3ILOA

Crystal structure of e. coli hppk(d97a) in complex with mgampcpp and 6-hydroxymethyl-7,8-dihydropterin
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
158
structure length
158
Chain Sequence
TVAYIAIGSNLASPLEQVNAALKALGDIPESHILTVSSFYRTPPLGPQDQPDYLNAAVALETSLAPEELLNHTQRIELQQGRVRKAERWGPRTLDLAIMLFGNEVINTERLTVPHYDMKNRGFMLWPLFEIAPELVFPDGEMLRQILHTRAFDKLNKW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosph
publication title Structural and functional roles of residues D95 and D97 in E. coli HPPK
rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 46
structure length 158
sequence length 158
ec nomenclature ec 2.7.6.3: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase.
pdb deposition date 2009-08-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01288 HPPK 7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.560 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits 7,8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK 3iloA00
3HSZA 1F9HA 3ILOA 4M5GA 3MCNA 1EX8A 5ETPA 4M5IA 5ETLA 3KUEA 1RU2A 5ETOA 1RAOA 5ETSA 4CRJA 3HCXA 1TMMA 1RU1A 3HD1A 3KUGA 4M5NA 5ETNA 2F63A 3UDEA 4F7VA 3KUHA 4PZVA 5ETQA 1HQ2A 3HD2A 3ILJA 3UDVA 3ILIA 4M5HA 3QBCA 5ETRA 4CYUB 5ETMA 1CBKA 3MCMA 3MCOA 1EQMA 4M5MA 5ETTA 1TMJA 2CG8A 3HSDA 3HT0A 4M5KA 2F65A 4M5JA 1RTZA 4M5LA 2QX0A 3HSJA 5ETKA 4CWBA 1HKAA 1RB0A 1G4CA 1DY3A 3HSGA 3UD5A 5ETVA 3ILLA 1EQ0A 3IP0A 4CYUA 2BMBA 1Q0NA 4AD6A 1KBRA 1IM6A
chains in the Genus database with same CATH superfamily
4JYAJ 1S7HA 3G8SA 5HP1B 3OTOJ 3UVJB 2VQFJ 2YQ0A 1N8RT 2YNIB 2OMOA 4DV6F 4DR3F 1NB7A 1Y5NB 4NZ0A 3KLEB 4LRAA 3ZZ0A 2Q1LA 2GVZA 4WE1B 3CDBA 3US5A 2R7RA 4X4PA 3O3LA 2IDEA 4ZKAA 4ZPDA 3BF4A 2CVEA 4DN0A 1JJ2R 4K5RA 3NGDA 3TUIC 3DM2A 3EWGA 4BCAA 1SC1B 2F4VF 2AT1B 4DX6A 2ZH8A 4ZHRA 5KAKA 3MCOA 3CJ2A 5IV4A 4K7QA 4AYBD 2YKMA 1X31C 2ADBA 2KG1A 2VPWB 2B3TB 2CXEA 2ZH3A 1WKLA 2VBXA 4HHJA 1VK3A 2KFNA 1IKYB 4P2MA 2DCLA 4QYZK 1S9EA 1LFPA 2WW8A 3QAEA 1SJ4P 2KT2A 4FF3A 1Y11A 5KFVA 1V6HA 3O2IA 2BE2B 1UW4A 3BBCA 3HM9A 3MR3A 2AJQA 1FNXH 4QU6A 2YH0A 4O0NA 2DJWA 1MMNA 4ATNA 3GYXB 1PBAA 4NE9C 2FVQA 5HQ8A 2GMLA 3SCJE 4YDXA 2PMWA 2PN6A 2FDNA 1RI7A 5C25A 4KQZA 2AX1A 4DG1A 1L3SA 4LR9A 4KGXB 2X51A 4DPOA 4O4GA 4DFJA 4U96A 4R0JA 2WAQD 4FNHA 4RUCA 5K5MA 5U47A 2NS1B 2RVJA 2LEBA 2PT0A 4HKQA 2HLUA 4NLOA 1REVB 3V81A 3FVYA 1K9MT 3UPFA 5HL7Q 3QWPA 3IRXB 1N5VA 4OYIA 2HWIA 3C14B 1XTZA 1OSCA 3CULA 2CQBA 2HRUA 4ZCKA 2QA4G 2YKPA 5DM6Q 1FKOB 2ZH5A 1UA0A 4K2XA 3TO8A 2QL5B 4OJ3A 2MQQA 4USIA 2AYGA 1J5OB 1VS3A 4IG3B 4YQWA 4QYZJ 1H74A 2OELA 1NPPA 2HIQA 4DWIA 2XSJA 3NXZA 2RNEA 1BY9A 3D7SB 1YDLA 3VGUA 2AYMA 2HNZA 4MH8A 1X4GA 5LSOA 1OY6A 2XMVA 2RHSB 1X7VA 1DBDA 5F8MA 3W5YA 4CTAB 1DTQB 1XMQF 4UOCA 3PW7A 2ERRA 1XNRJ 2ROPA 3AB4B 1S0MA 3GU0A 5K8OA 3TUZC 2QL9B 2DISA 2GC8A 2JC1A 4Q2MA 2GV1A 2L3MA 1OS5A 3CMQA 1BMQB 4IKAA 4C0BA 5JJBA 2OI2A 4CLZA 2JNJA 4CYUA 5IM0B 5JUMA 3C8YA 2C3YA 2MJNA 2Q66A 8RUCA 4J9MA 2KU7A 1HW8A 3R3TA 4C8MA 3MAHA 4PKDB 1H38A 4ZLLA 3EVWA 4DEZA 3T1HF 5E3QA 3FRYA 1WC0A 3O5TB 1FX2A 1RA6A 2XSFA 5B09A 4HTJA 2IA0A 2VOPA 3DHWC 1ZH5A 3DXSX 3HKWA 2PO4A 4ILMA 3M6XA 1HWKA 4A8WA 3G82A 1GNKA 2BMBA 1E6YB 2LXFA 1S77D 2UXCF 3I9V9 2RS8A 3EZUA 1TVRB 3OJSA 1VQ8S 2MGZB 3M1VA 1UWBB 1RT2A 3KFWX 4P6QA 1AROP 1N32J 2KFZA 1A7GE 1M5VC 5KG3A 1N4LA 3EPGA 3GONA 5H9EK 1X4HA 1Q78A 2DH9A 2OEKA 2V5HG 2BOAA 1BGXT 4N8NA 5KFFA 3CF5Q 1IJFB 2HYIB 4DL0C 4DXLA 5AE3A 4EMDA 2KYZA 2AX0A 4J9LA 2WVEA 1OWXA 3P3DA 4HHHA 2V4RA 5F0WA 1HWUA 5BXIA 5T7LB 4KRWA 4IR9A 2XO7A 2HQGA 3ISNC 4CLKA 2I2YA 1VC5A 2EFPA 2VOOA 4I4BA 1BWEA 4GKJJ 1HQ2A 2OPSA 3PJXA 2DHSA 1WI6A 4ANDA 2IM1A 3Q8RB 4ITSA 2C3OA 3VGVA 4RZRA 1NDKA 2W7AA 3P8BB 1ZM4A 1Y00A 3ZXWA 2HNYA 1UJ6A 3V6DA 4P72A 4DR5F 4C8ZA 2M8HA 2CQ4A 2PGCA 4LF9J 3NMRA 3M2VA 3PV8A 4HACB 1WDDA 4WJBA 2KDOA 3K17A 4QIWD 2MZJA 5D0RA 3GFYA 4DHVA 4ETXA 4FVMA 3BN4A 4F50A 1SC6A 4JI2F 1YRXA 2FHMA 5DG9A 1HHSA 4CO4A 2DXDA 2Z57B 1P9QC 4DCPB 2FLPA 4M5JA 1UZDA 3CDUA 4Y00A 4DOZA 1S4FA 3PW0A 3NCRA 4ED2A 2Z30B 1NK7A 2NCKL 4B9UA 1H2UX 2VPZB 1SL1A 1IBKF 3KMQA 3ILOA 2GW8A 1GK8A 1S7IA 3GPAA 3ZZTA 3OSNA 3RTVA 5A0YA 1EIYB 2DRDA 1NKEA 1W2BR 3LALA 4IRKA 1XR5A 5DG8A 3L95X 4KC5A 4B9LA 4ETZA 1R8HA 2CZ9A 4NEZA 2IM3A 3DLLQ 3IC1A 1IKWB 3KOAA 3MTJA 1AUSL 4C3MA 2OMLA 1X4FA 1DARA 4RW6B 2XYHB 3AOCA 2NLWA 3D6HB 4FS1A 3HK2A 3UN3A 4TU9A 4ED7A 4EZ9A 2Y1JA 1KSPA 1KOOA 2A1BA 1AA1B 4DV0F 1X0FA 4PQUA 4IYQA 2JEJA 1GAOA 4DX7A 4K4TA 1TL3A 2M4MA 1KLMB 4A47A 5T14A 5L1LA 2NPIA 2KHCA 4O3OA 4ED5A 1JKHB 5E3PA 2QTWA 4IFYB 1GTHA 1ZETA 2GJIA 1YKWA 2HWHA 3HCXA 4F0HA 4DCJB 2IVFB 3PXGa 3V6JA 3EGZA 5DETA 1VRUB 4EFAC 5LMNJ 3QIDA 4CT8A 2B5JB 3OTDA 4ES1A 1U6FA 3CGIA 1YLXA 4EYHB 2XMAA 2FZKB 2ZM6F 2R2SA 3A12A 3W8PA 1MW7A 2OAUA 4YEAA 3PKMA 4JV2A 3OVAA 4Y2AA 1PGZA 3UDCA 3MF5A 3OTOF 3SSRA 3L9ZA 3UR0A 2DKOB 2UV8G 2OKQA 2XLJA 4AXIA 2FPHX 4ES3A 2NXEA 3NGKA 1RJJA 4RNMA 2HBRB 2OPQB 2HVIA 2OH2A 4EO8A 4OLOA 5J2NA 1WI8A 3AD8C 2GNKA 3D0GE 4G1QB 4DR1F 2J6TA 1TK8A 3IR5B 2IPOB 4UTGA 1VRTB 1NKCA 1WWHA 2XBPA 3D4JA 4KHRA 2VL1A 2AP6A 2OJ3A 2MKCA 1KTQA 3MR5A 4DSFA 3MD1A 3N5BA 2XYPB 1MMLA 3MMCB 3DXBA 4KO0A 4HTIA 5GMKa 4QW9A 1NH8A 1UEKA 4CWBA 4YUDA 3HHLA 2JVOA 5KG1A 4LSZB 3W5XA 1F5CA 1JXLA 4YHHJ 3L3CA 1DQ9A 3RRGA 2QGFB 2XY7A 1W25A 1TUWA 4UQTA 3FQLA 1NJXA 3IWXA 4I64A 1VBKA 1B7YB 5KFWA 1RT6A 1HNZJ 5A8KB 5SZTA 2E1AA 3I0SB 2KI2A 3ENWA 1HBNA 1Q86T 3UVJA 2P6TA 2CA9A 1FJCA 2V6AA 2GQQA 1NO8A 3PHTA 1NDPA 1M1HA 3TEHB 3FCVA 2G1DA 1LWXA 3KLEA 2JSXA 1U6BA 5B0GA 3EXCX 2MLXA 4PPZA 2J6UA 3NP5A 1RWXB 1RT7A 5D4OA 4Z37A 3P5BP 3UD5A 4EBEA 1X9WA 1HWLA 2A2CA 2KT5A 1OPIA 4NXMF 5CA5A 1LQ9A 1TAUA 3QAUA 5CD4H 1T9UA 1RWKB 4OYMA 3W2VA 4CZCA 4HT7A 4B08A 2X7IA 3KLGA 5AXLA 1V3SA 4YP3A 5DGBA 2WVDA 3ENAA 4Y2KA 3SDEA 2U1AA 2EBGA 2HQ3A 2H48B 1SJQA 2WBMA 3QFWA 4UUWA 2J8AA 3FZBA 4PUOB 2HZCA 4ZJOA 4E2FB 3KHGA 4XDCA 2QJ3A 5G0RA 3BGFA 3WDOA 5IZHA 2F65A 5EHHA 2C28A 3CCLS 3R1LA 1PYSB 1NZAA 4KH0B 3OFEA 2BX6A 3HX9A 3RRHA 2CPFA 2DEJA 3DDKA 5GMEA 2EFOA 2HGLA 3MECB 1FHTA 1EHWA 2R4FA 2H9ZA 1QM9A 2XLIA 5KG6A 5KFHA 1LW0A 1RCXB 1JK9B 1LWEB 3EM1A 4A8QA 2D3OR 2IA6A 2DGWA 1T3NA 3R5AA 2XY6A 3BSCA 3ETOA 5K8MA 3PTWA 2IJNA 3TR5A 3SEOA 2HEKA 5DGAA 4OX7A 4MK8A 2BEFA 3IFEA 3PEHA 2FZGB 2ZKUA 1KTVA 4NLDA 3MFIA 4J9UE 3BB5A 2QFIA 3OL9A 2DH8A 2ZHBA 4USKA 4KPCA 3TVKA 3OV7A 2Y8YA 3MMAA 3PKYA 2ALYB 1N32F 3J81j 1TKXA 3CC7S 3HVRA 4C9DA 1XMOJ 5KFAA 4A48A 3GMGA 4ID5B 3H20A 4C8NA 4I2PB 5KTQA 3LGNA 3SI8A 1KQGB 4IG3A 2MZRA 2MZQA 1FFGB 4WFBQ 3A13A 4OZNA 4USJC 2HFZA 3KLIA 4A8XA 4J9OA 1X5SA 3VGTA 3HSDA 3LP2A 3RJMB 5B0CA 3OL6A 1WD6A 1MN9A 3M32A 4JOUA 2BKNA 4YS2A 3DI6B 4ZVOB 1NB2A 4R8UB 2ZWPA 3T41A 4ECXA 1RT3B 7FD1A 4ER8A 1NNDA 5L1JA 2L9WA 2BQUA 2UUCF 2EK1A 4OHYA 3CMES 1S9GB 2B0GA 1QE1B 3GV7B 1VQ5S 1FT8A 3KLHB 1N33J 3CJTA 1RHRB 3JYTB 5IM0A 3LWMA 2IY5B 1HYSA 5HSPA 5AT1B 2RU9A 1B7FA 1JLBB 1WKKA 2R7UA 4AT1B 1FRMA 3DLJA 4U6PA 1R6YA 1GMUA 2C3PA 1YG0A 2V2KA 4X4RA 1FDDA 6FDRA 2ZJPQ 4ECRA 1FJGJ 1W7WA 3JS9A 2VPYB 1PILA 2NR0A 4Y2IA 3D3CJ 4BWJA 2DIVA 4M1KA 5B7WA 3CO0P 2C2RA 3TARA 5DG7A 1Q8IA 3DLGA 3VWSA 4F0MA 4HLBA 2MGZA 2UUBJ 4ZVPB 5THWA 1RAGB 5F8IA 1Z4UA 4K4VA 4DR6J 1H7XA 5J2MA 2FIUA 4ZVFA 4HHUA 3IBFB 4USHA 4XAKA 4ICLA 4QIVA 2GHVC 2DGXA 3CJ4A 4LSNB 4FVCA 2W2MP 2R8GA 4LSLB 1C1CA 1T05B 2VDHA 2ZOGA 4OJGA 4LIWA 1TL7B 2W24A 2UXBJ 3BH7B 1AFJA 2FUG9 3AB2B 1FVSA 3M2RB 3LAKA 1CULB 3EGWB 4FBUA 3D0IE 4DBQA 3LP1A 1G7CB 3DC2A 3DLKB 4ZVTB 4AL6A 4PG5A 4RW9B 2ZVSA 3Q2SC 4NCGB 2W25A 2XS2A 3BR9A 4ZDNA 3QSIA 3JSMA 1FJEB 4ZVQB 3ET6B 4FXDA 3TAPA 2RRBA 5HVHA 1B3TA 4LMZA 2EFQA 4K0KF 3NNCA 5DQIA 4NLVA 3MM9B 5DDQC 3MM8A 5BJRA 4DR4J 1VI7A 3MCNA 2UU9J 1V9OA 3WZ0A 3R27A 1F0XA 2N3LA 1H7WA 4U67Q 4DV2F 3G6VA 1HBMA 3M8PB 1U09A 3R5DA 3F44A 5FJ4A 3D68A 2DR7A 4CLSA 3POTB 4KAIA 5E3AA 3I82A 2H5EA 4Q5VA 5KG2A 1J5EJ 3QGPA 3DRRB 3BGUA 1M0SA 5IS2A 1ROFA 3KK2A 3JQKA 1FWPA 2GVDA 2QX0A 2VA3A 4NOHA 1JLAA 4QPXA 4DSJA 2OPPB 1JLFB 5KG0A 1RE1B 4NZ7A 1KWMA 1WOPA 1HFEL 1NKBA 3QT6A 2YQ1A 3ADAC 2DR6A 2HMIB 3GIMA 1I94J 3QLHB 2ATLA 4RW7A 1R0AB 4DUZJ 2M5YA 2RUGA 1RWVB 2IM2A 4P7VA 4KGZB 3BPSP 3Q8VA 2GAGC 3SZ2A 4DQRA 1UPMB 3A3OB 3TUPA 5HANA 3TW0A 3OHAA 3PYEA 4BBYA 4DSLA 1S1UA 2WSEC 1O6XA 4F4YA 2YKQA 2KVQE 2KJVA 2B6AA 1KHWA 2YWKA 2J5AA 3K57A 4F67A 4PG7A 2BQ3A 1UTAA 2JL9A 3R8YA 4Z7CA 1FD8A 4PG8A 4UT4A 5HJYA 2HZVA 2D3ZA 2GGPB 3DOKA 3KG1A 3VR1A 3LGMA 1MG7A 4YB1P 2MB0B 1YRUA 2KRBA 4M5DB 4DV4F 3KHLA 3DCAA 4OZJA 1XEZA 1Y3JA 2BJ9A 2G4BA 5CAAA 3SV4A 1YI2S 1Q16B 2HVHA 4ED1A 2WVBA 3MPWA 3HI9A 4NPOA 1H72C 5KFNA 2RF2B 3C46A 4DQIA 1N36J 2BJEA 2DNMA 1KQSR 1EKRA 1APSA 2UUAF 2BRLA 1EETB 3CIMA 3P4UB 2IMWP 4I56A 5FLXU 2NUHA 3BKUA 3UD4P 1FDAA 1X5TA 4ECSA 3K8WA 4M8LA 2W2QP 3H2LA 4OX9J 2XMJA 3TNVA 1EP4B 1A6LA 1S72S 2BYCA 4DSEA 1OO0B 1SUQA 1DFDA 2KG0A 2R2UA 5GAHU 1U2FA 2KO1A 5KG4A 5E41A 4F3QA 3WC2A 3C66A 2FTRA 4WXOA 5KFDA 1TQLA 4WF9Q 1PCAA 4PXCA 3W1YC 4Y2CA 3G6ES 1GEHA 4KYZA 1WUUA 5KOWA 1C2PA 4DV1J 3OTEA 3G9CA 3WBZA 2B4OA 4DLEA 1G6BA 2ZE2A 2J0SD 4RW8B 1S1WA 5ETPA 5ADZA 3U1NA 2E5HA 4OIXA 2HK3A 2YH1A 1X4DA 2XNQA 3E8OA 2MKYA 1RT4A 3JSBA 1X60A 1D8YA 1S5ZA 3B78A 2XC9A 1FRLA 3J7YU 3MI7X 4ZVGA 1IXKA 4PWDA 2N82B 1Y4ZB 1Q5VA 2AGQA 1VRTA 3S01A 3S6EA 1QSLA 1QY7A 4OZ0A 2ZZNA 1MLAA 1RT5A 3VAIA 3HT3A 3FBCA 3AJDA 2QZ8A 2YKNA 4EEYA 4JI6J 1HNWJ 2ROEA 4UW2A 4X4QA 3FNNA 1RTJA 3EVMA 1DLOB 3DYAB 3UD3P 1UVMA 1XC9A 2DT9A 4ZCIA 1UA1A 4LF6F 3UI3A 3VAKA 2W4CA 2M88A 4NLPA 1FERA 3AHPA 3LO3A 1V3ZA 2LECA 4K5SA 3EUNA 4O3RA 2QLWA 2IC3A 1VRQC 3CJQA 3OW2R 4LBPA 2B9XA 2V2ZA 2IVYA 3PCOB 1EARA 2ZEJA 3FZ2A 2GIQA 1HQUB 3D6TB 1BHNA 3GIJA 3W2WB 3KDOA 2BRKA 1S6UA 2B9WA 4WK3A 3H4DA 2FVPA 2XZWA 5K14B 4AD6A 3NCPA 2RE1A 2OUGA 4PAAA 3MEEB 1MWYA 2AD9A 4UY8T 3HHNB 5IWAJ 5IOLA 5LMUF 3HDSA 4W92B 2VICA 5IXUA 4MFBA 3G8QA 2PIIA 3AAWB 2O67A 2MZSA 1G2EA 2RKIB 4FYWB 4ZIWA 1KQFB 2BANB 1PYTA 4CO0A 3NGUA 4A46A 2Q43A 3PEJA 1U8WA 2BA9A 1HR0F 3MM5A 1ITPA 4DL4A 1SH0A 3ICLA 1RTIB 4OHWA 4I68A 5LJ5Y 2A0FB 1PYOB 5I3PA 1VIXA 4L75A 2YTCA 1F3FA 4LRBA 3AQPA 2WONB 2YBVA 2EI5A 2DR5A 4P7TA 3IGNA 4Q7AA 1RWPB 2LQBA 4I2QB 2XMUA 4O0IA 2H4WB 4CLTA 3RB4A 1PC4A 1X5PA 1Y5IB 5J2QB 1IN0A 1SVDA 1ICEB 2BZ2A 1QAJA 1T3OA 2VU5A 4JB8B 4DL2A 2CFXA 3VZHA 1C4CA 2GX8A 1S10A 5LOQA 4O3NA 5HQMA 1BQMB 2C2KB 