3ILOA

Crystal structure of e. coli hppk(d97a) in complex with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLAIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural and functional roles of residues D95 and D97 in E. coli HPPK
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 46
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3iloA00
5ETSA 3HT0A 4M5GA 3UD5A 1IM6A 3KUGA 4M5MA 4CYUA 4CWBA 2F63A 3KUHA 3ILJA 1G4CA 3MCNA 1Q0NA 3KUEA 1RU2A 1RU1A 3HD2A 4M5LA 5ETKA 3HD1A 1RB0A 3HSZA 3IP0A 5ETTA 4PZVA 3QBCA 4M5IA 3UDVA 4F7VA 4M5HA 1TMMA 1HKAA 1HQ2A 3HCXA 1TMJA 3ILOA 5ETMA 5ETQA 5ETLA 4CRJA 4M5NA 3MCMA 3HSGA 5ETRA 4CYUB 1EQMA 2F65A 5ETOA 2CG8A 5ETNA 3ILLA 5ETPA 1DY3A 3ILIA 3HSDA 2BMBA 5ETVA 1CBKA 1RAOA 4AD6A 1EX8A 2QX0A 3MCOA 1EQ0A 1F9HA 1KBRA 4M5JA 1RTZA 4M5KA 3UDEA 3HSJA
chains in the Genus database with same CATH superfamily
2CKWA 3R8YA 3BO2A 2EC0A 2RUSA 3VCDA 1XNRF 2CQ0A 2RH3A 4NLXA 1FEEA 2J0XA 1PYTA 1IN0A 5HSPA 4I0WA 2HQDA 4KKOA 5E3PA 4NZ7A 4RW8B 2AP6A 3VQTA 2IMWP 1U4BA 5A2QU 1RHQB 2WAQD 3PY8A 3C6UB 1OYDA 4EYIB 5M2RA 2VFVA 2HWHA 2LKZA 1P9QC 2LCWA 4P52A 4K5RA 5K8PA 3UN2A 3RR8A 4IFYA 5T41A 5IWAJ 3OJSA 2OMOA 3I4PA 3CB4A 1PYOB 5F0WA 2UZAA 3CJ4A 3BSNA 3CJ3A 4FYVB 4FVMA 2QEXS 5HLFB 2YNIA 1S59A 4QWBA 3RAMA 2W7PA 2GO9A 2AGQA 1AZSA 1JLGA 1R0BG 2DPJA 1URRA 1KVIA 3QFWA 1P8GA 2QE5A 3RGIA 1Y9OA 2JFDA 2E44A 4ECTA 2N82B 4KGXB 1NJWA 2UXCF 3B8HA 1H7WA 1K8AT 3M2RA 3GPAA 3PJWA 3UDEA 3TJ9A 4DR6J 5L46A 2JVOA 1HWIA 3CVKA 5D0GA 1IKWA 3TZYA 2IDLA 3HSZA 3P4UB 5DQIA 2DISA 3C3LA 2ABYA 3OXGA 4LFCF 2W7OA 1VGYA 2PEHA 3M2UB 1KP6A 1NJZA 2WOMA 4OZ3A 3S6EA 1R8BA 2CWKA 2L9DA 1T05A 5LMUF 1Z2ZA 5A0YB 1NK8A 3B54A 2QL5B 4EGLA 2N4CA 3H5XA 1RACB 4ZVRB 3O1LA 4NOHA 3DM2B 4OZLA 2PFDA 3O6QA 2ZVSA 1FJ7A 1I5OB 2P9CA 4DV0J 2WRMA 4I64A 1LFWA 2OO4A 3BV8A 1SL1A 4DSEA 1V9OA 1IR1A 2OMLA 3CWJA 4W98A 1JX4A 4FYYB 1KLMA 3PYFA 3DGPA 2V8GA 2GIFA 2G1HA 2FUG9 1S0NA 2G4BA 5IWAF 3MR5A 3ENVA 2VG7B 4QR2A 3PXGa 2VFUA 3HVAA 5DZ7A 5I3QA 1U1OA 1R89A 2MQLA 2DH7A 1U1KA 2FLLA 1R0AB 3G2XA 4CTAB 3M1VA 1H3DA 4MIWA 1S1UA 2WONA 3DMJA 5K14B 2YH0A 1WC1A 2EW9A 3G6YA 2QV6A 3VZIA 2W2QP 3QO9A 3RUBL 2IJFA 3G87A 2O5DA 3OV7A 4ID5B 3FQLA 3QFHA 2HHVA 3MEDB 2NLWA 2BE2A 3EICA 2ZWOA 2WZ1A 3BGOP 2VBXA 3PEHA 3PEJA 3DLKA 4UUXA 2RHSB 2HVZA 2E1MC 4KSEB 2RB7A 1K73T 4DR6F 1SJFA 5CXTA 1RU2A 3Q8VA 1TP7A 3NBPA 4YR0A 5IZHA 3K7RA 4EWTA 3SCJE 2G9OA 5EGYA 1PBUA 3J7YI 3CJ5A 2JH3A 4WFNQ 4UW2A 3UQSA 5A6PA 3KK2A 3H4DA 1KQSR 4CCHA 1KKHA 4NEYA 3AA9A 3CJRA 3PRDA 3DOMB 1WOSA 3D0HE 1Q78A 3DU5A 2ZM6J 4MTPA 4H54A 5HBMA 9ATCB 1WF0A 3NY0A 2KI2A 4GO7X 4YB1P 3RBZA 4DV0F 2XLKA 4NEZA 5H9EJ 2LQ9A 3ENAA 1DHMA 1HKAA 2LDIA 1ZAXA 1JLAA 1H7XA 1LWCA 1SJ4P 2BABA 2CZ4A 2XYGB 2V68A 2VA3A 2KO1A 3H25A 5J2PA 1RWKB 3AA8A 4CH7A 2M8DB 2G0CA 4R8UB 3AT1B 4RKUC 3R2DJ 1ZAVA 3UDCA 3WDOA 3HMJG 1NPRA 1REGX 3CC2S 2ZITA 1N6QB 4JUZA 2JHEA 3NCRA 3UVJA 3LGHA 1VQSA 2FVSA 3NKYA 4ALZA 3ZZPA 1ZM2A 4I6WA 5B0DA 3MUVP 5F8JA 2FVCA 4IRKA 4DV1J 4R0JA 1VJQA 2LU1A 4MMOA 2J0QD 2C3YA 3GFZA 1RA6A 4F4AA 2CQIA 2GMJA 1RAOA 4NE9C 3FQKA 1UEUA 1KQKA 2ZHOA 2M52A 2BRLA 1YZ7A 1JXEA 3MFIA 1IXKA 2QLBB 2VU5A 1GMUA 4BWJA 1UZDA 3DOKB 1FDNA 2R3VA 5D6GA 2EFPA 2N3LA 4NI2B 1JLBA 3CO0P 1N5TA 1VIXA 1FX2A 3MAQA 2KFYA 5HROB 4FF4A 3OL9A 1NMEB 1JNRB 2D3O1 1UA1A 2ZM6F 2KRBA 1DQ9A 2F9DA 1N32J 4DU7A 3ZZRA 4KR0B 1S79A 2OFHX 2X1AA 2NREA 2Y1LB 2HS3A 3DRYA 2DXDA 3T1AA 1NHVA 1RWOB 1TMJA 3RW6A 4J9SA 3QAUA 2BM0A 4DL2A 2VH7A 1S49A 4E2FB 2AEJA 4DQQA 1FE4A 3O44A 4E98A 4KO0B 4X4SA 3QAEA 4MK9A 1Q53A 3F56A 3KLEA 3D2WA 5A8RB 3D5MA 2HURA 1RT3A 4DLEA 2E9ZA 2VQFJ 4QIEA 2RILA 3T9ZA 3V4IA 5HN0A 4AL5A 2R7WA 5KFFA 2GCFA 3JSBA 4LSNB 1WD6A 4FYDA 3NL0A 2MHNA 1NK5A 2M3DA 2VOOA 2P8IA 4DV1F 4UF4A 2Y9HA 2KVIA 1F60B 1U48A 1C0UA 2COLA 4J9PA 1U0HA 2I5JB 1S76D 2DGSA 1SBRA 1FTRA 1EB0A 3P5TL 5BYSA 3POTA 2U2FA 2V4JA 1VQKS 1TAQA 3NS5A 5L8RC 1Q86T 4OMFG 2ROGA 2YNHA 1NJXA 4P2SA 2V69A 2QJ3A 5G0RB 3CSKA 1FEHA 1E6VA 3CJ8A 3W8GA 2KM8C 4M8LA 4URQU 5L1IA 4OI0A 1WC0A 2VC1A 2ZH1A 4URSA 2M7SA 3OW2R 5KG0A 4RBUA 1N32F 1BC6A 4IDKA 2BDPA 3DRSA 4AT1B 1SPBP 1AYEA 4DX5A 1EP4B 4EI2A 3MM9B 2Q43A 2CPEA 1R3NA 1V3SA 1SUQB 2HBRB 5E3AA 2RF2A 4F50A 5F9NA 3MM6B 3T5LA 3M4XA 3PW5A 2FD2A 2V5HG 3D66A 2ALZA 5J2QB 2V6AA 2VQFF 5KFMA 3KDNA 4J9VA 3TUZC 3V6JA 3AHPA 1PIEA 3C15B 5IT9U 2GHPA 4P9SA 4WTOB 3MR3A 4JI3J 2QLFB 3ILIA 3PTWA 1G6BA 3CDAA 5C2GA 4LREA 3DLEB 2R7RA 2JOQA 5D4PA 2HVHA 1O6XA 1KNZA 1BQXA 2RMLA 4XPEA 5KT7A 2D74B 2MZJA 3BBCA 2I8EA 3L4BC 4NL5A 4CQ1A 4R5PB 4HHJA 3UPFA 4GO5X 1MROB 1RXOB 4TY8A 2V2KA 1WELA 1YITS 2FDNA 1PSDA 2F4VJ 2C3OA 1MMLA 5F41A 4RX6A 1UEKA 2E7WA 3TP2A 3QT6A 4KKOB 1QSLA 3I0SA 3CCJS 3ZXWA 3CNQP 2VKZG 4WCEQ 2GJIA 2QIFA 2BBEA 4NLSA 4E8UA 4S0MA 3L7UA 1HBNA 3OPKA 3BYPA 2DPIA 3CDEA 1M90T 4IFYB 2G0JA 3DDKA 3HP6A 2RDJA 5CYMA 2D69A 3GG0A 2C2NA 5E5NA 2BEFA 2P9EA 2GGPA 3M8SA 2V8PA 1F9FA 4ZP7A 1U25A 2APOA 4Y34A 2QLXA 4TYAA 5DLGA 3EVWA 2XWXA 1K0TA 3TQ1A 1U6FA 1X9WA 2I0XA 3GIJA 2YNIB 3PZPA 4KC5A 4F0HA 2GFFA 3FEYB 4RPFA 2KU7A 2Y3YA 1AZSB 1JLGB 3M6XA 1X4HA 2HGLA 1RT7A 4KFBA 3R5CA 3H7HB 4B9TA 4JI3F 1N5SA 3CDUA 4C0OC 4M95A 3N01A 3M2RB 4Q2LA 2AW0A 2DR9A 3AB2B 4MIAA 3K0JA 1IKWB 4PG6A 5ETPA 2HNZB 1PO6A 1RKIA 5A76A 2ZC4A 4ZPDA 4ZLLA 3M9NB 2UV8G 4K2XA 5KFJA 1KQGB 2BV3A 4QIGA 2WOMB 5LJ3Y 1FRKA 1T05B 3G82A 2HK3A 3OLAA 4DFPA 2F4VF 3H5UA 1HNVA 4OI1A 2MGZA 3M2VB 3KKFA 1U49A 2C2DA 4PXEA 2AKWB 1QUPA 4B9SA 3AJ1A 3FCVA 1GMVA 1VQPS 3R27A 2AEFA 4ED8A 2HFZA 3BGUA 3W9JA 2FHMA 4YMEA 3QSIA 5J1PA 3PR5B 3DGPB 1RISA 2YKPA 5LOQA 4OHXA 3OD2A 1L3KA 4CLKA 2XMAA 4JV2A 2CQHA 3CDWA 1FVSA 1U7LA 1QE1B 4F04B 3CJSA 1HQEA 3JS9A 2CPZA 4OZ1A 2FJAB 3M1VB 4RW7A 2YKNA 2WONB 3DMJB 3GIKA 4WU3A 4QYZK 1HWJA 4HYKA 3LQVA 3O2IA 1N54B 4M5GA 1PILA 3I32A 4ZVTB 4CP5A 3QO9B 1QTMA 2FHOB 4YB5A 3MM8B 2J7WA 4ANEA 4DLGA 2BE2B 3D3CJ 5THWA 5L9XA 4CM2A 4C11A 2H5IB 3UNGC 3CJTA 4Q43A 2VPXB 2VG5A 3DLKB 2CJYB 2OJ3A 3NBPB 2CIMA 4B02A 5H1SV 1KD1T 2C42A 1HI1A 2HNYA 3VF0B 2MKHA 3HVRA 3GU0A 4AL7A 1LOUA 3FBFA 4KGMA 4OZNA 1HQ2A 3KK2B 1T7PA 1PYSB 4ZVFA 2WB4A 2AX1A 4QIFA 2DHAA 4OLPA 5SZTA 1F3VA 4KBIA 2VFTA 1O5JA 4JI4J 5KFLA 5HBMB 4IFVA 1RB0A 3UDLA 1UJ5A 1PJ5A 4NXMJ 2QFIA 4LR8A 4K4UA 2FJWA 2B6AA 4FXVA 1WC4A 2VICA 2J0WA 4P10A 1JLAB 3W1YC 2MLZA 3ZTSA 1LWCB 1WSVA 4KPYA 4XTTA 1S1TA 2UVRA 2BJ9A 5J2PB 1TMMA 1I3OB 2F9JA 4OYXA 4LQ3A 3BGRA 2JDJA 1X4EA 3H0PA 2K7KA 3BO3A 5C5JA 1PBAA 3IM8A 1A7GE 3G6VA 2CQGA 1WC5A 5IQQA 4YP3A 1ULRA 3KJVA 1WF2A 3KJQB 2E5JA 2UUAJ 1SKSA 4PUOA 1W25A 2EEYA 3GV5B 2NZCA 1RTDA 1M5HA 3UVJB 1RT4A 1X0FA 4PRFA 2YKAA 4ZVSB 2AJ1A 2VPZB 2DRBA 2A6OA 2GV1A 4OLOA 1NNDA 3J7AN 1R6YA 2OEMA 1S6UA 1HBOA 3GZ7A 1FK9A 3KLIB 1XMOJ 1KOHA 2WCXA 1VK8A 4NLTA 1UZHA 4MJKA 3UNYA 1TZ0A 2B8PA 1HNWJ 4LF4J 2ZH7A 2AT1B 3RB3A 1UFKA 2AYMA 1B4SA 3MGJA 4ZLNA 3J7ZT 1H73A 3P45B 1G3OA 1JLBB 4ELTA 1F6TA 2A2DA 4FKXA 5ETOA 1T9UA 2PFFB 4ECXA 3OR2A 1JXVA 2RQ4A 2XCAA 3K59A 2GAHC 3LPYA 3GYXB 4PXBA 3LP0A 3RBEA 3GFHA 4J7CA 3KXDA 4JI4F 5E3RA 9RUBA 2FJXA 5ETRA 4NXMF 4HI1A 4ES1A 2EKYA 1VC0A 2HVEA 3FKBA 2FLNA 5A8WA 1NRKA 2KH9A 5CABA 3MPWA 3HO1A 2EK1A 3KG0A 3OR1A 2QX0A 2OSQA 1NHKL 3R3TA 2IVFB 2ZEJA 3QT7A 3TVZA 1YJTA 3QZ7A 4ECRA 3DGVA 3V4IB 1NK7A 4CLLA 1RAGB 2UUAF 2WW8A 4RUHA 4LVNP 5JVHQ 3U27A 3DOLA 4OYPA 4K4XA 2IMOA 1I51B 2ZBQA 3M8ZA 1AT1B 4X4NA 3M7VA 3G9CA 2FYXA 4RUAA 2D3OR 3B6BA 3AD8C 1C0UB 2OH2A 2JJ4D 1U0HB 4ANCA 3CUNA 2W2NP 4DUTA 3GCWP 1GXTA 2PA3A 2AYBA 2JFKA 4YDDB 1G2EA 1DURA 4HLBA 4OJHA 3CULA 1XMOF 3POTB 4O3NA 2V4JB 4YOEA 1R0CB 2DGVA 3MI7X 1YKWA 1P1TA 2Y8YA 1ZOTA 2YVSA 2YNHB 1HNWF 4KAIA 4LF4F 4RNFA 2HQFA 4DS4A 2ZH6A 3VWSA 2XSJA 5BR8J 4QU6A 1UVKA 3GONA 4DMZA 1ZA1B 1TKXA 2ZZNA 1U47A 3SV4A 2K2PA 2VA2A 3EGVA 2NZ4A 3JAMU 1RT2A 1RK8A 1DY3A 1NDKA 2NSBA 1U8WA 2IM3A 2ZH4A 1N5VA 1BY9A 2W4DA 1N48A 2CFXA 3MHYA 3W62A 5CCMA 5E0OA 5ADZA 1S6QB 2G2YA 2YX1A 5DDPC 3F44A 4IDKB 1L3SA 2DXEA 4NLPA 3DRSB 1WTBA 1XK8A 2DR7A 4DL6A 4LSZB 1X4GA 3KG1A 3KLFA 5ETQA 4PQAA 5KFPA 3I82A 1UETA 2BJ3A 5GMEA 2RF2B 4KGVB 2VPWB 2WVFA 2EBGA 1WG4A 2KT3A 5KFVA 4TVAB 4DZ6A 2POKA 3CCES 1KEKA 4FKYA 3RBDA 3FMBA 1LWXA 3QPIA 1U1RA 4DQIA 5KFIA 3RZAA 1J5EJ 3UD5A 5AXLA 1X4CA 2B56A 2EVZA 5EWEA 2YX4A 4F0KA 2DKOB 4X4OA 5KT6A 3W5ZA 1XIQA 2R4FA 4A48A 2AJ4A 4OHYA 4Y2KA 3LW5C 2AGPA 3W3SA 2DGXA 4FBUA 4UUWA 4FS2A 1NK6A 3ITHA 4NX9A 4TY8B 1GEHA 2CNNB 4ERDA 3H42A 3BDEA 2AJ0A 3IN5A 4PWDA 1QJHA 4RZRA 1W7WA 2RU3A 2FZKB 4YDXA 1U2FA 2LFVA 3Q8RB 1HD1A 4O3QA 2I1RA 5BR8F 2IJNA 3IWNC 3I0SB 5IQ6A 1SQGA 3BPDA 3FRYA 2YBVA 4BLGA 4IRCA 3HI9A 3MR6A 2G2ZA 3EXYA 4LRAA 1MU2A 3GYNA 2XULA 4AE5A 5GADU 3PR4A 4CLSA 2B5JA 2GQCA 1VIOA 4NCBA 4WK1A 2VZ9A 3T5JA 5CYMB 5AE3A 1WSRA 1VS3A 4USIA 1R8AA 5IT0A 4IG0A 2GGPB 4OI6A 5KFEA 1RAJA 2ZOFA 5GADI 1XERA 3I56S 4ZPTR 3R5BA 2J7UA 2OGUA 3C66A 3IS9A 2MZQA 1NM2A 2X1GA 5ETKA 4U95A 3H40A 3KK3A 4LMZA 1MWQA 5D0EA 3PJ9A 1M5SA 1RT7B 8ATCB 3BDPA 5F9LA 4KFBB 3DXSX 3VTIA 1J5EF 3CMQA 2CNKB 5D77A 2FC8A 4LFBJ 3GP9A 2SXLA 2DEIA 3RR7A 1WHWA 1FNMA 1J5OB 1MMNA 2CJXB 4ZHRA 1W26A 2GA7A 2FPHX 4DHVA 2WSFC 1F3FA 2E29A 1JB0C 1SKWA 3G82B 1VC6A 3M8YA 2ZBPA 5DZ6A 4C8LA 2ZJRQ 1Q95G 3TZZA 1S72S 1HNVB 4F26A 1SJ3P 4C8MA 3TJ8A 2LXIA 3TZWA 2MGZB 3R5GA 3HPOA 3H4BA 5HP1A 4ZVPB 3TJAA 4ILMA 2QTWA 4ETXA 4FBTA 3S1TA 4F0MA 2AGOA 4C8KA 2RQCA 1FKOB 1CJKA 2WVBA 3PW2A 1UPMB 2ASLA 3SMZA 3T5HA 4DG1A 1XR5A 1SKUB 4ZP9A 4TU7A 2F63A 1L3VA 3GJTB 4CO4A 2H54B 2Y0BB 2E66A 2OPRA 1N4LA 3N28A 4X4RA 3HHLD 3NG8A 2EFGA 5HVFA 1HQEB 1FA0A 5E7OB 2E9RX 3WHIA 1D8YA 4D3HA 4DL5A 4FF1A 4LFAJ 4DV4J 2X51A 3QJJA 5GAHI 4RW7B 3VAJA 1HBMA 2YKNB 4ENOA 1T9VA 3ZTRA 2XYPB 4NLWA 4OV6A 3R5JB 2CPXA 3CIMA 1T03A 2C2EA 3GLJA 3QIPA 1A6LA 3O8WA 2HS0A 3TUJC 2QGFB 2YQ3A 3D6HB 2JEGA 3HFZB 2RHQB 3FVYA 2ILYA 4C11B 3OTDA 4LFBF 4WYWA 3IR5B 4G1QA 2DNPA 3KUHA 2HQCA 1JJCB 5D4OA 3IFEA 2VF3A 2HNYB 2MZSA 4F67A 2HQ3A 1YIJS 2LVWA 4U7CA 4P2XA 1CJTA 3L09A 5D4NA 1S6PA 1JIHA 3J7Z5 3KLHA 4J9RA 2EFNA 3AXMA 1OPZA 4J9LA 3NGKA 2PT0A 4KY3A 2NYIA 3UCZP 2I2YA 2Z2MA 4DV2J 5JXSA 2HFVA 1RKJA 2YWGA 1TFWA 3PW4A 4IFVB 4B9UA 3W2WA 1CULA 4N56A 2W8LA 5CYQB 4HI2A 1E6YA 1B7FA 5JMNA 2B6AB 3E01B 4ZLJA 2CPIA 2A18A 4HACA 1S1XA 3GFYA 2EFOA 1S1TB 1TL7A 1LXJA 3BGRB 4XDCA 3UN5A 