5FLX Y;  3EGW B;  2XMA A;  2V5H G;  1BWV A;  4KO0 A;  3TVK A;  3JAM U;  1H72 C;  4DV6 J;  4ZLJ A;  5HL7 Q;  4KO0 B;  3WC0 A;  4DV6 F;  2ROP A;  3EZ5 A;  1PC5 A;  3KYL A;  4LF9 F;  3UDV A;  5HAN A;  1Q4R A;  2ZH6 A;  1EHW A;  1TL5 A;  2C28 A;  3CE8 A;  3JYT A;  3RU0 A;  1AFI A;  2KN4 A;  1SH2 A;  5DZ7 A;  5GVQ A;  5B08 A;  3BO4 A;  2QEX S;  1LFP A;  1IBK F;  4C8K A;  3KMQ A;  2W4C A;  2ASL A;  3MUM P;  4X65 J;  4B3T F;  4MIB A;  5FDL A;  1VQN S;  4EBC A;  4B9S A;  2W2M P;  3BH7 B;  4K2X A;  3ZC4 A;  4N5S A;  2YKP A;  1JXL A;  2HK3 A;  1VIO A;  2CYY A;  2DHX A;  3TUJ C;  2R2T A;  1HQE A;  4OX9 F;  1U8S A;  2AQ4 A;  2CIM A;  3HJF A;  4JI6 F;  3FKB A;  3AQP A;  4DQI A;  5DLF A;  4C8O A;  4L3N A;  2X1F A;  2F9J A;  1HWU A;  1QUV A;  4Y6I A;  1UWB B;  4LRB A;  4R0J A;  4RLE A;  1U1N A;  1XMO J;  1FCA A;  4P73 A;  2D3U A;  1CS4 A;  3WX4 A;  2BQU A;  4KHP F;  1URN A;  3T1H J;  2AMC B;  3UPF A;  2HVH A;  4USW A;  3W5X A;  4DJB A;  3VAH A;  2HFO A;  1VLO A;  2LU2 A;  4BC9 A;  4CNY A;  3EWG A;  3K5M A;  4LIW A;  1TAQ A;  3IAM 9;  3VAG A;  1NCL A;  2P8I A;  4MH8 A;  2LEC A;  1K1Q A;  3BS9 A;  3M30 A;  2F7V A;  5HLF B;  3VGS A;  5HAT A;  3GON A;  1Y11 A;  3GJR B;  2CQC A;  2H3E B;  5B7W A;  2HFS A;  5DLG A;  5ETN A;  2KYX A;  3EX7 B;  3P49 B;  3G6E S;  4U67 Q;  4O44 A;  1DLO A;  2CNL B;  3BSC A;  1T05 A;  2MZS A;  1VIS A;  3H5Y A;  3C2P A;  2XS2 A;  1HNW J;  2NPF A;  4DFK A;  3AHP A;  1RJJ A;  2MEW A;  2HHQ A;  3BGU A;  4J9S A;  1JLA A;  1N36 J;  3DU6 A;  1IKW A;  2MLZ A;  4LBP A;  2EK1 A;  3N6L A;  4PQU A;  2QL5 B;  4ERD A;  1GXL A;  1X9W A;  1FNO A;  1DTQ A;  2IVY A;  1HR0 J;  1OJ4 A;  1KP6 A;  3MM7 A;  3CJK A;  4Y2M A;  4DF8 A;  3MF5 A;  2FLP A;  4I2P A;  2HHH F;  4ZMM A;  5CZX A;  4RJV A;  3U27 A;  3W2W A;  2MQQ A;  2P2C B;  3KLI B;  1CUL B;  2RD5 C;  3ENV A;  3PNI A;  2YWH A;  4TLR A;  1RWK B;  2FZK B;  1JLE B;  4FVM A;  1NRK A;  5ETP A;  1WTB A;  5KG0 A;  5GAH I;  4ZLP A;  1M5O C;  4X4R A;  2ERR A;  4J37 A;  2RSQ A;  1S77 D;  1LOU A;  1NK0 A;  4K7Q A;  3CD5 A;  1ZTT A;  3L4B C; 
#chains in the Genus database with same CATH homology
 3QBC A;  3UDE A;  3MCO A;  3MCM A;  5ETM A;  4AD6 A;  1CBK A;  3HCX A;  3ILO A;  3KUE A;  5ETV A;  4CYU A;  3HSZ A;  3UDV A;  4M5I A;  1KBR A;  1Q0N A;  3IP0 A;  2F65 A;  4CRJ A;  3KUH A;  5ETR A;  5ETO A;  1F9H A;  1TMM A;  1EQM A;  3HD1 A;  1EX8 A;  1HKA A;  1RTZ A;  4M5L A;  3KUG A;  3HSG A;  5ETK A;  1RB0 A;  1TMJ A;  4M5G A;  4M5M A;  3HSD A;  1RU1 A;  1RAO A;  4M5K A;  4M5N A;  4F7V A;  3UD5 A;  4M5J A;  3MCN A;  1G4C A;  1HQ2 A;  1RU2 A;  5ETS A;  5ETL A;  2CG8 A;  4M5H A;  5ETT A;  3HT0 A;  4PZV A;  5ETP A;  5ETN A;  5ETQ A;  1IM6 A;  3HD2 A;  3HSJ A;  2QX0 A;  1DY3 A;  4CYU B;  4CWB A;  2BMB A;  1EQ0 A;  2F63 A;  3ILI A;  3ILJ A;  3ILL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...