2V8DA 4YOEA 1LWEA 3GSIA 2ZD1B 4X62J 4ZITA 3CD0A 4LQ3A 1RHJB 4LR8A 2ZC3A 1FK9B 2GCFA 4C6AA 1IBCB 2CPDA 3PIOQ 2EPIA 4LFBJ 2GAHC 2CIMA 2ZH2A 4IRDA 1XNQF 2DBBA 4I6WA 1IKVA 3N28A 3T5HA 3AJ2A 1FFWB 1MN7A 2UUBF 5C7PA 4G65A 2OHDA 1JLEA 3N6MA 2E5JA 5C42B 3THVA 4HDGA 1CJUB 1TL1A 3OR2B 5I42A 1D09B 3DRPA 1O8BA 4C7QA 4OQJA 3MEGA 2PMHA 4L72B 1JNZB 1CS4A 4C3LA 4BS2A 4PPDA 1VIOA 4USTA 2UXBF 3DLHA 2E1MC 3OL7A 1D1UA 5L9NA 3D6FB 4UF4A 5FLXY 4K59A 4WPAA 4R5PB 1K0TA 4BC9A 3HD1A 3OLAA 4JV0A 1FRKA 2QA1A 1YZ6A 1F9FA 5FDLA 1M5SA 2VFTA 4QIFA 2RB7A 1HMVB 5F8HA 2WHOA 4CNZA 4M5NA 3JB9k 4YB7A 4J37A 4B3SJ 2LXUA 4A8YA 4MIWA 4F36A 2I38A 2LKZA 5D0EA 3OLBA 2YNGB 1YJ9S 1L5UA 4QWAA 1BLUA 2XQCA 2D9PA 1IKXA 3OHBA 1Q0NA 2GMJA 1FKPA 1MWQA 2NPFA 1QVGR 2PA8D 3Q8YA 3DU6A 1TMMA 2IRUA 5IC4B 2FQQB 4L3KA 4D3HA 4NYZA 1KVKA 2NSBA 3NBPB 2AZ3A 4OYZA 2ZUAA 3PO4A 4E8UA 1X4BA 3H8YA 1MROB 3H59A 3K59A 3LP0B 1YHQS 5L1IA 4ZLJA 2A10A 1BQNB 2VBZA 2VJVA 1W26A 1YTYA 2CJ9A 3SSSA 2PMZD 4A4JA 1KS2A 1GX6A 2PD1A 2E5IA 5JVHQ 4RBUA 1NSKL 1J2VA 1Y3KA 1FTCA 2HHPA 1NMEB 1TUGB 4LF4J 1UWAA 3RAXA 5GAHI 2FHOB 4F7VA 2MSTA 1T95A 4DMZA 1J27A 3K5LA 1I94F 3OR1B 1N5YA 2FC9A 3MXHP 2A18A 3VAHA 1HD1A 1U49A 1RABB 4NLXA 4ANCA 2MTLA 1E6VB 3AQOA 4NASA 4UZCA 2WTFA 3QT7A 3DOLB 5D77A 2A6OA 3CDWA 2I1RA 3P96A 4OI6A 2IFXA 2UVWA 3QBCA 3HVAA 4JV1A 2QLFB 2CQ3A 5HLFB 4J7CA 4D3GA 1S6QB 1RWUA 2DNLA 3I55S 1K0VA 4DV5F 1T9TA 3GTYX 4H4MB 1U2RA 2UZAA 4DR2F 1ZAXA 1S99A 1RXOB 4B9TA 2CNOB 3W62A 2KVIA 5L46A 1TKZA 3PJ9A 3PRBA 3MZIA 2V4JA 2Q79A 2MDAA 3TAQA 1CVJA 2J9CA 2E5LJ 2OEJA 2AMCB 4LFCJ 3BKTA 2RHQB 2C3UA 2AIRB 2VIHA 1N36F 1DTTA 5KFTA 2W9CA 3IR7B 4RW4A 2PE8A 1JMTA 4XIUA 4LF5J 1GFWB 1C0TA 2KZMA 3NWGA 4RU2A 2HBQB 3I9ZA 2XS5A 2LFVA 1SXLA 4M94A 3C3LA 4NL5A 2JEGA 4OZ2A 4AQYJ 2AJ1A 4X2BA 1T94A 3BBFA 4CLFA 2BW7A 1JLFA 2KYXA 3NKYA 3FFIA 3RAMA 1SPBP 1L3UA 3T9ZA 2K06A 5LSRA 2OFGX 1HBUA 4M5HA 3LANA 1FE4A 4QWDA 1XR7A 3D2WA 1Q8LA 1M5HA 2C22A 2MPUA 2XTJP 2XHWA 3BPDA 1XJWB 1UEVA 3UN2A 1D3WA 1UFKA 1PJ6A 2DD8S 2CPJA 5J1NA 2V94A 4MKYA 4IQXA 1Y0HA 5KFRA 1NJZA 3GIKA 1WEYA 4KV8B 3HVTB 2K1RA 3OTCA 3I56S 4EWTA 4B3MJ 4I7FA 4J9SA 4O3SA 3BQ1A 1LXNA 4H4KA 4ZPWR 4FF1A 3RBXA 1O0PA 2Y0BB 2V50A 1F2HA 1NJIT 2O3DA 4QWBA 4OL8A 1XWLA 5CCMA 3NNHA 4Z2XA 4AL7A 3IRWP 1V3RA 2OTJS 5HAOA 5LM7E 4B9VA 2E44A 2F8HA 3CXCR 1HBOA 1O51A 2DNOA 1B70B 3CEDA 2C2NA 3DKDA 2VA2A 1SV5B 3TQ1A 1RWWB 4LIRA 4WYWA 1AYEA 1G1XA 1QSSA 1JLCA 5KG7A 2YPZA 1S1VA 2FYXA 2F4FA 2H5JB 4ZS6A 4ZVEA 4QWEA 5H9FK 3ENVA 1D0EA 1KP6A 3FCWA 4NI2A 3VQTA 3HZGA 1ZPWX 2YKAA 4JI8F 1V5IB 2BM1A 1PC5A 2Z8QA 2WOMA 1N56A 1RTZA 2VG5A 3BH6B 2QFJA 4GC6A 5I4MA 3M30B 3GZ7A 4JV5J 3UWTA 1GMWD 2HG4A 2DK2A 3PZPA 1CJKA 3MMBB 3OJUA 1FTRA 2B9YA 2EEYA 5C24B 4ZPAA 5IWAF 4LBHA 2JFKA 2Z2LA 4GKKF 3RG6A 1EX8A 1JLQA 3DMJB 3A3NB 5D4NA 3DNCA 3TZWA 3SCLE 1UJ5A 1KRPA 2PEHA 4O3PA 1EQ0A 1HQEA 3ZZUA 4O3QA 3QZ8A 2P5VA 4DZ6A 3LWLA 2EWHA 2LQJA 4JP8A 3TYTA 2B51A 4KFBB 1FDNA 4DPXA 3UCUP 5J1EA 1RKJA 1R8BA 1U0HB 1RTDA 4LFAJ 3SV3A 2XCPA 2DEIA 4XK8C 3CC4S 3HXMA 1AW0A 2G0IA 1HPZB 5H9FJ 3W3SA 4LVOP 4KKOA 3VTIA 1FKAF 4ZK7M 3Q22A 3M9NB 2D7SA 4Y2MA 1HI1A 3M9MB 4JI7F 1LOUA 3BGRB 5KT3A 1RDRA 2EKNA 4DZDA 1WG5A 3HKZD 4UY85 1FF2A 2W7OA 3PW2A 4FF2A 2CNNB 2OTLS 2XHCA 4NA1A 1EKSA 2AEFA 4TVAB 4B3OA 2IAJB 4OZ3A 1SH3A 2HHHJ 2R7OA 4URQU 2FJAB 3GG0A 1L3KA 3ZTSA 1TL4A 1NK0A 4Q8EA 2E9RX 5J2PB 5DQHA 4KIAA 3W2WA 5A6WA 5C5JA 1FRJA 2F7VA 3OSPA 2J9DA 5HVFA 2IYIA 3EPIA 2B4PA 3LUYA 3M8WA 2LQ8A 5D15A 3C6TA 3HHLC 3TAMB 1WC4A 3PFEA 3KK3B 1QVFR 2F8MA 2JZ5A 3VAGA 1GH8A 5ETTA 2L9NA 5EWEA 1R0BG 2RKIA 4LF8F 2AWZA 5J1PA 4UOHA 2DRBA 1F9HA 2OFHX 4BC7A 3IR6B 2W9BA 3VHQA 4X4OA 3CUNA 3NCQA 2OO4A 2O1PA 1I5OB 1Q8KA 3B4MA 2KT3A 1X4AA 2CQGA 4CI0B 2Y0SD 4JI1F 3E01B 3N6NA 2CPIA 5A6PA 3V5RA 4IH7A 1U1KA 2ZDPA 2H1YA 4Q0BA 2ILYA 4MTPA 3CCTA 5DLFA 5L38A 1WNEA 1HNVB 2MZ1A 1HNIA 1KONA 2HNDB 3AOAA 5F9LA 2RRNA 1PAEX 2OPRB 3MUTP 2H5IB 1UFWA 4YDDB 1SQGA 3I0RA 2F5GA 2Y1IA 4YMEA 2R8IA 3AT1B 4RJVA 5KFLA 1TKTA 4B9SA 3KLFA 3KNAA 3MAQA 3N6LA 3R5GA 2CADA 4OI1A 4K4SA 3MPUB 2R3VA 2J7UA 1RAFB 1YK9A 3GFHA 1VDHA 1I3OB 1Q53A 5KFBA 3LGHA 3FRZA 4PWWA 4CH7A 4KPYA 3SFGA 1VK8A 2CQ1A 2KHDA 1NDLA 2F1FA 4DR7J 5DLGA 2AEMA 1VQ6S 5FIIA 1GMVA 4ZIVA 3B54A 1UW9A 2BKPA 3CJKA 4ES2A 2QYCA 5CYMB 5HROA 2CYYA 4A8KA 4DFKA 3W60A 2CDRB 2VFSA 4H4OB 4OV1A 4PG4A 3KK1A 3M8QB 2KKHA 2VHGA 2VZ9A 2ZBRA 4ZA1A 1WELA 4WP9A 4TY8B 2AGPA 3DGPA 2IDLA 3NS6A 4LRDA 4RNOA 2Y3YA 3EVOA 4DUTA 4I6YA 5AJ3F 2CQCA 2ZH9A 4EK2A 2VG6B 3FBFA 2CPHA 3T9NA 4K4UA 4X4VA 4CQ1A 2KL8A 3ITHB 4WU3A 3U1MA 2MHEA 4A8MP 4NEYA 2CQIA 2DNRA 1PJ5A 1MU2A 1TZ0A 2DHGA 1RTHB 3Q24A 4WIIA 3W9JA 3A8EA 1C1BB 2EFNA 3H5UA 1VQNS 4OI0A 1I1GA 1P1LA 1LWFA 3TVYA 3HJFA 4F4WA 3SXLA 3HFKA 3MM6B 1VQ9S 4DU7A 2FY8A 2HZAA 3GR0A 1WACA 3DLEA 5A8WA 1YRTA 1REGX 2GA7A 2DITA 3GSDA 1VQOS 2FZCB 3V4IA 4QWCA 4C8LA 3NNAA 1VFJA 4CO5A 4FXVA 3FSXA 2YNHB 2RSQA 3ZZYA 5F8NA 3TA1A 1WORA 4F0KA 4QU7A 1IR1A 4LFCF 1S1TA 1YWXA 3NBPA 3SYZA 3QT8A 5LT5A 1YX2A 2A3JA 3GYNA 3H2UB 2G0JA 3GFZA 1T0TV 1S6PB 4DL6A 5E7OB 5I3UA 2ILZA 2C1EB 1IQTA 3IBCB 4O44A 1SBRA 2VDIA 1N6QB 2RQ4A 2MLYA 5IFMA 1RHQB 2PDAA 1VBYA 5EGYA 4AQYF 1TP7A 4M95A 3QGIA 4GRSA 5DZ6A 2GIRA 5KFPA 2AJFE 2KB2A 1RYRA 1FE0A 4PYAA 4P9SA 3WQPA 2W2OP 3KJVA 2Z0GA 3T5JA 1UPPA 2YNFB 4DUYJ 3NRBA 1CJTA 4B3TJ 3AXKA 5HN0A 3DOLA 1VC0A 1UL3A 2Q6BA 4Q45A 3MEDB 1UETA 4F4ZA 5D3GA 1XERA 4K50A 4DV3F 2XZTB 1UVKA 1XBWA 1T9YA 3M2UA 1G3OA 3NGRA 4GVLA 3IS9A 5IQQA 3C6UB 2XI3A 4B17A 1WKJA 1OMSA 3PW5A 3MM7B 5AE2A 3L09A 1S1XA 4WK1A 2D3UA 4P52A 5CYQA 4WTYA 4NLWA 2WSCC 2AKWB 4PQAA 3N01A 3FEYB 4MMOA 3CCVS 2YVSA 1JLGA 5CZVA 4IUFA 1TV6B 2D41A 4DPTA 3BREA 3CIZA 3G6YA 5ETQA 1NAQA 3H25A 3H5SA 5E33A 2LXIA 3OXFA 4DJBA 1CJVA 3AXMA 4QQBA 2MZTA 2E9TA 1FO1A 4ZPBA 2MQMA 2C2EA 2LCWA 4C0HA 2CQ2A 1OQ6A 1XMBA 4YB6A 2HW3A 4MKBA 3HLUA 2GZOA 4JV5F 2GO8A 4W90B 1M5OC 4ZHRB 4YY3F 1YJWS 3HFVA 2XGQA 4JI3J 1ZM3A 2WSFC 2YKMB 3FJ2A 3KKFA 1NJYA 3ISND 1JIHA 3DRSA 2PEBA 4ZPCA 4N47A 3VAFA 2F40A 5DQGA 5D4LA 1D9DA 3N79A 1N34F 3FMWA 4F26A 1EB0A 1OYEA 3HHDA 3F0NA 1S9EB 3EZ5A 3F41A 2BW2A 1RT1A 2VQEJ 4AUKA 2ZNZA 3H90A 3QATA 2JWNA 2AQ4A 2HQIA 4ILRA 2HGNA 1C0UB 4JI4J 3CTRA 3X1LB 4CDIA 2VC1A 3CJ0A 3OVBA 2MKIA 4OI3A 2PI5A 4DV7J 4LF2A 5C25B 1I6JA 3OVSA 4X65J 4CLUA 4QR1A 3QZ7A 3B82A 2I5JA 3K89A 3G2XA 2VASA 2EK6A 4O4GB 3TA2A 2WZ1A 1C4AA 2X1FA 4K4WA 1XN9A 4A8SA 5HBMA 3HZEA 4C0OC 3S7RA 4TQSA 4B3RF 2Z58B 4OJHA 4YB5A 4DV6J 4DR3J 2G2YA 4E98A 4HL9A 2V8VA 5D0HA 1N5SA 1A0OB 3H0PA 4Y28C 2HFOA 5KT6A 5BR8F 1PIEA 3CMAS 4EUVA 2F4VJ 4DI6A 4OHXA 3JTNA 2AYBA 3UO0A 2XGPA 3LH2S 3SQGB 3O1LA 3T1YF 1H0HB 5A8RA 2VODA 5HATA 2WBRA 2XSJB 4KBIA 4M63A 2HNZB 3MCSA 3BQ2A 2B56A 1U8SA 2F63A 2GJFA 1IBLF 3B6BA 4NXNF 2XM3A 1IJEB 4Z7YA 1U1QA 1DURA 4ZN3A 1T02A 3KHHA 4ENOA 3JXOA 1RBLA 3MOZA 2ZWOA 1TU0B 4NLUA 8ATCB 4CYUB 4N56A 3BO2A 1U24A 5HO4A 2QSFA 1B4SA 1P8GA 1WHWA 3I4PA 2YWWA 3OUYA 3IWNC 3N9UC 2P6SA 3PYFA 4Q44A 2H51B 3C15A 2CG8A 3CCMS 1LWCA 2GHWA 1M5PC 1VJQA 4DQPA 2MJUA 3CJ3A 4OYPA 4MIBA 1QAYA 2MYFA 3G82B 1VBZA 1RAEB 2IAJA 3P45B 1AUDA 2VG7B 3M6VA 4F4KA 1QLNA 3ZNUA 1F9EB 3M1VB 3VALA 2X3DA 5K20B 2GHPA 3QJLA 3T3FA 1FRIA 1RISA 3R2DJ 3NG8A 3UNGC 3PX6A 2GS8A 5B0FA 1U1NA 2CUYA 4DX5A 4ELVA 2J7WA 2X3GA 3GJSB 1KR4A 3KNGA 5F41A 2ROGA 3JSRA 1YIJS 4DF8A 2GQCA 1JX4A 4GVBA 4AE5A 2GMHA 1OSDA 3IP0A 4OX8A 1XMQJ 4WFAQ 1WG1A 5KFSA 1R6VA 1R8PA 1NUEA 1FNOA 3CCJS 3R1HA 2V2VA 4OI2A 1KDNA 1RHKB 1M1GA 3Q8PB 1RAIB 1R7IA 2OPSB 4B9MA 3QIPA 3F73A 1VBXA 4F2SA 5LL6d 1UJ4A 2W2PP 3RR7A 3BYPA 4Q2LA 4N7TA 3CC2S 4JYAF 2U2FA 3HFZB 1CPZA 4NLTA 2VQFF 3VAJA 3ZNJ1 1NPRA 3MAAB 4URGA 2V8PA 3QO9A 2HNYB 3PYGA 4NCAA 1JQGA 3V6DB 3UNYA 1RZMA 2NYIA 3OFHA 4ECTA 2R8JA 2QV6A 2JX2A 3BSNA 3T1HJ 1U1MA 2HNDA 3FGVA 3M2VB 4DN9A 1JJCB 1K1SA 3EGNA 4X64J 4L3NA 3KLVA 2UXCJ 2R9LA 2DB1A 1FX4A 3CJRA 3IAS9 3W66A 1WF2A 1U45A 3X3UA 4IG0B 2HKEA 1R89A 3ILIA 5IT9U 5K8PA 2MLZA 2X1AA 4OHVA 1VCTA 3OQ2A 3PNIA 1LW2A 4IFVA 2M9KA 1H3DA 3OFGA 1WEXA 2DPJA 3CT9A 4LQ9A 5B0DA 2VJUA 5CYMA 5EX3A 2ALZA 3CWJA 5A0YB 1UEUA 2IJRA 4DU8A 4NRTA 2FGOA 2PC6A 1BUXA 1VLYA 1RHMB 2W9AA 1JNRB 3T1AA 3TX8A 4RX6A 1K8AT 1EJ7L 4P2XA 3GP9A 2BKOA 1SJFA 1PSDA 3B8HA 1CQMA 2AGOA 2JFDA 3QT5A 4PG6A 2FJXA 1RWOB 3RBZA 3L7PA 5HP1A 5D6GA 2VONA 5B0AA 4TXSA 5KFEA 2YNIA 2QE5A 3DLBA 2JVRA 1Y5LB 1SC3B 3G71S 4PQUB 2QG9B 1PG5B 2CDQA 4CIOA 4WE1A 1QUVA 1TL3B 1UCNA 3I4HX 3DRYA 4IO9Q 3P6YC 2W8LA 1BQXA 4ZN1A 2ZH4A 1ELOA 4OFZA 2HRTA 3D67A 2PFFB 4CM0A 1VQLS 4JI2J 3MOJB 1ZS6A 2SXLA 4Y3CA 4N5SA 2C2DA 3SMZA 3AOBA 1WSVA 2LYVA 2CJKA 2HBZB 4QR2A 3MCMA 4P2FA 5CZXA 1IKYA 4DPYA 5KT4A 5IT0A 2R42A 2P9EA 4MT1A 1XNRF 1NK6A 2VPXB 3HP6A 1ULRA 1IBKJ 1S59A 2CZ4A 2BE2A 4HI2A 4RNFA 3OL8A 2I9SA 3KG4A 1W2IA 1KQKA 4EZ6A 4WZMA 2J0QD 4FXWA 3W64A 4UOFA 4EYIB 3B4DA 1DQ8A 3LA0A 4NZ6A 2LMIA 3NGTA 1H73A 4WFXA 4C97A 2Z2MA 5HJXA 2UVVA 2LEAA 4USUA 2Y9HA 1WC6A 3FQKA 4MAKA 4CLPA 1WTBA 4UQGA 3I32A 9ATCB 2RS2A 2HFNA 3D1HA 4QIEA 3CDAA 2DIUA 4GO7X 3TRGA 4F2RA 2MQNA 2ASYA 1UP1A 3N0VA 4RBTA 1NSPA 1MMDA 2HHWA 3MEDA 2ZITA 1SKSA 4DV0J 1REVA 2ACYA 3CW2C 3ZZZA 2YWGA 3RU0A 3MUVP 5K9FA 2CRLA 1S9FA 3WX4A 2KRRA 2QLXA 3BN7A 4CCHA 1NH7A 4ZLPA 4YR3A 3W63A 2LDYA 3IRXA 3D66A 1RK8A 3IXQA 4KGVB 1NSQA 2HRYA 2E7XA 3C14A 3SBMA 1GXUA 3HO1A 2K3KA 1L3VA 1RU2A 1D9AA 3L7OA 1NHVA 2R2TA 3HHLB 3GCXP 1T7PA 1FKOA 5KFYA 2NXUA 2Y8WA 4H54A 2D69A 4JI5J 4ZCMA 1J5OA 3QRQA 4KY3A 2ZDOA 3THTA 4X65F 2H65B 3Q8UA 2M0GB 2XY5A 4OZ1A 3KJFB 4CTAA 1DTQA 3MWBA 3HSZA 1RT6B 5ETSA 1LK5A 4KR0B 1HBNB 1YQHA 5KT5A 1NM2A 4A8FA 2V8GA 4CP5A 4GKJF 4HDHA 4JBCA 2COLA 1RT7B 1IUJA 4J9QA 2L48A 4P74A 1TAQA 4MJKA 4C98A 3SCIE 2QEXS 1GXLA 1G4CA 3RUBL 2YY3A 2OLWA 4DR1J 3E51A 3GQCA 5H1SV 3W2VB 4N76A 3KLGB 2NZ4A 2RH3A 4A8OA 4LF9F 3V6HA 3D9BA 3IBWA 4DPWA 3AD9C 3SDEB 1HLWA 1A9NB 4MYTA 1E6YA 2BE7D 2RQKA 3TP2A 4MYUA 2RU3A 1TELA 2FLOA 1AB8A 1CG2A 3TZXA 4QBUA 5K8NA 3K5MA 1TVRA 1UWBA 2DGQA 5G0RB 2IRXA 3V6KA 5DDRC 3VAMA 2AHOB 4HEA9 3ISZA 3ONQA 2HHVA 2VUGA 5IT9Y 3QFHA 2XCAA 3QJJA 1C0UA 1R8CA 2CQ0A 3CPWR 5A76A 1FEEA 1P27B 2HS3A 1F6TA 3AODA 4ZPVR 3M6UA 1QAIA 3TI0A 4N41A 5ITHA 4Y65A 2H3EB 4NA3A 5ETMA 2V9WA 1RHUB 2DY1A 2HVEA 1LW0B 3QJPA 2V69A 3KDNA 1YJRA 3GB0A 5T7LA 4NYOA 3Q83A 3GIRA 3A8IA 4K4XA 2EFGA 2RDIA 4G1PA 3PW4A 3M8YA 4WKYA 2E1PA 1TL5A 2HQDA 