1IJEB 1NH8A 3O3LA 4KYZA 2PGCA 2IVYA 3PFOA 1RYSA 4NCAA 2JEIA 2BACA 4ECZA 3UE2A 2DNMA 1QLNA 2PIIA 3OT9A 3KJVB 1D1UA 2CADA 4LFAF 4DV4F 1T3OA 2DRAA 1YX2A 3A8KA 3PDNA 1RTDB 5AE1A 1RT4B 1HI8A 1UW4A 2R7OA 3IM9A 5IS2A 1VMBA 4QWEA 1GAOA 3H59A 1KLNA 1X9MA 2BJ7A 2HHHJ 3QZ8A 3W61A 1HBOB 4ZPWR 4EBCA 1I94J 2HHUA 3GJSB 5ETNA 1FK9B 3DYAA 4W4MA 3ISND 4A8YA 2Y8WA 2B4UA 4DFKA 2CQBA 3ZTOA 3KJNB 3CO9A 3F73A 1WEZA 2HBZB 3M8RA 2CZVC 3NXZA 2RUGA 4X2BA 2H5EA 3TNVA 2ASJA 4DL7A 1GK8A 2BJDA 3WC2A 1AROP 3OVSA 3I55S 4A47A 3HXMA 2A2CA 1KHWA 3OR2B 2LQBA 3H5SA 3HHLC 4ZCLA 3UCUP 2NS1B 4OYAA 4DV2F 2K3KA 3ILLA 3HDSA 3LP0B 5L9NA 3EPIA 1EETA 2XI3A 1MN7A 3IRXB 2BQUA 5FLXU 3RAQA 3SYZA 3HKWA 2MZ1A 1FTCA 1TAUA 5A8WB 1RCXB 1PGZA 4B08A 3EX7B 4Q2MA 3HVTA 5B09A 2EK6A 3OR1B 2BKOA 2W4PA 3PCOB 5AXKA 3IAM9 4NWBA 4QW8A 4DR7J 1H72C 3PX6A 2RSQA 4KGZB 4JB8B 5HJXA 1FDDA 1X60A 1Y5IB 4LBPA 4DN0A 4ED6A 3EZOA 4CYUA 3G6XA 2KVQE 1X31C 3SQGA 3F0NA 2OAUA 2OLWA 4OHZA 3DC2A 3DOLB 2HWTA 4N8NA 3W60A 4YB6A 3DU6A 3BN7A 4UOCA 3M30A 4CO5A 2J9DA 1YRUA 2HBYB 2J9DE 3C14A 2HHHF 2F5GA 3MTJA 4FS1A 1RT5A 4G1PA 4EUVA 1F5AA 3CCLS 1I94F 1RWMB 1RE1B 4KH0B 4D3GA 3LWLA 2IBOA 4CO3A 2HK2A 3EJMA 1S10A 2CQPA 1SL2A 3LA0A 5ETTA 1Z4UA 4ECQA 3VGVA 2BJ8A 1VISA 5KFBA 3CCUS 4N76A 2XY5A 1VQ9S 4MKBA 2XSJB 3GV7B 4OV1A 4ZCIA 5KFOA 2XMJA 4RW4A 3MPUB 1TKXB 4FXDA 5HQLA 1RT2B 4USVA 1GTEA 4J5OA 2BW2A 4ILLA 1U6ZA 1EQMA 4TN2A 3M8PA 5J1EA 3KMSA 4MK7A 2B7BB 3N6MA 2K7JA 1F5BA 2YX7A 3T41A 4DV7J 3HSGA 2XI2A 3NAHA 3FFIA 1N52B 4JP8A 1HWUA 3DHWC 5BYRA 3KLFB 2IRYA 2JLGA 1IQTA 3GCXP 2QA4S 1XQIA 3KHLA 5F3ZA 2DK2A 4DR7F 4F4YA 1UJ6A 4A4JA 2JLFA 3K17A 2W9BA 1IKXB 2GIQA 4QYZJ 3NOCA 3U1LA 1B0VA 4WU2A 1ELOA 2N7CA 1EKSA 2LXFA 3C16A 4PXCA 5DDOC 5K9FA 2KXHA 1CS4A 1RTIA 3AJDA 3DI6A 2AYEA 4RWWA 1FT8A 2J6TA 4DEZA 2QSFA 2HRYA 3OUYA 4ECVA 1HNXJ 2F7VA 2OTJS 2HG4A 4DUZJ 4CH0S 1ZM9A 3HM9A 2Q79A 3ITHB 4OYMA 3TA2A 2MKJA 1BUXA 2ZNZA 1RTHA 3ZNJ1 3HHKA 2ZNYA 1Q0NA 1RAFB 2OP5A 4V1Ak 4PWDB 3TVKA 1M1GA 4UOFA 2DH8A 5F3TA 2XSFA 2KB2A 2VG6A 4QOTA 3K5NA 4N7TA 2IAJA 4OHWA 3BQ0A 5HMWA 3W7BA 2DEJA 1UMJA 1XNQJ 3HLUA 5EX3A 5DO2A 1CBKA 1MU2B 1R27B 2CVIA 1LWEA 4U96A 3D67A 4B9MA 1H98A 2B5JB 2W9CB 2RDIA 3RJMB 3TW0A 3UD4P 3BGLA 2B9XA 2HMIA 1SIWB 4WKYA 4C3MA 3N79A 4DV7F 1NDLA 4IG0B 2C3UA 3NGUA 4LR9A 1Y5NB 1EJ7L 1RHRB 3IS9B 2BRKA 2VDIA 4QZVB 2ZOMA 2AV5A 1RGVA 3KK3B 2M0GB 1I1GA 1FHTA 4YR2A 2JLEA 4GKJJ 4X4QA 6FDRA 2R2RA 5DETA 1S5ZA 1Q5YA 8AT1B 5CA5A 1VRUA 4ZMMA 3A3OB 3EE3A 1S0OA 3FNNA 3OJUA 5GAGI 3T1HJ 2Q1LA 3MECA 1NJYA 3DDIA 2E1CA 1HNXF 6AT1B 4WP9A 4ZHRB 3PX0A 4DUZF 4OZ5A 4F02A 2ROPA 4DF4A 1FJGJ 4ED0A 3GJQB 2AU0A 4C97A 3NNCA 1C1BA 4USKA 2VODA 5KT2A 4OX9J 1MN9A 3CC4S 4ZN1A 1TL4A 3PM9A 1D0EA 5CH7B 5C24A 3CCQS 5C7PA 3C6TA 2KM8B 2RRAA 2XMUA 5HP1B 5DG7A 2CWXA 1BLUA 1KR4A 3NEKA 3NGSA 3EMTA 4ZJOA 2VBZA 1XNQF 2CA9A 1CEZA 5KFNA 2L08A 1CJKB 3KUEA 2KJWA 1EIYB 7FD1A 4ZVHA 4DG1B 5F8IA 2R7QA 4WTYA 1T9XA 2O01C 2NCKL 2LU2A 1JLFA 2QL9B 3L7PA 4CI0B 2B8QA 2FC9A 4MH8A 3K2YA 2OPRB 2XY7A 1U1LA 1M0SA 2LDYA 2X1BA 1C1CA 2W8KA 4I7FA 1HBMB 2RQMA 4WYLA 2IFXA 3LOUA 2J9CA 4C2MA 1RHMB 2R7UA 3JTOA 2H4YB 1CC7A 1DLOA 1T03B 3TAPA 1VDHA 1VQYA 3QIPB 4GKJF 4KE5A 2KYXA 2QA1A 3E8OA 1HNZJ 5HMXA 2CJAA 1SB6A 1Y00A 4DUYJ 1SC4B 2MXYA 1S0VA 1X5PA 4I2PA 2ZZMA 1FRMA 5HVHA 3T1HF 4G1QB 3EPGA 3PNIA 2BMBA 2WSEC 1JWWA 4U8YA 5D15A 1RWWB 4FN5A 4QPTA 4CNYA 1FJGF 1YBAA 1CJTB 4A8FA 2ZJPQ 1S6PB 3ZZUA 1KQFB 1KFDA 3VGUA 3KLHB 2ERRA 4OX9F 2QYCA 2FTRA 1LXNA 3J81Y 4USJC 4WPAA 4MKVA 4W92B 2GQQA 4M94A 3ZZYA 1BE4A 2ZHBA 1CULB 5F8HA 4RW9A 3M8QA 3TAQA 3NLCA 1E6YB 4K4TA 3RB6A 2V2ZA 1KDNA 4HACB 1S1XB 2CQ3A 3PHTA 5KOWA 2VDHA 1CLFA 4IQMA 3CTRA 1X4DA 4I4BA 5CQGA 1TL7B 2F40A 2QO3A 2CNLB 1IUJA 1K47A 3LGNA 5I3PA 5B08A 2V0NA 1ZETA 3KFWX 2VFSA 4YHHJ 3D28A 3NNHA 1N5YA 4DFJA 2EXUA 3M9MB 3QRQA 5CHCB 2ZWPA 3Q89A 4GKKJ 2F3JA 1FXLA 2OTLS 2GJFA 4K0KJ 2E7VA 3Q8UA 4EMDA 4P7VA 4RBTA 4CWBA 3I4HX 1HFEL 4ZDNA 2DNKA 3SIPB 4IOCQ 3LF0A 2MKYA 2RJZA 4LIWA 4QIWD 1VQNS 5D3GA 2XG8A 1HNZF 4RO0A 4CO0A 2UP1A 4DUYF 1YTYA 2VBYA 5EN1A 1YQHA 4GVBA 2P5VA 1FJCA 3DYAB 3UDVA 1DQ8A 1U1NA 1FNOA 1PAUB 2GJ2A 1FVQA 4I2QA 3ISZA 2UV8A 1U2CA 4OYBA 1VQ6S 2VQEJ 2ZUAA 1ITPA 4HH0A 3G8SA 3VVTA 3UW1A 3RB0A 4OFZA 2DIUA 5LJ5Y 5B0CA 2KZMA 4CO1A 3OL7A 4J9UE 2QZ8A 4NLOA 1BGXT 1O0PA 1X4AA 2QFJA 2W2MP 1BXNA 1ICEB 1EETB 2WVDA 3J80U 4OQJA 1LW2A 1T11A 4NLDA 1TKTA 5HQ8A 3MXHP 2DGTA 3LO3A 2MY7A 3VAGA 5GVQA 3CD7A 1HW9A 3HVTB 1YRXA 2W4CA 4C8OA 4TNOA 2WVEA 2GW8A 3Q2TC 3AOBA 5LSRA 3W5XA 1CQMA 5HMYA 1U1MA 4YHHF 3T5KA 1FD2A 5D0RA 4RNMA 2CG4A 3UCGA 4R25A 1NH7A 2JNJA 1RYRA 2ZH5A 5LSOA 3QSYB 4CYUB 3MEEA 3SQGB 1WEYA 1NK0A 3L95X 2M5YA 4GKKF 3B78A 2IM2A 2V94A 4K0KF 2CNOB 1Q8KA 3MPDA 1RHJB 3DNCA 3M30B 5HATA 3IR6B 2XMTA 2DNHA 5MLCV 3C14B 1YDLA 1RT5B 2Q3PA 4F3OA 4WJBA 4IO1A 3FCWA 2ILZA 1VRQC 1FFWB 4PAAA 4ANDA 2FY8A 1NK4A 4TU8A 4DXLA 3OL6A 2DTJA 4O0IA 1VRTA 4RW4B 3P6YC 3ZNUA 4ZA1A 2BW7A 2VQEF 5J2MB 2R8GA 3OTBA 2HKEA 1B70B 3RU0A 4N8OA 1PKUA 5E33A 1O51A 4MFBA 3FSIA 5J1EB 3M8PB 1SCJB 4O23A 4ID8A 3I5CA 1Z1ZA 4AD6A 4IG3A 1DQAA 1Q79A 3DFEA 3KUGA 3CJ0A 3FFIB 4F36A 3MF5A 3DLJA 2BZ2A 2EFQA 3C8YA 3ILOA 3T9NA 2L3MA 4TU9A 4PKDB 5ETLA 5L1LA 3L7OA 2YKMB 2M88A 2FJEB 1HHQA 2HSEB 2RQKA 3KHRA 3TYTA 2HFSA 4KPCA 3SCLE 4HL9A 3CW2C 1XR7A 2GMLA 4RNNA 4PCQA 3QMQA 4OIXA 3GR0A 2H65B 3MEKA 2W9BB 3QQCD 4X4PA 2CDQA 1HBUA 3DLGA 1IBMJ 1AUDA 2DY1A 1Q81T 5IM0A 3C16B 3MMBA 3R6GB 1CS4B 4USTA 1RTIB 3DI6B 4DPOA 2J5AA 1OS5A 1MWYA 3OUYB 2HQGA 2YXLA 5A2QY 4Y2AA 5H9FK 1VCTA 2JZ5A 2DCLA 2QN6B 5E41A 3NGDA 4YFUA 4A8WA 2BQRA 2QLJB 2XLIA 1N33J 4LF1A 1KN6A 1RTHB 2AZ1A 3J7YU 2B4OA 1EQ0A 3THTA 2HFNA 2VG6B 1X5SA 4LF7J 2HIQA 2VV5A 2FHKA 2IAJB 2LYVA 3DRRA 4FPRA 1JK9B 1C0TA 2C28A 1PC4A 2Z2YB 1Q8LA 4L73A 5E3QA 3MWBA 3I9V9 3LALA 3PW7A 2NSCA 3A3PB 1LWEB 4TYBA 3RRKA 2R7SA 3CE8A 2OEKA 2GO8A 3NCPA 2PI4A 2HMIB 1OSCA 1IVZA 7AT1B 2H51B 3R5AA 1BMQB 5B7WA 2WTFA 3PACA 1RWVB 4MKAA 2KG0A 4F8RA 2XHCA 1CC8A 4P7TA 5EWFA 2AD9A 5AT1B 1XN9A 3G71S 3KMQA 1RABB 1S48A 3WX8A 2B43A 1B0TA 3R6LB 3KG4A 7FDRA 2GHWA 2ASYA 3NNAA 2ZOGA 2DB1A 3S01A 1P27B 2K3IA 3VVUA 1IBMF 4ZITA 1W2BR 2ZH9A 3E51A 1VRUB 1PAEX 3KLVA 1T0TV 4C9DA 1A0OB 1CJUA 2ZE2A 2ZDPA 4FP9A 1TELA 3MECB 2WHOA 3OFHA 3ILJA 3PYGA 4DR4J 3GMGA 5G4DA 1NKEA 3ZZTA 3V6HA 2AEMA 1C1BB 2AJQA 2ACMA 3KHGA 1N33F 1H0HB 3BQ2A 3VAHA 2V8HA 1CSJA 2NUUG 2HS4A 2XEXA 3RYLA 1GQEA 2A0FB 5C24B 4M5HA 1Q82T 1IR0A 4EZ6A 4LF7F 3C6TB 3Q83A 2B51A 1TL5A 2MB0B 2E5HA 3BJYA 1ZM3A 3CXCR 1QAYA 4K8RA 1R31A 1IQZA 3VAKA 1VI7A 2YPYA 2Z58B 3D54A 2LA6A 2AYGA 4ATNA 2DVIA 1WDDA 1WTFA 4NYZA 4U7UD 5LT5A 2VKRA 3MEGA 2RD5C 5DDQC 2ZH2A 3K89A 5J1NA 1VLOA 3BN4A 5CYJA 3S8SA 3Q2SC 3V81A 2XNQA 3PIPQ 1UL3A 1JLFB 3PVXA 1JKHA 1NZ8A 2KHDA 1OY6A 4TLQA 1K1QA 4CO2A 2AHOB 1H2TZ 1SC6A 1C1CB 2XY6A 1OY8A 4ER8A 2ADBA 1HYSA 2R8KA 1H2UX 5EX0A 1DLOB 2Z30B 3BH6B 2D41A 4DCOB 1Q7YT 3PW0A 3LPEA 2R8IA 4FF3A 2QMWA 3HD2A 1AUSL 4OX8A 3UI3A 1UTAA 1F2GA 4N5SA 1RDRA 3IBCB 4WF9Q 2DHSA 1X8DA 4I2PB 2QA4G 2FQQB 2K06A 1OMSA 3C2PA 4X4VA 3N9UC 5D0HA 5MAOA 2R2UA 3Q86A 2ATCB 4Y2CA 5LXYA 2CPHA 1LW0A 1GH8A 1M5PC 4DR4F 4H4OA 4JBCA 2XTJP 2E1AA 1D9DA 1APSA 4K5SA 1R7IA 3VHQA 2Q6BA 2IDEA 4YR3A 1RI7A 2YH1A 4J9KA 4ZPBA 4UZCA 2ZH8A 3W9HA 1FRXA 4B3SJ 4RW9B 3M8QB 4KV8A 1RQ0A 2IRXA 1JLCA 1OO0B 3R5DA 1RBAA 3CMES 3BYRA 2HIYA 1M1HA 4HVZA 2FVRA 1RTZA 4YUDA 5KFUA 4OZ0A 2BKPA 8RUCA 3W9IA 5C25A 2LEBA 2DGWA 1N0UA 1N5YB 1RCOB 3EGNA 5C42B 5A6WA 4GC6A 3N0VA 3SSQA 2YKOA 4CT8A 3ZZOA 2PMWA 3GILA 2OEJA 3SQOP 1IWAA 3OTEA 5CZXA 3QJPA 2AMCB 3Q23A 4Z7YA 2HHPA 1Q16B 5D3GB 4JV1A 5CCLA 4WIIA 2FIUA 1GMWA 4HT5A 3NWGA 3FGVA 2Z2ZA 4EYHB 1VBYA 4BC9A 2QRRA 3S7RA 3SDEB 1S7IA 2B4VA 1SXLA 4X62J 4Z7CA 3R9LA 1VYAA 4TQSA 2CZ9A 1JJ4A 3MCOA 1J27A 4NA2A 1AW0A 3G6ES 5L38A 3MMCA 2AIRB 2MMYA 3HK2A 2P6TA 2H3EB 1XR6A 2M70A 2BOAA 1MNEA 4P74A 3W65A 5I4MA 2OFGX 1UFLA 2QMUB 5F8NA 2Q66A 1LW2B 4B3SF 3FBCA 4UQGA 2MKIA 4V19X 1WKKA 2ZDOA 4KHMA 3KLGA 3BKTA 1J2VA 2PA8D 2FB0A 3WC0A 3BS9A 1WKJA 4HT7A 1TK0A 4X4TA 3NAIA 2KKHA 3Q8QB 3I96A 2VUGA 4LF8J 1T94A 1REVA 1MLAA 1X4BA 3GSDA 3TQEA 3BBBA 4TXSA 1HLWA 2I38A 4B9VA 2AF6A 2OSRA 3DRXA 4OI3A 4FNIA 3MEEB 1WDTA 2CXEA 4OX6A 3PO4A 1H74A 4HTJA 4ZVEA 3T1YJ 2JEJA 4QIVA 4P72A 3IMQJ 5EUHA 3K5OA 2IYGA 3Q8PB 3I6PA 4BDPA 4BS2A 4KJIA 4V19J 3A12A 4B9NA 2YQ0A 4X64J 3KYLA 2HRTA 3H8YA 3LP2A 2GQ2A 3IGNA 3O5TB 3UR3C 2XWYA 1FDAA 4URGA 3X3UA 3FK4A 1HW8A 1AB8A 3IAS9 2VOPA 4BC7A 4M5IA 5D78A 4ED7A 4OYWA 1KVJA 5KG1A 4X62F 4JI5J 1JJHA 3CIZA 1VRTB 3J81j 1TV6A 4C0BA 1S9EA 4H4MA 4U8VA 4ZOSA 3TOQA 1HIYA 4YQWA 4I56A 3NGRA 4MAKA 1EKRA 1N8RT 1EAYC 4ZJLA 2WW4A 5DQGA 2IBKA 1QAXA 1WHVA 3T6JA 4ED2A 2MQ8A 5IT9Y 4NLYA 3I87A 2X7IA 4IG3B 2VC0A 3P8BB 3E2EA 3P49B 2MJNA 1PJ6A 2J6UA 2JX2A 1WUUA 2D7SA 2CJBA 4DL3A 4RBVA 1UWBA 3T3FA 4IOAQ 2W24A 1AA1B 4RW6A 1DZ5A 5EDWA 5B0EA 1ZTTA 1KLMB 1XEZA 4TLRA 2C1EB 4DPWA 1GTHA 4XAKA 4LF8F 4LRDA 1VHFA 3LTOA 2CPYA 5KFQA 4DPYA 3EGZA 2FGCA 1D3WA 4IQXA 5LL6d 3AODA 4ECUA 2MEWA 4LR7A 1NO8A 1OWXA 2ZVIA 1HBUB 3DLGB 5IM0B 1ZS6A 3D68A 3MM9A 3MMBB 4H4KA 3T1YF 4JI8J 3D3BJ 1S1UB 2DNYA 5F8GA 3IRWP 2DNOA 1SUQA 3FSYA 1TL1A 1FXDA 4F3MA 1S1WA 3I0RA 3A8JA 2HZAA 4PG5A 4X64F 3LAMA 5DM6Q 4ZVQB 3HZGA 4YY3J 2B0GA 2BE9B 4DX8H 3QJLA 4ZJQA 1Y3KA 4ECWA 3R1LA 3D4JA 3TRGA 3UN3A 4B3MJ 3RRGA 3SZ2A 4ITSA 2ZHAA 5HJYA 2RS2A 3BKFA 5K8NA 4A8MP 3BSAA 2MZRA 2GX8A 3A4TA 4PWWA 1QVFR 4JI5F 3DRRB 1I6JA 3K57A 2R7VA 1C0TB 1IBKJ 2MYFA 4O0NA 1MROA 1RBLA 4G1IA 3QIDA 2I9SA 3ICLA 2XS5A 5BJRA 2RNEA 5KOXA 2VONA 4NCGA 1TL3A 2UVVA 1KVKA 4DL0C 1OSDA 1T9YA 2JRSA 2FHJA 4I68A 2QA2A 2DH9A 1RSCA 4E0DA 3UFCX 4DI6A 3I5AA 1HPZA 3IG1A 4UOHA 5D8HB 3VAIA 3K58A 2HHWA 2R42A 4EU0A 2PEBA 4AYBD 1B0PA 4K7QA 1QY7A 1UVJA 4JV5J 4KT0C 2LP4A 3QT5A 4UZBA 3OHAA 2E5LJ 1IBLJ 5D4LA 2YWHA 5AE2A 1C2PA 4J9MA 3PIOQ 4MYUA 2HPUA 2CJQA 4O3OA 4RU9A 1UJ4A 3MCMA 2LMIA 4N77A 1RZMA 1TU0B 4JI8F 1KTQA 2YWKA 3SSRA 2HRUA 1CJUB 1EZZB 2ZE2B 3QLHA 1XJWB 2OI2A 3W63A 1FNXH 1KHVA 5KTQA 4YY3F 1RWPB 3BGFA 2AQ4A 4WFXA 2IC3A 1QAJA 1VR6A 2W25A 1GFWB 2OPQA 2ZD1A 4B3MF 2FVPA 1DAXA 3JSMA 5IV4A 4IRDA 4OI2A 1JXLA 2AJ2A 3VAMA 1C4AA 3BSOA 1QM9A 4PG4A 4UY8T 1BQMA 4O44A 2KYZA 3QWPA 2HNZA 1IBKF 4HTIA 3JTNA 1OYEA 3NGTA 4MK8A 