3MURP 3ZTPA 1S0OA 4H4KC 1U1LA 4I0WA 4KH1B 2C2ZB 1JXVA 1ZTWA 1PJ7A 4NXMJ 3MMAB 4DPUA 4ZLNA 2ASLA 1TKXB 3FK4A 3GJRB 3PYDA 3L4BC 3SQGA 4WP3A 1URNA 3KLIB 4HACA 3CD7A 2V9KA 3G87A 2ZH7A 3LP2B 2CWKA 4QR0A 4W4MA 3M32B 3AFGA 4K2JA 1AFIA 2ZZMA 3U1LA 3ZTOA 2ZZTA 4O4RA 4KHMA 5LMNF 2KZZA 3AY0A 2C2MB 4RR5A 2CJXB 1ZA1B 2HLTA 4RL1A 3R9LA 3QQCD 1IM4A 3T19A 5HMXA 3HSGA 2A6MA 1DRZA 1WEZA 1S97A 4L76A 1HYSB 4WWSA 4YFUA 4AXJA 4LBIA 2HHXA 4WZQA 3MGJA 5EDWA 1NZ8A 5F3TA 1RLCL 1GXTA 3HVWA 3MPDA 4TLRA 4RUBA 4ZMMA 4LF1A 1YJVA 1FESA 1S12A 2BJ1A 4X64F 1TFWA 1N54B 1RWMB 1IKWA 2VG7A 3PY8A 4W98A 2UVUA 4RW6A 1XK8A 3DLGB 3R2CJ 3M9OB 2QN6B 3TZYA 1U02A 2GJ2A 2VBWA 3R5BA 2KH9A 2J76E 4KT0C 4WFNQ 1N5TA 3VVUA 4CT9A 4JI0J 2HURA 5J2MB 3AA8A 3S8SA 1OJ4A 3KUHA 3UDLA 4IDKB 1U1RA 2V68A 4ICLB 1KLMA 3T5LA 4ERDA 1JKHA 3R7BB 5DRKA 2AEJA 1C1CB 1RAHB 4IFYA 4CO3A 3GJQB 2LU2A 3T6BA 1NJWA 2WK4A 3Q8SB 4FBTA 2BJDA 3R5JB 1VMBA 3QPIA 3LP1B 1VRUA 2ACMA 4R25A 4ECZA 2B5JA 4YN3B 2VBYA 4YHHF 1NRKA 2HHUA 1NLKL 2UUCJ 4Q43A 1KVJA 2XZDB 4I69A 1CBKA 2RQMA 2OIHA 3RR8A 3BZQA 3JSMB 2P2CB 1NSAA 3TJAA 1HNZF 2ATCB 3QNWB 3R6LB 3QYYA 4M5IA 2R7XA 2ZC4A 4U8YA 4TU7A 1YBAA 4V19X 3MAAA 1T03B 3GLJA 1T8EA 2UP1A 1AZSB 4BDPA 3MM8B 4FYXB 2OPQA 1D9FA 1PO6A 2J0WA 2CG4A 1KC8T 3O6QA 4OZ5A 1HBMB 5DS7A 3U02A 1VQ4S 1B0VA 2M2BA 4G1QA 3A1YG 2XB2D 4DS5A 2DYAA 1T9WA 2IVMA 4PXDA 1PAUB 4EO6A 4IG0A 3CD5A 4WFYA 4BWMA 3NOGA 1JJ4A 3A3PB 2OP5A 5H9EJ 3BSAA 1IBMJ 4IO1A 2N7YA 1RACB 2B4UA 3KK2B 1DAXA 2GVDB 1U1OA 1PBUA 1RQ0A 1JLAB 1UFLA 4YR0A 4R0EA 5KT2A 1UVJA 1CSJA 4KHPJ 3MMCA 2DVIA 2OSQA 4ALZA 5M2UA 4RW7B 2IIHA 2YX4A 1ZM2A 3ETMA 3FCHA 1T9XA 4KE5A 4ECVA 3OTBA 4F4XA 2GO9A 2Z56B 3O8WA 4Y6IA 4KB7A 3L7UA 2VB6A 1TUVA 3V2UC 1NU4A 1S1UB 3G4SS 2Q6CA 4NWBA 2B6AB 1JWWA 2UVRA 4ID8A 5A8KA 1CC7A 3I0SA 3D3BJ 3QRPA 4MKAA 3CCQS 2FVCA 3J7AN 2W4PA 1WHYA 4FPIA 4HVZA 1JB0C 4PCQA 2PSZA 3DOKB 4NLRA 3TVZA 2R7SA 5EUHA 2R8HA 2WB4A 4K0KJ 2QYGA 3W65A 2KXNB 1HI0P 4X4NA 2VD3A 4NLYA 4EU0A 4DV2J 2HAFA 4RWXA 1AXQA 1HHQA 3W9HA 3GR1A 1XMOF 3VGSA 1VJWA 4C11B 1KNZA 3JTPA 3ZTQA 4JI5F 4L74A 4JUZA 3OPKA 3H98A 3PHEA 4IQMA 3K2YA 4NMLA 2CNLB 3BV8A 1FXRA 1YVFA 1H2VZ 2J0XA 1S57A 1SUQB 3QGGA 1NDCA 3DHXA 4PUOA 1R31A 2WB1D 5GVQA 4X84A 3HULA 2YWHA 2JLFA 5EWFA 1KOHA 1JXEA 5HK4A 3G8TA 4J9PA 4CLWA 2V2QA 7AT1B 1RWNB 1U0SA 5GAGU 3O44A 2IMOA 4QYRA 4CLYA 1QAXA 1GMWA 1RAAB 5F8JA 1N33F 1Z2LA 3FBBA 3H40A 3MECA 5ETOA 3NOCA 3UQSA 1R0CB 2AV5A 3SQOP 2ZE2B 1S1WB 2BM0A 4HYKA 2F9JA 1OY9A 2D9OA 1CEZA 3NWRA 5L8RC 2NUUG 1IQZA 1RT4B 1IR0A 3SFUA 4V19J 2UUTA 1FJGF 3EGVA 4UZBA 1FRHA 2ZBPA 4PWDB 8AT1B 5DDOC 5BYQA 2FVRA 3GV5B 2HFSA 5GADU 1IR2A 3E2EA 4NLGA 4DV4J 3M05A 1RT5B 3BSOA 4CLLA 1BXNA 2BABA 2VC0A 4EBCA 2EG1A 2ZNYA 5LSLA 5KFZA 3RZAA 3CDEA 3D28A 2YKNB 2M7SA 3PO5A 3HMJG 1YITS 2FB0A 2HIYA 2DPIA 2E9ZA 3K5NA 4DR6F 1RTJB 5LXRA 1WSRA 1ZM9A 4HR2A 2UUAJ 4ID5A 2VF3A 3KJNB 4IOCQ 4I2PA 2JDJA 1HIYA 2CKWA 4BHQA 3OT9A 1S48A 2IBKA 3GYGA 2XLKA 2MKKA 2BDPA 2IC3B 2R2RA 1L3TA 4C8KA 4TQRA 1HI8A 3DI6A 1WC5A 5I3QA 3MDFA 4R8UA 1FRXA 2B7CB 1RT3A 4CO1A 3BJYA 1GX5A 5ETLA 2B9EA 2QA4S 2O66A 2CQPA 3N4WA 1K73T 4S0MA 1WDTA 2A2DA 1NXIA 2I8EA 2QO3A 1S9GA 2K8GA 1QE1A 1VQ7S 3KLHA 2V8HA 3JYTA 2LQ5A 4RWWA 1AT1B 1M1KT 2P9GA 3M7VA 9RUBA 4MFBB 3UCGA 3I6PA 1JLBA 2R8KA 2E1CA 1RADB 4DQQA 1N0UA 5ETKA 3GG1A 3ELHA 5L9XA 2RDJA 2BJ3A 3J81U 1BC6A 2AF6A 1X0PA 4DR4F 3MM5B 4FP9A 3KHRA 2UU9F 4M5LA 2K2PA 2MY8A 4FF4A 3JQMA 3D1OA 2CQDA 1X4CA 1F3VA 3RRKA 2DHHA 2J6SA 1B0TA 2BQRA 5LJ3Y 1RCOB 2J8SA 5CQGA 2Z2YB 3IG1B 3S1TA 2W01A 4PXEA 5IT4A 1WHVA 1J5EF 3TZZA 3I31A 4OYXA 4DL3A 1KVIA 2K7JA 1XQIA 4QPTA 2IM0A 3CCZA 1UVNA 2QSWA 4LF6J 3RW6A 3UDEA 5KFXA 2QLJB 2R7WA 2Q3PA 3SSQA 4ZJQA 4LSNA 3V4MA 4LSLA 1NHUA 1T05A 1TL7A 4P71A 4DUZF 4TKTA 4QOTA 3D0HE 3M2RA 2HK2A 1CULA 3U7JA 5DDPC 3KMSA 2DH7A 4N77A 3DLKA 2HS0A 2IJFA 1FXDA 4RW9A 2FJWA 4NCGA 1XIQA 1SKRA 1UMJA 2KXHA 5D4PA 3C2PA 1FJ7A 2JC0A 1IKVB 5LMUJ 1HA1A 1QD1A 3CCSS 5DM7Q 5KFMA 1SKWA 1SC4B 3ET6A 3MHYA 2B8PA 1HWIA 5IV3A 1HL6A 2PFDA 1JLEB 3IGVA 4KJIA 1BWVA 3TOQA 1MWZA 1TL1B 2EXUA 5HMWA 2RRAA 3UW1A 4M5MA 4JI0F 3J7YI 3HT0A 5I42B 2HS4A 3DRPB 2C42A 3TWZA 3NLCA 1KBRA 2VFRA 1SJRA 4IH5A 3MM9A 3MEGB 2G2OA 3DDIA 5DJBA 2DR8A 4MK7A 5D0GA 1UVLA 1HR0J 2UXDJ 3FSIA 5EN1A 1CS4B 1CQNA 2JLEA 2G0CA 1WHXA 1DHMA 3M8PA 4LVNP 4ZVUB 1RA7A 2EVZA 3CCRS 2FC8A 3BM7A 3ZC4A 3W9IA 5KFCA 2QC3A 4C8YA 3POTA 2D3O1 3CCES 2BJ7A 3HD2A 2L41A 2B43A 1KLNA 1U2CA 3DRRA 4OX9F 3ZZRA 4RO0A 3BYRA 2ZHAA 4X4UA 5FDLB 3A8KA 3IM9A 2EG2A 1KFDA 2G2ZA 2YWFA 2OPPA 2ZVIA 1NK4A 1T11A 2E7VA 1QTMA 1X5OA 3MEKA 5HI7A 2HMIA 4ILLA 3QLHA 1TR0A 1R0AA 2EC0A 4FS2A 4OHZA 5DZ7A 1IKXB 2XG8A 3VZIA 4LR7A 1FKPB 2CPZA 1H2TZ 5KFIA 4DV1F 5KOXA 4I67A 2BVZA 2RJZA 2ASDA 1Y7PA 1XNQJ 1RP5A 4KSEB 3LOUA 3PDNA 4ED6A 2BBEA 3FDSA 4B02A 4LRFA 5E2QA 3TUJC 2O5DA 1IBMF 3RB0A 5DO2A 4USVA 1M90T 3H4BA 3OXLA 2GGPA 4OYBA 4QZVB 3HPOA 4QCLA 1HKAA 3E3XA 4DDFA 2MQOA 1UVIA 4M5DA 2HHSA 4IDKA 5HMYA 4KHPF 2G9OA 5G4DA 3MPYA 4JI6F 1HNWF 2RF2A 2FVSA 1N5YB 2QMWA 1U47A 2HQCA 1FCAA 4ZVSB 1HNXJ 5GAGI 2N4CA 4OZLA 1EETA 3A4TA 2L9DA 4I6AA 4ZP9A 2ZBQA 1SIZA 4ECWA 3LAMA 3OBIA 3FSYA 4RKUC 2M52A 3K5PA 3PX0A 2EFVA 3EYZA 4K4YA 2LVWA 1EP4A 4ECQA 1MSWD 4OYOA 1CC8A 2QT7A 4FZVA 3CSKA 4C48A 1UAWA 2XMTA 2OD6A 3K0JA 2BV3A 1Y9OA 4URSA 2LA6A 4USMA 2HPUA 2X1BA 1T03A 4RBVA 2ZUGA 4P2SA 1TKZB 3IWLA 1EZZB 3I5AA 3TEGA 2V4JB 5GADI 4B9NA 1AZSA 4EI2A 2WW4A 2CQHA 2KM8C 2W4DA 2GIFA 4J5OA 4U7CA 4N8OA 4RW8A 2LDIA 2OD4A 1DTTB 2QIFA 1DQAA 2W9CB 3CD6S 4RPFA 2CJAA 4RW4B 4FYYB 3J81Y 2JRSA 3FMBA 3ZZOA 2JOQA 2DNKA 4WIQA 1C0TB 2JEIA 5F8LA 3D54A 3JSYA 5KG5A 3M4XA 3DN9A 3NY0A 1FWLA 3I5BA 1F5BA 4EBDA 1ACMB 1VQPS 2CJYB 3MR6A 3CNQP 3I87A 3FFIB 4J9NA 1TFYA 1NCLA 1ZA2B 3UDVA 4V1Ak 3HHLD 1RKIA 2DNPA 2VFVA 2WVCA 5MAOA 3HSJA 1I51B 4BLGA 1DLOA 3DYAA 1HBUB 1EAYC 4F25A 5F8GA 4XO0A 1YJUA 1H6KX 4RNNA 4DS4A 4XPCA 4ELUA 4ZP7A 4WXWA 3NMAA 1X4EA 2J9EA 4WBFA 3ZFVA 1KEKA 3BR8A 4O23A 3SIPB 1QJHA 2K1RB 4PWUA 1Q8BA 3K8VA 2DGUA 4I7FB 2W8KA 2XWYA 3K58A 4X62F 3FKBA 4DV5J 1HQUA 2CJQA 3FBEA 4DR2J 4CM2A 1TKDA 4L73A 4WU2A 3DRXA 3DU5A 1VR6A 3CE8A 4I1TA 2YQ3A 4DCOB 4LFBF 5K14A 5KT7A 2DTJA 3BO4A 2BJ8A 2VKRA 4G6VB 3MEEA 1ZOTA 1DJ0A 1R3NA 4J9KA 1HBOB 2XMWA 5LXYA 4TYAA 3BO3A 2BR0A 2XYGB 2LEPA 1NEEA 1RUSA 1URRA 1SCJB 2DXEA 1JLCB 5CD4A 1S1VB 4C11A 4ZCLA 1ZAVA 2BANA 3LW5C 2ADCA 3JAMU 4FN5A 1HHTP 3J80U 2V67A 4NX9A 2BUNA 2DCUB 4NI2B 3Q0AA 2E5GA 1SL2A 1WC1A 1RTIA 4GC7A 3BS9A 1K1QA 2X1GA 3NAHA 4TYBA 2WOMB 1YGYA 2WONA 3ULHA 2VG5B 2E7WA 2FHJA 3R6GB 1VGYA 1HW9A 2DXFA 3BDEA 1CJKB 4I2QA 5CXTA 5CCLA 4P10A 5AE1A 3PRDA 5E3CA 5J2QA 1EQMA 1JLQB 2M3DA 5JVGQ 4B3SF 2DNGA 1KN6A 5GAEU 3QMQA 1R27B 4GMKA 3MMJA 1P1TA 1Q4RA 2J7KA 1TK5A 1BQMA 1NK5A 1HQEB 3H42A 2ZD1A 3UFCX 2BXJA 3RW7A 4XPEA 4DF4A 1KHVA 2MY7A 4OI4A 3DDNA 1SL0A 3ILLA 2NXCA 1FK9A 5M2PA 2DNHA 3PJWA 1LXJA 4UUXA 5KFJA 4C3KA 5J1EB 2ZOMA 4ED3A 5ETNA 1RGVA 2KN4A 3GIIA 1K44A 4EGLA 4IH6A 1RTDB 1LEOA 2FJEB 6FD1A 4RU9A 2ZOFA 2YWEA 2ZKTA 1RBAA 3K5OA 3FC9A 5EWGA 1WG4A 2YXLA 4KKOB 3UE2A 3KXDA 3G86A 5C42A 2R7QA 3WHIA 2EBEA 1CJUA 3H5XA 1LFWA 3OR2A 3WC0A 4F3MA 5RUBA 3ZZPA 2QRRA 3I96A 2AYEA 2HFVA 1SB6A 4PABA 4ECUA 3PVXA 4G1IA 2HSEB 4LF4F 4U8VA 1VHFA 3W5ZA 4MKVA 3AA9A 1S76D 4ED8A 4JI8J 4QJVA 4B3OB 1JJHA 1ZZNA 3IM8A 3EZOA 4MIAA 1WF1A 2V63A 4TY9A 4QIGA 4F8RA 2MSSA 3D1QA 4HT5A 1R8AA 2D74B 4R5PA 2MKJA 4M5KA 2YX7A 2UV8A 1GTEA 4TLQA 1FI4A 2ZJQQ 4NA2A 3KWMA 2W7PA 3T5KA 5L1KA 2EW9A 1HMVA 4UOGA 1FA0A 1FNMA 4GKKJ 2LP4A 3C6TB 1B0PA 3VCDA 2ZFHA 2L08A 2YNGA 3Q23A 2DNNA 4J9VA 4WP8A 2V0NA 1OY8A 1QUPA 4HH1A 2N3OA 2MMYA 2N4DA 1Q82T 2W9BB 1Q5YA 2E5LF 2UXDF 1F2GA 1YZ7A 3J7ZT 2KXFA 1MROA 3LP0A 3UCZP 2B8QA 3KYLA 4PRFA 2EC2A 4LF7J 3W7BA 2KFYA 1BQNA 2Z2ZA 3Q8QB 1VQYA 4LF5F 3IG1A 3CVKA 4U9RA 3R97A 2N7CA 4Q0BB 1RU1A 2XEXA 3MPVA 4JI7J 5CHCB 4ZPTR 3GWCA 3P5TL 3R5CA 2NYHA 3IAM9 1HNIB 4RUHA 4LUBA 3WX8A 5EX0A 1Y10A 2UUWA 2HAIA 3QGHA 3BEGB 4J90A 3I0RB 4OYWA 3UN5A 1GQEA 2FY1A 2IHR1 5KFQA 1TKTB 2XS7A 3KLFB 4NRUA 3KTQA 1S49A 3OR1A 2FD2A 3EMTA 2F9DA 4KGMA 4XDDA 1SJ3P 1E6VA 1N88A 5SUHA 2GQ2A 3DOMB 1S0VA 2E29A 3TQEA 4C2MA 3AH6A 3C16B 1MNEA 4NMXA 5BYSA 1IWGA 1O5JA 4B3MF 5HLFA 3QSYB 5BYRA 2IYGA 4LJMA 1S6QA 3VVTA 4U7UK 3H7HB 1QDUB 2K7KA 4H4MA 3CJKB 5HROB 3PG9A 3GE9A 4LT6A 3PIPQ 4OMFG 2QLBB 1TTHB 2NQPA 4LF8J 3KK1B 4DSKA 1UZHA 1OQ3A 2D1CA 4NYPA 1LKZA 3THPA 4CH1A 3DGPB 1ZYQA 4DL5A 2AZ1A 3CCUS 2CPYA 2V4QA 1FWKA 2MXYA 4NCBA 4PYDA 1Q7LB 3G96A 1SKUB 4JI1J 4ZP8A 1RAJA 3LPEA 1HNXF 3NAIA 3MFHA 3K7RA 3J7A1 3JAMY 1NBEB 2QMXA 3J80Y 1VQKS 2KTQA 2FJDB 1MU2B 2ZBIA 3RB3A 1Q81T 3BQ0A 4C4WA 2GVZB 4IR1A 1K47A 1WOSA 5A2QU 1U6ZA 5C2GA 1LK7A 2P8IA 1LWFB 1IM6A 3Q89A 2DNYA 3DLEB 2P9CA 5A8WB 3TJ8A 3OD2A 4TU8A 3C19A 2ZJRQ 2OEMA 3PRVA 1U4BA 3VV2B 3DM2B 2CWXA 3WIVA 3V4IB 2HBYB 2HVDA 3R7SB 3M8RA 1ZTTA 4J91A 2VKZG 2LLZA 4OJ1A 2V34A 3P49B 5MLCV 3AD7C 1Q7YT 7FDRA 1S1TB 4KTQA 2HVZA 4ZOSA 2NXJA 3CJ8A 4KV8A 3HVTA 4OLPA 4DLGA 3FEZA 4ECYA 3JQJA 1RBOB 4X66J 4E0DA 2DR9A 2BACA 5I3UB 4O44B 4U95A 4C8OA 2BE9B 3RAQA 4AL5A 4OYAA 3NL0A 3OXGA 2CVIA 3RBDA 2HGMA 4FYVB 5B08A 2XMMA 3CJSA 3BGOP 4FKXA 4HI1A 3GILA 2RIJA 4LFAF 3GV8B 2HWTA 3BKFA 4K8RA 1LV5A 2HHQA 4DG1B 4RUAA 5F3ZA 3KUEA 1B64A 1SV5A 2ASJA 3RB6A 3CB4A 3KJVB 5AJ3J 4FYDA 1CJTB 2GFFA 1FVQA 1Z1ZA 4WFZA 2DO4A 1SJ1A 4OV6A 3IA0A 1WJ9A 2WRMA 1SI9A 1FD2A 1RAOA 3KG0A 1VOMA 4PZVA 5D3GB 2F8EX 3V81B 3EE3A 5GAEI 3EICA 4G3IA 2HHHF 3M2UB 4ZVHA 3TJ9A 3IS9B 2FHJD 4P75A 1VQMS 2FLLA 4RNHA 3M30A 2DHXA 1S1XB 1YJTA 3MUMP 2XI2A 1HARA 2AJ0A 5CYQB 2JEFA 3VF0B 2WCXA 2B4VA 2ZH6A 3MMBA 1DZ5A 2Y1RI 1VLOA 5C24A 4GO5X 1JLGB 4HH0A 3TANA 1QSYA 2F3JA 2IRYA 3DMJA 1U26A 1SIWB 2OGUA 3HF5A 4FPRA 1QTNB 1UKUA 2G13A 4TN2A 4LRCA 2DNZA 3UR3C 5KFUA 3CCWA 1F1BB 2ABYA 4TNOA 3RGIA 1YJNS 1NPKA 1CJVB 4ELTA 1VC6A 5AXMA 2AW0A 4KFBA 2H4YB 2VH7A 4IRCA 2CAJA 4CH0S 1U0HA 3Q86A 1S4EA 2DNQA 4QW8A 1Q1KA 1WC3A 2PI4A 2RILA 1DY3A 3G6XA 1RSCA 1HPZA 5E3RA 1NHKL 2APOA 2VV5A 2K3IA 3BGRA 3ILJA 5ETRA 2FJVA 4WTOB 1ZPVA 5B0BA 3EDQB 3R7NB 2POKA 3DRSB 5CABA 3HJVA 1Z2ZA 4WYLA 3QWUA 2E66A 4DFMA 2DRAA 4DV3J 4F02A 4F4AA 5IC6B 3WIUA 2W1BA 2O01C 1RLDA 4X4TA 1RT1B 1X9MA 3H2VE 1RT2B 1YSJA 1NK8A 3D6MB 5J2PA 3MR7A 2RD5C 4F04B 5HVGA 5M2RA 2I0XA 2C2OB 2YX1A 1BD6A 1TK0A 3M8SA 1H98A 1Q79A 4DR7F 2MQ8A 2RUSA 