3MCSA 5ITHA 4NA3A 1SH0A 3VAFA 1N56A 1Q8IA 1PJ7A 4DQPA 2HFUA 4AUKA 2L9NA 2DR6A 2FZCB 3IC1A 1DTTA 3MEGB 4OZ2A 3AB4B 2M9KA 2YPZA 4C0HA 3V81B 3M2VA 3B4MA 3K5MA 4G6VB 3MMJA 2R2TA 3PYEA 1ROFA 3TZXA 1JKHB 2HEKA 3N5BA 1HA1A 3Q0AA 4IUFA 4JV5F 1V3ZA 3D6FB 3TVYA 3T6BA 1HYSB 2C2KB 2E5LF 5I42A 3KLEB 1B7YB 4HEA9 1IBLF 1SH3A 5LSLA 2JC0A 3CJKA 1RT3B 1YBUA 2EKNA 4USHA 2UUWA 1QE1A 3HX9A 2PDAA 3OXLA 4I69A 5AXMA 3LAKA 5GAEU 4N41A 3CF5Q 1VJWA 3PYDA 4DPXA 2MY8A 3K5PA 3MUTP 2ZZTA 3W8PA 1LW0B 3MM8A 2D9OA 3GWCA 2K1RA 3DLLQ 4H4OB 1FWPA 2RS8A 3D7SB 5GAEI 3EDRB 4OJ3A 3HF5A 2HHQA 1S9GA 4Q45A 4KGKA 3EM1A 2NYHA 4BCAA 3VR1A 3HHNB 2QG9B 2AZ3A 4KQZA 2NQPA 1EHWA 1UVIA 3TWZA 3NS7B 4KV8B 3MOZA 3AFGA 1JLCB 1OQ3A 1E6VB 4QW9A 2KG1A 3ADAC 1UAWA 1P9YA 4LF9J 2HYIB 1GXLA 4MKYA 2JEFA 4QJVA 1QD1A 3CCSS 4XO0A 2J8SA 4WK3A 4JOUA 5C25B 1HNIA 4GC7A 3MR7A 3V6KA 4P2FA 1FWLA 2PE8A 3R2CJ 1WHYA 2YTCA 3HJFA 4DR2J 3MFHA 2IM1A 1CVJA 2BYCA 5HVGA 5LM7E 4U67Q 4M5LA 3MR2A 1LWFA 4C48A 5KFKA 1WOPA 5IT4A 3KTQA 2C2MB 3OBIA 5FDLA 3QT8A 3FCHA 1F9HA 2EPIA 1FKPA 4C8NA 3VZHA 3MAHA 2VHGA 1R8PA 1HWKA 1FI4A 4DWIA 1VBKA 2V2VA 2BKNA 1JLEA 2KDOA 4J9NA 2XBPA 4M5JA 1S99A 2C22A 1YJRA 3LP1A 2R7XA 2WB1D 2PMHA 5H9FJ 1URNA 3W66A 5FIIA 4Q5VA 2MKKA 2P9GA 2Z57B 1KFSA 2RU9A 3CJ2A 4L3NA 2ZUGA 1UFWA 2VIHA 5KFXA 3LANA 2FGOA 3MMCB 5E2QA 4RUBA 1U26A 2JWNA 4EFAC 2HAIA 4L76A 4QWDA 3KLIA 4UOGA 2V4QA 3OFGA 1S7HA 2A3JA 1S12A 5KG7A 1WI6A 2DR5A 2XC9A 3BQ1A 4WZQA 2HLTA 4PYAA 3KLGB 1QSSA 2NXUA 3FSXA 1RBOB 2M4MA 1P1LA 3QBCA 1HBNB 2DCUB 4LF9F 1NJIT 3UR0A 4NLVA 3W64A 4OX7A 1S1VA 4OYOA 2NR0A 1REVB 2QSWA 2ZJQQ 3MCNA 4PQUA 2FZGB 5LXRA 4DR2F 2QT7A 4TQRA 5B0BA 2MPUA 2YNGA 3GIMA 4DX7A 3GYGA 1NPPA 1VC5A 1QDUB 1U02A 1VQ5S 4ICLA 2Y1RI 2IRUA 3SFGA 5SUHA 1IKYA 3FMWA 3JAMY 2WBRA 4K4YA 2A6MA 4KHPJ 3LP2B 5L1JA 4ZP6A 1CPZA 3HKZD 3SSSA 2GHVC 5DQHA 2RRNA 3FEZA 1VHIA 3DHXA 1FXRA 1R43A 4M5KA 4WFAQ 2CPFA 3A3NB 6FD1A 2XO6A 2C2ZB 2V67A 3VGTA 4QR1A 1TV6B 3QGIA 1S9EB 1FDBA 2F1FA 4H4MB 5DS7A 4ECSA 3CCZA 2YWFA 2CQDA 4PPDA 3BEGB 1JJ2R 2ZFHA 2GNKA 2XGPA 4UQTA 4WXOA 2HVIA 3KWMA 4NPOA 1XC9A 3I9ZA 1YJNS 4LIRA 3AQPA 3GSIA 1DRZA 4JV0A 3PX4A 1CQNA 1UWBB 4F4WA 4RW6B 1WG1A 2XS7A 1RTJA 3ZTPA 1VQ4S 1NDPA 1RAIB 1XMBA 1RAEB 3CCMS 4NZ6A 3V5RA 1OQ6A 2R8HA 1HL6A 5GAHU 4RL1A 1U8SA 1S6QA 3R1HA 4DS5A 1SH2A 2BANA 3VQSA 4DL4A 4BWMA 2DRDA 3WZ0A 2B7CB 2X3DA 5M2UA 4EO8A 4AL6A 1QUVA 3DCAA 1SV5A 2D1CA 1HARA 3BZQA 3CCVS 4ZK7M 2A1BA 1FERA 5KFAA 1F9EB 1WC3A 3GIIA 1TL1B 1S1WB 3I0RB 1YJUA 5KFHA 4ZIWA 3AQOA 4WXWA 2RT3A 2V4RA 2R8JA 3IWXA 4KHPF 3AD7C 1NDCA 3N6NA 2DNNA 1S9FA 2VG5B 2J7KA 5IFMA 3P3DA 2NXJA 2M8HA 3B4DA 1Q8BA 2IIHA 4UY85 1LV5A 4K4ZA 2FVQA 4OHVA 1VQ7S 4OZJA 2J9EA 4IKAA 2BA9A 2N7YA 1HI0P 4NCGB 2ACYA 1TL3B 4JI6J 2ZKUA 3ULHA 3UO0A 3CMAS 3DKDA 3GV8B 4Q0BA 1GXUA 1FE0A 3MD3A 3G4SS 1HPZB 3TEHB 5HI7A 5EWGA 3IG1B 4FF2A 4C3KA 2VD3A 4Q44A 2E9TA 4M5DA 4Y00A 2JVRA 4C8ZA 4DSIA 3BBFA 5DDRC 1XMQJ 4HDGA 4X4UA 4BHQA 4DV5J 4WP8A 2XQCA 1WNEA 1BQNA 2DT9A 4I6AA 2BQ3A 3D0IE 2NXEA 1B3TA 1YZ6A 1WI8A 4UTGA 1S97A 2YWWA 2QL7B 3IWLA 5HL7Q 2W01A 1TUVA 4PUOB 4RWXA 2R2SA 4J90A 5F8MA 4FNHA 1SVDA 1FESA 1HHSA 2FLPA 4P75A 3D6TB 4USMA 4NLQA 3QLHB 4YB7A 4JI2J 2O67A 1IM4A 2IC3B 4NRUA 1NSPA 2IPOB 2JSXA 4M5NA 3OFEA 3BM7A 2OHDA 2OPQB 4K4WA 2ZD1B 4NZ0A 1UP1A 4PG7A 5FD1A 3JSMB 1MWZA 2DGOA 2KTQA 1R6VA 3EZ5A 3U02A 4DR1J 3J7A1 1J5OA 1JLQA 4DV3J 1U2RA 4Y0FA 1BQMB 4O44B 4G3IA 2KZZA 4OL8A 3BO4A 4FYXB 1S57A 1FRJA 2GVDA 3HHDA 4DPUA 2NPIA 3LH2S 4JI6F 1K44A 1DTTB 1F2HA 4LT6A 5ETVA 3H2UB 3RRHA 2CJKA 2IA6A 2Z4PA 4L6V3 3EGWB 3TAMA 2XGQA 3D1HA 1V6HA 2V8DA 4F3QA 2DGUA 1U1PA 4ED3A 2XMWA 2D9PA 3HULA 4IH7A 4BBYA 3H20A 1XMQF 5DGAA 1KONA 5J2NA 2NPFA 2UXBJ 3V2UC 2EI5A 1FFSB 2UUCJ 1MW7A 2ATLA 4DV5F 4CIOA 1ZYQA 5I42B 4F2SA 1FKOA 2NUHA 3KK1A 4DDFA 5KG5A 3GJRB 1QAIA 3CJKB 5JVGQ 2XB2D 4CLWA 3IA0A 4O3SA 5DG9A 3H98A 1QTNB 3D9BA 4M1KA 1T8EA 5IXUA 4CRJA 1TFYA 4AQYJ 5DGBA 1N5QA 1PCAA 1EX8A 1FO1A 4JI2F 1RWUA 2MKCA 1Y11A 3QGPA 4X66J 3BH7B 3MMAA 4K59A 1C4CA 4DSKA 2K1RB 1PC5A 1NPKA 1UPPA 4ECYA 2HNDA 3PHEA 1S9GB 4Y6IA 4O4GA 1LEOA 4DX6A 5KG6A 1RP5A 3W5YA 4DR1F 3FDSA 3M6UA 3C19A 2Z56B 4L75A 4DV3F 4J9OA 2JC1A 4WFBQ 2D3ZA 4EEYA 5K8OA 4K50A 2DO4A 1NKBA 3Q8SB 3FZ2A 4JYAJ 4OJGA 3GFXA 4A8QA 4ES3A 2OD4A 1TK8A 4Q7AA 1HNIB 1U6BA 1KSPA 4HKQA 1NLKL 2QMXA 3M8WA 1YRTA 1RT6A 2CAJA 3N4WA 4AFFA 2C3PA 5CYQA 4O3RA 1LWFB 4ES2A 4LF5J 2XO7A 4CLZA 3E01A 4I67A 2V63A 2UXBF 4LRFA 3NOGA 5FDLB 2UUCF 1SI9A 2U1AA 2PN6A 2O66A 1S77D 4MYTA 1TK5A 3K5LA 1YJ7A 1FKPB 3ISNC 1X9SA 4MIBA 1T3NA 2IHR1 1VLYA 3R97A 4J9QA 3CCWA 1JLEB 4CLUA 2CUYA 4ETZA 1QSYA 3FRZA 1T02A 1WEXA 1U0SA 3LP1B 3V4MA 2ZBRA 3TUIC 4AQYF 1S4EA 2ASDA 1SIZA 1FJEB 3PG9A 5FLXY 3OVAA 4ZVOB 1VBXA 2XMKA 4EZ9A 1SJQA 4X66F 4TY9A 2HWIA 2R9LA 3NMAA 2LQJA 2MHEA 1AXQA 4GVLA 2HVDA 3R7NB 2RKIA 2HAFA 2DGQA 1PG5B 2L41A 1VQMS 2XHWA 2QC3A 2DJWA 2Y0SD 1Q7LB 1YWXA 2XZDB 2MLXA 3AOCA 1YJ9S 3F41A 3OFFA 4NLRA 2OD6A 4JI0J 4KIAA 4X65J 4JYAF 4QBUA 2EG1A 1VK3A 1S1VB 4XDDA 2GZOA 1SJ1A 2ADCA 3IRXA 4PQUB 4FXWA 2X3GA 2YNGB 5E3CA 4LF5F 3H5YA 5KG3A 3N5FA 3OSPA 2OPPA 1D8ZA 4DCJB 2RIJA 4ICLB 3RTVA 4WFZA 1IKYB 3JYTA 4A8KA 5GAGU 4M5MA 3HT3A 3D1QA 5CAAA 2MTLA 1S0MA 3MPYA 1JMTA 4ZVGA 5BXIA 5IC4B 3DN9A 3OL8A 3CD5A 2B4PA 5KFTA 5U47A 2GAGC 4K2JA 2RRBA 1NEEA 4F2RA 2XLJA 5KFZA 3GIRA 2B9WA 3X1LB 1TKDA 4A8SA 2LECA 1FRHA 3THPA 1HQUA 1BWVA 4ZP8A 3DLBA 3I31A 3IP0A 1JQGA 3SFUA 5CD4A 3IBFB 1ZM4A 1NKCA 1BHNA 3FBBA 2D3UA 3JQMA 2UVUA 4WFYA 2HQIA 2MLYA 2HZVA 3L3CA 1UWAA 2EG2A 1RWNB 2MSSA 2Q6CA 4LBHA 3HSDA 2E1RA 2AX0A 1IWGA 1RTJB 3G8QA 2G0IA 1Y10A 1L3TA 2OPSA 3THVA 4JI0F 3BR9A 5T14A 4DV6J 2HGMA 4IOBA 4X65F 1R8CA 4LSLA 4U6PA 4ZCMA 3AY0A 5KFRA 4C6AA 2BANB 3G86A 1F0XA 1AFJA 2XNRA 3MD1A 2NXNA 3ET6A 2KXFA 2GMHA 1SV5B 3VV2B 1MMDA 1G7CB 2BJEA 3TO8A 4WZMA 2DO0A 1WOOA 3MM5A 1TUGB 2PD1A 4IR9A 2PMZD 1WACA 1MG7A 2XMVA 2EC2A 1IKXA 5L1KA 2ZBCA 2GVZA 4LQ9A 3MTKA 2UUTA 3GB0A 4HR2A 1P6TA 4G65A 5EHHA 1FD8A 3RB4A 4WIQA 2Z0GA 1Q4RA 5A8KA 4USWA 2CVEA 1WC6A 1WORA 2KT5A 4QYRA 4B17A 3SCKE 2VASA 4LRCA 3KDOA 1N36J 4XIUA 3DDNA 4QWAA 1UEVA 2HGNA 4PXDA 4Q0BB 5HMZA 3W2WB 3HD1A 3PV8A 3NCQA 2O3DA 2XM3A 2C3MA 2DHXA 4M5DB 3DRPA 4LVOP 1KTVA 3M9OB 2CPDA 3FC9A 4QPXA 2CYYA 1KRPA 4F4KA 2F8EX 4QR0A 1YHQS 4DV6F 2XMMA 3HFVA 2E1PA 2A10A 4DU8A 2OUGA 4N47A 2BOPA 1BQNB 4WE1A 2W9CA 1X0PA 1AFIA 1RT1A 4ILRA 4FPIA 3PKMA 2LQ8A 1NCLA 2C2OB 4FYWB 3MURP 1RU1A 4AXJA 4PZVA 3CD0A 5ETMA 2ZBIA 1GNKA 5T7LA 1UA0A 3KHHA 3A8IA 3WIUA 1D09B 2VJVA 3Q22A 3P5BP 3TEGA 4OYIA 4U7UK 1U09A 4DCPB 2KHCA 2LA4A 1WKLA 5C2CA 3E3XA 3MAAA 1RADB 4O3PA 1O8BA 1RA7A 1Q1KA 4CNZA 1IJFB 3RW7A 3QATA 4ELVA 4IR1A 2RAQA 2MQMA 2ALYB 3ONQA 1IKVA 1F1BB 2MDAA 1RAAB 4RNHA 1SC1B 4LJMA 4OYZA 5K5MA 2VBWA 3R7SB 1Y3JA 1YVFA 2DNGA 2CJ9A 1XWLA 3NP5A 3CJQA 3WBZA 1JLQB 2K8GA 3V6DA 4WKRA 2CDRB 3CDBA 3RAXA 1FCAA 2VL1A 5KT5A 1V5VA 2HHSA 3M32A 3SBMA 4RU2A 1KC8T 2KXNB 4NRTA 3WQPA 2MQPA 4R0EA 2GVDB 2VJUA 1N36F 2C2RA 1H2VZ 4YEAA 3QYYA 3EWGA 4NMXA 4CLPA 2PSZA 3SCIE 2H9ZA 3HCXA 4AXIA 3TAMB 2CRLA 5FJ4A 1GX6A 1TVRA 4L74A 5LMNJ 4Q8EA 3LUYA 5J2NB 1RJJA 4C4WA 5JUMA 4EBDA 2VB6A 3VALA 2XCPA 4CLFA 3AOAA 3KK1B 2W2OP 1Q5VA 2HZCA 3W2VA 2N3OA 1YGYA 3AD9C 3OLBA 4Y28C 1FRLA 3EUNA 4ZLPA 2IVMA 5K20B 2KN4A 1BWEA 4GMKA 2V34A 2HHTA 4YN3B 5IV3A 2J76E 2DIVA 5RUBA 3SEOA 1KWMA 1HMVA 2WK4A 2DITA 2HW3A 3TR5A 2J0SD 3BF4A 2YNFA 2DNQA 3BB5A 5I3UA 4QU7A 1TKZA 4EK2A 3NS6A 2IYIA 1WF1A 1VQOS 3IBWA 2B3TB 2BXJA 3MMAB 5KAKA 2Y1IA 3MUMP 1NBEB 1W2IA 2V8VA 1SKRA 5KG4A 2YQ1A 4DR3J 3K8WA 2HNDB 3HZEA 3JQJA 1VFJA 4NASA 2H1YA 4Q8FA 5F0UA 4O4GB 3JQKA 1NB2A 3NRBA 2MQQA 3ELHA 1JNZB 4XK8C 3LWMA 5KT4A 2PC6A 1N34J 1S4FA 3PO5A 2AJFE 2KT2A 2L9WA 4PWUA 3OTCA 3Q8YA 1L5UA 3PFEA 2YKQA 2DHHA 1X5OA 1T9WA 1RT6B 1G4CA 4NLUA 5LMNF 3US5A 4F4ZA 4ZVUB 3MZIA 4O4RA 4KHRA 3EVMA 1M5OC 5H9EK 1X7VA 5KFSA 4B3OA 2Z8QA 2V9WA 4PR6A 4RLEA 1WG5A 1V5IB 4PG8A 1VQLS 3EVOA 4I6YA 1DTQA 3OSNA 2RDDA 1SC3B 2LEPA 4EO6A 4C98A 4IO9Q 3LGMA 1UCNA 2RE1A 3J80Y 4FVCA 4FDFA 3TANA 1UW9A 3GTYX 4ELUA 4C8YA 4CH1A 2EBEA 2QLWA 3ENWA 5KFGA 3MM7A 4HHUA 4DBQA 3HT0A 2W7AA 2G1DA 2EWHA 3AXKA 3CT9A 1CJVA 2MJUA 1YJVA 4MT1A 1A9NB 5HANA 3HVWA 4ZPCA 2KJVA 4DR3F 3HHEA 2FY1A 2BVZA 2RKIB 3CD6S 4OJ1A 3FUYA 1NSAA 1LQ9A 2F8MA 3HHLA 1FFGB 2IY5B 3AAWB 1NHUA 4K4VA 1MSWD 4F25A 2W1BA 3A1YG 1M5KC 5HAOA 3KJFB 1VBZA 1N34F 4XPCA 5F8LA 1TTHB 4B3RJ 3L9ZA 3U1NA 3FBEA 1NK9A 3ETOA 3CPWR 2UXDJ 4CM0A 1B64A 4LRBA 4IH6A 2N4DA 1WWHA 4IYQA 2DNZA 4RW8A 1RHKB 3JTPA 1FX4A 2CQ4A 1GT8A 3TI0A 4DOZA 2G13A 4ZKAA 3C6UA 3ZZ0A 2ZC3A 3RG6A 2OPPB 1SQFA 2EFVA 1VOMA 3VGSA 4IH5A 4Z37A 1CG2A 4K4SA 1HD0A 3JYTB 3P96A 1NXIA 2OKQA 1IBCB 2E5IA 1YSJA 1UVNA 2LLZA 2ROEA 5DLFA 3U1MA 1HWLA 1OIAA 3Q24A 1IM6A 4CDIA 1LFPA 1Y4ZB 2DR8A 4LBIA 1SQEA 4Y2MA 3ZO7A 2ZH3A 2BR0A 5HLFA 2H4WB 3IR7B 2E7XA 2GC8A 2H48B 2OIHA 3A13A 3JSYA 3B82A 2JL9A 3BSCA 4DPTA 4YS2A 4U9RA 4P2MA 2HHXA 1NB7A 5CZVA 1HQUB 3JB9k 3QWUA 2G2OA 2Y1JA 3R7BB 1SL0A 4ED1A 1FRIA 4WP3A 1ZA2B 4EBEA 3HJVA 1M1KT 2DYAA 3M6WA 5J2MA 2PI5A 2BE7D 3ZC4A 2O1PA 3PRVA 4CZCA 2LQ5A 3M2UA 2OPSB 1GMWD 1S6OA 1T9TA 3I5BA 4B3RF 3K8VA 2BX6A 5A0YA 5AXNA 2XS2A 4LSLB 4HDHA 4LF2A 2UXDF 2F8HA 3TARA 1R8HA 1YBTA 2PO4A 1V3RA 3DM2A 4Y3CA 5JJBA 4HH1A 3OXFA 1H38A 3ET6B 2CG8A 4CLYA 2DD8S 1X4FA 3EXCX 3FEXB 4I7FB 2M2BA 3NMRA 1HHTP 2YKMA 1OY9A 5HK4A 2FJBB 4NMLA 4LUBA 3MM5B 5KFWA 1TQLA 4ZPVR 2VG7A 3H90A 4JI7J 3IXQA 1BD6A 1OPIA 1N0VC 4PEOA 4QWCA 2GVZB 1K1SA 1R0AA 4CTAA 3CC7S 5HO4A 5K14A 4KTQA 4QQBA 5BYQA 5M2PA 1KOOA 1XBWA 3CEDA 4ZS6A 5A8KB 4DJBA 1NUEA 3U7JA 2X1FA 4HHHA 4ID5A 3BR8A 3MEDA 4I1TA 4CT9A 2IA0A 1RLCL 1KS2A 1ZPVA 5KT3A 1TR0A 3FZBA 2ZKTA 4ZIVA 4KH1B 1YI2S 3ZFVA 3D1OA 1RWXB 1RLDA 1SJRA 5ETSA 3PKYA 3DRPB 3QNWB 2LEAA 3IGVA 3DLHA 4RUCA 4L72B 4CLTA 1LNQA 2UUBJ 2F65A 2MKSA 4B9LA 2DHGA 3TX0A 3DOMA 4DF8A 1K0VA 4ED4A 2CQ2A 4JI1J 4WE1B 3SV3A 1RT1B 3TA0A 4P6QA 5KFCA 1Y0HA 2AWZA 2J8AA 1WHXA 2WBMA 4ZN3A 1Z2LA 5AJ3J 5B0FA 4RJVA 3CCTA 5T7LB 5DG8A 3GQCA 2BJ1A 1RHUB 2R7TA 4R8UA 2CQCA 4DSFA 4J91A 5GMDA 1EARA 2CPJA 2V2QA 3HSJA 4NYOA 3J81U 3MAAB 4A8XA 5DRKA 1DARA 3QGHA 1HR0J 4JI7F 5B0GA 2KL8A 4X84A 1YJWS 4W90B 3SI8A 2I6WA 5B0AA 1N6QA 4GVBB 5DM7Q 1IKVB 2LXUA 5DJBA 1LK7A 3ENQA 4NYPA 