1NK9A 3MD3A 3D5MA 4DSIA 2NREA 4L6V3 2XMKA 3TAMA 1U7LA 2I5JB 1FFSB 3PR5B 3U27A 3KK3A 4Y0FA 5E5NA 4CRJA 2XO6A 2ZH1A 2JHEA 2YPYA 1WTFA 2MQLA 4J9RA 5HBMB 2CPXA 2M70A 1P6TA 4OX6A 3MTKA 5GMDA 4ZVRB 4ED4A 4FKYA 3JTOA 3DGVA 2CZVC 1FXLA 2JH3A 5HQLA 3BDPA 3LTOA 4AFFA 1OPZA 3ZO7A 2MKHA 3E01A 4PEOA 1U48A 2DGTA 1S79A 5ETVA 2QMUB 2AU0A 2J9DE 1X9SA 4YY3J 3BGLA 1B99A 4Q8FA 3HHKA 5A2QY 1HNVA 3PM9A 4CNYA 3FUYA 1RB0A 5A8RB 1CLFA 2OPRA 6AT1B 1N34J 1FEHA 1PKUA 3IN5A 5FD1A 3A8JA 3TA0A 3I5CA 5E0OA 2RAQA 5IQ6A 4K4ZA 2RQCA 1S0NA 2HFUA 4CO2A 4DFPA 2XNRA 5D8HB 1F60B 5KFKA 5JMNA 5C2CA 4IOAQ 1GT8A 3NEKA 1RYSA 3EXYA 2CNKB 2LQ9A 3SCKE 1BE4A 4ZP6A 1U25A 1FDBA 4LF7F 3GCWP 3EJMA 3W61A 3OUYB 2M8DB 3DFEA 1N5QA 3M6WA 3MR2A 2MQPA 3C15B 3H5YA 1P9YA 4H4OA 1YJ7A 4YR2A 3HHEA 1VHIA 1LWCB 4B3RJ 5L39A 3RYLA 1IVZA 3M8QA 3BBBA 4ED0A 2Y1LB 3LQVA 3CJ5A 3N5FA 2QL7B 1X8DA 2RMLA 3NS5A 1LNQA 4TY8A 3ENQA 2DGVA 3EX7B 3Q2TC 2PA3A 1KFSA 5HMZA 2G1HA 3M8ZA 2DGOA 3PX4A 2AJ2A 1VYAA 2RDDA 2B7BB 1N0VC 3PACA 2VG6A 4DUYF 4DX8H 4B3TF 3ITHA 5BR8J 1N48A 3LPYA 4NLSA 1RTHA 1ZZFA 3LF0A 4DR5J 2WVFA 3J7Z5 2LU1A 1C1BA 3T1YJ 3NS7B 4P73A 1M5KC 4X4SA 1U1PA 4PR6A 5KFGA 3CO9A 2DHAA 5JXSA 3MM6A 1OYDA 1WOOA 4GVBB 2ZHOA 2KM8B 5B0EA 1S6OA 3PR4A 2XULA 2NZCA 2I6WA 1IBLJ 2YNHA 4NXNJ 2DY9A 2R7TA 1D8ZA 4ANEA 2IBOA 2KJWA 3KUGA 4WCEQ 1WF0A 3IMQJ 2H54B 1SQEA 2CJBA 4XTTA 2EKYA 4DQSA 2JJ4D 3QIPB 3NGSA 2W2NP 4Y34A 2E1RA 1ZAWA 4NLQA 3EDRB 1YBUA 2NXNA 5KFOA 1S6PA 2FGCA 2FJBB 4KGKA 3F56A 2OSRA 1SH2A 3QO9B 5AXNA 1N6QA 2QA2A 4M5GA 1ZBTA 2Z4PA 2HHTA 2MKSA 2LA4A 1N52B 4ZJLA 1R43A 2MEWA 2AJ4A 5J2NB 1VISA 2C3MA 2R7VA 3PFOA 4PXBA 3VQSA 2ZBCA 2NSCA 1OIAA 1T9VA 3AJ1A 3W8GA 2YKOA 5F0UA 2YNFA 3RBEA 3T6JA 3FEXB 4USWA 2HQFA 4JI3F 1HD0A 5T41A 1Q95G 3KJQB 4LREA 3DOMA 2DO0A 2JLGA 2MHNA 2BOPA 2FHKA 1VQSA 3C16A 1LW2B 4IFVB 2RT3A 4FDFA 1YBTA 3GFXA 2DGSA 4DL7A 4X66F 1XR6A 4U7UD 2VQEF 3QRRA 4KO0B 1KD1T 1V5VA 4WKRA 3C6UA 3IO1A 2XWXA 2CPEA 3MM7A 5D78A 2FLNA 1HWJA 4RLEA 1TMJA 4FNIA 5AXKA 2VFUA 4IOBA 1SQFA 4JI4F 5CH7B 1F5AA 4F3OA 3TX0A 4DV7F 3OFFA 1KKHA 3GJTB 5CYJA 1IWAA 1TV6A 2ZM6J 5F9NA 4MK9A 3ZTRA
chains in the Genus database with same CATH topology
3HSZA 1F9HA 3ILOA 4M5GA 3MCNA 1EX8A 5ETPA 4M5IA 5ETLA 3KUEA 1RU2A 5ETOA 1RAOA 5ETSA 4CRJA 3HCXA 1TMMA 1RU1A 3HD1A 3KUGA 4M5NA 5ETNA 2F63A 3UDEA 4F7VA 3KUHA 4PZVA 5ETQA 1HQ2A 3HD2A 3ILJA 3UDVA 3ILIA 4M5HA 3QBCA 5ETRA 4CYUB 5ETMA 1CBKA 3MCMA 3MCOA 1EQMA 4M5MA 5ETTA 1TMJA 2CG8A 3HSDA 3HT0A 4M5KA 2F65A 4M5JA 1RTZA 4M5LA 2QX0A 3HSJA 5ETKA 4CWBA 1HKAA 1RB0A 1G4CA 1DY3A 3HSGA 3UD5A 5ETVA 3ILLA 1EQ0A 3IP0A 4CYUA 2BMBA 1Q0NA 4AD6A 1KBRA 1IM6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HSZ A;  1F9H A;  3ILO A;  4M5G A;  3MCN A;  1EX8 A;  5ETP A;  4M5I A;  5ETL A;  3KUE A;  1RU2 A;  5ETO A;  1RAO A;  5ETS A;  4CRJ A;  3HCX A;  1TMM A;  1RU1 A;  3HD1 A;  3KUG A;  4M5N A;  5ETN A;  2F63 A;  3UDE A;  4F7V A;  3KUH A;  4PZV A;  5ETQ A;  1HQ2 A;  3HD2 A;  3ILJ A;  3UDV A;  3ILI A;  4M5H A;  3QBC A;  5ETR A;  4CYU B;  5ETM A;  1CBK A;  3MCM A;  3MCO A;  1EQM A;  4M5M A;  5ETT A;  1TMJ A;  2CG8 A;  3HSD A;  3HT0 A;  4M5K A;  2F65 A;  4M5J A;  1RTZ A;  4M5L A;  2QX0 A;  3HSJ A;  5ETK A;  4CWB A;  1HKA A;  1RB0 A;  1G4C A;  1DY3 A;  3HSG A;  3UD5 A;  5ETV A;  3ILL A;  1EQ0 A;  3IP0 A;  4CYU A;  2BMB A;  1Q0N A;  4AD6 A;  1KBR A;  1IM6 A; 
#chains in the Genus database with same CATH topology
 4JYA J;  1S7H A;  3G8S A;  5HP1 B;  3OTO J;  3UVJ B;  2VQF J;  2YQ0 A;  1N8R T;  2YNI B;  2OMO A;  4DV6 F;  4DR3 F;  1NB7 A;  1Y5N B;  4NZ0 A;  3KLE B;  4LRA A;  3ZZ0 A;  2Q1L A;  2GVZ A;  4WE1 B;  3CDB A;  3US5 A;  2R7R A;  4X4P A;  3O3L A;  2IDE A;  4ZKA A;  4ZPD A;  3BF4 A;  2CVE A;  4DN0 A;  1JJ2 R;  4K5R A;  3NGD A;  3TUI C;  3DM2 A;  3EWG A;  4BCA A;  1SC1 B;  2F4V F;  2AT1 B;  4DX6 A;  2ZH8 A;  4ZHR A;  5KAK A;  3MCO A;  3CJ2 A;  5IV4 A;  4K7Q A;  4AYB D;  2YKM A;  1X31 C;  2ADB A;  2KG1 A;  2VPW B;  2B3T B;  2CXE A;  2ZH3 A;  1WKL A;  2VBX A;  4HHJ A;  1VK3 A;  2KFN A;  1IKY B;  4P2M A;  2DCL A;  4QYZ K;  1S9E A;  1LFP A;  2WW8 A;  3QAE A;  1SJ4 P;  2KT2 A;  4FF3 A;  1Y11 A;  5KFV A;  1V6H A;  3O2I A;  2BE2 B;  1UW4 A;  3BBC A;  3HM9 A;  3MR3 A;  2AJQ A;  1FNX H;  4QU6 A;  2YH0 A;  4O0N A;  2DJW A;  1MMN A;  4ATN A;  3GYX B;  1PBA A;  4NE9 C;  2FVQ A;  5HQ8 A;  2GML A;  3SCJ E;  4YDX A;  2PMW A;  2PN6 A;  2FDN A;  1RI7 A;  5C25 A;  4KQZ A;  2AX1 A;  4DG1 A;  1L3S A;  4LR9 A;  4KGX B;  2X51 A;  4DPO A;  4O4G A;  4DFJ A;  4U96 A;  4R0J A;  2WAQ D;  4FNH A;  4RUC A;  5K5M A;  5U47 A;  2NS1 B;  2RVJ A;  2LEB A;  2PT0 A;  4HKQ A;  2HLU A;  4NLO A;  1REV B;  3V81 A;  3FVY A;  1K9M T;  3UPF A;  5HL7 Q;  3QWP A;  3IRX B;  1N5V A;  4OYI A;  2HWI A;  3C14 B;  1XTZ A;  1OSC A;  3CUL A;  2CQB A;  2HRU A;  4ZCK A;  2QA4 G;  2YKP A;  5DM6 Q;  1FKO B;  2ZH5 A;  1UA0 A;  4K2X A;  3TO8 A;  2QL5 B;  4OJ3 A;  2MQQ A;  4USI A;  2AYG A;  1J5O B;  1VS3 A;  4IG3 B;  4YQW A;  4QYZ J;  1H74 A;  2OEL A;  1NPP A;  2HIQ A;  4DWI A;  2XSJ A;  3NXZ A;  2RNE A;  1BY9 A;  3D7S B;  1YDL A;  3VGU A;  2AYM A;  2HNZ A;  4MH8 A;  1X4G A;  5LSO A;  1OY6 A;  2XMV A;  2RHS B;  1X7V A;  1DBD A;  5F8M A;  3W5Y A;  4CTA B;  1DTQ B;  1XMQ F;  4UOC A;  3PW7 A;  2ERR A;  1XNR J;  2ROP A;  3AB4 B;  1S0M A;  3GU0 A;  5K8O A;  3TUZ C;  2QL9 B;  2DIS A;  2GC8 A;  2JC1 A;  4Q2M A;  2GV1 A;  2L3M A;  1OS5 A;  3CMQ A;  1BMQ B;  4IKA A;  4C0B A;  5JJB A;  2OI2 A;  4CLZ A;  2JNJ A;  4CYU A;  5IM0 B;  5JUM A;  3C8Y A;  2C3Y A;  2MJN A;  2Q66 A;  8RUC A;  4J9M A;  2KU7 A;  1HW8 A;  3R3T A;  4C8M A;  3MAH A;  4PKD B;  1H38 A;  4ZLL A;  3EVW A;  4DEZ A;  3T1H F;  5E3Q A;  3FRY A;  1WC0 A;  3O5T B;  1FX2 A;  1RA6 A;  2XSF A;  5B09 A;  4HTJ A;  2IA0 A;  2VOP A;  3DHW C;  1ZH5 A;  3DXS X;  3HKW A;  2PO4 A;  4ILM A;  3M6X A;  1HWK A;  4A8W A;  3G82 A;  1GNK A;  2BMB A;  1E6Y B;  2LXF A;  1S77 D;  2UXC F;  3I9V 9;  2RS8 A;  3EZU A;  1TVR B;  3OJS A;  1VQ8 S;  2MGZ B;  3M1V A;  1UWB B;  1RT2 A;  3KFW X;  4P6Q A;  1ARO P;  1N32 J;  2KFZ A;  1A7G E;  1M5V C;  5KG3 A;  1N4L A;  3EPG A;  3GON A;  5H9E K;  1X4H A;  1Q78 A;  2DH9 A;  2OEK A;  2V5H G;  2BOA A;  1BGX T;  4N8N A;  5KFF A;  3CF5 Q;  1IJF B;  2HYI B;  4DL0 C;  4DXL A;  5AE3 A;  4EMD A;  2KYZ A;  2AX0 A;  4J9L A;  2WVE A;  1OWX A;  3P3D A;  4HHH A;  2V4R A;  5F0W A;  1HWU A;  5BXI A;  5T7L B;  4KRW A;  4IR9 A;  2XO7 A;  2HQG A;  3ISN C;  4CLK A;  2I2Y A;  1VC5 A;  2EFP A;  2VOO A;  4I4B A;  1BWE A;  4GKJ J;  1HQ2 A;  2OPS A;  3PJX A;  2DHS A;  1WI6 A;  4AND A;  2IM1 A;  3Q8R B;  4ITS A;  2C3O A;  3VGV A;  4RZR A;  1NDK A;  2W7A A;  3P8B B;  1ZM4 A;  1Y00 A;  3ZXW A;  2HNY A;  1UJ6 A;  3V6D A;  4P72 A;  4DR5 F;  4C8Z A;  2M8H A;  2CQ4 A;  2PGC A;  4LF9 J;  3NMR A;  3M2V A;  3PV8 A;  4HAC B;  1WDD A;  4WJB A;  2KDO A;  3K17 A;  4QIW D;  2MZJ A;  5D0R A;  3GFY A;  4DHV A;  4ETX A;  4FVM A;  3BN4 A;  4F50 A;  1SC6 A;  4JI2 F;  1YRX A;  2FHM A;  5DG9 A;  1HHS A;  4CO4 A;  2DXD A;  2Z57 B;  1P9Q C;  4DCP B;  2FLP A;  4M5J A;  1UZD A;  3CDU A;  4Y00 A;  4DOZ A;  1S4F A;  3PW0 A;  3NCR A;  4ED2 A;  2Z30 B;  1NK7 A;  2NCK L;  4B9U A;  1H2U X;  2VPZ B;  1SL1 A;  1IBK F;  3KMQ A;  3ILO A;  2GW8 A;  1GK8 A;  1S7I A;  3GPA A;  3ZZT A;  3OSN A;  3RTV A;  5A0Y A;  1EIY B;  2DRD A;  1NKE A;  1W2B R;  3LAL A;  4IRK A;  1XR5 A;  5DG8 A;  3L95 X;  4KC5 A;  4B9L A;  4ETZ A;  1R8H A;  2CZ9 A;  4NEZ A;  2IM3 A;  3DLL Q;  3IC1 A;  1IKW B;  3KOA A;  3MTJ A;  1AUS L;  4C3M A;  2OML A;  1X4F A;  1DAR A;  4RW6 B;  2XYH B;  3AOC A;  2NLW A;  3D6H B;  4FS1 A;  3HK2 A;  3UN3 A;  4TU9 A;  4ED7 A;  4EZ9 A;  2Y1J A;  1KSP A;  1KOO A;  2A1B A;  1AA1 B;  4DV0 F;  1X0F A;  4PQU A;  4IYQ A;  2JEJ A;  1GAO A;  4DX7 A;  4K4T A;  1TL3 A;  2M4M A;  1KLM B;  4A47 A;  5T14 A;  5L1L A;  2NPI A;  2KHC A;  4O3O A;  4ED5 A;  1JKH B;  5E3P A;  2QTW A;  4IFY B;  1GTH A;  1ZET A;  2GJI A;  1YKW A;  2HWH A;  3HCX A;  4F0H A;  4DCJ B;  2IVF B;  3PXG a;  3V6J A;  3EGZ A;  5DET A;  1VRU B;  4EFA C;  5LMN J;  3QID A;  4CT8 A;  2B5J B;  3OTD A;  4ES1 A;  1U6F A;  3CGI A;  1YLX A;  4EYH B;  2XMA A;  2FZK B;  2ZM6 F;  2R2S A;  3A12 A;  3W8P A;  1MW7 A;  2OAU A;  4YEA A;  3PKM A;  4JV2 A;  3OVA A;  4Y2A A;  1PGZ A;  3UDC A;  3MF5 A;  3OTO F;  3SSR A;  3L9Z A;  3UR0 A;  2DKO B;  2UV8 G;  2OKQ A;  2XLJ A;  4AXI A;  2FPH X;  4ES3 A;  2NXE A;  3NGK A;  1RJJ A;  4RNM A;  2HBR B;  2OPQ B;  2HVI A;  2OH2 A;  4EO8 A;  4OLO A;  5J2N A;  1WI8 A;  3AD8 C;  2GNK A;  3D0G E;  4G1Q B;  4DR1 F;  2J6T A;  1TK8 A;  3IR5 B;  2IPO B;  4UTG A;  1VRT B;  1NKC A;  1WWH A;  2XBP A;  3D4J A;  4KHR A;  2VL1 A;  2AP6 A;  2OJ3 A;  2MKC A;  1KTQ A;  3MR5 A;  4DSF A;  3MD1 A;  3N5B A;  2XYP B;  1MML A;  3MMC B;  3DXB A;  4KO0 A;  4HTI A;  5GMK a;  4QW9 A;  1NH8 A;  1UEK A;  4CWB A;  4YUD A;  3HHL A;  2JVO A;  5KG1 A;  4LSZ B;  3W5X A;  1F5C A;  1JXL A;  4YHH J;  3L3C A;  1DQ9 A;  3RRG A;  2QGF B;  2XY7 A;  1W25 A;  1TUW A;  4UQT A;  3FQL A;  1NJX A;  3IWX A;  4I64 A;  1VBK A;  1B7Y B;  5KFW A;  1RT6 A;  1HNZ J;  5A8K B;  5SZT A;  2E1A A;  3I0S B;  2KI2 A;  3ENW A;  1HBN A;  1Q86 T;  3UVJ A;  2P6T A;  2CA9 A;  1FJC A;  2V6A A;  2GQQ A;  1NO8 A;  3PHT A;  1NDP A;  1M1H A;  3TEH B;  3FCV A;  2G1D A;  1LWX A;  3KLE A;  2JSX A;  1U6B A;  5B0G A;  3EXC X;  2MLX A;  4PPZ A;  2J6U A;  3NP5 A;  1RWX B;  1RT7 A;  5D4O A;  4Z37 A;  3P5B P;  3UD5 A;  4EBE A;  1X9W A;  1HWL A;  2A2C A;  2KT5 A;  1OPI A;  4NXM F;  5CA5 A;  1LQ9 A;  1TAU A;  3QAU A;  5CD4 H;  1T9U A;  1RWK B;  4OYM A;  3W2V A;  4CZC A;  4HT7 A;  4B08 A;  2X7I A;  3KLG A;  5AXL A;  1V3S A;  4YP3 A;  5DGB A;  2WVD A;  3ENA A;  4Y2K A;  3SDE A;  2U1A A;  2EBG A;  2HQ3 A;  2H48 B;  1SJQ A;  2WBM A;  3QFW A;  4UUW A;  2J8A A;  3FZB A;  4PUO B;  2HZC A;  4ZJO A;  4E2F B;  3KHG A;  4XDC A;  2QJ3 A;  5G0R A;  3BGF A;  3WDO A;  5IZH A;  2F65 A;  5EHH A;  2C28 A;  3CCL S;  3R1L A;  1PYS B;  1NZA A;  4KH0 B;  3OFE A;  2BX6 A;  3HX9 A;  3RRH A;  2CPF A;  2DEJ A;  3DDK A;  5GME A;  2EFO A;  2HGL A;  3MEC B;  1FHT A;  1EHW A;  2R4F A;  2H9Z A;  1QM9 A;  2XLI A;  5KG6 A;  5KFH