2DNLA 4I2QB 1ZBTA 2MZTA 1N88A 3SXLA 3V6DB 2HFOA 3PRBA 2OELA 2WSCC 4KB7A 1ZPWX 3M32B 3GR1A 3UWTA 1D9FA 2DNRA 4USUA 1OJ4A 1ZH5A 2DBBA 1L3UA 4ZPAA 4DFMA 1T95A 1TKTB 4LF6J 1U1QA 3DOKA 2QYGA 1XTZA 4KRWA 2DY9A 4NI2A 4DQRA 1TVRB 3MPVA 2UUBF 1G1XA 4A8OA 4DN9A 4PPZA 4WWSA 2IJRA 5HROA 4FZVA 2MQOA 3CCRS 2YWEA 3OHBA 4JI1F 2IM0A 3W2VB 2UVWA 4B3TJ 2W2PP 3T19A 1D9AA 4P71A 4A46A 5HQMA 2MQNA 2FJVA 4Z2XA 1NAQA 4DR5J 3EZUA 3A8EA 4UT4A 2VPYB 4Y65A 5AJ3F 3OVBA 3ZTQA 2Z2LA 1ZAWA 2KFZA 2P6SA 1HMVB 1DJ0A 3KNGA 2P2CB 3M6VA 2V50A 4KO0A 2NXCA 1FKAF 2YNFB 2V9KA 1LKZA 1M5VC 5I3UB 5A8RA 1TKZB 1ACMB 2J6SA 2FHJD 4NLGA 1HR0F 3QRRA 3G96A 5GMKa 2GS8A 2H5JB 5CD4H 5K8MA 1YK9A 3FJ2A 3CGIA 3EYZA 3MOJB 4LSNA 1ZZFA 1IR2A 4NXNJ 4NA1A 5IOLA 1RUSA 1LK5A 3OQ2A 4P73A 4WBFA 1NSQA 1B99A 1TUWA 2KRRA 1KBRA 4J37A 3M05A 2I5JA 2E5GA 1DFDA 1RAHB 3MDFA 1U24A 1UVMA 4DQSA 1DBDA 3OTOJ 4TKTA 1F5CA 4MFBB 3WX4A 2UU9J 3D0GE 3NWRA 1UKUA 3QRPA 3HFKA 2FLOA 3QGGA 3GG1A 3UD3P 2VFRA 5KG2A 1XNRJ 3GE9A 4RR5A 4QCLA 5G0RA 4LF6F 1FWKA 3JSRA 1Y5LB 2FJDB 4DSJA 4M63A 1YG0A 3BREA 1ZTWA 3DXBA 3G8TA 2MSTA 4DSLA 2RVJA 4PYDA 3D6MB 4B3OB 1UVLA 1X5TA 4C3LA 3PJXA 4Y2IA 4B3TF 1YLXA 2GIRA 4RNOA 2XZWA 3TA1A 1U45A 3TX8A 1DTQB 4DR5F 4ZCKA 3H2VE 5C42A 3BKUA 2HLUA 2BM1A 4F7VA 1EP4A 1FF2A 4F4XA 2HBQB 3IO1A 3C46A 2CQ1A 4OI4A 3BPSP 3WIVA 4C7QA 2L48A 5L39A 3KOAA 3MM6A 4GRSA 1ZZNA 3MM7B 5KFYA 4L3KA 3AJ2A 5J2QA 4H4KC 4PABA 1CJVB 1Y7PA 3C15A 4DZDA 1NZAA 1VQ8S 4NXNF 4ED5A 2UXCJ 3DLEA 5KFDA 3H2LA 5IC6B 2B9EA 2F4FA 3RBXA 3AH6A 2B9YA 3JXOA 3SDEA 3HHLB 3ZZZA 2DXFA 3ETMA 1K9MT 1GX5A 4R5PA 2WVCA 1H6KX 1NSKL 2W9AA 3OTOF 4LFCJ 1NU4A 2XYHB 1QVGR 2UU9F 3TUPA 3KNAA 2BUNA 1WJ9A 2XZTB 2YY3A 3EDQB 2KFNA 3N6LA 5LMUJ
chains in the Genus database with same CATH topology
5ETSA 3HT0A 4M5GA 3UD5A 1IM6A 3KUGA 4M5MA 4CYUA 4CWBA 2F63A 3KUHA 3ILJA 1G4CA 3MCNA 1Q0NA 3KUEA 1RU2A 1RU1A 3HD2A 4M5LA 5ETKA 3HD1A 1RB0A 3HSZA 3IP0A 5ETTA 4PZVA 3QBCA 4M5IA 3UDVA 4F7VA 4M5HA 1TMMA 1HKAA 1HQ2A 3HCXA 1TMJA 3ILOA 5ETMA 5ETQA 5ETLA 4CRJA 4M5NA 3MCMA 3HSGA 5ETRA 4CYUB 1EQMA 2F65A 5ETOA 2CG8A 5ETNA 3ILLA 5ETPA 1DY3A 3ILIA 3HSDA 2BMBA 5ETVA 1CBKA 1RAOA 4AD6A 1EX8A 2QX0A 3MCOA 1EQ0A 1F9HA 1KBRA 4M5JA 1RTZA 4M5KA 3UDEA 3HSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ETS A;  3HT0 A;  4M5G A;  3UD5 A;  1IM6 A;  3KUG A;  4M5M A;  4CYU A;  4CWB A;  2F63 A;  3KUH A;  3ILJ A;  1G4C A;  3MCN A;  1Q0N A;  3KUE A;  1RU2 A;  1RU1 A;  3HD2 A;  4M5L A;  5ETK A;  3HD1 A;  1RB0 A;  3HSZ A;  3IP0 A;  5ETT A;  4PZV A;  3QBC A;  4M5I A;  3UDV A;  4F7V A;  4M5H A;  1TMM A;  1HKA A;  1HQ2 A;  3HCX A;  1TMJ A;  3ILO A;  5ETM A;  5ETQ A;  5ETL A;  4CRJ A;  4M5N A;  3MCM A;  3HSG A;  5ETR A;  4CYU B;  1EQM A;  2F65 A;  5ETO A;  2CG8 A;  5ETN A;  3ILL A;  5ETP A;  1DY3 A;  3ILI A;  3HSD A;  2BMB A;  5ETV A;  1CBK A;  1RAO A;  4AD6 A;  1EX8 A;  2QX0 A;  3MCO A;  1EQ0 A;  1F9H A;  1KBR A;  4M5J A;  1RTZ A;  4M5K A;  3UDE A;  3HSJ A; 
#chains in the Genus database with same CATH topology
 2CKW A;  3R8Y A;  3BO2 A;  2EC0 A;  2RUS A;  3VCD A;  1XNR F;  2CQ0 A;  2RH3 A;  4NLX A;  1FEE A;  2J0X A;  1PYT A;  1IN0 A;  5HSP A;  4I0W A;  2HQD A;  4KKO A;  5E3P A;  4NZ7 A;  4RW8 B;  2AP6 A;  3VQT A;  2IMW P;  1U4B A;  5A2Q U;  1RHQ B;  2WAQ D;  3PY8 A;  3C6U B;  1OYD A;  4EYI B;  5M2R A;  2VFV A;  2HWH A;  2LKZ A;  1P9Q C;  2LCW A;  4P52 A;  4K5R A;  5K8P A;  3UN2 A;  3RR8 A;  4IFY A;  5T41 A;  5IWA J;  3OJS A;  2OMO A;  3I4P A;  3CB4 A;  1PYO B;  5F0W A;  2UZA A;  3CJ4 A;  3BSN A;  3CJ3 A;  4FYV B;  4FVM A;  2QEX S;  5HLF B;  2YNI A;  1S59 A;  4QWB A;  3RAM A;  2W7P A;  2GO9 A;  2AGQ A;  1AZS A;  1JLG A;  1R0B G;  2DPJ A;  1URR A;  1KVI A;  3QFW A;  1P8G A;  2QE5 A;  3RGI A;  1Y9O A;  2JFD A;  2E44 A;  4ECT A;  2N82 B;  4KGX B;  1NJW A;  2UXC F;  3B8H A;  1H7W A;  1K8A T;  3M2R A;  3GPA A;  3PJW A;  3UDE A;  3TJ9 A;  4DR6 J;  5L46 A;  2JVO A;  1HWI A;  3CVK A;  5D0G A;  1IKW A;  3TZY A;  2IDL A;  3HSZ A;  3P4U B;  5DQI A;  2DIS A;  3C3L A;  2ABY A;  3OXG A;  4LFC F;  2W7O A;  1VGY A;  2PEH A;  3M2U B;  1KP6 A;  1NJZ A;  2WOM A;  4OZ3 A;  3S6E A;  1R8B A;  2CWK A;  2L9D A;  1T05 A;  5LMU F;  1Z2Z A;  5A0Y B;  1NK8 A;  3B54 A;  2QL5 B;  4EGL A;  2N4C A;  3H5X A;  1RAC B;  4ZVR B;  3O1L A;  4NOH A;  3DM2 B;  4OZL A;  2PFD A;  3O6Q A;  2ZVS A;  1FJ7 A;  1I5O B;  2P9C A;  4DV0 J;  2WRM A;  4I64 A;  1LFW A;  2OO4 A;  3BV8 A;  1SL1 A;  4DSE A;  1V9O A;  1IR1 A;  2OML A;  3CWJ A;  4W98 A;  1JX4 A;  4FYY B;  1KLM A;  3PYF A;  3DGP A;  2V8G A;  2GIF A;  2G1H A;  2FUG 9;  1S0N A;  2G4B A;  5IWA F;  3MR5 A;  3ENV A;  2VG7 B;  4QR2 A;  3PXG a;  2VFU A;  3HVA A;  5DZ7 A;  5I3Q A;  1U1O A;  1R89 A;  2MQL A;  2DH7 A;  1U1K A;  2FLL A;  1R0A B;  3G2X A;  4CTA B;  3M1V A;  1H3D A;  4MIW A;  1S1U A;  2WON A;  3DMJ A;  5K14 B;  2YH0 A;  1WC1 A;  2EW9 A;  3G6Y A;  2QV6 A;  3VZI A;  2W2Q P;  3QO9 A;  3RUB L;  2IJF A;  3G87 A;  2O5D A;  3OV7 A;  4ID5 B;  3FQL A;  3QFH A;  2HHV A;  3MED B;  2NLW A;  2BE2 A;  3EIC A;  2ZWO A;  2WZ1 A;  3BGO P;  2VBX A;  3PEH A;  3PEJ A;  3DLK A;  4UUX A;  2RHS B;  2HVZ A;  2E1M C;  4KSE B;  2RB7 A;  1K73 T;  4DR6 F;  1SJF A;  5CXT A;  1RU2 A;  3Q8V A;  1TP7 A;  3NBP A;  4YR0 A;  5IZH A;  3K7R A;  4EWT A;  3SCJ E;  2G9O A;  5EGY A;  1PBU A;  3J7Y I;  3CJ5 A;  2JH3 A;  4WFN Q;  4UW2 A;  3UQS A;  5A6P A;  3KK2 A;  3H4D A;  1KQS R;  4CCH A;  1KKH A;  4NEY A;  3AA9 A;  3CJR A;  3PRD A;  3DOM B;  1WOS A;  3D0H E;  1Q78 A;  3DU5 A;  2ZM6 J;  4MTP A;  4H54 A;  5HBM A;  9ATC B;  1WF0 A;  3NY0 A;  2KI2 A;  4GO7 X;  4YB1 P;  3RBZ A;  4DV0 F;  2XLK A;  4NEZ A;  5H9E J;  2LQ9 A;  3ENA A;  1DHM A;  1HKA A;  2LDI A;  1ZAX A;  1JLA A;  1H7X A;  1LWC A;  1SJ4 P;  2BAB A;  2CZ4 A;  2XYG B;  2V68 A;  2VA3 A;  2KO1 A;  3H25 A;  5J2P A;  1RWK B;  3AA8 A;  4CH7 A;  2M8D B;  2G0C A;  4R8U B;  3AT1 B;  4RKU C;  3R2D J;  1ZAV A;  3UDC A;  3WDO A;  3HMJ G;  1NPR A;  1REG X;  3CC2 S;  2ZIT A;  1N6Q B;  4JUZ A;  2JHE A;  3NCR A;  3UVJ A;  3LGH A;  1VQS A;  2FVS A;  3NKY A;  4ALZ A;  3ZZP A;  1ZM2 A;  4I6W A;  5B0D A;  3MUV P;  5F8J A;  2FVC A;  4IRK A;  4DV1 J;  4R0J A;  1VJQ A;  2LU1 A;  4MMO A;  2J0Q D;  2C3Y A;  3GFZ A;  1RA6 A;  4F4A A;  2CQI A;  2GMJ A;  1RAO A;  4NE9 C;  3FQK A;  1UEU A;  1KQK A;  2ZHO A;  2M52 A;  2BRL A;  1YZ7 A;  1JXE A;  3MFI A;  1IXK A;  2QLB B;  2VU5 A;  1GMU A;  4BWJ A;  1UZD A;  3DOK B;  1FDN A;  2R3V A;  5D6G A;  2EFP A;  2N3L A;  4NI2 B;  1JLB A;  3CO0 P;  1N5T A;  1VIX A;  1FX2 A;  3MAQ A;  2KFY A;  5HRO B;  4FF4 A;  3OL9 A;  1NME B;  1JNR B;  2D3O 1;  1UA1 A;  2ZM6 F;  2KRB A;  1DQ9 A;  2F9D A;  1N32 J;  4DU7 A;  3ZZR A;  4KR0 B;  1S79 A;  2OFH X;  2X1A A;  2NRE A;  2Y1L B;  2HS3 A;  3DRY A;  2DXD A;  3T1A A;  1NHV A;  1RWO B;  1TMJ A;  3RW6 A;  4J9S A;  3QAU A;  2BM0 A;  4DL2 A;  2VH7 A;  1S49 A;  4E2F B;  2AEJ A;  4DQQ A;  1FE4 A;  3O44 A;  4E98 A;  4KO0 B;  4X4S A;  3QAE A;  4MK9 A;  1Q53 A;  3F56 A;  3KLE A;  3D2W A;  5A8R B;  3D5M A;  2HUR A;  1RT3 A;  4DLE A;  2E9Z A;  2VQF J;  4QIE A;  2RIL A;  3T9Z A;  3V4I A;  5HN0 A;  4AL5 A;  2R7W A;  5KFF A;  2GCF A;  3JSB A;  4LSN B;  1WD6 A;  4FYD A;  3NL0 A;  2MHN A;  1NK5 A;  2M3D A;  2VOO A;  2P8I A;  4DV1 F;  4UF4 A;  2Y9H A;  2KVI A;  1F60 B;  1U48 A;  1C0U A;  2COL A;  4J9P A;  1U0H A;  2I5J B;  1S76 D;  2DGS A;  1SBR A;  1FTR A;  1EB0 A;  3P5T L;  5BYS A;  3POT A;  2U2F A;  2V4J A;  1VQK S;  1TAQ A;  3NS5 A;  5L8R C;  1Q86 T;  4OMF G;  2ROG A;  2YNH A;  1NJX A;  4P2S A;  2V69 A;  2QJ3 A;  5G0R B;  3CSK A;  1FEH A;  1E6V A;  3CJ8 A;  3W8G A;  2KM8 C;  4M8L A;  4URQ U;  5L1I A;  4OI0 A;  1WC0 A;  2VC1 A;  2ZH1 A;  4URS A;  2M7S A;  3OW2 R;  5KG0 A;  4RBU A;  1N32 F;  1BC6 A;  4IDK A;  2BDP A;  3DRS A;  4AT1 B;  1SPB P;  1AYE A;  4DX5 A;  1EP4 B;  4EI2 A;  3MM9 B;  2Q43 A;  2CPE A;  1R3N A;  1V3S A;  1SUQ B;  2HBR B;  5E3A A;  2RF2 A;  4F50 A;  5F9N A;  3MM6 B;  3T5L A;  3M4X A;  3PW5 A;  2FD2 A;  2V5H G;  3D66 A;  2ALZ A;  5J2Q B;  2V6A A;  2VQF F;  5KFM A;  3KDN A;  4J9V A;  3TUZ C;  3V6J A;  3AHP A;  1PIE A;  3C15 B;  5IT9 U;  2GHP A;  4P9S A;  4WTO B;  3MR3 A;  4JI3 J;  2QLF B;  3ILI A;  3PTW A;  1G6B A;  3CDA A;  5C2G A;  4LRE A;  3DLE B;  2R7R A;  2JOQ A;  5D4P A;  2HVH A;  1O6X A;  1KNZ A;  1BQX A;  2RML A;  4XPE A;  5KT7 A;  2D74 B;  2MZJ A;  3BBC A;  2I8E A;  3L4B C;  4NL5 A;  4CQ1 A;  4R5P B;  4HHJ A;  3UPF A;  4GO5 X;  1MRO B;  1RXO B;  4TY8 A;  2V2K A;  1WEL A;  1YIT S;  2FDN A;  1PSD A;  2F4V J;  2C3O A;  1MML A;  5F41 A;  4RX6 A;  1UEK A;  2E7W A;  3TP2 A;  3QT6 A;  4KKO B;  1QSL A;  3I0S A;  3CCJ S;  3ZXW A;  3CNQ P;  2VKZ G;  4WCE Q;  2GJI A;  2QIF A;  2BBE A;  4NLS A;  4E8U A;  4S0M A;  3L7U A;  1HBN A;  3OPK A;  3BYP A;  2DPI A;  3CDE A;  1M90 T;  4IFY B;  2G0J A;  3DDK A;  3HP6 A;  2RDJ A;  5CYM A;  2D69 A;  3GG0 A;  2C2N A;  5E5N A;  2BEF A;  2P9E A;  2GGP A;  3M8S A;  2V8P A;  1F9F A;  4ZP7 A;  1U25 A;  2APO A;  4Y34 A;  2QLX A;  4TYA A;  5DLG A;  3EVW A;  2XWX A;  1K0T A;  3TQ1 A;  1U6F A;  1X9W A;  2I0X A;  3GIJ A;  2YNI B;  3PZP A;  4KC5 A;  4F0H A;  2GFF A;  3FEY B;  4RPF A;  2KU7 A;  2Y3Y A;  1AZS B;  1JLG B;  3M6X A;  1X4H A;  2HGL A;  1RT7 A;  4KFB A;  3R5C A;  3H7H B;  4B9T A;  4JI3 F;  1N5S A;  3CDU A;  4C0O C;  4M95 A;  3N01 A;  3M2R B;  4Q2L A;  2AW0 A;  2DR9 A;  3AB2 B;  4MIA A;  3K0J A;  1IKW B;  4PG6 A;  5ETP A;  2HNZ B;  1PO6 A;  1RKI A;  5A76 A;  2ZC4 A;  4ZPD A;  4ZLL A;  3M9N B;  2UV8 G;  4K2X A;  5KFJ A;  1KQG B;  2BV3 A;  4QIG A;  2WOM B;  5LJ3 Y;  1FRK A;  1T05 B;  3G82 A;  2HK3 A;  3OLA A;  4DFP A;  2F4V F;  3H5U A;  1HNV A;  4OI1 A;  2MGZ A;  3M2V B;  3KKF A;  1U49 A;  2C2D A;  4PXE A;  2AKW B;  1QUP A;  4B9S A;  3AJ1 A;  3FCV A;  1GMV A;  1VQP S;  3R27 A;  2AEF A;  4ED8 A;  2HFZ A;  3BGU A;  3W9J A;  2FHM A;  4YME A;  3QSI A;  5J1P A;  3PR5 B;  3DGP B;  1RIS A;  2YKP A;  5LOQ A;  4OHX A;  3OD2 A;  1L3K A;  4CLK A;  2XMA A;  4JV2 A;  2CQH A;  3CDW A;  1FVS A;  1U7L A;  1QE1 B;  4F04 B;  3CJS A;  1HQE A;  3JS9 