A;  1LW0 A;  1RCX B;  1JK9 B;  1LWE B;  3EM1 A;  4A8Q A;  2D3O R;  2IA6 A;  2DGW A;  1T3N A;  3R5A A;  2XY6 A;  3BSC A;  3ETO A;  5K8M A;  3PTW A;  2IJN A;  3TR5 A;  3SEO A;  2HEK A;  5DGA A;  4OX7 A;  4MK8 A;  2BEF A;  3IFE A;  3PEH A;  2FZG B;  2ZKU A;  1KTV A;  4NLD A;  3MFI A;  4J9U E;  3BB5 A;  2QFI A;  3OL9 A;  2DH8 A;  2ZHB A;  4USK A;  4KPC A;  3TVK A;  3OV7 A;  2Y8Y A;  3MMA A;  3PKY A;  2ALY B;  1N32 F;  3J81 j;  1TKX A;  3CC7 S;  3HVR A;  4C9D A;  1XMO J;  5KFA A;  4A48 A;  3GMG A;  4ID5 B;  3H20 A;  4C8N A;  4I2P B;  5KTQ A;  3LGN A;  3SI8 A;  1KQG B;  4IG3 A;  2MZR A;  2MZQ A;  1FFG B;  4WFB Q;  3A13 A;  4OZN A;  4USJ C;  2HFZ A;  3KLI A;  4A8X A;  4J9O A;  1X5S A;  3VGT A;  3HSD A;  3LP2 A;  3RJM B;  5B0C A;  3OL6 A;  1WD6 A;  1MN9 A;  3M32 A;  4JOU A;  2BKN A;  4YS2 A;  3DI6 B;  4ZVO B;  1NB2 A;  4R8U B;  2ZWP A;  3T41 A;  4ECX A;  1RT3 B;  7FD1 A;  4ER8 A;  1NND A;  5L1J A;  2L9W A;  2BQU A;  2UUC F;  2EK1 A;  4OHY A;  3CME S;  1S9G B;  2B0G A;  1QE1 B;  3GV7 B;  1VQ5 S;  1FT8 A;  3KLH B;  1N33 J;  3CJT A;  1RHR B;  3JYT B;  5IM0 A;  3LWM A;  2IY5 B;  1HYS A;  5HSP A;  5AT1 B;  2RU9 A;  1B7F A;  1JLB B;  1WKK A;  2R7U A;  4AT1 B;  1FRM A;  3DLJ A;  4U6P A;  1R6Y A;  1GMU A;  2C3P A;  1YG0 A;  2V2K A;  4X4R A;  1FDD A;  6FDR A;  2ZJP Q;  4ECR A;  1FJG J;  1W7W A;  3JS9 A;  2VPY B;  1PIL A;  2NR0 A;  4Y2I A;  3D3C J;  4BWJ A;  2DIV A;  4M1K A;  5B7W A;  3CO0 P;  2C2R A;  3TAR A;  5DG7 A;  1Q8I A;  3DLG A;  3VWS A;  4F0M A;  4HLB A;  2MGZ A;  2UUB J;  4ZVP B;  5THW A;  1RAG B;  5F8I A;  1Z4U A;  4K4V A;  4DR6 J;  1H7X A;  5J2M A;  2FIU A;  4ZVF A;  4HHU A;  3IBF B;  4USH A;  4XAK A;  4ICL A;  4QIV A;  2GHV C;  2DGX A;  3CJ4 A;  4LSN B;  4FVC A;  2W2M P;  2R8G A;  4LSL B;  1C1C A;  1T05 B;  2VDH A;  2ZOG A;  4OJG A;  4LIW A;  1TL7 B;  2W24 A;  2UXB J;  3BH7 B;  1AFJ A;  2FUG 9;  3AB2 B;  1FVS A;  3M2R B;  3LAK A;  1CUL B;  3EGW B;  4FBU A;  3D0I E;  4DBQ A;  3LP1 A;  1G7C B;  3DC2 A;  3DLK B;  4ZVT B;  4AL6 A;  4PG5 A;  4RW9 B;  2ZVS A;  3Q2S C;  4NCG B;  2W25 A;  2XS2 A;  3BR9 A;  4ZDN A;  3QSI A;  3JSM A;  1FJE B;  4ZVQ B;  3ET6 B;  4FXD A;  3TAP A;  2RRB A;  5HVH A;  1B3T A;  4LMZ A;  2EFQ A;  4K0K F;  3NNC A;  5DQI A;  4NLV A;  3MM9 B;  5DDQ C;  3MM8 A;  5BJR A;  4DR4 J;  1VI7 A;  3MCN A;  2UU9 J;  1V9O A;  3WZ0 A;  3R27 A;  1F0X A;  2N3L A;  1H7W A;  4U67 Q;  4DV2 F;  3G6V A;  1HBM A;  3M8P B;  1U09 A;  3R5D A;  3F44 A;  5FJ4 A;  3D68 A;  2DR7 A;  4CLS A;  3POT B;  4KAI A;  5E3A A;  3I82 A;  2H5E A;  4Q5V A;  5KG2 A;  1J5E J;  3QGP A;  3DRR B;  3BGU A;  1M0S A;  5IS2 A;  1ROF A;  3KK2 A;  3JQK A;  1FWP A;  2GVD A;  2QX0 A;  2VA3 A;  4NOH A;  1JLA A;  4QPX A;  4DSJ A;  2OPP B;  1JLF B;  5KG0 A;  1RE1 B;  4NZ7 A;  1KWM A;  1WOP A;  1HFE L;  1NKB A;  3QT6 A;  2YQ1 A;  3ADA C;  2DR6 A;  2HMI B;  3GIM A;  1I94 J;  3QLH B;  2ATL A;  4RW7 A;  1R0A B;  4DUZ J;  2M5Y A;  2RUG A;  1RWV B;  2IM2 A;  4P7V A;  4KGZ B;  3BPS P;  3Q8V A;  2GAG C;  3SZ2 A;  4DQR A;  1UPM B;  3A3O B;  3TUP A;  5HAN A;  3TW0 A;  3OHA A;  3PYE A;  4BBY A;  4DSL A;  1S1U A;  2WSE C;  1O6X A;  4F4Y A;  2YKQ A;  2KVQ E;  2KJV A;  2B6A A;  1KHW A;  2YWK A;  2J5A A;  3K57 A;  4F67 A;  4PG7 A;  2BQ3 A;  1UTA A;  2JL9 A;  3R8Y A;  4Z7C A;  1FD8 A;  4PG8 A;  4UT4 A;  5HJY A;  2HZV A;  2D3Z A;  2GGP B;  3DOK A;  3KG1 A;  3VR1 A;  3LGM A;  1MG7 A;  4YB1 P;  2MB0 B;  1YRU A;  2KRB A;  4M5D B;  4DV4 F;  3KHL A;  3DCA A;  4OZJ A;  1XEZ A;  1Y3J A;  2BJ9 A;  2G4B A;  5CAA A;  3SV4 A;  1YI2 S;  1Q16 B;  2HVH A;  4ED1 A;  2WVB A;  3MPW A;  3HI9 A;  4NPO A;  1H72 C;  5KFN A;  2RF2 B;  3C46 A;  4DQI A;  1N36 J;  2BJE A;  2DNM A;  1KQS R;  1EKR A;  1APS A;  2UUA F;  2BRL A;  1EET B;  3CIM A;  3P4U B;  2IMW P;  4I56 A;  5FLX U;  2NUH A;  3BKU A;  3UD4 P;  1FDA A;  1X5T A;  4ECS A;  3K8W A;  4M8L A;  2W2Q P;  3H2L A;  4OX9 J;  2XMJ A;  3TNV A;  1EP4 B;  1A6L A;  1S72 S;  2BYC A;  4DSE A;  1OO0 B;  1SUQ A;  1DFD A;  2KG0 A;  2R2U A;  5GAH U;  1U2F A;  2KO1 A;  5KG4 A;  5E41 A;  4F3Q A;  3WC2 A;  3C66 A;  2FTR A;  4WXO A;  5KFD A;  1TQL A;  4WF9 Q;  1PCA A;  4PXC A;  3W1Y C;  4Y2C A;  3G6E S;  1GEH A;  4KYZ A;  1WUU A;  5KOW A;  1C2P A;  4DV1 J;  3OTE A;  3G9C A;  3WBZ A;  2B4O A;  4DLE A;  1G6B A;  2ZE2 A;  2J0S D;  4RW8 B;  1S1W A;  5ETP A;  5ADZ A;  3U1N A;  2E5H A;  4OIX A;  2HK3 A;  2YH1 A;  1X4D A;  2XNQ A;  3E8O A;  2MKY A;  1RT4 A;  3JSB A;  1X60 A;  1D8Y A;  1S5Z A;  3B78 A;  2XC9 A;  1FRL A;  3J7Y U;  3MI7 X;  4ZVG A;  1IXK A;  4PWD A;  2N82 B;  1Y4Z B;  1Q5V A;  2AGQ A;  1VRT A;  3S01 A;  3S6E A;  1QSL A;  1QY7 A;  4OZ0 A;  2ZZN A;  1MLA A;  1RT5 A;  3VAI A;  3HT3 A;  3FBC A;  3AJD A;  2QZ8 A;  2YKN A;  4EEY A;  4JI6 J;  1HNW J;  2ROE A;  4UW2 A;  4X4Q A;  3FNN A;  1RTJ A;  3EVM A;  1DLO B;  3DYA B;  3UD3 P;  1UVM A;  1XC9 A;  2DT9 A;  4ZCI A;  1UA1 A;  4LF6 F;  3UI3 A;  3VAK A;  2W4C A;  2M88 A;  4NLP A;  1FER A;  3AHP A;  3LO3 A;  1V3Z A;  2LEC A;  4K5S A;  3EUN A;  4O3R A;  2QLW A;  2IC3 A;  1VRQ C;  3CJQ A;  3OW2 R;  4LBP A;  2B9X A;  2V2Z A;  2IVY A;  3PCO B;  1EAR A;  2ZEJ A;  3FZ2 A;  2GIQ A;  1HQU B;  3D6T B;  1BHN A;  3GIJ A;  3W2W B;  3KDO A;  2BRK A;  1S6U A;  2B9W A;  4WK3 A;  3H4D A;  2FVP A;  2XZW A;  5K14 B;  4AD6 A;  3NCP A;  2RE1 A;  2OUG A;  4PAA A;  3MEE B;  1MWY A;  2AD9 A;  4UY8 T;  3HHN B;  5IWA J;  5IOL A;  5LMU F;  3HDS A;  4W92 B;  2VIC A;  5IXU A;  4MFB A;  3G8Q A;  2PII A;  3AAW B;  2O67 A;  2MZS A;  1G2E A;  2RKI B;  4FYW B;  4ZIW A;  1KQF B;  2BAN B;  1PYT A;  4CO0 A;  3NGU A;  4A46 A;  2Q43 A;  3PEJ A;  1U8W A;  2BA9 A;  1HR0 F;  3MM5 A;  1ITP A;  4DL4 A;  1SH0 A;  3ICL A;  1RTI B;  4OHW A;  4I68 A;  5LJ5 Y;  2A0F B;  1PYO B;  5I3P A;  1VIX A;  4L75 A;  2YTC A;  1F3F A;  4LRB A;  3AQP A;  2WON B;  2YBV A;  2EI5 A;  2DR5 A;  4P7T A;  3IGN A;  4Q7A A;  1RWP B;  2LQB A;  4I2Q B;  2XMU A;  4O0I A;  2H4W B;  4CLT A;  3RB4 A;  1PC4 A;  1X5P A;  1Y5I B;  5J2Q B;  1IN0 A;  1SVD A;  1ICE B;  2BZ2 A;  1QAJ A;  1T3O A;  2VU5 A;  4JB8 B;  4DL2 A;  2CFX A;  3VZH A;  1C4C A;  2GX8 A;  1S10 A;  5LOQ A;  4O3N A;  5HQM A;  1BQM B;  2C2K B;  2V8D A;  4YOE A;  1LWE A;  3GSI A;  2ZD1 B;  4X62 J;  4ZIT A;  3CD0 A;  4LQ3 A;  1RHJ B;  4LR8 A;  2ZC3 A;  1FK9 B;  2GCF A;  4C6A A;  1IBC B;  2CPD A;  3PIO Q;  2EPI A;  4LFB J;  2GAH C;  2CIM A;  2ZH2 A;  4IRD A;  1XNQ F;  2DBB A;  4I6W A;  1IKV A;  3N28 A;  3T5H A;  3AJ2 A;  1FFW B;  1MN7 A;  2UUB F;  5C7P A;  4G65 A;  2OHD A;  1JLE A;  3N6M A;  2E5J A;  5C42 B;  3THV A;  4HDG A;  1CJU B;  1TL1 A;  3OR2 B;  5I42 A;  1D09 B;  3DRP A;  1O8B A;  4C7Q A;  4OQJ A;  3MEG A;  2PMH A;  4L72 B;  1JNZ B;  1CS4 A;  4C3L A;  4BS2 A;  4PPD A;  1VIO A;  4UST A;  2UXB F;  3DLH A;  2E1M C;  3OL7 A;  1D1U A;  5L9N A;  3D6F B;  4UF4 A;  5FLX Y;  4K59 A;  4WPA A;  4R5P B;  1K0T A;  4BC9 A;  3HD1 A;  3OLA A;  4JV0 A;  1FRK A;  2QA1 A;  1YZ6 A;  1F9F A;  5FDL A;  1M5S A;  2VFT A;  4QIF A;  2RB7 A;  1HMV B;  5F8H A;  2WHO A;  4CNZ A;  4M5N A;  3JB9 k;  4YB7 A;  4J37 A;  4B3S J;  2LXU A;  4A8Y A;  4MIW A;  4F36 A;  2I38 A;  2LKZ A;  5D0E A;  3OLB A;  2YNG B;  1YJ9 S;  1L5U A;  4QWA A;  1BLU A;  2XQC A;  2D9P A;  1IKX A;  3OHB A;  1Q0N A;  2GMJ A;  1FKP A;  1MWQ A;  2NPF A;  1QVG R;  2PA8 D;  3Q8Y A;  3DU6 A;  1TMM A;  2IRU A;  5IC4 B;  2FQQ B;  4L3K A;  4D3H A;  4NYZ A;  1KVK A;  2NSB A;  3NBP B;  2AZ3 A;  4OYZ A;  2ZUA A;  3PO4 A;  4E8U A;  1X4B A;  3H8Y A;  1MRO B;  3H59 A;  3K59 A;  3LP0 B;  1YHQ S;  5L1I A;  4ZLJ A;  2A10 A;  1BQN B;  2VBZ A;  2VJV A;  1W26 A;  1YTY A;  2CJ9 A;  3SSS A;  2PMZ D;  4A4J A;  1KS2 A;  1GX6 A;  2PD1 A;  2E5I A;  5JVH Q;  4RBU A;  1NSK L;  1J2V A;  1Y3K A;  1FTC A;  2HHP A;  1NME B;  1TUG B;  4LF4 J;  1UWA A;  3RAX A;  5GAH I;  2FHO B;  4F7V A;  2MST A;  1T95 A;  4DMZ A;  1J27 A;  3K5L A;  1I94 F;  3OR1 B;  1N5Y A;  2FC9 A;  3MXH P;  2A18 A;  3VAH A;  1HD1 A;  1U49 A;  1RAB B;  4NLX A;  4ANC A;  2MTL A;  1E6V B;  3AQO A;  4NAS A;  4UZC A;  2WTF A;  3QT7 A;  3DOL B;  5D77 A;  2A6O A;  3CDW A;  2I1R A;  3P96 A;  4OI6 A;  2IFX A;  2UVW A;  3QBC A;  3HVA A;  4JV1 A;  2QLF B;  2CQ3 A;  5HLF B;  4J7C A;  4D3G A;  1S6Q B;  1RWU A;  2DNL A;  3I55 S;  1K0V A;  4DV5 F;  1T9T A;  3GTY X;  4H4M B;  1U2R A;  2UZA A;  4DR2 F;  1ZAX A;  1S99 A;  1RXO B;  4B9T A;  2CNO B;  3W62 A;  2KVI A;  5L46 A;  1TKZ A;  3PJ9 A;  3PRB A;  3MZI A;  2V4J A;  2Q79 A;  2MDA A;  3TAQ A;  1CVJ A;  2J9C A;  2E5L J;  2OEJ A;  2AMC B;  4LFC J;  3BKT A;  2RHQ B;  2C3U A;  2AIR B;  2VIH A;  1N36 F;  1DTT A;  5KFT A;  2W9C A;  3IR7 B;  4RW4 A;  2PE8 A;  1JMT A;  4XIU A;  4LF5 J;  1GFW B;  1C0T A;  2KZM A;  3NWG A;  4RU2 A;  2HBQ B;  3I9Z A;  2XS5 A;  2LFV A;  1SXL A;  4M94 A;  3C3L A;  4NL5 A;  2JEG A;  4OZ2 A;  4AQY J;  2AJ1 A;  4X2B A;  1T94 A;  3BBF A;  4CLF A;  2BW7 A;  1JLF A;  2KYX A;  3NKY A;  3FFI A;  3RAM A;  1SPB P;  1L3U A;  3T9Z A;  2K06 A;  5LSR A;  2OFG X;  1HBU A;  4M5H A;  3LAN A;  1FE4 A;  4QWD A;  1XR7 A;  3D2W A;  1Q8L A;  1M5H A;  2C22 A;  2MPU A;  2XTJ P;  2XHW A;  3BPD A;  1XJW B;  1UEV A;  3UN2 A;  1D3W A;  1UFK A;  1PJ6 A;  2DD8 S;  2CPJ A;  5J1N A;  2V94 A;  4MKY A;  4IQX A;  1Y0H A;  5KFR A;  1NJZ A;  3GIK A;  1WEY A;  4KV8 B;  3HVT B;  2K1R A;  3OTC A;  3I56 S;  4EWT A;  4B3M J;  4I7F A;  4J9S A;  4O3S A;  3BQ1 A;  1LXN A;  4H4K A;  4ZPW R;  4FF1 A;  3RBX A;  1O0P A;  2Y0B B;  2V50 A;  1F2H A;  1NJI T;  2O3D A;  4QWB A;  4OL8 A;  1XWL A;  5CCM A;  3NNH A;  4Z2X A;  4AL7 A;  3IRW P;  1V3R A;  2OTJ S;  5HAO A;  5LM7 E;  4B9V A;  2E44 A;  2F8H A;  3CXC R;  1HBO A;  1O51 A;  2DNO A;  1B70 B;  3CED A;  2C2N A;  3DKD A;  2VA2 A;  1SV5 B;  3TQ1 A;  1RWW B;  4LIR A;  4WYW A;  1AYE A;  1G1X A;  1QSS A;  1JLC A;  5KG7 A;  2YPZ A;  1S1V A;  2FYX A;  2F4F A;  2H5J B;  4ZS6 A;  4ZVE A;  4QWE A;  5H9F K;  3ENV A;  1D0E A;  1KP6 A;  3FCW A;  4NI2 A;  3VQT A;  3HZG A;  1ZPW X;  2YKA A;  4JI8 F;  1V5I B;  2BM1 A;  1PC5 A;  2Z8Q A;  2WOM A;  1N56 A;  1RTZ A;  2VG5 A;  3BH6 B;  2QFJ A;  4GC6 A;  5I4M A;  3M30 B;  3GZ7 A;  4JV5 J;  