A;  2CPZ A;  4OZ1 A;  2FJA B;  3M1V B;  4RW7 A;  2YKN A;  2WON B;  3DMJ B;  3GIK A;  4WU3 A;  4QYZ K;  1HWJ A;  4HYK A;  3LQV A;  3O2I A;  1N54 B;  4M5G A;  1PIL A;  3I32 A;  4ZVT B;  4CP5 A;  3QO9 B;  1QTM A;  2FHO B;  4YB5 A;  3MM8 B;  2J7W A;  4ANE A;  4DLG A;  2BE2 B;  3D3C J;  5THW A;  5L9X A;  4CM2 A;  4C11 A;  2H5I B;  3UNG C;  3CJT A;  4Q43 A;  2VPX B;  2VG5 A;  3DLK B;  2CJY B;  2OJ3 A;  3NBP B;  2CIM A;  4B02 A;  5H1S V;  1KD1 T;  2C42 A;  1HI1 A;  2HNY A;  3VF0 B;  2MKH A;  3HVR A;  3GU0 A;  4AL7 A;  1LOU A;  3FBF A;  4KGM A;  4OZN A;  1HQ2 A;  3KK2 B;  1T7P A;  1PYS B;  4ZVF A;  2WB4 A;  2AX1 A;  4QIF A;  2DHA A;  4OLP A;  5SZT A;  1F3V A;  4KBI A;  2VFT A;  1O5J A;  4JI4 J;  5KFL A;  5HBM B;  4IFV A;  1RB0 A;  3UDL A;  1UJ5 A;  1PJ5 A;  4NXM J;  2QFI A;  4LR8 A;  4K4U A;  2FJW A;  2B6A A;  4FXV A;  1WC4 A;  2VIC A;  2J0W A;  4P10 A;  1JLA B;  3W1Y C;  2MLZ A;  3ZTS A;  1LWC B;  1WSV A;  4KPY A;  4XTT A;  1S1T A;  2UVR A;  2BJ9 A;  5J2P B;  1TMM A;  1I3O B;  2F9J A;  4OYX A;  4LQ3 A;  3BGR A;  2JDJ A;  1X4E A;  3H0P A;  2K7K A;  3BO3 A;  5C5J A;  1PBA A;  3IM8 A;  1A7G E;  3G6V A;  2CQG A;  1WC5 A;  5IQQ A;  4YP3 A;  1ULR A;  3KJV A;  1WF2 A;  3KJQ B;  2E5J A;  2UUA J;  1SKS A;  4PUO A;  1W25 A;  2EEY A;  3GV5 B;  2NZC A;  1RTD A;  1M5H A;  3UVJ B;  1RT4 A;  1X0F A;  4PRF A;  2YKA A;  4ZVS B;  2AJ1 A;  2VPZ B;  2DRB A;  2A6O A;  2GV1 A;  4OLO A;  1NND A;  3J7A N;  1R6Y A;  2OEM A;  1S6U A;  1HBO A;  3GZ7 A;  1FK9 A;  3KLI B;  1XMO J;  1KOH A;  2WCX A;  1VK8 A;  4NLT A;  1UZH A;  4MJK A;  3UNY A;  1TZ0 A;  2B8P A;  1HNW J;  4LF4 J;  2ZH7 A;  2AT1 B;  3RB3 A;  1UFK A;  2AYM A;  1B4S A;  3MGJ A;  4ZLN A;  3J7Z T;  1H73 A;  3P45 B;  1G3O A;  1JLB B;  4ELT A;  1F6T A;  2A2D A;  4FKX A;  5ETO A;  1T9U A;  2PFF B;  4ECX A;  3OR2 A;  1JXV A;  2RQ4 A;  2XCA A;  3K59 A;  2GAH C;  3LPY A;  3GYX B;  4PXB A;  3LP0 A;  3RBE A;  3GFH A;  4J7C A;  3KXD A;  4JI4 F;  5E3R A;  9RUB A;  2FJX A;  5ETR A;  4NXM F;  4HI1 A;  4ES1 A;  2EKY A;  1VC0 A;  2HVE A;  3FKB A;  2FLN A;  5A8W A;  1NRK A;  2KH9 A;  5CAB A;  3MPW A;  3HO1 A;  2EK1 A;  3KG0 A;  3OR1 A;  2QX0 A;  2OSQ A;  1NHK L;  3R3T A;  2IVF B;  2ZEJ A;  3QT7 A;  3TVZ A;  1YJT A;  3QZ7 A;  4ECR A;  3DGV A;  3V4I B;  1NK7 A;  4CLL A;  1RAG B;  2UUA F;  2WW8 A;  4RUH A;  4LVN P;  5JVH Q;  3U27 A;  3DOL A;  4OYP A;  4K4X A;  2IMO A;  1I51 B;  2ZBQ A;  3M8Z A;  1AT1 B;  4X4N A;  3M7V A;  3G9C A;  2FYX A;  4RUA A;  2D3O R;  3B6B A;  3AD8 C;  1C0U B;  2OH2 A;  2JJ4 D;  1U0H B;  4ANC A;  3CUN A;  2W2N P;  4DUT A;  3GCW P;  1GXT A;  2PA3 A;  2AYB A;  2JFK A;  4YDD B;  1G2E A;  1DUR A;  4HLB A;  4OJH A;  3CUL A;  1XMO F;  3POT B;  4O3N A;  2V4J B;  4YOE A;  1R0C B;  2DGV A;  3MI7 X;  1YKW A;  1P1T A;  2Y8Y A;  1ZOT A;  2YVS A;  2YNH B;  1HNW F;  4KAI A;  4LF4 F;  4RNF A;  2HQF A;  4DS4 A;  2ZH6 A;  3VWS A;  2XSJ A;  5BR8 J;  4QU6 A;  1UVK A;  3GON A;  4DMZ A;  1ZA1 B;  1TKX A;  2ZZN A;  1U47 A;  3SV4 A;  2K2P A;  2VA2 A;  3EGV A;  2NZ4 A;  3JAM U;  1RT2 A;  1RK8 A;  1DY3 A;  1NDK A;  2NSB A;  1U8W A;  2IM3 A;  2ZH4 A;  1N5V A;  1BY9 A;  2W4D A;  1N48 A;  2CFX A;  3MHY A;  3W62 A;  5CCM A;  5E0O A;  5ADZ A;  1S6Q B;  2G2Y A;  2YX1 A;  5DDP C;  3F44 A;  4IDK B;  1L3S A;  2DXE A;  4NLP A;  3DRS B;  1WTB A;  1XK8 A;  2DR7 A;  4DL6 A;  4LSZ B;  1X4G A;  3KG1 A;  3KLF A;  5ETQ A;  4PQA A;  5KFP A;  3I82 A;  1UET A;  2BJ3 A;  5GME A;  2RF2 B;  4KGV B;  2VPW B;  2WVF A;  2EBG A;  1WG4 A;  2KT3 A;  5KFV A;  4TVA B;  4DZ6 A;  2POK A;  3CCE S;  1KEK A;  4FKY A;  3RBD A;  3FMB A;  1LWX A;  3QPI A;  1U1R A;  4DQI A;  5KFI A;  3RZA A;  1J5E J;  3UD5 A;  5AXL A;  1X4C A;  2B56 A;  2EVZ A;  5EWE A;  2YX4 A;  4F0K A;  2DKO B;  4X4O A;  5KT6 A;  3W5Z A;  1XIQ A;  2R4F A;  4A48 A;  2AJ4 A;  4OHY A;  4Y2K A;  3LW5 C;  2AGP A;  3W3S A;  2DGX A;  4FBU A;  4UUW A;  4FS2 A;  1NK6 A;  3ITH A;  4NX9 A;  4TY8 B;  1GEH A;  2CNN B;  4ERD A;  3H42 A;  3BDE A;  2AJ0 A;  3IN5 A;  4PWD A;  1QJH A;  4RZR A;  1W7W A;  2RU3 A;  2FZK B;  4YDX A;  1U2F A;  2LFV A;  3Q8R B;  1HD1 A;  4O3Q A;  2I1R A;  5BR8 F;  2IJN A;  3IWN C;  3I0S B;  5IQ6 A;  1SQG A;  3BPD A;  3FRY A;  2YBV A;  4BLG A;  4IRC A;  3HI9 A;  3MR6 A;  2G2Z A;  3EXY A;  4LRA A;  1MU2 A;  3GYN A;  2XUL A;  4AE5 A;  5GAD U;  3PR4 A;  4CLS A;  2B5J A;  2GQC A;  1VIO A;  4NCB A;  4WK1 A;  2VZ9 A;  3T5J A;  5CYM B;  5AE3 A;  1WSR A;  1VS3 A;  4USI A;  1R8A A;  5IT0 A;  4IG0 A;  2GGP B;  4OI6 A;  5KFE A;  1RAJ A;  2ZOF A;  5GAD I;  1XER A;  3I56 S;  4ZPT R;  3R5B A;  2J7U A;  2OGU A;  3C66 A;  3IS9 A;  2MZQ A;  1NM2 A;  2X1G A;  5ETK A;  4U95 A;  3H40 A;  3KK3 A;  4LMZ A;  1MWQ A;  5D0E A;  3PJ9 A;  1M5S A;  1RT7 B;  8ATC B;  3BDP A;  5F9L A;  4KFB B;  3DXS X;  3VTI A;  1J5E F;  3CMQ A;  2CNK B;  5D77 A;  2FC8 A;  4LFB J;  3GP9 A;  2SXL A;  2DEI A;  3RR7 A;  1WHW A;  1FNM A;  1J5O B;  1MMN A;  2CJX B;  4ZHR A;  1W26 A;  2GA7 A;  2FPH X;  4DHV A;  2WSF C;  1F3F A;  2E29 A;  1JB0 C;  1SKW A;  3G82 B;  1VC6 A;  3M8Y A;  2ZBP A;  5DZ6 A;  4C8L A;  2ZJR Q;  1Q95 G;  3TZZ A;  1S72 S;  1HNV B;  4F26 A;  1SJ3 P;  4C8M A;  3TJ8 A;  2LXI A;  3TZW A;  2MGZ B;  3R5G A;  3HPO A;  3H4B A;  5HP1 A;  4ZVP B;  3TJA A;  4ILM A;  2QTW A;  4ETX A;  4FBT A;  3S1T A;  4F0M A;  2AGO A;  4C8K A;  2RQC A;  1FKO B;  1CJK A;  2WVB A;  3PW2 A;  1UPM B;  2ASL A;  3SMZ A;  3T5H A;  4DG1 A;  1XR5 A;  1SKU B;  4ZP9 A;  4TU7 A;  2F63 A;  1L3V A;  3GJT B;  4CO4 A;  2H54 B;  2Y0B B;  2E66 A;  2OPR A;  1N4L A;  3N28 A;  4X4R A;  3HHL D;  3NG8 A;  2EFG A;  5HVF A;  1HQE B;  1FA0 A;  5E7O B;  2E9R X;  3WHI A;  1D8Y A;  4D3H A;  4DL5 A;  4FF1 A;  4LFA J;  4DV4 J;  2X51 A;  3QJJ A;  5GAH I;  4RW7 B;  3VAJ A;  1HBM A;  2YKN B;  4ENO A;  1T9V A;  3ZTR A;  2XYP B;  4NLW A;  4OV6 A;  3R5J B;  2CPX A;  3CIM A;  1T03 A;  2C2E A;  3GLJ A;  3QIP A;  1A6L A;  3O8W A;  2HS0 A;  3TUJ C;  2QGF B;  2YQ3 A;  3D6H B;  2JEG A;  3HFZ B;  2RHQ B;  3FVY A;  2ILY A;  4C11 B;  3OTD A;  4LFB F;  4WYW A;  3IR5 B;  4G1Q A;  2DNP A;  3KUH A;  2HQC A;  1JJC B;  5D4O A;  3IFE A;  2VF3 A;  2HNY B;  2MZS A;  4F67 A;  2HQ3 A;  1YIJ S;  2LVW A;  4U7C A;  4P2X A;  1CJT A;  3L09 A;  5D4N A;  1S6P A;  1JIH A;  3J7Z 5;  3KLH A;  4J9R A;  2EFN A;  3AXM A;  1OPZ A;  4J9L A;  3NGK A;  2PT0 A;  4KY3 A;  2NYI A;  3UCZ P;  2I2Y A;  2Z2M A;  4DV2 J;  5JXS A;  2HFV A;  1RKJ A;  2YWG A;  1TFW A;  3PW4 A;  4IFV B;  4B9U A;  3W2W A;  1CUL A;  4N56 A;  2W8L A;  5CYQ B;  4HI2 A;  1E6Y A;  1B7F A;  5JMN A;  2B6A B;  3E01 B;  4ZLJ A;  2CPI A;  2A18 A;  4HAC A;  1S1X A;  3GFY A;  2EFO A;  1S1T B;  1TL7 A;  1LXJ A;  3BGR B;  4XDC A;  3UN5 A;  1IJE B;  1NH8 A;  3O3L A;  4KYZ A;  2PGC A;  2IVY A;  3PFO A;  1RYS A;  4NCA A;  2JEI A;  2BAC A;  4ECZ A;  3UE2 A;  2DNM A;  1QLN A;  2PII A;  3OT9 A;  3KJV B;  1D1U A;  2CAD A;  4LFA F;  4DV4 F;  1T3O A;  2DRA A;  1YX2 A;  3A8K A;  3PDN A;  1RTD B;  5AE1 A;  1RT4 B;  1HI8 A;  1UW4 A;  2R7O A;  3IM9 A;  5IS2 A;  1VMB A;  4QWE A;  1GAO A;  3H59 A;  1KLN A;  1X9M A;  2BJ7 A;  2HHH J;  3QZ8 A;  3W61 A;  1HBO B;  4ZPW R;  4EBC A;  1I94 J;  2HHU A;  3GJS B;  5ETN A;  1FK9 B;  3DYA A;  4W4M A;  3ISN D;  4A8Y A;  2Y8W A;  2B4U A;  4DFK A;  2CQB A;  3ZTO A;  3KJN B;  3CO9 A;  3F73 A;  1WEZ A;  2HBZ B;  3M8R A;  2CZV C;  3NXZ A;  2RUG A;  4X2B A;  2H5E A;  3TNV A;  2ASJ A;  4DL7 A;  1GK8 A;  2BJD A;  3WC2 A;  1ARO P;  3OVS A;  3I55 S;  4A47 A;  3HXM A;  2A2C A;  1KHW A;  3OR2 B;  2LQB A;  3H5S A;  3HHL C;  4ZCL A;  3UCU P;  2NS1 B;  4OYA A;  4DV2 F;  2K3K A;  3ILL A;  3HDS A;  3LP0 B;  5L9N A;  3EPI A;  1EET A;  2XI3 A;  1MN7 A;  3IRX B;  2BQU A;  5FLX U;  3RAQ A;  3SYZ A;  3HKW A;  2MZ1 A;  1FTC A;  1TAU A;  5A8W B;  1RCX B;  1PGZ A;  4B08 A;  3EX7 B;  4Q2M A;  3HVT A;  5B09 A;  2EK6 A;  3OR1 B;  2BKO A;  2W4P A;  3PCO B;  5AXK A;  3IAM 9;  4NWB A;  4QW8 A;  4DR7 J;  1H72 C;  3PX6 A;  2RSQ A;  4KGZ B;  4JB8 B;  5HJX A;  1FDD A;  1X60 A;  1Y5I B;  4LBP A;  4DN0 A;  4ED6 A;  3EZO A;  4CYU A;  3G6X A;  2KVQ E;  1X31 C;  3SQG A;  3F0N A;  2OAU A;  2OLW A;  4OHZ A;  3DC2 A;  3DOL B;  2HWT A;  4N8N A;  3W60 A;  4YB6 A;  3DU6 A;  3BN7 A;  4UOC A;  3M30 A;  4CO5 A;  2J9D A;  1YRU A;  2HBY B;  2J9D E;  3C14 A;  2HHH F;  2F5G A;  3MTJ A;  4FS1 A;  1RT5 A;  4G1P A;  4EUV A;  1F5A A;  3CCL S;  1I94 F;  1RWM B;  1RE1 B;  4KH0 B;  4D3G A;  3LWL A;  2IBO A;  4CO3 A;  2HK2 A;  3EJM A;  1S10 A;  2CQP A;  1SL2 A;  3LA0 A;  5ETT A;  1Z4U A;  4ECQ A;  3VGV A;  2BJ8 A;  1VIS A;  5KFB A;  3CCU S;  4N76 A;  2XY5 A;  1VQ9 S;  4MKB A;  2XSJ B;  3GV7 B;  4OV1 A;  4ZCI A;  5KFO A;  2XMJ A;  4RW4 A;  3MPU B;  1TKX B;  4FXD A;  5HQL A;  1RT2 B;  4USV A;  1GTE A;  4J5O A;  2BW2 A;  4ILL A;  1U6Z A;  1EQM A;  4TN2 A;  3M8P A;  5J1E A;  3KMS A;  4MK7 A;  2B7B B;  3N6M A;  2K7J A;  1F5B A;  2YX7 A;  3T41 A;  4DV7 J;  3HSG A;  2XI2 A;  3NAH A;  3FFI A;  1N52 B;  4JP8 A;  1HWU A;  3DHW C;  5BYR A;  3KLF B;  2IRY A;  2JLG A;  1IQT A;  3GCX P;  2QA4 S;  1XQI A;  3KHL A;  5F3Z A;  2DK2 A;  4DR7 F;  4F4Y A;  1UJ6 A;  4A4J A;  2JLF A;  3K17 A;  2W9B A;  1IKX B;  2GIQ A;  4QYZ J;  3NOC A;  3U1L A;  1B0V A;  4WU2 A;  1ELO A;  2N7C A;  1EKS A;  2LXF A;  3C16 A;  4PXC A;  5DDO C;  5K9F A;  2KXH A;  1CS4 A;  1RTI A;  3AJD A;  3DI6 A;  2AYE A;  4RWW A;  1FT8 A;  2J6T A;  4DEZ A;  2QSF A;  2HRY A;  3OUY A;  4ECV A;  1HNX J;  2F7V A;  2OTJ S;  2HG4 A;  4DUZ J;  4CH0 S;  1ZM9 A;  3HM9 A;  2Q79 A;  3ITH B;  4OYM A;  3TA2 A;  2MKJ A;  1BUX A;  2ZNZ A;  1RTH A;  3ZNJ 1;  3HHK A;  2ZNY A;  1Q0N A;  1RAF B;  2OP5 A;  4V1A k;  4PWD B;  3TVK A;  1M1G A;  4UOF A;  2DH8 A;  5F3T A;  2XSF A;  2KB2 A;  2VG6 A;  4QOT A;  3K5N A;  4N7T A;  2IAJ A;  4OHW A;  3BQ0 A;  5HMW A;  3W7B A;  2DEJ A;  1UMJ A;  1XNQ J;  3HLU A;  5EX3 A;  5DO2 A;  1CBK A;  1MU2 B;  1R27 B;  2CVI A;  1LWE A;  4U96 A;  3D67 A;  4B9M A;  1H98 A;  2B5J B;  2W9C B;  2RDI A;  3RJM B;  3TW0 A;  3UD4 P;  3BGL A;  2B9X A;  2HMI A;  1SIW B;  4WKY A;  4C3M A;  3N79 A;  4DV7 F;  1NDL A;  4IG0 B;  2C3U A;  3NGU A;  4LR9 A;  1Y5N B;  1EJ7 L;  1RHR B;  3IS9 B;  2BRK A;  2VDI A;  4QZV B;  2ZOM A;  2AV5 A;  1RGV A;  3KK3 B;  2M0G B;  1I1G A;  1FHT A;  4YR2 A;  2JLE A;  4GKJ J;  4X4Q A;  6FDR A;  2R2R A;  5DET A;  1S5Z A;  1Q5Y A;  8AT1 B;  5CA5 A;  1VRU A;  4ZMM A;  3A3O B;  3EE3 A;  1S0O A;  3FNN A;  3OJU A;  5GAG I;  3T1H J;  2Q1L A;  3MEC A;  1NJY A;  3DDI A;  2E1C A;  1HNX F;  6AT1 B;  4WP9 A;  4ZHR B;  3PX0 A;  4DUZ F;  4OZ5 A;  4F02 A;  2ROP A;  4DF4 A;  1FJG J;  4ED0 A;  3GJQ B;  2AU0 A;  4C97 A;  3NNC A;  1C1B A;  4USK A;  2VOD A;  5KT2 A;  4OX9 J;  1MN9 A;  3CC4 S;  4ZN1 A;  1TL4 A;  3PM9 A;  1D0E A;  5CH7 B;  5C24 A;  3CCQ S;  5C7P A;  3C6T A;  2KM8 B;  2RRA A;  2XMU A;  5HP1 B;  5DG7 A;  2CWX A;  1BLU A;  1KR4 A;  3NEK A;  3NGS A;  3EMT A;  4ZJO A;  2VBZ A;  1XNQ F;  2CA9 A;  1CEZ A;  5KFN A;  2L08 A;  1CJK B;  3KUE A;  2KJW A;  1EIY B;  7FD1 A;  4ZVH A;  4DG1 B;  5F8I A;  2R7Q A;  4WTY A;  1T9X A;  2O01 C;  2NCK L;  2LU2 A;  1JLF A;  2QL9 B;  3L7P A;  4CI0 B;  2B8Q A;  2FC9 A;  4MH8 A;  3K2Y A;  2OPR B;  2XY7 A;  1U1L A;  1M0S A;  2LDY A;  2X1B A;  1C1C A;  2W8K A;  4I7F A;  1HBM B;  2RQM A;  4WYL A;  2IFX A;  3LOU A;  2J9C A;  4C2M A;  1RHM B;  2R7U A;  3JTO A;  2H4Y B;  1CC7 A;  1DLO A;  1T03 B;  3TAP A;  1VDH A;  1VQY A;  3QIP B;  4GKJ F;  4KE5 A;  2KYX A;  2QA1 A;  3E8O A;  1HNZ J;  5HMX A;  2CJA A;  1SB6 A;  1Y00 A;  4DUY J;  1SC4 B;  2MXY A;  1S0V A;  1X5P A;  4I2P A;  2ZZM A;  1FRM A;  5HVH A;  3T1H F;  4G1Q B;  3EPG A;  3PNI A;  2BMB A;  2WSE C;  1JWW A;  4U8Y A;  5D15 A;  1RWW B;  4FN5 A;  4QPT A;  4CNY A;  1FJG F;  1YBA A;  1CJT B;  4A8F A;  2ZJP Q;  1S6P B;  3ZZU A;  1KQF B;  1KFD A;  3VGU A;  3KLH B;  2ERR A;  4OX9 F;  2QYC A;  2FTR A;  1LXN A;  3J81 Y;  4USJ C;  4WPA A;  4MKV A;  4W92 B;  2GQQ A;  4M94 A;  3ZZY A;  1BE4 A;  2ZHB A;  1CUL B;  5F8H A;  4RW9 A;  3M8Q A;  3TAQ A;  3NLC A;  1E6Y B;  4K4T A;  3RB6 A;  2V2Z A;  1KDN A;  4HAC B;  1S1X B;  2CQ3 A;  3PHT A;  5KOW A;  2VDH A;  1CLF A;  4IQM A;  3CTR A;  1X4D A;  4I4B A;  5CQG A;  1TL7 B;  2F40 A;  2QO3 A;  2CNL B;  1IUJ A;  1K47 A;  3LGN A;  5I3P A;  5B08 A;  2V0N A;  1ZET A;  3KFW X;  2VFS A;  4YHH J;  3D28 A;  3NNH A;  1N5Y A;  4DFJ A;  2EXU A;  3M9M B;  3QRQ A;  5CHC B;  2ZWP A;  3Q89 A;  4GKK J;  2F3J A;  1FXL A;  2OTL S;  2GJF A;  4K0K J;  2E7V A;  3Q8U A;  4EMD A;  4P7V A;  4RBT A;  4CWB A;  3I4H X;  1HFE L;  4ZDN A;  2DNK A;  3SIP B;  4IOC Q;  3LF0 A;  2MKY A;  2RJZ A;  4LIW A;  4QIW D;  1VQN S;  5D3G A;  2XG8 A;  1HNZ F;  4RO0 A;  4CO0 A;  2UP1 A;  4DUY F;  1YTY A;  2VBY A;  5EN1 A;  1YQH A;  4GVB A;  2P5V A;  1FJC A;  3DYA B;  3UDV A;  1DQ8 A;  1U1N A;  1FNO A;  1PAU B;  2GJ2 A;  1FVQ A;  4I2Q A;  3ISZ A;  2UV8 A;  1U2C A;  4OYB A;  1VQ6 S;  2VQE J;  2ZUA A;  1ITP A;  4HH0 A;  3G8S A;  3VVT A;  3UW1 A;  3RB0 A;  4OFZ A;  2DIU A;  5LJ5 Y;  5B0C A;  2KZM A;  4CO1 A;  3OL7 A;  4J9U E;  2QZ8 A;  4NLO A;  1BGX T;  1O0P A;  1X4A A;  2QFJ A;  2W2M P;  1BXN A;  1ICE B;  1EET B;  2WVD A;  3J80 U;  4OQJ A;  1LW2 A;  1T11 A;  4NLD A;  1TKT A;  5HQ8 A;  3MXH P;  2DGT A;  3LO3 A;  2MY7 A;  3VAG A;  5GVQ A;  3CD7 A;  1HW9 A;  3HVT B;  1YRX A;  2W4C A;  4C8O A;  4TNO A;  2WVE A;  2GW8 A;  3Q2T C;  3AOB A;  5LSR A;  3W5X A;  1CQM A;  5HMY A;  1U1M A;  4YHH F;  3T5K A;  1FD2 A;  5D0R A;  4RNM A;  2CG4 A;  3UCG A;  4R25 A;  1NH7 A;  2JNJ A;  1RYR A;  2ZH5 A;  5LSO A;  3QSY B;  4CYU B;  3MEE A;  3SQG B;  1WEY A;  1NK0 A;  3L95 X;  2M5Y A;  4GKK F;  3B78 A;  2IM2 A;  2V94 A;  4K0K F;  2CNO B;  1Q8K A;  3MPD A;  1RHJ B;  3DNC A;  3M30 B;  5HAT A;  3IR6 B;  2XMT A;  2DNH A;  5MLC V;  3C14 B;  1YDL A;  1RT5 B;  2Q3P A;  4F3O A;  4WJB A;  4IO1 A;  3FCW A;  2ILZ A;  1VRQ C;  1FFW B;  4PAA A;  4AND A;  2FY8 A;  1NK4 A;  4TU8 A;  4DXL A;  3OL6 A;  2DTJ A;  4O0I A;  1VRT A;  4RW4 B;  3P6Y C;  3ZNU A;  4ZA1 A;  2BW7 A;  2VQE F;  5J2M B;  2R8G A;  3OTB A;  2HKE A;  1B70 B;  3RU0 A;  4N8O A;  1PKU A;  5E33 A;  1O51 A;  4MFB A;  3FSI A;  5J1E B;  3M8P B;  1SCJ B;  4O23 A;  4ID8 A;  3I5C A;  1Z1Z A;  4AD6 A;  4IG3 A;  1DQA A;  1Q79 A;  3DFE A;  3KUG A;  3CJ0 A;  3FFI B;  4F36 A;  3MF5 A;  3DLJ A;  2BZ2 A;  2EFQ A;  3C8Y A;  3ILO A;  3T9N A;  2L3M A;  4TU9 A;  4PKD B;  5ETL A;  5L1L A;  3L7O A;  2YKM B;  2M88 A;  2FJE B;  1HHQ A;  2HSE B;  2RQK A;  3KHR A;  3TYT A;  2HFS A;  4KPC A;  3SCL E;  4HL9 A;  3CW2 C;  1XR7 A;  2GML A;  4RNN A;  4PCQ A;  3QMQ A;  4OIX A;  3GR0 A;  2H65 B;  3MEK A;  2W9B B;  3QQC D;  4X4P A;  2CDQ A;  1HBU A;  3DLG A;  1IBM J;  1AUD A;  2DY1 A;  1Q81 T;  5IM0 A;  3C16 B;  3MMB A;  3R6G B;  1CS4 B;  4UST A;  1RTI B;  3DI6 B;  4DPO A;  2J5A A;  1OS5 A;  1MWY A;  3OUY B;  2HQG A;  2YXL A;  5A2Q Y;  4Y2A A;  5H9F K;  1VCT A;  2JZ5 A;  2DCL A;  2QN6 B;  5E41 A;  3NGD A;  4YFU A;  4A8W A;  2BQR A;  2QLJ B;  2XLI A;  1N33 J;  4LF1 A;  1KN6 A;  1RTH B;  2AZ1 A;  3J7Y U;  2B4O A;  1EQ0 A;  3THT A;  2HFN A;  2VG6 B;  1X5S A;  4LF7 J;  2HIQ A;  2VV5 A;  2FHK A;  2IAJ B;  2LYV A;  3DRR A;  4FPR A;  1JK9 B;  1C0T A;  2C28 A;  1PC4 A;  2Z2Y B;  1Q8L A;  4L73 A;  5E3Q A;  3MWB A;  3I9V 9;  3LAL A;  3PW7 A;  2NSC A;  3A3P B;  1LWE B;  4TYB A;  3RRK A;  2R7S A;  3CE8 A;  2OEK A;  2GO8 A;  3NCP A;  2PI4 A;  2HMI B;  1OSC A;  1IVZ A;  7AT1 B;  2H51 B;  3R5A A;  1BMQ B;  5B7W A;  2WTF A;  3PAC A;  1RWV B;  4MKA A;  2KG0 A;  4F8R A;  2XHC A;  1CC8 A;  4P7T A;  5EWF A;  2AD9 A;  5AT1 B;  1XN9 A;  3G71 S;  3KMQ A;  1RAB B;  1S48 A;  3WX8 A;  2B43 A;  1B0T A;  3R6L B;  3KG4 A;  7FDR A;  2GHW A;  2ASY A;  3NNA A;  2ZOG A;  2DB1 A;  3S01 A;  1P27 B;  2K3I A;  3VVU A;  1IBM F;  4ZIT A;  1W2B R;  2ZH9 A;  3E51 A;  1VRU B;  1PAE X;  3KLV A;  1T0T V;  4C9D A;  1A0O B;  1CJU A;  2ZE2 A;  2ZDP A;  4FP9 A;  1TEL A;  3MEC B;  2WHO A;  3OFH A;  3ILJ A;  3PYG A;  4DR4 J;  3GMG A;  5G4D A;  1NKE A;  3ZZT A;  3V6H A;  2AEM A;  1C1B B;  2AJQ A;  2ACM A;  3KHG A;  1N33 F;  1H0H B;  3BQ2 A;  3VAH A;  2V8H A;  1CSJ A;  2NUU G;  2HS4 A;  2XEX A;  3RYL A;  1GQE A;  2A0F B;  5C24 B;  4M5H A;  1Q82 T;  1IR0 A;  4EZ6 A;  4LF7 F;  3C6T B;  3Q83 A;  2B51 A;  1TL5 A;  2MB0 B;  2E5H A;  3BJY A;  1ZM3 A;  3CXC R;  1QAY A;  4K8R A;  1R31 A;  1IQZ A;  3VAK A;  1VI7 A;  2YPY A;  2Z58 B;  3D54 A;  2LA6 A;  2AYG A;  4ATN A;  2DVI A;  1WDD A;  1WTF A;  4NYZ A;  4U7U D;  5LT5 A;  2VKR A;  3MEG A;  2RD5 C;  5DDQ C;  2ZH2 A;  3K89 A;  5J1N A;  1VLO A;  3BN4 A;  5CYJ A;  3S8S A;  3Q2S C;  3V81 A;  2XNQ A;  3PIP Q;  1UL3 A;  1JLF B;  3PVX A;  1JKH A;  1NZ8 A;  2KHD A;  1OY6 A;  4TLQ A;  1K1Q A;  4CO2 A;  2AHO B;  1H2T Z;  1SC6 A;  1C1C B;  2XY6 A;  1OY8 A;  4ER8 A;  2ADB A;  1HYS A;  2R8K A;  1H2U X;  5EX0 A;  1DLO B;  2Z30 B;  3BH6 B;  2D41 A;  4DCO B;  1Q7Y T;  3PW0 A;  3LPE A;  2R8I A;  4FF3 A;  2QMW A;  3HD2 A;  1AUS L;  4OX8 A;  3UI3 A;  1UTA A;  1F2G A;  4N5S A;  1RDR A;  3IBC B;  4WF9 Q;  2DHS A;  1X8D A;  4I2P B;  2QA4 G;  2FQQ B;  2K06 A;  1OMS A;  3C2P A;  4X4V A;  3N9U C;  5D0H A;  5MAO A;  2R2U A;  3Q86 A;  2ATC B;  4Y2C A;  5LXY A;  2CPH A;  1LW0 A;  1GH8 A;  1M5P C;  4DR4 F;  4H4O A;  4JBC A;  2XTJ P;  2E1A A;  1D9D A;  1APS A;  4K5S A;  1R7I A;  3VHQ A;  2Q6B A;  2IDE A;  4YR3 A;  1RI7 A;  2YH1 A;  4J9K A;  4ZPB A;  4UZC A;  2ZH8 A;  3W9H A;  1FRX A;  4B3S J;  4RW9 B;  3M8Q B;  4KV8 A;  1RQ0 A;  2IRX A;  1JLC A;  1OO0 B;  3R5D A;  1RBA A;  3CME S;  3BYR A;  2HIY A;  1M1H A;  4HVZ A;  2FVR A;  1RTZ A;  4YUD A;  5KFU A;  4OZ0 A;  2BKP A;  8RUC A;  3W9I A;  5C25 A;  2LEB A;  2DGW A;  1N0U A;  1N5Y B;  1RCO B;  3EGN A;  5C42 B;  5A6W A;  4GC6 A;  3N0V A;  3SSQ A;  2YKO A;  4CT8 A;  3ZZO A;  2PMW A;  3GIL A;  2OEJ A;  3SQO P;  1IWA A;  3OTE A;  5CZX A;  3QJP A;  2AMC B;  3Q23 A;  4Z7Y A;  2HHP A;  1Q16 B;  5D3G B;  4JV1 A;  5CCL A;  4WII A;  2FIU A;  1GMW A;  4HT5 A;  3NWG A;  3FGV A;  2Z2Z A;  4EYH B;  1VBY A;  4BC9 A;  2QRR A;  3S7R A;  3SDE B;  1S7I A;  2B4V A;  1SXL A;  4X62 J;  4Z7C A;  3R9L A;  1VYA A;  4TQS A;  2CZ9 A;  1JJ4 A;  3MCO A;  1J27 A;  4NA2 A;  1AW0 A;  3G6E S;  5L38 A;  3MMC A;  2AIR B;  2MMY A;  3HK2 A;  2P6T A;  2H3E B;  1XR6 A;  2M70 A;  2BOA A;  1MNE A;  4P74 A;  3W65 A;  5I4M A;  2OFG X;  1UFL A;  2QMU B;  5F8N A;  2Q66 A;  1LW2 B;  4B3S F;  3FBC A;  4UQG A;  2MKI A;  4V19 X;  1WKK A;  2ZDO A;  4KHM A;  3KLG A;  3BKT A;  1J2V A;  2PA8 D;  2FB0 A;  3WC0 A;  3BS9 A;  1WKJ A;  4HT7 A;  1TK0 A;  4X4T A;  3NAI A;  2KKH A;  3Q8Q B;  3I96 A;  2VUG A;  4LF8 J;  1T94 A;  1REV A;  1MLA A;  1X4B A;  3GSD A;  3TQE A;  3BBB A;  4TXS A;  1HLW A;  2I38 A;  4B9V A;  2AF6 A;  2OSR A;  3DRX A;  4OI3 A;  4FNI A;  3MEE B;  1WDT A;  2CXE A;  4OX6 A;  3PO4 A;  1H74 A;  4HTJ A;  4ZVE A;  3T1Y J;  2JEJ A;  4QIV A;  4P72 A;  3IMQ J;  5EUH A;  3K5O A;  2IYG A;  3Q8P B;  3I6P A;  4BDP A;  4BS2 A;  4KJI A;  4V19 J;  3A12 A;  4B9N A;  2YQ0 A;  4X64 J;  3KYL A;  2HRT A;  3H8Y A;  3LP2 A;  2GQ2 A;  3IGN A;  3O5T B;  3UR3 C;  2XWY A;  1FDA A;  4URG A;  3X3U A;  3FK4 A;  1HW8 A;  1AB8 A;  3IAS 9;  2VOP A;  4BC7 A;  4M5I A;  5D78 A;  4ED7 A;  4OYW A;  1KVJ A;  5KG1 A;  4X62 F;  4JI5 J;  1JJH A;  3CIZ A;  1VRT B;  3J81 j;  1TV6 A;  4C0B A;  1S9E A;  4H4M A;  4U8V A;  4ZOS A;  3TOQ A;  1HIY A;  4YQW A;  4I56 A;  3NGR A;  4MAK A;  1EKR A;  1N8R T;  1EAY C;  4ZJL A;  2WW4 A;  5DQG A;  2IBK A;  1QAX A;  1WHV A;  3T6J A;  4ED2 A;  2MQ8 A;  5IT9 Y;  4NLY A;  3I87 A;  2X7I A;  4IG3 B;  2VC0 A;  3P8B B;  3E2E A;  3P49 B;  2MJN A;  1PJ6 A;  2J6U A;  2JX2 A;  1WUU A;  2D7S A;  2CJB A;  4DL3 A;  4RBV A;  1UWB A;  3T3F A;  4IOA Q;  2W24 A;  1AA1 B;  4RW6 A;  1DZ5 A;  5EDW A;  5B0E A;  1ZTT A;  1KLM B;  1XEZ A;  4TLR A;  2C1E B;  4DPW A;  1GTH A;  4XAK A;  4LF8 F;  4LRD A;  1VHF A;  3LTO A;  2CPY A;  5KFQ A;  4DPY A;  3EGZ A;  2FGC A;  1D3W A;  4IQX A;  5LL6 d;  3AOD A;  4ECU A;  2MEW A;  4LR7 A;  1NO8 A;  1OWX A;  2ZVI A;  1HBU B;  3DLG B;  5IM0 B;  1ZS6 A;  3D68 A;  3MM9 A;  3MMB B;  4H4K A;  3T1Y F;  4JI8 