3UWT A;  1GMW D;  2HG4 A;  2DK2 A;  3PZP A;  1CJK A;  3MMB B;  3OJU A;  1FTR A;  2B9Y A;  2EEY A;  5C24 B;  4ZPA A;  5IWA F;  4LBH A;  2JFK A;  2Z2L A;  4GKK F;  3RG6 A;  1EX8 A;  1JLQ A;  3DMJ B;  3A3N B;  5D4N A;  3DNC A;  3TZW A;  3SCL E;  1UJ5 A;  1KRP A;  2PEH A;  4O3P A;  1EQ0 A;  1HQE A;  3ZZU A;  4O3Q A;  3QZ8 A;  2P5V A;  4DZ6 A;  3LWL A;  2EWH A;  2LQJ A;  4JP8 A;  3TYT A;  2B51 A;  4KFB B;  1FDN A;  4DPX A;  3UCU P;  5J1E A;  1RKJ A;  1R8B A;  1U0H B;  1RTD A;  4LFA J;  3SV3 A;  2XCP A;  2DEI A;  4XK8 C;  3CC4 S;  3HXM A;  1AW0 A;  2G0I A;  1HPZ B;  5H9F J;  3W3S A;  4LVO P;  4KKO A;  3VTI A;  1FKA F;  4ZK7 M;  3Q22 A;  3M9N B;  2D7S A;  4Y2M A;  1HI1 A;  3M9M B;  4JI7 F;  1LOU A;  3BGR B;  5KT3 A;  1RDR A;  2EKN A;  4DZD A;  1WG5 A;  3HKZ D;  4UY8 5;  1FF2 A;  2W7O A;  3PW2 A;  4FF2 A;  2CNN B;  2OTL S;  2XHC A;  4NA1 A;  1EKS A;  2AEF A;  4TVA B;  4B3O A;  2IAJ B;  4OZ3 A;  1SH3 A;  2HHH J;  2R7O A;  4URQ U;  2FJA B;  3GG0 A;  1L3K A;  3ZTS A;  1TL4 A;  1NK0 A;  4Q8E A;  2E9R X;  5J2P B;  5DQH A;  4KIA A;  3W2W A;  5A6W A;  5C5J A;  1FRJ A;  2F7V A;  3OSP A;  2J9D A;  5HVF A;  2IYI A;  3EPI A;  2B4P A;  3LUY A;  3M8W A;  2LQ8 A;  5D15 A;  3C6T A;  3HHL C;  3TAM B;  1WC4 A;  3PFE A;  3KK3 B;  1QVF R;  2F8M A;  2JZ5 A;  3VAG A;  1GH8 A;  5ETT A;  2L9N A;  5EWE A;  1R0B G;  2RKI A;  4LF8 F;  2AWZ A;  5J1P A;  4UOH A;  2DRB A;  1F9H A;  2OFH X;  4BC7 A;  3IR6 B;  2W9B A;  3VHQ A;  4X4O A;  3CUN A;  3NCQ A;  2OO4 A;  2O1P A;  1I5O B;  1Q8K A;  3B4M A;  2KT3 A;  1X4A A;  2CQG A;  4CI0 B;  2Y0S D;  4JI1 F;  3E01 B;  3N6N A;  2CPI A;  5A6P A;  3V5R A;  4IH7 A;  1U1K A;  2ZDP A;  2H1Y A;  4Q0B A;  2ILY A;  4MTP A;  3CCT A;  5DLF A;  5L38 A;  1WNE A;  1HNV B;  2MZ1 A;  1HNI A;  1KON A;  2HND B;  3AOA A;  5F9L A;  2RRN A;  1PAE X;  2OPR B;  3MUT P;  2H5I B;  1UFW A;  4YDD B;  1SQG A;  3I0R A;  2F5G A;  2Y1I A;  4YME A;  2R8I A;  3AT1 B;  4RJV A;  5KFL A;  1TKT A;  4B9S A;  3KLF A;  3KNA A;  3MAQ A;  3N6L A;  3R5G A;  2CAD A;  4OI1 A;  4K4S A;  3MPU B;  2R3V A;  2J7U A;  1RAF B;  1YK9 A;  3GFH A;  1VDH A;  1I3O B;  1Q53 A;  5KFB A;  3LGH A;  3FRZ A;  4PWW A;  4CH7 A;  4KPY A;  3SFG A;  1VK8 A;  2CQ1 A;  2KHD A;  1NDL A;  2F1F A;  4DR7 J;  5DLG A;  2AEM A;  1VQ6 S;  5FII A;  1GMV A;  4ZIV A;  3B54 A;  1UW9 A;  2BKP A;  3CJK A;  4ES2 A;  2QYC A;  5CYM B;  5HRO A;  2CYY A;  4A8K A;  4DFK A;  3W60 A;  2CDR B;  2VFS A;  4H4O B;  4OV1 A;  4PG4 A;  3KK1 A;  3M8Q B;  2KKH A;  2VHG A;  2VZ9 A;  2ZBR A;  4ZA1 A;  1WEL A;  4WP9 A;  4TY8 B;  2AGP A;  3DGP A;  2IDL A;  3NS6 A;  4LRD A;  4RNO A;  2Y3Y A;  3EVO A;  4DUT A;  4I6Y A;  5AJ3 F;  2CQC A;  2ZH9 A;  4EK2 A;  2VG6 B;  3FBF A;  2CPH A;  3T9N A;  4K4U A;  4X4V A;  4CQ1 A;  2KL8 A;  3ITH B;  4WU3 A;  3U1M A;  2MHE A;  4A8M P;  4NEY A;  2CQI A;  2DNR A;  1PJ5 A;  1MU2 A;  1TZ0 A;  2DHG A;  1RTH B;  3Q24 A;  4WII A;  3W9J A;  3A8E A;  1C1B B;  2EFN A;  3H5U A;  1VQN S;  4OI0 A;  1I1G A;  1P1L A;  1LWF A;  3TVY A;  3HJF A;  4F4W A;  3SXL A;  3HFK A;  3MM6 B;  1VQ9 S;  4DU7 A;  2FY8 A;  2HZA A;  3GR0 A;  1WAC A;  3DLE A;  5A8W A;  1YRT A;  1REG X;  2GA7 A;  2DIT A;  3GSD A;  1VQO S;  2FZC B;  3V4I A;  4QWC A;  4C8L A;  3NNA A;  1VFJ A;  4CO5 A;  4FXV A;  3FSX A;  2YNH B;  2RSQ A;  3ZZY A;  5F8N A;  3TA1 A;  1WOR A;  4F0K A;  4QU7 A;  1IR1 A;  4LFC F;  1S1T A;  1YWX A;  3NBP A;  3SYZ A;  3QT8 A;  5LT5 A;  1YX2 A;  2A3J A;  3GYN A;  3H2U B;  2G0J A;  3GFZ A;  1T0T V;  1S6P B;  4DL6 A;  5E7O B;  5I3U A;  2ILZ A;  2C1E B;  1IQT A;  3IBC B;  4O44 A;  1SBR A;  2VDI A;  1N6Q B;  2RQ4 A;  2MLY A;  5IFM A;  1RHQ B;  2PDA A;  1VBY A;  5EGY A;  4AQY F;  1TP7 A;  4M95 A;  3QGI A;  4GRS A;  5DZ6 A;  2GIR A;  5KFP A;  2AJF E;  2KB2 A;  1RYR A;  1FE0 A;  4PYA A;  4P9S A;  3WQP A;  2W2O P;  3KJV A;  2Z0G A;  3T5J A;  1UPP A;  2YNF B;  4DUY J;  3NRB A;  1CJT A;  4B3T J;  3AXK A;  5HN0 A;  3DOL A;  1VC0 A;  1UL3 A;  2Q6B A;  4Q45 A;  3MED B;  1UET A;  4F4Z A;  5D3G A;  1XER A;  4K50 A;  4DV3 F;  2XZT B;  1UVK A;  1XBW A;  1T9Y A;  3M2U A;  1G3O A;  3NGR A;  4GVL A;  3IS9 A;  5IQQ A;  3C6U B;  2XI3 A;  4B17 A;  1WKJ A;  1OMS A;  3PW5 A;  3MM7 B;  5AE2 A;  3L09 A;  1S1X A;  4WK1 A;  2D3U A;  4P52 A;  5CYQ A;  4WTY A;  4NLW A;  2WSC C;  2AKW B;  4PQA A;  3N01 A;  3FEY B;  4MMO A;  3CCV S;  2YVS A;  1JLG A;  5CZV A;  4IUF A;  1TV6 B;  2D41 A;  4DPT A;  3BRE A;  3CIZ A;  3G6Y A;  5ETQ A;  1NAQ A;  3H25 A;  3H5S A;  5E33 A;  2LXI A;  3OXF A;  4DJB A;  1CJV A;  3AXM A;  4QQB A;  2MZT A;  2E9T A;  1FO1 A;  4ZPB A;  2MQM A;  2C2E A;  2LCW A;  4C0H A;  2CQ2 A;  1OQ6 A;  1XMB A;  4YB6 A;  2HW3 A;  4MKB A;  3HLU A;  2GZO A;  4JV5 F;  2GO8 A;  4W90 B;  1M5O C;  4ZHR B;  4YY3 F;  1YJW S;  3HFV A;  2XGQ A;  4JI3 J;  1ZM3 A;  2WSF C;  2YKM B;  3FJ2 A;  3KKF A;  1NJY A;  3ISN D;  1JIH A;  3DRS A;  2PEB A;  4ZPC A;  4N47 A;  3VAF A;  2F40 A;  5DQG A;  5D4L A;  1D9D A;  3N79 A;  1N34 F;  3FMW A;  4F26 A;  1EB0 A;  1OYE A;  3HHD A;  3F0N A;  1S9E B;  3EZ5 A;  3F41 A;  2BW2 A;  1RT1 A;  2VQE J;  4AUK A;  2ZNZ A;  3H90 A;  3QAT A;  2JWN A;  2AQ4 A;  2HQI A;  4ILR A;  2HGN A;  1C0U B;  4JI4 J;  3CTR A;  3X1L B;  4CDI A;  2VC1 A;  3CJ0 A;  3OVB A;  2MKI A;  4OI3 A;  2PI5 A;  4DV7 J;  4LF2 A;  5C25 B;  1I6J A;  3OVS A;  4X65 J;  4CLU A;  4QR1 A;  3QZ7 A;  3B82 A;  2I5J A;  3K89 A;  3G2X A;  2VAS A;  2EK6 A;  4O4G B;  3TA2 A;  2WZ1 A;  1C4A A;  2X1F A;  4K4W A;  1XN9 A;  4A8S A;  5HBM A;  3HZE A;  4C0O C;  3S7R A;  4TQS A;  4B3R F;  2Z58 B;  4OJH A;  4YB5 A;  4DV6 J;  4DR3 J;  2G2Y A;  4E98 A;  4HL9 A;  2V8V A;  5D0H A;  1N5S A;  1A0O B;  3H0P A;  4Y28 C;  2HFO A;  5KT6 A;  5BR8 F;  1PIE A;  3CMA S;  4EUV A;  2F4V J;  4DI6 A;  4OHX A;  3JTN A;  2AYB A;  3UO0 A;  2XGP A;  3LH2 S;  3SQG B;  3O1L A;  3T1Y F;  1H0H B;  5A8R A;  2VOD A;  5HAT A;  2WBR A;  2XSJ B;  4KBI A;  4M63 A;  2HNZ B;  3MCS A;  3BQ2 A;  2B56 A;  1U8S A;  2F63 A;  2GJF A;  1IBL F;  3B6B A;  4NXN F;  2XM3 A;  1IJE B;  4Z7Y A;  1U1Q A;  1DUR A;  4ZN3 A;  1T02 A;  3KHH A;  4ENO A;  3JXO A;  1RBL A;  3MOZ A;  2ZWO A;  1TU0 B;  4NLU A;  8ATC B;  4CYU B;  4N56 A;  3BO2 A;  1U24 A;  5HO4 A;  2QSF A;  1B4S A;  1P8G A;  1WHW A;  3I4P A;  2YWW A;  3OUY A;  3IWN C;  3N9U C;  2P6S A;  3PYF A;  4Q44 A;  2H51 B;  3C15 A;  2CG8 A;  3CCM S;  1LWC A;  2GHW A;  1M5P C;  1VJQ A;  4DQP A;  2MJU A;  3CJ3 A;  4OYP A;  4MIB A;  1QAY A;  2MYF A;  3G82 B;  1VBZ A;  1RAE B;  2IAJ A;  3P45 B;  1AUD A;  2VG7 B;  3M6V A;  4F4K A;  1QLN A;  3ZNU A;  1F9E B;  3M1V B;  3VAL A;  2X3D A;  5K20 B;  2GHP A;  3QJL A;  3T3F A;  1FRI A;  1RIS A;  3R2D J;  3NG8 A;  3UNG C;  3PX6 A;  2GS8 A;  5B0F A;  1U1N A;  2CUY A;  4DX5 A;  4ELV A;  2J7W A;  2X3G A;  3GJS B;  1KR4 A;  3KNG A;  5F41 A;  2ROG A;  3JSR A;  1YIJ S;  4DF8 A;  2GQC A;  1JX4 A;  4GVB A;  4AE5 A;  2GMH A;  1OSD A;  3IP0 A;  4OX8 A;  1XMQ J;  4WFA Q;  1WG1 A;  5KFS A;  1R6V A;  1R8P A;  1NUE A;  1FNO A;  3CCJ S;  3R1H A;  2V2V A;  4OI2 A;  1KDN A;  1RHK B;  1M1G A;  3Q8P B;  1RAI B;  1R7I A;  2OPS B;  4B9M A;  3QIP A;  3F73 A;  1VBX A;  4F2S A;  5LL6 d;  1UJ4 A;  2W2P P;  3RR7 A;  3BYP A;  4Q2L A;  4N7T A;  3CC2 S;  4JYA F;  2U2F A;  3HFZ B;  1CPZ A;  4NLT A;  2VQF F;  3VAJ A;  3ZNJ 1;  1NPR A;  3MAA B;  4URG A;  2V8P A;  3QO9 A;  2HNY B;  3PYG A;  4NCA A;  1JQG A;  3V6D B;  3UNY A;  1RZM A;  2NYI A;  3OFH A;  4ECT A;  2R8J A;  2QV6 A;  2JX2 A;  3BSN A;  3T1H J;  1U1M A;  2HND A;  3FGV A;  3M2V B;  4DN9 A;  1JJC B;  1K1S A;  3EGN A;  4X64 J;  4L3N A;  3KLV A;  2UXC J;  2R9L A;  2DB1 A;  1FX4 A;  3CJR A;  3IAS 9;  3W66 A;  1WF2 A;  1U45 A;  3X3U A;  4IG0 B;  2HKE A;  1R89 A;  3ILI A;  5IT9 U;  5K8P A;  2MLZ A;  2X1A A;  4OHV A;  1VCT A;  3OQ2 A;  3PNI A;  1LW2 A;  4IFV A;  2M9K A;  1H3D A;  3OFG A;  1WEX A;  2DPJ A;  3CT9 A;  4LQ9 A;  5B0D A;  2VJU A;  5CYM A;  5EX3 A;  2ALZ A;  3CWJ A;  5A0Y B;  1UEU A;  2IJR A;  4DU8 A;  4NRT A;  2FGO A;  2PC6 A;  1BUX A;  1VLY A;  1RHM B;  2W9A A;  1JNR B;  3T1A A;  3TX8 A;  4RX6 A;  1K8A T;  1EJ7 L;  4P2X A;  3GP9 A;  2BKO A;  1SJF A;  1PSD A;  3B8H A;  1CQM A;  2AGO A;  2JFD A;  3QT5 A;  4PG6 A;  2FJX A;  1RWO B;  3RBZ A;  3L7P A;  5HP1 A;  5D6G A;  2VON A;  5B0A A;  4TXS A;  5KFE A;  2YNI A;  2QE5 A;  3DLB A;  2JVR A;  1Y5L B;  1SC3 B;  3G71 S;  4PQU B;  2QG9 B;  1PG5 B;  2CDQ A;  4CIO A;  4WE1 A;  1QUV A;  1TL3 B;  1UCN A;  3I4H X;  3DRY A;  4IO9 Q;  3P6Y C;  2W8L A;  1BQX A;  4ZN1 A;  2ZH4 A;  1ELO A;  4OFZ A;  2HRT A;  3D67 A;  2PFF B;  4CM0 A;  1VQL S;  4JI2 J;  3MOJ B;  1ZS6 A;  2SXL A;  4Y3C A;  4N5S A;  2C2D A;  3SMZ A;  3AOB A;  1WSV A;  2LYV A;  2CJK A;  2HBZ B;  4QR2 A;  3MCM A;  4P2F A;  5CZX A;  1IKY A;  4DPY A;  5KT4 A;  5IT0 A;  2R42 A;  2P9E A;  4MT1 A;  1XNR F;  1NK6 A;  2VPX B;  3HP6 A;  1ULR A;  1IBK J;  1S59 A;  2CZ4 A;  2BE2 A;  4HI2 A;  4RNF A;  3OL8 A;  2I9S A;  3KG4 A;  1W2I A;  1KQK A;  4EZ6 A;  4WZM A;  2J0Q D;  4FXW A;  3W64 A;  4UOF A;  4EYI B;  3B4D A;  1DQ8 A;  3LA0 A;  4NZ6 A;  2LMI A;  3NGT A;  1H73 A;  4WFX A;  4C97 A;  2Z2M A;  5HJX A;  2UVV A;  2LEA A;  4USU A;  2Y9H A;  1WC6 A;  3FQK A;  4MAK A;  4CLP A;  1WTB A;  4UQG A;  3I32 A;  9ATC B;  2RS2 A;  2HFN A;  3D1H A;  4QIE A;  3CDA A;  2DIU A;  4GO7 X;  3TRG A;  4F2R A;  2MQN A;  2ASY A;  1UP1 A;  3N0V A;  4RBT A;  1NSP A;  1MMD A;  2HHW A;  3MED A;  2ZIT A;  1SKS A;  4DV0 J;  1REV A;  2ACY A;  3CW2 C;  3ZZZ A;  2YWG A;  3RU0 A;  3MUV P;  5K9F A;  2CRL A;  1S9F A;  3WX4 A;  2KRR A;  2QLX A;  3BN7 A;  4CCH A;  1NH7 A;  4ZLP A;  4YR3 A;  3W63 A;  2LDY A;  3IRX A;  3D66 A;  1RK8 A;  3IXQ A;  4KGV B;  1NSQ A;  2HRY A;  2E7X A;  3C14 A;  3SBM A;  1GXU A;  3HO1 A;  2K3K A;  1L3V A;  1RU2 A;  1D9A A;  3L7O A;  1NHV A;  2R2T A;  3HHL B;  3GCX P;  1T7P A;  1FKO A;  5KFY A;  2NXU A;  2Y8W A;  4H54 A;  2D69 A;  4JI5 J;  4ZCM A;  1J5O A;  3QRQ A;  4KY3 A;  2ZDO A;  3THT A;  4X65 F;  2H65 B;  3Q8U A;  2M0G B;  2XY5 A;  4OZ1 A;  3KJF B;  4CTA A;  1DTQ A;  3MWB A;  3HSZ A;  1RT6 B;  5ETS A;  1LK5 A;  4KR0 B;  1HBN B;  1YQH A;  5KT5 A;  1NM2 