J;  3D3B J;  1S1U B;  2DNY A;  5F8G A;  3IRW P;  2DNO A;  1SUQ A;  3FSY A;  1TL1 A;  1FXD A;  4F3M A;  1S1W A;  3I0R A;  3A8J A;  2HZA A;  4PG5 A;  4X64 F;  3LAM A;  5DM6 Q;  4ZVQ B;  3HZG A;  4YY3 J;  2B0G A;  2BE9 B;  4DX8 H;  3QJL A;  4ZJQ A;  1Y3K A;  4ECW A;  3R1L A;  3D4J A;  3TRG A;  3UN3 A;  4B3M J;  3RRG A;  3SZ2 A;  4ITS A;  2ZHA A;  5HJY A;  2RS2 A;  3BKF A;  5K8N A;  4A8M P;  3BSA A;  2MZR A;  2GX8 A;  3A4T A;  4PWW A;  1QVF R;  4JI5 F;  3DRR B;  1I6J A;  3K57 A;  2R7V A;  1C0T B;  1IBK J;  2MYF A;  4O0N A;  1MRO A;  1RBL A;  4G1I A;  3QID A;  2I9S A;  3ICL A;  2XS5 A;  5BJR A;  2RNE A;  5KOX A;  2VON A;  4NCG A;  1TL3 A;  2UVV A;  1KVK A;  4DL0 C;  1OSD A;  1T9Y A;  2JRS A;  2FHJ A;  4I68 A;  2QA2 A;  2DH9 A;  1RSC A;  4E0D A;  3UFC X;  4DI6 A;  3I5A A;  1HPZ A;  3IG1 A;  4UOH A;  5D8H B;  3VAI A;  3K58 A;  2HHW A;  2R42 A;  4EU0 A;  2PEB A;  4AYB D;  1B0P A;  4K7Q A;  1QY7 A;  1UVJ A;  4JV5 J;  4KT0 C;  2LP4 A;  3QT5 A;  4UZB A;  3OHA A;  2E5L J;  1IBL J;  5D4L A;  2YWH A;  5AE2 A;  1C2P A;  4J9M A;  3PIO Q;  4MYU A;  2HPU A;  2CJQ A;  4O3O A;  4RU9 A;  1UJ4 A;  3MCM A;  2LMI A;  4N77 A;  1RZM A;  1TU0 B;  4JI8 F;  1KTQ A;  2YWK A;  3SSR A;  2HRU A;  1CJU B;  1EZZ B;  2ZE2 B;  3QLH A;  1XJW B;  2OI2 A;  3W63 A;  1FNX H;  1KHV A;  5KTQ A;  4YY3 F;  1RWP B;  3BGF A;  2AQ4 A;  4WFX A;  2IC3 A;  1QAJ A;  1VR6 A;  2W25 A;  1GFW B;  2OPQ A;  2ZD1 A;  4B3M F;  2FVP A;  1DAX A;  3JSM A;  5IV4 A;  4IRD A;  4OI2 A;  1JXL A;  2AJ2 A;  3VAM A;  1C4A A;  3BSO A;  1QM9 A;  4PG4 A;  4UY8 T;  1BQM A;  4O44 A;  2KYZ A;  3QWP A;  2HNZ A;  1IBK F;  4HTI A;  3JTN A;  1OYE A;  3NGT A;  4MK8 A;  3MCS A;  5ITH A;  4NA3 A;  1SH0 A;  3VAF A;  1N56 A;  1Q8I A;  1PJ7 A;  4DQP A;  2HFU A;  4AUK A;  2L9N A;  2DR6 A;  2FZC B;  3IC1 A;  1DTT A;  3MEG B;  4OZ2 A;  3AB4 B;  2M9K A;  2YPZ A;  4C0H A;  3V81 B;  3M2V A;  3B4M A;  3K5M A;  4G6V B;  3MMJ A;  2R2T A;  3PYE A;  1ROF A;  3TZX A;  1JKH B;  2HEK A;  3N5B A;  1HA1 A;  3Q0A A;  4IUF A;  4JV5 F;  1V3Z A;  3D6F B;  3TVY A;  3T6B A;  1HYS B;  2C2K B;  2E5L F;  5I42 A;  3KLE B;  1B7Y B;  4HEA 9;  1IBL F;  1SH3 A;  5LSL A;  2JC0 A;  3CJK A;  1RT3 B;  1YBU A;  2EKN A;  4USH A;  2UUW A;  1QE1 A;  3HX9 A;  2PDA A;  3OXL A;  4I69 A;  5AXM A;  3LAK A;  5GAE U;  4N41 A;  3CF5 Q;  1VJW A;  3PYD A;  4DPX A;  2MY8 A;  3K5P A;  3MUT P;  2ZZT A;  3W8P A;  1LW0 B;  3MM8 A;  2D9O A;  3GWC A;  2K1R A;  3DLL Q;  4H4O B;  1FWP A;  2RS8 A;  3D7S B;  5GAE I;  3EDR B;  4OJ3 A;  3HF5 A;  2HHQ A;  1S9G A;  4Q45 A;  4KGK A;  3EM1 A;  2NYH A;  4BCA A;  3VR1 A;  3HHN B;  2QG9 B;  2AZ3 A;  4KQZ A;  2NQP A;  1EHW A;  1UVI A;  3TWZ A;  3NS7 B;  4KV8 B;  3MOZ A;  3AFG A;  1JLC B;  1OQ3 A;  1E6V B;  4QW9 A;  2KG1 A;  3ADA C;  1UAW A;  1P9Y A;  4LF9 J;  2HYI B;  1GXL A;  4MKY A;  2JEF A;  4QJV A;  1QD1 A;  3CCS S;  4XO0 A;  2J8S A;  4WK3 A;  4JOU A;  5C25 B;  1HNI A;  4GC7 A;  3MR7 A;  3V6K A;  4P2F A;  1FWL A;  2PE8 A;  3R2C J;  1WHY A;  2YTC A;  3HJF A;  4DR2 J;  3MFH A;  2IM1 A;  1CVJ A;  2BYC A;  5HVG A;  5LM7 E;  4U67 Q;  4M5L A;  3MR2 A;  1LWF A;  4C48 A;  5KFK A;  1WOP A;  5IT4 A;  3KTQ A;  2C2M B;  3OBI A;  5FDL A;  3QT8 A;  3FCH A;  1F9H A;  2EPI A;  1FKP A;  4C8N A;  3VZH A;  3MAH A;  2VHG A;  1R8P A;  1HWK A;  1FI4 A;  4DWI A;  1VBK A;  2V2V A;  2BKN A;  1JLE A;  2KDO A;  4J9N A;  2XBP A;  4M5J A;  1S99 A;  2C22 A;  1YJR A;  3LP1 A;  2R7X A;  2WB1 D;  2PMH A;  5H9F J;  1URN A;  3W66 A;  5FII A;  4Q5V A;  2MKK A;  2P9G A;  2Z57 B;  1KFS A;  2RU9 A;  3CJ2 A;  4L3N A;  2ZUG A;  1UFW A;  2VIH A;  5KFX A;  3LAN A;  2FGO A;  3MMC B;  5E2Q A;  4RUB A;  1U26 A;  2JWN A;  4EFA C;  2HAI A;  4L76 A;  4QWD A;  3KLI A;  4UOG A;  2V4Q A;  3OFG A;  1S7H A;  2A3J A;  1S12 A;  5KG7 A;  1WI6 A;  2DR5 A;  2XC9 A;  3BQ1 A;  4WZQ A;  2HLT A;  4PYA A;  3KLG B;  1QSS A;  2NXU A;  3FSX A;  1RBO B;  2M4M A;  1P1L A;  3QBC A;  1HBN B;  2DCU B;  4LF9 F;  1NJI T;  3UR0 A;  4NLV A;  3W64 A;  4OX7 A;  1S1V A;  4OYO A;  2NR0 A;  1REV B;  2QSW A;  2ZJQ Q;  3MCN A;  4PQU A;  2FZG B;  5LXR A;  4DR2 F;  2QT7 A;  4TQR A;  5B0B A;  2MPU A;  2YNG A;  3GIM A;  4DX7 A;  3GYG A;  1NPP A;  1VC5 A;  1QDU B;  1U02 A;  1VQ5 S;  4ICL A;  2Y1R I;  2IRU A;  3SFG A;  5SUH A;  1IKY A;  3FMW A;  3JAM Y;  2WBR A;  4K4Y A;  2A6M A;  4KHP J;  3LP2 B;  5L1J A;  4ZP6 A;  1CPZ A;  3HKZ D;  3SSS A;  2GHV C;  5DQH A;  2RRN A;  3FEZ A;  1VHI A;  3DHX A;  1FXR A;  1R43 A;  4M5K A;  4WFA Q;  2CPF A;  3A3N B;  6FD1 A;  2XO6 A;  2C2Z B;  2V67 A;  3VGT A;  4QR1 A;  1TV6 B;  3QGI A;  1S9E B;  1FDB A;  2F1F A;  4H4M B;  5DS7 A;  4ECS A;  3CCZ A;  2YWF A;  2CQD A;  4PPD A;  3BEG B;  1JJ2 R;  2ZFH A;  2GNK A;  2XGP A;  4UQT A;  4WXO A;  2HVI A;  3KWM A;  4NPO A;  1XC9 A;  3I9Z A;  1YJN S;  4LIR A;  3AQP A;  3GSI A;  1DRZ A;  4JV0 A;  3PX4 A;  1CQN A;  1UWB B;  4F4W A;  4RW6 B;  1WG1 A;  2XS7 A;  1RTJ A;  3ZTP A;  1VQ4 S;  1NDP A;  1RAI B;  1XMB A;  1RAE B;  3CCM S;  4NZ6 A;  3V5R A;  1OQ6 A;  2R8H A;  1HL6 A;  5GAH U;  4RL1 A;  1U8S A;  1S6Q A;  3R1H A;  4DS5 A;  1SH2 A;  2BAN A;  3VQS A;  4DL4 A;  4BWM A;  2DRD A;  3WZ0 A;  2B7C B;  2X3D A;  5M2U A;  4EO8 A;  4AL6 A;  1QUV A;  3DCA A;  1SV5 A;  2D1C A;  1HAR A;  3BZQ A;  3CCV S;  4ZK7 M;  2A1B A;  1FER A;  5KFA A;  1F9E B;  1WC3 A;  3GII A;  1TL1 B;  1S1W B;  3I0R B;  1YJU A;  5KFH A;  4ZIW A;  3AQO A;  4WXW A;  2RT3 A;  2V4R A;  2R8J A;  3IWX A;  4KHP F;  3AD7 C;  1NDC A;  3N6N A;  2DNN A;  1S9F A;  2VG5 B;  2J7K A;  5IFM A;  3P3D A;  2NXJ A;  2M8H A;  3B4D A;  1Q8B A;  2IIH A;  4UY8 5;  1LV5 A;  4K4Z A;  2FVQ A;  4OHV A;  1VQ7 S;  4OZJ A;  2J9E A;  4IKA A;  2BA9 A;  2N7Y A;  1HI0 P;  4NCG B;  2ACY A;  1TL3 B;  4JI6 J;  2ZKU A;  3ULH A;  3UO0 A;  3CMA S;  3DKD A;  3GV8 B;  4Q0B A;  1GXU A;  1FE0 A;  3MD3 A;  3G4S S;  1HPZ B;  3TEH B;  5HI7 A;  5EWG A;  3IG1 B;  4FF2 A;  4C3K A;  2VD3 A;  4Q44 A;  2E9T A;  4M5D A;  4Y00 A;  2JVR A;  4C8Z A;  4DSI A;  3BBF A;  5DDR C;  1XMQ J;  4HDG A;  4X4U A;  4BHQ A;  4DV5 J;  4WP8 A;  2XQC A;  1WNE A;  1BQN A;  2DT9 A;  4I6A A;  2BQ3 A;  3D0I E;  2NXE A;  1B3T A;  1YZ6 A;  1WI8 A;  4UTG A;  1S97 A;  2YWW A;  2QL7 B;  3IWL A;  5HL7 Q;  2W01 A;  1TUV A;  4PUO B;  4RWX A;  2R2S A;  4J90 A;  5F8M A;  4FNH A;  1SVD A;  1FES A;  1HHS A;  2FLP A;  4P75 A;  3D6T B;  4USM A;  4NLQ A;  3QLH B;  4YB7 A;  4JI2 J;  2O67 A;  1IM4 A;  2IC3 B;  4NRU A;  1NSP A;  2IPO B;  2JSX A;  4M5N A;  3OFE A;  3BM7 A;  2OHD A;  2OPQ B;  4K4W A;  2ZD1 B;  4NZ0 A;  1UP1 A;  4PG7 A;  5FD1 A;  3JSM B;  1MWZ A;  2DGO A;  2KTQ A;  1R6V A;  3EZ5 A;  3U02 A;  4DR1 J;  3J7A 1;  1J5O A;  1JLQ A;  4DV3 J;  1U2R A;  4Y0F A;  1BQM B;  4O44 B;  4G3I A;  2KZZ A;  4OL8 A;  3BO4 A;  4FYX B;  1S57 A;  1FRJ A;  2GVD A;  3HHD A;  4DPU A;  2NPI A;  3LH2 S;  4JI6 F;  1K44 A;  1DTT B;  1F2H A;  4LT6 A;  5ETV A;  3H2U B;  3RRH A;  2CJK A;  2IA6 A;  2Z4P A;  4L6V 3;  3EGW B;  3TAM A;  2XGQ A;  3D1H A;  1V6H A;  2V8D A;  4F3Q A;  2DGU A;  1U1P A;  4ED3 A;  2XMW A;  2D9P A;  3HUL A;  4IH7 A;  4BBY A;  3H20 A;  1XMQ F;  5DGA A;  1KON A;  5J2N A;  2NPF A;  2UXB J;  3V2U C;  2EI5 A;  1FFS B;  2UUC J;  1MW7 A;  2ATL A;  4DV5 F;  4CIO A;  1ZYQ A;  5I42 B;  4F2S A;  1FKO A;  2NUH A;  3KK1 A;  4DDF A;  5KG5 A;  3GJR B;  1QAI A;  3CJK B;  5JVG Q;  2XB2 D;  4CLW A;  3IA0 A;  4O3S A;  5DG9 A;  3H98 A;  1QTN B;  3D9B A;  4M1K A;  1T8E A;  5IXU A;  4CRJ A;  1TFY A;  4AQY J;  5DGB A;  1N5Q A;  1PCA A;  1EX8 A;  1FO1 A;  4JI2 F;  1RWU A;  2MKC A;  1Y11 A;  3QGP A;  4X66 J;  3BH7 B;  3MMA A;  4K59 A;  1C4C A;  4DSK A;  2K1R B;  1PC5 A;  1NPK A;  1UPP A;  4ECY A;  2HND A;  3PHE A;  1S9G B;  4Y6I A;  4O4G A;  1LEO A;  4DX6 A;  5KG6 A;  1RP5 A;  3W5Y A;  4DR1 F;  3FDS A;  3M6U A;  3C19 A;  2Z56 B;  4L75 A;  4DV3 F;  4J9O A;  2JC1 A;  4WFB Q;  2D3Z A;  4EEY A;  5K8O A;  4K50 A;  2DO4 A;  1NKB A;  3Q8S B;  3FZ2 A;  4JYA J;  4OJG A;  3GFX A;  4A8Q A;  4ES3 A;  2OD4 A;  1TK8 A;  4Q7A A;  1HNI B;  1U6B A;  1KSP A;  4HKQ A;  1NLK L;  2QMX A;  3M8W A;  1YRT A;  1RT6 A;  2CAJ A;  3N4W A;  4AFF A;  2C3P A;  5CYQ A;  4O3R A;  1LWF B;  4ES2 A;  4LF5 J;  2XO7 A;  4CLZ A;  3E01 A;  4I67 A;  2V63 A;  2UXB F;  4LRF A;  3NOG A;  5FDL B;  2UUC F;  1SI9 A;  2U1A A;  2PN6 A;  2O66 A;  1S77 D;  4MYT A;  1TK5 A;  3K5L A;  1YJ7 A;  1FKP B;  3ISN C;  1X9S A;  4MIB A;  1T3N A;  2IHR 1;  1VLY A;  3R97 A;  4J9Q A;  3CCW A;  1JLE B;  4CLU A;  2CUY A;  4ETZ A;  1QSY A;  3FRZ A;  1T02 A;  1WEX A;  1U0S A;  3LP1 B;  3V4M A;  2ZBR A;  3TUI C;  4AQY F;  1S4E A;  2ASD A;  1SIZ A;  1FJE B;  3PG9 A;  5FLX Y;  3OVA A;  4ZVO B;  1VBX A;  2XMK A;  4EZ9 A;  1SJQ A;  4X66 F;  4TY9 A;  2HWI A;  2R9L A;  3NMA A;  2LQJ A;  2MHE A;  1AXQ A;  4GVL A;  2HVD A;  3R7N B;  2RKI A;  2HAF A;  2DGQ A;  1PG5 B;  2L41 A;  1VQM S;  2XHW A;  2QC3 A;  2DJW A;  2Y0S D;  1Q7L B;  1YWX A;  2XZD B;  2MLX A;  3AOC A;  1YJ9 S;  3F41 A;  3OFF A;  4NLR A;  2OD6 A;  4JI0 J;  4KIA A;  4X65 J;  4JYA F;  4QBU A;  2EG1 A;  1VK3 A;  1S1V B;  4XDD A;  2GZO A;  1SJ1 A;  2ADC A;  3IRX A;  4PQU B;  4FXW A;  2X3G A;  2YNG B;  5E3C A;  4LF5 F;  3H5Y A;  5KG3 A;  3N5F A;  3OSP A;  2OPP A;  1D8Z A;  4DCJ B;  2RIJ A;  4ICL B;  3RTV A;  4WFZ A;  1IKY B;  3JYT A;  4A8K A;  5GAG U;  4M5M A;  3HT3 A;  3D1Q A;  5CAA A;  2MTL A;  1S0M A;  3MPY A;  1JMT A;  4ZVG A;  5BXI A;  5IC4 B;  3DN9 A;  3OL8 A;  3CD5 A;  2B4P A;  5KFT A;  5U47 A;  2GAG C;  4K2J A;  2RRB A;  1NEE A;  4F2R A;  2XLJ A;  5KFZ A;  3GIR A;  2B9W A;  3X1L B;  1TKD A;  4A8S A;  2LEC A;  1FRH A;  3THP A;  1HQU A;  1BWV A;  4ZP8 A;  3DLB A;  3I31 A;  3IP0 A;  1JQG A;  3SFU A;  5CD4 A;  3IBF B;  1ZM4 A;  1NKC A;  1BHN A;  3FBB A;  2D3U A;  3JQM A;  2UVU A;  4WFY A;  2HQI A;  2MLY A;  2HZV A;  3L3C A;  1UWA A;  2EG2 A;  1RWN B;  2MSS A;  2Q6C A;  4LBH A;  3HSD A;  2E1R A;  2AX0 A;  1IWG A;  1RTJ B;  3G8Q A;  2G0I A;  1Y10 A;  1L3T A;  2OPS A;  3THV A;  4JI0 F;  3BR9 A;  5T14 A;  4DV6 J;  2HGM A;  4IOB A;  4X65 F;  1R8C