A;  4A8F A;  2V8G A;  4CP5 A;  4GKJ F;  4HDH A;  4JBC A;  2COL A;  1RT7 B;  1IUJ A;  4J9Q A;  2L48 A;  4P74 A;  1TAQ A;  4MJK A;  4C98 A;  3SCI E;  2QEX S;  1GXL A;  1G4C A;  3RUB L;  2YY3 A;  2OLW A;  4DR1 J;  3E51 A;  3GQC A;  5H1S V;  3W2V B;  4N76 A;  3KLG B;  2NZ4 A;  2RH3 A;  4A8O A;  4LF9 F;  3V6H A;  3D9B A;  3IBW A;  4DPW A;  3AD9 C;  3SDE B;  1HLW A;  1A9N B;  4MYT A;  1E6Y A;  2BE7 D;  2RQK A;  3TP2 A;  4MYU A;  2RU3 A;  1TEL A;  2FLO A;  1AB8 A;  1CG2 A;  3TZX A;  4QBU A;  5K8N A;  3K5M A;  1TVR A;  1UWB A;  2DGQ A;  5G0R B;  2IRX A;  3V6K A;  5DDR C;  3VAM A;  2AHO B;  4HEA 9;  3ISZ A;  3ONQ A;  2HHV A;  2VUG A;  5IT9 Y;  3QFH A;  2XCA A;  3QJJ A;  1C0U A;  1R8C A;  2CQ0 A;  3CPW R;  5A76 A;  1FEE A;  1P27 B;  2HS3 A;  1F6T A;  3AOD A;  4ZPV R;  3M6U A;  1QAI A;  3TI0 A;  4N41 A;  5ITH A;  4Y65 A;  2H3E B;  4NA3 A;  5ETM A;  2V9W A;  1RHU B;  2DY1 A;  2HVE A;  1LW0 B;  3QJP A;  2V69 A;  3KDN A;  1YJR A;  3GB0 A;  5T7L A;  4NYO A;  3Q83 A;  3GIR A;  3A8I A;  4K4X A;  2EFG A;  2RDI A;  4G1P A;  3PW4 A;  3M8Y A;  4WKY A;  2E1P A;  1TL5 A;  2HQD A;  3MUR P;  3ZTP A;  1S0O A;  4H4K C;  1U1L A;  4I0W A;  4KH1 B;  2C2Z B;  1JXV A;  1ZTW A;  1PJ7 A;  4NXM J;  3MMA B;  4DPU A;  4ZLN A;  2ASL A;  1TKX B;  3FK4 A;  3GJR B;  3PYD A;  3L4B C;  3SQG A;  4WP3 A;  1URN A;  3KLI B;  4HAC A;  3CD7 A;  2V9K A;  3G87 A;  2ZH7 A;  3LP2 B;  2CWK A;  4QR0 A;  4W4M A;  3M32 B;  3AFG A;  4K2J A;  1AFI A;  2ZZM A;  3U1L A;  3ZTO A;  2ZZT A;  4O4R A;  4KHM A;  5LMN F;  2KZZ A;  3AY0 A;  2C2M B;  4RR5 A;  2CJX B;  1ZA1 B;  2HLT A;  4RL1 A;  3R9L A;  3QQC D;  1IM4 A;  3T19 A;  5HMX A;  3HSG A;  2A6M A;  1DRZ A;  1WEZ A;  1S97 A;  4L76 A;  1HYS B;  4WWS A;  4YFU A;  4AXJ A;  4LBI A;  2HHX A;  4WZQ A;  3MGJ A;  5EDW A;  1NZ8 A;  5F3T A;  1RLC L;  1GXT A;  3HVW A;  3MPD A;  4TLR A;  4RUB A;  4ZMM A;  4LF1 A;  1YJV A;  1FES A;  1S12 A;  2BJ1 A;  4X64 F;  1TFW A;  1N54 B;  1RWM B;  1IKW A;  2VG7 A;  3PY8 A;  4W98 A;  2UVU A;  4RW6 A;  1XK8 A;  3DLG B;  3R2C J;  3M9O B;  2QN6 B;  3TZY A;  1U02 A;  2GJ2 A;  2VBW A;  3R5B A;  2KH9 A;  2J76 E;  4KT0 C;  4WFN Q;  1N5T A;  3VVU A;  4CT9 A;  4JI0 J;  2HUR A;  5J2M B;  3AA8 A;  3S8S A;  1OJ4 A;  3KUH A;  3UDL A;  4IDK B;  1U1R A;  2V68 A;  4ICL B;  1KLM A;  3T5L A;  4ERD A;  1JKH A;  3R7B B;  5DRK A;  2AEJ A;  1C1C B;  1RAH B;  4IFY A;  4CO3 A;  3GJQ B;  2LU2 A;  3T6B A;  1NJW A;  2WK4 A;  3Q8S B;  4FBT A;  2BJD A;  3R5J B;  1VMB A;  3QPI A;  3LP1 B;  1VRU A;  2ACM A;  4R25 A;  4ECZ A;  2B5J A;  4YN3 B;  2VBY A;  4YHH F;  1NRK A;  2HHU A;  1NLK L;  2UUC J;  4Q43 A;  1KVJ A;  2XZD B;  4I69 A;  1CBK A;  2RQM A;  2OIH A;  3RR8 A;  3BZQ A;  3JSM B;  2P2C B;  1NSA A;  3TJA A;  1HNZ F;  2ATC B;  3QNW B;  3R6L B;  3QYY A;  4M5I A;  2R7X A;  2ZC4 A;  4U8Y A;  4TU7 A;  1YBA A;  4V19 X;  3MAA A;  1T03 B;  3GLJ A;  1T8E A;  2UP1 A;  1AZS B;  4BDP A;  3MM8 B;  4FYX B;  2OPQ A;  1D9F A;  1PO6 A;  2J0W A;  2CG4 A;  1KC8 T;  3O6Q A;  4OZ5 A;  1HBM B;  5DS7 A;  3U02 A;  1VQ4 S;  1B0V A;  2M2B A;  4G1Q A;  3A1Y G;  2XB2 D;  4DS5 A;  2DYA A;  1T9W A;  2IVM A;  4PXD A;  1PAU B;  4EO6 A;  4IG0 A;  3CD5 A;  4WFY A;  4BWM A;  3NOG A;  1JJ4 A;  3A3P B;  2OP5 A;  5H9E J;  3BSA A;  1IBM J;  4IO1 A;  2N7Y A;  1RAC B;  2B4U A;  3KK2 B;  1DAX A;  2GVD B;  1U1O A;  1PBU A;  1RQ0 A;  1JLA B;  1UFL A;  4YR0 A;  4R0E A;  5KT2 A;  1UVJ A;  1CSJ A;  4KHP J;  3MMC A;  2DVI A;  2OSQ A;  4ALZ A;  5M2U A;  4RW7 B;  2IIH A;  2YX4 A;  1ZM2 A;  3ETM A;  3FCH A;  1T9X A;  4KE5 A;  4ECV A;  3OTB A;  4F4X A;  2GO9 A;  2Z56 B;  3O8W A;  4Y6I A;  4KB7 A;  3L7U A;  2VB6 A;  1TUV A;  3V2U C;  1NU4 A;  1S1U B;  3G4S S;  2Q6C A;  4NWB A;  2B6A B;  1JWW A;  2UVR A;  4ID8 A;  5A8K A;  1CC7 A;  3I0S A;  3D3B J;  3QRP A;  4MKA A;  3CCQ S;  2FVC A;  3J7A N;  2W4P A;  1WHY A;  4FPI A;  4HVZ A;  1JB0 C;  4PCQ A;  2PSZ A;  3DOK B;  4NLR A;  3TVZ A;  2R7S A;  5EUH A;  2R8H A;  2WB4 A;  4K0K J;  2QYG A;  3W65 A;  2KXN B;  1HI0 P;  4X4N A;  2VD3 A;  4NLY A;  4EU0 A;  4DV2 J;  2HAF A;  4RWX A;  1AXQ A;  1HHQ A;  3W9H A;  3GR1 A;  1XMO F;  3VGS A;  1VJW A;  4C11 B;  1KNZ A;  3JTP A;  3ZTQ A;  4JI5 F;  4L74 A;  4JUZ A;  3OPK A;  3H98 A;  3PHE A;  4IQM A;  3K2Y A;  4NML A;  2CNL B;  3BV8 A;  1FXR A;  1YVF A;  1H2V Z;  2J0X A;  1S57 A;  1SUQ B;  3QGG A;  1NDC A;  3DHX A;  4PUO A;  1R31 A;  2WB1 D;  5GVQ A;  4X84 A;  3HUL A;  2YWH A;  2JLF A;  5EWF A;  1KOH A;  1JXE A;  5HK4 A;  3G8T A;  4J9P A;  4CLW A;  2V2Q A;  7AT1 B;  1RWN B;  1U0S A;  5GAG U;  3O44 A;  2IMO A;  4QYR A;  4CLY A;  1QAX A;  1GMW A;  1RAA B;  5F8J A;  1N33 F;  1Z2L A;  3FBB A;  3H40 A;  3MEC A;  5ETO A;  3NOC A;  3UQS A;  1R0C B;  2AV5 A;  3SQO P;  2ZE2 B;  1S1W B;  2BM0 A;  4HYK A;  2F9J A;  1OY9 A;  2D9O A;  1CEZ A;  3NWR A;  5L8R C;  2NUU G;  1IQZ A;  1RT4 B;  1IR0 A;  3SFU A;  4V19 J;  2UUT A;  1FJG F;  3EGV A;  4UZB A;  1FRH A;  2ZBP A;  4PWD B;  8AT1 B;  5DDO C;  5BYQ A;  2FVR A;  3GV5 B;  2HFS A;  5GAD U;  1IR2 A;  3E2E A;  4NLG A;  4DV4 J;  3M05 A;  1RT5 B;  3BSO A;  4CLL A;  1BXN A;  2BAB A;  2VC0 A;  4EBC A;  2EG1 A;  2ZNY A;  5LSL A;  5KFZ A;  3RZA A;  3CDE A;  3D28 A;  2YKN B;  2M7S A;  3PO5 A;  3HMJ G;  1YIT S;  2FB0 A;  2HIY A;  2DPI A;  2E9Z A;  3K5N A;  4DR6 F;  1RTJ B;  5LXR A;  1WSR A;  1ZM9 A;  4HR2 A;  2UUA J;  4ID5 A;  2VF3 A;  3KJN B;  4IOC Q;  4I2P A;  2JDJ A;  1HIY A;  2CKW A;  4BHQ A;  3OT9 A;  1S48 A;  2IBK A;  3GYG A;  2XLK A;  2MKK A;  2BDP A;  2IC3 B;  2R2R A;  1L3T A;  4C8K A;  4TQR A;  1HI8 A;  3DI6 A;  1WC5 A;  5I3Q A;  3MDF A;  4R8U A;  1FRX A;  2B7C B;  1RT3 A;  4CO1 A;  3BJY A;  1GX5 A;  5ETL A;  2B9E A;  2QA4 S;  2O66 A;  2CQP A;  3N4W A;  1K73 T;  4S0M A;  1WDT A;  2A2D A;  1NXI A;  2I8E A;  2QO3 A;  1S9G A;  2K8G A;  1QE1 A;  1VQ7 S;  3KLH A;  2V8H A;  3JYT A;  2LQ5 A;  4RWW A;  1AT1 B;  1M1K T;  2P9G A;  3M7V A;  9RUB A;  4MFB B;  3UCG A;  3I6P A;  1JLB A;  2R8K A;  2E1C A;  1RAD B;  4DQQ A;  1N0U A;  5ETK A;  3GG1 A;  3ELH A;  5L9X A;  2RDJ A;  2BJ3 A;  3J81 U;  1BC6 A;  2AF6 A;  1X0P A;  4DR4 F;  3MM5 B;  4FP9 A;  3KHR A;  2UU9 F;  4M5L A;  2K2P A;  2MY8 A;  4FF4 A;  3JQM A;  3D1O A;  2CQD A;  1X4C A;  1F3V A;  3RRK A;  2DHH A;  2J6S A;  1B0T A;  2BQR A;  5LJ3 Y;  1RCO B;  2J8S A;  5CQG A;  2Z2Y B;  3IG1 B;  3S1T A;  2W01 A;  4PXE A;  5IT4 A;  1WHV A;  1J5E F;  3TZZ A;  3I31 A;  4OYX A;  4DL3 A;  1KVI A;  2K7J A;  1XQI A;  4QPT A;  2IM0 A;  3CCZ A;  1UVN A;  2QSW A;  4LF6 J;  3RW6 A;  3UDE A;  5KFX A;  2QLJ B;  2R7W A;  2Q3P A;  3SSQ A;  4ZJQ A;  4LSN A;  3V4M A;  4LSL A;  1NHU A;  1T05 A;  1TL7 A;  4P71 A;  4DUZ F;  4TKT A;  4QOT A;  3D0H E;  3M2R A;  2HK2 A;  1CUL A;  3U7J A;  5DDP C;  3KMS A;  2DH7 A;  4N77 A;  3DLK A;  2HS0 A;  2IJF A;  1FXD A;  4RW9 A;  2FJW A;  4NCG A;  1XIQ A;  1SKR A;  1UMJ A;  2KXH A;  5D4P A;  3C2P A;  1FJ7 A;  2JC0 A;  1IKV B;  5LMU J;  1HA1 A;  1QD1 A;  3CCS S;  5DM7 Q;  5KFM A;  1SKW A;  1SC4 B;  3ET6 A;  3MHY A;  2B8P A;  1HWI A;  5IV3 A;  1HL6 A;  2PFD A;  1JLE B;  3IGV A;  4KJI A;  1BWV A;  3TOQ A;  1MWZ A;  1TL1 B;  2EXU A;  5HMW A;  2RRA A;  3UW1 A;  4M5M A;  4JI0 F;  3J7Y I;  3HT0 A;  5I42 B;  2HS4 A;  3DRP B;  2C42 A;  3TWZ A;  3NLC A;  1KBR A;  2VFR A;  1SJR A;  4IH5 A;  3MM9 A;  3MEG B;  2G2O A;  3DDI A;  5DJB A;  2DR8 A;  4MK7 A;  5D0G A;  1UVL A;  1HR0 J;  2UXD J;  3FSI A;  5EN1 A;  1CS4 B;  1CQN A;  2JLE A;  2G0C A;  1WHX A;  1DHM A;  3M8P A;  4LVN P;  4ZVU B;  1RA7 A;  2EVZ A;  3CCR S;  2FC8 A;  3BM7 A;  3ZC4 A;  3W9I A;  5KFC A;  2QC3 A;  4C8Y A;  3POT A;  2D3O 1;  3CCE S;  2BJ7 A;  3HD2 A;  2L41 A;  2B43 A;  1KLN A;  1U2C A;  3DRR A;  4OX9 F;  3ZZR A;  4RO0 A;  3BYR A;  2ZHA A;  4X4U A;  5FDL B;  3A8K A;  3IM9 A;  2EG2 A;  1KFD A;  2G2Z A;  2YWF A;  2OPP A;  2ZVI A;  1NK4 A;  1T11 A;  2E7V A;  1QTM A;  1X5O A;  3MEK A;  5HI7 A;  2HMI A;  4ILL A;  3QLH A;  1TR0 A;  1R0A A;  2EC0 A;  4FS2 A;  4OHZ A;  5DZ7 A;  1IKX B;  2XG8 A;  3VZI A;  4LR7 A;  1FKP B;  2CPZ A;  1H2T Z;  5KFI A;  4DV1 F;  5KOX A;  4I67 A;  2BVZ A;  2RJZ A;  2ASD A;  1Y7P A;  1XNQ J;  1RP5 A;  4KSE B;  3LOU A;  3PDN A;  4ED6 A;  2BBE A;  3FDS A;  4B02 A;  4LRF A;  5E2Q A;  3TUJ C;  2O5D A;  1IBM F;  3RB0 A;  5DO2 A;  4USV A;  1M90 T;  3H4B A;  3OXL A;  2GGP A;  4OYB A;  4QZV B;  3HPO A;  4QCL A;  1HKA A;  3E3X A;  4DDF A;  2MQO A;  1UVI A;  4M5D A;  2HHS A;  4IDK A;  5HMY A;  4KHP F;  2G9O A;  5G4D A;  3MPY A;  4JI6 F;  1HNW F;  2RF2 A;  2FVS A;  1N5Y B;  2QMW A;  1U47 A;  2HQC A;  1FCA A;  4ZVS B;  1HNX J;  5GAG I;  2N4C A;  4OZL A;  1EET A;  3A4T A;  2L9D A;  4I6A A;  4ZP9 A;  2ZBQ A;  1SIZ A;  4ECW A;  3LAM A;  3OBI A;  3FSY A;  4RKU C;  2M52 A;  3K5P A;  3PX0 A;  2EFV A;  3EYZ A;  4K4Y A;  2LVW A;  1EP4 A;  4ECQ A;  1MSW D;  4OYO A;  1CC8 A;  2QT7 A;  4FZV A;  3CSK A;  4C48 A;  1UAW A;  2XMT A;  2OD6 A;  3K0J A;  2BV3 A;  1Y9O A;  4URS A;  2LA6 A;  4USM A;  2HPU A;  2X1B A;  1T03 A;  4RBV A;  2ZUG A;  4P2S A;  1TKZ B;  3IWL A;  1EZZ B;  3I5A A;  3TEG A;  2V4J B;  5GAD I;  4B9N A;  1AZS A;  4EI2 A;  2WW4 A;  2CQH A;  2KM8 C;  2W4D A;  2GIF A;  4J5O A;  4U7C A;  4N8O A;  4RW8 A;  2LDI A;  2OD4 A;  1DTT B;  2QIF A;  1DQA A;  2W9C B;  3CD6 S;  4RPF A;  2CJA A;  4RW4 B;  4FYY B;  3J81 Y;  2JRS A;  3FMB A;  3ZZO A;  2JOQ A;  2DNK A;  4WIQ A;  1C0T B;  2JEI A;  5F8L A;  3D54 A;  3JSY A;  5KG5 A;  3M4X A;  3DN9 A;  3NY0 A;  1FWL A;  3I5B A;  1F5B A;  4EBD A;  1ACM B;  1VQP S;  2CJY B;  3MR6 A;  3CNQ P;  3I87 A;  3FFI B;  4J9N A;  1TFY A;  1NCL A;  1ZA2 B;  3UDV A;  4V1A k;  3HHL D;  1RKI A;  2DNP A;  2VFV A;  2WVC A;  5MAO A;  3HSJ A;  1I51 B;  4BLG A;  1DLO A;  3DYA A;  1HBU B;  1EAY C;  4F25 A;  5F8G A;  4XO0 A;  1YJU A;  1H6K X;  4RNN A;  4DS4 A;  4XPC A;  4ELU A;  4ZP7 A;  4WXW A;  3NMA A;  1X4E A;  2J9E A;  4WBF A;  3ZFV A;  1KEK A;  3BR8 A;  4O23 A;  3SIP B;  1QJH A;  2K1R B;  4PWU A;  1Q8B A;  3K8V A;  2DGU A;  4I7F B;  2W8K A;  2XWY A;  3K58 A;  4X62 F;  3FKB A;  4DV5 J;  1HQU A;  2CJQ A;  3FBE A;  4DR2 J;  4CM2 A;  1TKD A;  4L73 A;  4WU2 A;  3DRX A;  3DU5 A;  1VR6 A;  3CE8 A;  4I1T A;  2YQ3 A;  4DCO B;  4LFB F;  5K14 A;  5KT7 A;  2DTJ A;  3BO4 A;  2BJ8 A;  2VKR A;  4G6V B;  3MEE A;  1ZOT A;  1DJ0 A;  1R3N A;  4J9K A;  1HBO B;  2XMW A;  5LXY A;  4TYA A;  3BO3 A;  2BR0 A;  2XYG B;  2LEP A;  1NEE A;  1RUS A;  1URR A;  1SCJ B;  2DXE A;  1JLC B;  5CD4 A;  1S1V B;  4C11 A;  4ZCL A;  1ZAV A;  2BAN A;  3LW5 C;  2ADC A;  3JAM U;  4FN5 A;  1HHT P;  3J80 U;  2V67 A;  4NX9 A;  2BUN A;  2DCU B;  4NI2 B;  3Q0A A;  2E5G A;  1SL2 A;  1WC1 A;  1RTI A;  4GC7 A;  3BS9 A;  1K1Q A;  2X1G A;  3NAH A;  4TYB A;  2WOM B;  1YGY A;  2WON A;  3ULH A;  2VG5 B;  2E7W A;  2FHJ A;  3R6G B;  1VGY A;  1HW9 A;  2DXF A;  3BDE A;  1CJK B;  4I2Q A;  5CXT A;  5CCL A;  4P10 A;  5AE1 A;  3PRD A;  5E3C A;  5J2Q A;  1EQM A;  1JLQ B;  2M3D A;  5JVG Q;  4B3S F;  2DNG A;  1KN6 A;  5GAE U;  3QMQ A;  1R27 B;  4GMK A;  3MMJ A;  1P1T A;  1Q4R A;  2J7K A;  1TK5 A;  1BQM A;  1NK5 A;  1HQE B;  3H42 A;  2ZD1 A;  3UFC X;  2BXJ A;  3RW7 A;  4XPE A;  4DF4 A;  1KHV A;  2MY7 A;  4OI4 A;  3DDN A;  1SL0 A;  3ILL A;  2NXC A;  1FK9 A;  5M2P A;  2DNH A;  3PJW A;  1LXJ A;  4UUX A;  5KFJ A;  4C3K A;  5J1E B;  2ZOM A;  4ED3 A;  5ETN A;  1RGV A;  2KN4 A;  3GII A;  1K44 A;  4EGL A;  4IH6 A;  1RTD B;  1LEO A;  2FJE B;  6FD1 A;  4RU9 A;  2ZOF A;  2YWE A;  2ZKT A;  1RBA A;  3K5O A;  3FC9 A;  5EWG A;  1WG4 A;  2YXL A;  4KKO B;  3UE2 A;  3KXD A;  3G86 A;  5C42 A;  2R7Q A;  3WHI A;  2EBE A;  1CJU A;  3H5X A;  1LFW A;  3OR2 A;  3WC0 A;  4F3M A;  5RUB A;  3ZZP A;  2QRR A;  3I96 A;  2AYE A;  2HFV A;  1SB6 A;  4PAB A;  4ECU A;  3PVX A;  4G1I A;  2HSE B;  4LF4 F;  4U8V A;  1VHF A;  3W5Z A;  4MKV A;  3AA9 A;  1S76 D;  4ED8 A;  4JI8 J;  4QJV A;  4B3O B;  1JJH A;  1ZZN A;  3IM8 A;  3EZO A;  4MIA A;  1WF1 A;  2V63 A;  4TY9 A;  4QIG A;  4F8R A;  2MSS A;  3D1Q A;  4HT5 A;  1R8A A;  2D74 B;  4R5P A;  2MKJ A;  4M5K A;  2YX7 A;  2UV8 A;  1GTE A;  4TLQ A;  1FI4 A;  2ZJQ Q;  4NA2 A;  3KWM A;  2W7P A;  3T5K A;  5L1K A;  2EW9 A;  1HMV A;  4UOG A;  1FA0 A;  1FNM A;  4GKK J;  2LP4 A;  3C6T B;  1B0P A;  3VCD A;  2ZFH A;  2L08 A;  2YNG A;  3Q23 A;  2DNN A;  4J9V A;  4WP8 A;  2V0N A;  1OY8 A;  1QUP A;  4HH1 A;  2N3O A;  2MMY A;  2N4D A;  1Q82 T;  2W9B B;  1Q5Y A;  2E5L F;  2UXD F;  1F2G A;  1YZ7 A;  3J7Z T;  2KXF A;  1MRO A;  3LP0 A;  3UCZ P;  2B8Q A;  3KYL A;  4PRF A;  2EC2 A;  4LF7 J;  3W7B A;  2KFY A;  1BQN A;  2Z2Z A;  3Q8Q B;  1VQY A;  4LF5 F;  3IG1 A;  3CVK A;  4U9R A;  3R97 A;  2N7C A;  4Q0B B;  1RU1 A;  2XEX A;  3MPV A;  4JI7 J;  5CHC B;  4ZPT R;  3GWC A;  3P5T L;  3R5C A;  2NYH A;  3IAM 9;  1HNI B;  4RUH A;  4LUB A;  3WX8 A;  5EX0 A;  1Y10 A;  2UUW A;  2HAI A;  3QGH A;  3BEG B;  4J90 A;  3I0R B;  4OYW A;  3UN5 A;  1GQE A;  2FY1 A;  2IHR 1;  5KFQ A;  1TKT B;  2XS7 A;  3KLF B;  4NRU A;  3KTQ A;  1S49 A;  3OR1 A;  2FD2 A;  3EMT A;  2F9D A;  4KGM A;  4XDD A;  1SJ3 P;  1E6V A;  1N88 A;  5SUH A;  2GQ2 A;  3DOM B;  1S0V A;  2E29 A;  3TQE A;  4C2M A;  3AH6 A;  3C16 B;  1MNE A;  4NMX A;  5BYS A;  1IWG A;  1O5J A;  4B3M F;  5HLF A;  3QSY B;  5BYR A;  2IYG A;  4LJM A;  1S6Q A;  3VVT A;  4U7U K;  3H7H B;  1QDU B;  2K7K A;  4H4M A;  3CJK B;  5HRO B;  3PG9 A;  3GE9 A;  4LT6 A;  3PIP Q;  4OMF G;  2QLB B;  1TTH B;  2NQP A;  4LF8 J;  3KK1 B;  4DSK A;  1UZH A;  1OQ3 A;  2D1C A;  4NYP A;  1LKZ A;  3THP A;  4CH1 A;  3DGP B;  1ZYQ A;  4DL5 A;  2AZ1 A;  3CCU S;  2CPY A;  2V4Q A;  1FWK A;  2MXY A;  4NCB A;  4PYD A;  1Q7L B;  3G96 A;  1SKU B;  4JI1 J;  4ZP8 A;  1RAJ A;  3LPE A;  1HNX F;  3NAI A;  3MFH A;  3K7R A;  3J7A 1;  3JAM Y;  1NBE B;  2QMX A;  3J80 Y;  1VQK S;  2KTQ A;  2FJD B;  1MU2 B;  2ZBI A;  3RB3 A;  1Q81 T;  3BQ0 A;  4C4W A;  2GVZ B;  4IR1 A;  1K47 A;  1WOS A;  5A2Q U;  1U6Z A;  5C2G A;  1LK7 A;  2P8I A;  1LWF B;  1IM6 A;  3Q89 A;  2DNY A;  3DLE B;  2P9C A;  5A8W B;  3TJ8 A;  3OD2 A;  4TU8 A;  3C19 A;  2ZJR Q;  2OEM A;  3PRV A;  1U4B A;  3VV2 B;  3DM2 B;  2CWX A;  3WIV A;  3V4I B;  2HBY B;  2HVD A;  3R7S B;  3M8R A;  1ZTT A;  4J91 A;  2VKZ G;  2LLZ A;  4OJ1 A;  2V34 A;  3P49 B;  5MLC V;  3AD7 C;  1Q7Y T;  7FDR A;  1S1T B;  4KTQ A;  2HVZ A;  4ZOS A;  2NXJ A;  3CJ8 A;  4KV8 A;  3HVT A;  4OLP A;  4DLG A;  3FEZ A;  4ECY A;  3JQJ A;  1RBO B;  4X66 J;  4E0D A;  2DR9 A;  2BAC A;  5I3U B;  4O44 B;  4U95 A;  4C8O A;  2BE9 B;  3RAQ A;  4AL5 A;  4OYA A;  3NL0 A;  3OXG A;  2CVI A;  3RBD A;  2HGM A;  4FYV B;  5B08 A;  2XMM A;  3CJS A;  3BGO P;  4FKX A;  4HI1 A;  3GIL A;  2RIJ A;  4LFA F;  3GV8 B;  2HWT A;  3BKF A;  4K8R A;  1LV5 A;  2HHQ A;  4DG1 B;  4RUA A;  5F3Z A;  3KUE A;  1B64 A;  1SV5 A;  2ASJ A;  3RB6 A;  3CB4 A;  3KJV B;  5AJ3 J;  4FYD A;  1CJT B;  2GFF A;  1FVQ A;  1Z1Z A;  4WFZ A;  2DO4 A;  1SJ1 A;  4OV6 A;  3IA0 A;  1WJ9 A;  2WRM A;  1SI9 A;  1FD2 A;  1RAO A;  3KG0 A;  1VOM A;  4PZV A;  5D3G B;  2F8E X;  3V81 B;  3EE3 A;  5GAE I;  3EIC A;  4G3I A;  2HHH F;  3M2U B;  4ZVH A;  3TJ9 A;  3IS9 B;  2FHJ D;  4P75 A;  1VQM S;  2FLL A;  4RNH A;  3M30 A;  2DHX A;  1S1X B;  1YJT A;  3MUM P;  2XI2 A;  1HAR A;  2AJ0 A;  5CYQ B;  2JEF A;  3VF0 B;  2WCX A;  2B4V A;  2ZH6 A;  3MMB A;  1DZ5 A;  2Y1R I;  1VLO A;  5C24 A;  4GO5 X;  1JLG B;  4HH0 A;  3TAN A;  1QSY A;  2F3J A;  2IRY A;  3DMJ A;  1U26 A;  1SIW B;  2OGU A;  3HF5 A;  4FPR A;  1QTN B;  1UKU A;  2G13 A;  4TN2 A;  4LRC A;  2DNZ A;  3UR3 C;  5KFU A;  3CCW A;  1F1B B;  2ABY A;  4TNO A;  3RGI A;  1YJN S;  1NPK A;  1CJV B;  4ELT A;  1VC6 A;  5AXM A;  2AW0 A;  4KFB A;  2H4Y B;  2VH7 A;  4IRC A;  2CAJ A;  4CH0 S;  1U0H A;  3Q86 A;  1S4E A;  2DNQ A;  4QW8 A;  1Q1K A;  1WC3 A;  2PI4 A;  2RIL A;  1DY3 A;  3G6X A;  1RSC A;  1HPZ A;  5E3R A;  1NHK L;  2APO A;  2VV5 A;  2K3I A;  3BGR A;  3ILJ A;  5ETR A;  2FJV A;  4WTO B;  1ZPV A;  5B0B A;  3EDQ B;  3R7N B;  2POK A;  3DRS B;  5CAB A;  3HJV A;  1Z2Z A;  4WYL A;  3QWU A;  2E66 A;  4DFM A;  2DRA A;  4DV3 J;  4F02 A;  4F4A A;  5IC6 B;  3WIU A;  2W1B A;  2O01 C;  1RLD A;  4X4T A;  1RT1 B;  1X9M A;  3H2V E;  1RT2 B;  1YSJ A;  1NK8 A;  3D6M B;  5J2P A;  3MR7 A;  2RD5 C;  4F04 B;  5HVG A;  5M2R A;  2I0X A;  2C2O B;  2YX1 A;  1BD6 A;  1TK0 A;  3M8S A;  1H98 A;  1Q79 A;  4DR7 F;  2MQ8 A;  2RUS A;  1NK9 A;  3MD3 A;  3D5M A;  4DSI A;  2NRE A;  4L6V 3;  2XMK A;  3TAM A;  1U7L A;  2I5J B;  1FFS B;  3PR5 B;  3U27 A;  3KK3 A;  4Y0F A;  5E5N A;  4CRJ A;  2XO6 A;  2ZH1 A;  2JHE A;  2YPY A;  1WTF A;  2MQL A;  4J9R A;  5HBM B;  2CPX A;  2M70 A;  1P6T A;  4OX6 A;  3MTK A;  5GMD A;  4ZVR B;  4ED4 A;  4FKY A;  3JTO A;  3DGV A;  2CZV C;  1FXL A;  2JH3 A;  5HQL A;  3BDP A;  3LTO A;  4AFF A;  1OPZ A;  3ZO7 A;  2MKH A;  3E01 A;  4PEO A;  1U48 A;  2DGT A;  1S79 A;  5ETV A;  2QMU B;  2AU0 A;  2J9D E;  1X9S A;  4YY3 J;  3BGL A;  1B99 A;  4Q8F A;  3HHK A;  5A2Q Y;  1HNV A;  3PM9 A;  4CNY A;  3FUY A;  1RB0 A;  5A8R B;  1CLF A;  2OPR A;  6AT1 B;  1N34 J;  1FEH A;  1PKU A;  3IN5 A;  5FD1 A;  3A8J A;  3TA0 A;  3I5C A;  5E0O A;  2RAQ A;  5IQ6 A;  4K4Z A;  2RQC A;  1S0N A;  2HFU A;  4CO2 A;  4DFP A;  2XNR A;  5D8H B;  1F60 B;  5KFK A;  5JMN A;  5C2C A;  4IOA Q;  1GT8 A;  3NEK A;  1RYS A;  3EXY A;  2CNK B;  2LQ9 A;  3SCK E;  1BE4 A;  4ZP6 A;  1U25 A;  1FDB A;  4LF7 F;  3GCW P;  3EJM A;  3W61 A;  3OUY B;  2M8D B;  3DFE A;  1N5Q A;  3M6W A;  3MR2 A;  2MQP A;  3C15 B;  3H5Y A;  1P9Y A;  4H4O A;  1YJ7 A;  4YR2 A;  3HHE A;  1VHI A;  1LWC B;  4B3R J;  5L39 A;  3RYL A;  1IVZ A;  3M8Q A;  3BBB A;  4ED0 A;  2Y1L B;  3LQV A;  3CJ5 A;  3N5F A;  2QL7 B;  1X8D A;  2RML A;  3NS5 A;  1LNQ A;  4TY8 A;  3ENQ A;  2DGV A;  3EX7 B;  3Q2T C;  2PA3 A;  1KFS A;  5HMZ A;  2G1H A;  3M8Z A;  2DGO A;  3PX4 A;  2AJ2 A;  1VYA A;  2RDD A;  2B7B B;  1N0V C;  3PAC A;  2VG6 A;  4DUY F;  4DX8 H;  4B3T F;  3ITH A;  5BR8 J;  1N48 A;  3LPY A;  4NLS A;  1RTH A;  1ZZF A;  3LF0 A;  4DR5 J;  2WVF A;  3J7Z 5;  2LU1 A;  1C1B A;  3T1Y J;  3NS7 B;  4P73 A;  1M5K C;  4X4S A;  1U1P A;  4PR6 A;  5KFG A;  3CO9 A;  2DHA A;  5JXS A;  3MM6 A;  1OYD A;  1WOO A;  4GVB B;  2ZHO A;  2KM8 B;  5B0E A;  1S6O A;  3PR4 A;  2XUL A;  2NZC A;  2I6W A;  1IBL J;  2YNH A;  4NXN J;  2DY9 A;  2R7T A;  1D8Z A;  4ANE A;  2IBO A;  2KJW A;  3KUG A;  4WCE Q;  1WF0 A;  3IMQ J;  2H54 B;  1SQE A;  2CJB A;  4XTT A;  2EKY A;  4DQS A;  2JJ4 D;  3QIP B;  3NGS A;  2W2N P;  4Y34 A;  2E1R A;  1ZAW A;  4NLQ A;  3EDR B;  1YBU A;  2NXN A;  5KFO A;  1S6P A;  2FGC A;  2FJB B;  4KGK A;  3F56 A;  2OSR A;  1SH2 A;  3QO9 B;  5AXN A;  1N6Q A;  2QA2 A;  4M5G A;  1ZBT A;  2Z4P A;  2HHT A;  2MKS A;  2LA4 A;  1N52 B;  4ZJL A;  1R43 A;  2MEW A;  2AJ4 A;  5J2N B;  1VIS A;  2C3M A;  2R7V A;  3PFO A;  4PXB A;  3VQS A;  2ZBC A;  2NSC A;  1OIA A;  1T9V A;  3AJ1 A;  3W8G A;  2YKO A;  5F0U A;  2YNF A;  3RBE A;  3T6J A;  3FEX B;  4USW A;  2HQF A;  4JI3 F;  1HD0 A;  5T41 A;  1Q95 G;  3KJQ B;  4LRE A;  3DOM A;  2DO0 A;  2JLG A;  2MHN A;  2BOP A;  2FHK A;  1VQS A;  3C16 A;  1LW2 B;  4IFV B;  2RT3 A;  4FDF A;  1YBT A;  3GFX A;  2DGS A;  4DL7 A;  4X66 F;  1XR6 A;  4U7U D;  2VQE F;  3QRR A;  4KO0 B;  1KD1 T;  1V5V A;  4WKR A;  3C6U A;  3IO1 A;  2XWX A;  2CPE A;  3MM7 A;  5D78 A;  2FLN A;  1HWJ A;  4RLE A;  1TMJ A;  4FNI A;  5AXK A;  2VFU A;  4IOB A;  1SQF A;  4JI4 F;  5CH7 B;  1F5A A;  4F3O A;  3TX0 A;  4DV7 F;  3OFF A;  1KKH A;  3GJT B;  5CYJ A;  1IWA A;  1TV6 A;  2ZM6 J;  5F9N A;  4MK9 A;  3ZTR A; 
#chains in the Genus database with same CATH homology
 3HSZ A;  1F9H A;  3ILO A;  4M5G A;  3MCN A;  1EX8 A;  5ETP A;  4M5I A;  5ETL A;  3KUE A;  1RU2 A;  5ETO A;  1RAO A;  5ETS A;  4CRJ A;  3HCX A;  1TMM A;  1RU1 A;  3HD1 A;  3KUG A;  4M5N A;  5ETN A;  2F63 A;  3UDE A;  4F7V A;  3KUH A;  4PZV A;  5ETQ A;  1HQ2 A;  3HD2 A;  3ILJ A;  3UDV A;  3ILI A;  4M5H A;  3QBC A;  5ETR A;  4CYU B;  5ETM A;  1CBK A;  3MCM A;  3MCO A;  1EQM A;  4M5M A;  5ETT A;  1TMJ A;  2CG8 A;  3HSD A;  3HT0 A;  4M5K A;  2F65 A;  4M5J A;  1RTZ A;  4M5L A;  2QX0 A;  3HSJ A;  5ETK A;  4CWB A;  1HKA A;  1RB0 A;  1G4C A;  1DY3 A;  3HSG A;  3UD5 A;  5ETV A;  3ILL A;  1EQ0 A;  3IP0 A;  4CYU A;  2BMB A;  1Q0N A;  4AD6 A;  1KBR A;  1IM6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...