A;  4LSL A;  4U6P A;  4ZCM A;  3AY0 A;  5KFR A;  4C6A A;  2BAN B;  3G86 A;  1F0X A;  1AFJ A;  2XNR A;  3MD1 A;  2NXN A;  3ET6 A;  2KXF A;  2GMH A;  1SV5 B;  3VV2 B;  1MMD A;  1G7C B;  2BJE A;  3TO8 A;  4WZM A;  2DO0 A;  1WOO A;  3MM5 A;  1TUG B;  2PD1 A;  4IR9 A;  2PMZ D;  1WAC A;  1MG7 A;  2XMV A;  2EC2 A;  1IKX A;  5L1K A;  2ZBC A;  2GVZ A;  4LQ9 A;  3MTK A;  2UUT A;  3GB0 A;  4HR2 A;  1P6T A;  4G65 A;  5EHH A;  1FD8 A;  3RB4 A;  4WIQ A;  2Z0G A;  1Q4R A;  5A8K A;  4USW A;  2CVE A;  1WC6 A;  1WOR A;  2KT5 A;  4QYR A;  4B17 A;  3SCK E;  2VAS A;  4LRC A;  3KDO A;  1N36 J;  4XIU A;  3DDN A;  4QWA A;  1UEV A;  2HGN A;  4PXD A;  4Q0B B;  5HMZ A;  3W2W B;  3HD1 A;  3PV8 A;  3NCQ A;  2O3D A;  2XM3 A;  2C3M A;  2DHX A;  4M5D B;  3DRP A;  4LVO P;  1KTV A;  3M9O B;  2CPD A;  3FC9 A;  4QPX A;  2CYY A;  1KRP A;  4F4K A;  2F8E X;  4QR0 A;  1YHQ S;  4DV6 F;  2XMM A;  3HFV A;  2E1P A;  2A10 A;  4DU8 A;  2OUG A;  4N47 A;  2BOP A;  1BQN B;  4WE1 A;  2W9C A;  1X0P A;  1AFI A;  1RT1 A;  4ILR A;  4FPI A;  3PKM A;  2LQ8 A;  1NCL A;  2C2O B;  4FYW B;  3MUR P;  1RU1 A;  4AXJ A;  4PZV A;  3CD0 A;  5ETM A;  2ZBI A;  1GNK A;  5T7L A;  1UA0 A;  3KHH A;  3A8I A;  3WIU A;  1D09 B;  2VJV A;  3Q22 A;  3P5B P;  3TEG A;  4OYI A;  4U7U K;  1U09 A;  4DCP B;  2KHC A;  2LA4 A;  1WKL A;  5C2C A;  3E3X A;  3MAA A;  1RAD B;  4O3P A;  1O8B A;  1RA7 A;  1Q1K A;  4CNZ A;  1IJF B;  3RW7 A;  3QAT A;  4ELV A;  4IR1 A;  2RAQ A;  2MQM A;  2ALY B;  3ONQ A;  1IKV A;  1F1B B;  2MDA A;  1RAA B;  4RNH A;  1SC1 B;  4LJM A;  4OYZ A;  5K5M A;  2VBW A;  3R7S B;  1Y3J A;  1YVF A;  2DNG A;  2CJ9 A;  1XWL A;  3NP5 A;  3CJQ A;  3WBZ A;  1JLQ B;  2K8G A;  3V6D A;  4WKR A;  2CDR B;  3CDB A;  3RAX A;  1FCA A;  2VL1 A;  5KT5 A;  1V5V A;  2HHS A;  3M32 A;  3SBM A;  4RU2 A;  1KC8 T;  2KXN B;  4NRT A;  3WQP A;  2MQP A;  4R0E A;  2GVD B;  2VJU A;  1N36 F;  2C2R A;  1H2V Z;  4YEA A;  3QYY A;  3EWG A;  4NMX A;  4CLP A;  2PSZ A;  3SCI E;  2H9Z A;  3HCX A;  4AXI A;  3TAM B;  2CRL A;  5FJ4 A;  1GX6 A;  1TVR A;  4L74 A;  5LMN J;  4Q8E A;  3LUY A;  5J2N B;  1RJJ A;  4C4W A;  5JUM A;  4EBD A;  2VB6 A;  3VAL A;  2XCP A;  4CLF A;  3AOA A;  3KK1 B;  2W2O P;  1Q5V A;  2HZC A;  3W2V A;  2N3O A;  1YGY A;  3AD9 C;  3OLB A;  4Y28 C;  1FRL A;  3EUN A;  4ZLP A;  2IVM A;  5K20 B;  2KN4 A;  1BWE A;  4GMK A;  2V34 A;  2HHT A;  4YN3 B;  5IV3 A;  2J76 E;  2DIV A;  5RUB A;  3SEO A;  1KWM A;  1HMV A;  2WK4 A;  2DIT A;  2HW3 A;  3TR5 A;  2J0S D;  3BF4 A;  2YNF A;  2DNQ A;  3BB5 A;  5I3U A;  4QU7 A;  1TKZ A;  4EK2 A;  3NS6 A;  2IYI A;  1WF1 A;  1VQO S;  3IBW A;  2B3T B;  2BXJ A;  3MMA B;  5KAK A;  2Y1I A;  3MUM P;  1NBE B;  1W2I A;  2V8V A;  1SKR A;  5KG4 A;  2YQ1 A;  4DR3 J;  3K8W A;  2HND B;  3HZE A;  3JQJ A;  1VFJ A;  4NAS A;  2H1Y A;  4Q8F A;  5F0U A;  4O4G B;  3JQK A;  1NB2 A;  3NRB A;  2MQQ A;  3ELH A;  1JNZ B;  4XK8 C;  3LWM A;  5KT4 A;  2PC6 A;  1N34 J;  1S4F A;  3PO5 A;  2AJF E;  2KT2 A;  2L9W A;  4PWU A;  3OTC A;  3Q8Y A;  1L5U A;  3PFE A;  2YKQ A;  2DHH A;  1X5O A;  1T9W A;  1RT6 B;  1G4C A;  4NLU A;  5LMN F;  3US5 A;  4F4Z A;  4ZVU B;  3MZI A;  4O4R A;  4KHR A;  3EVM A;  1M5O C;  5H9E K;  1X7V A;  5KFS A;  4B3O A;  2Z8Q A;  2V9W A;  4PR6 A;  4RLE A;  1WG5 A;  1V5I B;  4PG8 A;  1VQL S;  3EVO A;  4I6Y A;  1DTQ A;  3OSN A;  2RDD A;  1SC3 B;  2LEP A;  4EO6 A;  4C98 A;  4IO9 Q;  3LGM A;  1UCN A;  2RE1 A;  3J80 Y;  4FVC A;  4FDF A;  3TAN A;  1UW9 A;  3GTY X;  4ELU A;  4C8Y A;  4CH1 A;  2EBE A;  2QLW A;  3ENW A;  5KFG A;  3MM7 A;  4HHU A;  4DBQ A;  3HT0 A;  2W7A A;  2G1D A;  2EWH A;  3AXK A;  3CT9 A;  1CJV A;  2MJU A;  1YJV A;  4MT1 A;  1A9N B;  5HAN A;  3HVW A;  4ZPC A;  2KJV A;  4DR3 F;  3HHE A;  2FY1 A;  2BVZ A;  2RKI B;  3CD6 S;  4OJ1 A;  3FUY A;  1NSA A;  1LQ9 A;  2F8M A;  3HHL A;  1FFG B;  2IY5 B;  3AAW B;  1NHU A;  4K4V A;  1MSW D;  4F25 A;  2W1B A;  3A1Y G;  1M5K C;  5HAO A;  3KJF B;  1VBZ A;  1N34 F;  4XPC A;  5F8L A;  1TTH B;  4B3R J;  3L9Z A;  3U1N A;  3FBE A;  1NK9 A;  3ETO A;  3CPW R;  2UXD J;  4CM0 A;  1B64 A;  4LRB A;  4IH6 A;  2N4D A;  1WWH A;  4IYQ A;  2DNZ A;  4RW8 A;  1RHK B;  3JTP A;  1FX4 A;  2CQ4 A;  1GT8 A;  3TI0 A;  4DOZ A;  2G13 A;  4ZKA A;  3C6U A;  3ZZ0 A;  2ZC3 A;  3RG6 A;  2OPP B;  1SQF A;  2EFV A;  1VOM A;  3VGS A;  4IH5 A;  4Z37 A;  1CG2 A;  4K4S A;  1HD0 A;  3JYT B;  3P96 A;  1NXI A;  2OKQ A;  1IBC B;  2E5I A;  1YSJ A;  1UVN A;  2LLZ A;  2ROE A;  5DLF A;  3U1M A;  1HWL A;  1OIA A;  3Q24 A;  1IM6 A;  4CDI A;  1LFP A;  1Y4Z B;  2DR8 A;  4LBI A;  1SQE A;  4Y2M A;  3ZO7 A;  2ZH3 A;  2BR0 A;  5HLF A;  2H4W B;  3IR7 B;  2E7X A;  2GC8 A;  2H48 B;  2OIH A;  3A13 A;  3JSY A;  3B82 A;  2JL9 A;  3BSC A;  4DPT A;  4YS2 A;  4U9R A;  4P2M A;  2HHX A;  1NB7 A;  5CZV A;  1HQU B;  3JB9 k;  3QWU A;  2G2O A;  2Y1J A;  3R7B B;  1SL0 A;  4ED1 A;  1FRI A;  4WP3 A;  1ZA2 B;  4EBE A;  3HJV A;  1M1K T;  2DYA A;  3M6W A;  5J2M A;  2PI5 A;  2BE7 D;  3ZC4 A;  2O1P A;  3PRV A;  4CZC A;  2LQ5 A;  3M2U A;  2OPS B;  1GMW D;  1S6O A;  1T9T A;  3I5B A;  4B3R F;  3K8V A;  2BX6 A;  5A0Y A;  5AXN A;  2XS2 A;  4LSL B;  4HDH A;  4LF2 A;  2UXD F;  2F8H A;  3TAR A;  1R8H A;  1YBT A;  2PO4 A;  1V3R A;  3DM2 A;  4Y3C A;  5JJB A;  4HH1 A;  3OXF A;  1H38 A;  3ET6 B;  2CG8 A;  4CLY A;  2DD8 S;  1X4F A;  3EXC X;  3FEX B;  4I7F B;  2M2B A;  3NMR A;  1HHT P;  2YKM A;  1OY9 A;  5HK4 A;  2FJB B;  4NML A;  4LUB A;  3MM5 B;  5KFW A;  1TQL A;  4ZPV R;  2VG7 A;  3H90 A;  4JI7 J;  3IXQ A;  1BD6 A;  1OPI A;  1N0V C;  4PEO A;  4QWC A;  2GVZ B;  1K1S A;  1R0A A;  4CTA A;  3CC7 S;  5HO4 A;  5K14 A;  4KTQ A;  4QQB A;  5BYQ A;  5M2P A;  1KOO A;  1XBW A;  3CED A;  4ZS6 A;  5A8K B;  4DJB A;  1NUE A;  3U7J A;  2X1F A;  4HHH A;  4ID5 A;  3BR8 A;  3MED A;  4I1T A;  4CT9 A;  2IA0 A;  1RLC L;  1KS2 A;  1ZPV A;  5KT3 A;  1TR0 A;  3FZB A;  2ZKT A;  4ZIV A;  4KH1 B;  1YI2 S;  3ZFV A;  3D1O A;  1RWX B;  1RLD A;  1SJR A;  5ETS A;  3PKY A;  3DRP B;  3QNW B;  2LEA A;  3IGV A;  3DLH A;  4RUC A;  4L72 B;  4CLT A;  1LNQ A;  2UUB J;  2F65 A;  2MKS A;  4B9L A;  2DHG A;  3TX0 A;  3DOM A;  4DF8 A;  1K0V A;  4ED4 A;  2CQ2 A;  4JI1 J;  4WE1 B;  3SV3 A;  1RT1 B;  3TA0 A;  4P6Q A;  5KFC A;  1Y0H A;  2AWZ A;  2J8A A;  1WHX A;  2WBM A;  4ZN3 A;  1Z2L A;  5AJ3 J;  5B0F A;  4RJV A;  3CCT A;  5T7L B;  5DG8 A;  3GQC A;  2BJ1 A;  1RHU B;  2R7T A;  4R8U A;  2CQC A;  4DSF A;  4J91 A;  5GMD A;  1EAR A;  2CPJ A;  2V2Q A;  3HSJ A;  4NYO A;  3J81 U;  3MAA B;  4A8X A;  5DRK A;  1DAR A;  3QGH A;  1HR0 J;  4JI7 F;  5B0G A;  2KL8 A;  4X84 A;  1YJW S;  4W90 B;  3SI8 A;  2I6W A;  5B0A A;  1N6Q A;  4GVB B;  5DM7 Q;  1IKV B;  2LXU A;  5DJB A;  1LK7 A;  3ENQ A;  4NYP A;  2DNL A;  4I2Q B;  1ZBT A;  2MZT A;  1N88 A;  3SXL A;  3V6D B;  2HFO A;  3PRB A;  2OEL A;  2WSC C;  4KB7 A;  1ZPW X;  3M32 B;  3GR1 A;  3UWT A;  1D9F A;  2DNR A;  4USU A;  1OJ4 A;  1ZH5 A;  2DBB A;  1L3U A;  4ZPA A;  4DFM A;  1T95 A;  1TKT B;  4LF6 J;  1U1Q A;  3DOK A;  2QYG A;  1XTZ A;  4KRW A;  2DY9 A;  4NI2 A;  4DQR A;  1TVR B;  3MPV A;  2UUB F;  1G1X A;  4A8O A;  4DN9 A;  4PPZ A;  4WWS A;  2IJR A;  5HRO A;  4FZV A;  2MQO A;  3CCR S;  2YWE A;  3OHB A;  4JI1 F;  2IM0 A;  3W2V B;  2UVW A;  4B3T J;  2W2P P;  3T19 A;  1D9A A;  4P71 A;  4A46 A;  5HQM A;  2MQN A;  2FJV A;  4Z2X A;  1NAQ A;  4DR5 J;  3EZU A;  3A8E A;  4UT4 A;  2VPY B;  4Y65 A;  5AJ3 F;  3OVB A;  3ZTQ A;  2Z2L A;  1ZAW A;  2KFZ A;  2P6S A;  1HMV B;  1DJ0 A;  3KNG A;  2P2C B;  3M6V A;  2V50 A;  4KO0 A;  2NXC A;  1FKA F;  2YNF B;  2V9K A;  1LKZ A;  1M5V C;  5I3U B;  5A8R A;  1TKZ B;  1ACM B;  2J6S A;  2FHJ D;  4NLG A;  1HR0 F;  3QRR A;  3G96 A;  5GMK a;  2GS8 A;  2H5J B;  5CD4 H;  5K8M A;  1YK9 A;  3FJ2 A;  3CGI A;  3EYZ A;  3MOJ B;  4LSN A;  1ZZF A;  1IR2 A;  4NXN J;  4NA1 A;  5IOL A;  1RUS A;  1LK5 A;  3OQ2 A;  4P73 A;  4WBF A;  1NSQ A;  1B99 A;  1TUW A;  2KRR A;  1KBR A;  4J37 A;  3M05 A;  2I5J A;  2E5G A;  1DFD A;  1RAH B;  3MDF A;  1U24 A;  1UVM A;  4DQS A;  1DBD A;  3OTO J;  4TKT A;  1F5C A;  4MFB B;  3WX4 A;  2UU9 J;  3D0G E;  3NWR A;  1UKU A;  3QRP A;  3HFK A;  2FLO A;  3QGG A;  3GG1 A;  3UD3 P;  2VFR A;  5KG2 A;  1XNR J;  3GE9 A;  4RR5 A;  4QCL A;  5G0R A;  4LF6 F;  1FWK A;  3JSR A;  1Y5L B;  2FJD B;  4DSJ A;  4M63 A;  1YG0 A;  3BRE A;  1ZTW A;  3DXB A;  3G8T A;  2MST A;  4DSL A;  2RVJ A;  4PYD A;  3D6M B;  4B3O B;  1UVL A;  1X5T A;  4C3L A;  3PJX A;  4Y2I A;  4B3T F;  1YLX A;  2GIR A;  4RNO A;  2XZW A;  3TA1 A;  1U45 A;  3TX8 A;  1DTQ B;  4DR5 F;  4ZCK A;  3H2V E;  5C42 A;  3BKU A;  2HLU A;  2BM1 A;  4F7V A;  1EP4 A;  1FF2 A;  4F4X A;  2HBQ B;  3IO1 A;  3C46 A;  2CQ1 A;  4OI4 A;  3BPS P;  3WIV A;  4C7Q A;  2L48 A;  5L39 A;  3KOA A;  3MM6 A;  4GRS A;  1ZZN A;  3MM7 B;  5KFY A;  4L3K A;  3AJ2 A;  5J2Q A;  4H4K C;  4PAB A;  1CJV B;  1Y7P A;  3C15 A;  4DZD A;  1NZA A;  1VQ8 S;  4NXN F;  4ED5 A;  2UXC J;  3DLE A;  5KFD A;  3H2L A;  5IC6 B;  2B9E A;  2F4F A;  3RBX A;  3AH6 A;  2B9Y A;  3JXO A;  3SDE A;  3HHL B;  3ZZZ A;  2DXF A;  3ETM A;  1K9M T;  1GX5 A;  4R5P A;  2WVC A;  1H6K X;  1NSK L;  2W9A A;  3OTO F;  4LFC J;  1NU4 A;  2XYH B;  1QVG R;  2UU9 F;  3TUP A;  3KNA A;  2BUN A;  1WJ9 A;  2XZT B;  2YY3 A;  3EDQ B;  2KFN A;  3N6L A;  5LMU J; 
#chains in the Genus database with same CATH homology
 5ETS A;  3HT0 A;  4M5G A;  3UD5 A;  1IM6 A;  3KUG A;  4M5M A;  4CYU A;  4CWB A;  2F63 A;  3KUH A;  3ILJ A;  1G4C A;  3MCN A;  1Q0N A;  3KUE A;  1RU2 A;  1RU1 A;  3HD2 A;  4M5L A;  5ETK A;  3HD1 A;  1RB0 A;  3HSZ A;  3IP0 A;  5ETT A;  4PZV A;  3QBC A;  4M5I A;  3UDV A;  4F7V A;  4M5H A;  1TMM A;  1HKA A;  1HQ2 A;  3HCX A;  1TMJ A;  3ILO A;  5ETM A;  5ETQ A;  5ETL A;  4CRJ A;  4M5N A;  3MCM A;  3HSG A;  5ETR A;  4CYU B;  1EQM A;  2F65 A;  5ETO A;  2CG8 A;  5ETN A;  3ILL A;  5ETP A;  1DY3 A;  3ILI A;  3HSD A;  2BMB A;  5ETV A;  1CBK A;  1RAO A;  4AD6 A;  1EX8 A;  2QX0 A;  3MCO A;  1EQ0 A;  1F9H A;  1KBR A;  4M5J A;  1RTZ A;  4M5K A;  3UDE A;  3HSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...