3IMFA

1.99 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor'
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
255
structure length
248
Chain Sequence
b'NAMKEKVVIITGGSSGMGKGMATRFAKEGARVVITGRTKEKLEEAKLEIEQFPGQILTVQMDVRNTDDIQKMIEQIDEKFGRIDILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQAIGKYWIEKGIKGNIINMVATYAWDAGPGVIHSAAAKAGVLAMTKTLAVEWGRKYGIRVNAIAPGPIERTGGAEMAKRTIQSVPLGRLGTPEEIAGLAYYLCSDEAAYINGTCMTMDGGQHLHQYP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short chain dehydrogenase
molecule tags Oxidoreductase
source organism Bacillus anthracis str. 'ames ancestor'
publication title 1.99 Angstrom resolution crystal structure of a short chain dehydrogenase from Bacillus anthracis str. 'Ames Ancestor'
rcsb
total genus 80
structure length 248
sequence length 255
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3imfA00
4OAQA 1E1KA 1DAOA 1FMCA 1GPJA 2DVMA 1E7YA 2VHVA 1O89A 3HZZA 3N74A 4Y67A 4AFNA 3H5AA 1B14A 4CMJA 4QEDA 4B79A 4CM9D 5I9NA 3TJRA 2EEZA 4RCVA 3VH1A 3VDQA 4RF3A 3KYDB 1H93A 2JCVA 5HBRA 4IDEA 5A1TA 4NPCA 4BGUA 4JJIA 3OP4A 3ZWMA 1D3AA 4TRRA 4DIFA 3ANNA 5IZ4A 1I2ZA 2CZCA 4WGGA 2WD7A 4KQWA 3AI1A 3CMMA 3RVDA 5LDHA 1PS9A 3H9JA 4HNGA 1DIGA 1GZ4A 1X13A 4GGOA 1GPDG 4GAEA 3WNVA 4DLAA 3QV1A 3A14A 2FR8A 1M2WA 1N1GA 3K92A 1O8CA 1U5AA 1ZK1A 3FSRA 1Q2XA 3P7MA 4G5HA 4E5NA 5KJ6A 2VZ8A 2GD1O 1SOWA 1X0XA 2VYVA 2GPTA 3DAPA 1KEVA 2YV2A 3UICA 3E82A 2GN4A 4M87A 2EW2A 1F17A 1C1XB 1R4MA 1DSSG 3NEPX 2ZB7A 4EEZA 2ZATA 2A94A 4Z3DA 2DBZA 3FPCA 1SMKA 5DBGA 3ZCXA 3M6IA 1OZAA 2Q49A 4CLDA 4CUJA 2VZ0A 4DYVA 5TJ9A 3QY9A 4ITUA 1NQAO 4M8SA 3KOUA 3UH1A 4IIUA 2GN6A 4JBGA 1YL6A 1FJHA 2DM6A 4OSOA 1ULUA 3AY7A 3K5PA 4QFCA 1YB4A 3OECA 3NDIA 2EIHA 4BNUA 4YT5A 4QSMA 2QRKA 3RUHA 1UDBA 4B4OA 5KKCA 1V8BA 2PGDA 1LA2A 1EDZA 3ETEA 5HS6A 3OJOA 4I5EA 1RYDA 4ZQBA 3B70A 3ITKA 2EHDA 2EP5A 3RBXA 2SCUA 2IYOA 4UVIA 1O9BA 3UN1A 5HWSA 3JYOA 3WICA 3DMTA 4NDNE 1B26A 1VJ0A 2BLLA 4UUMA 1HZZA 2X0JA 1VKOA 4CLHA 4CMGA 2X0RA 3D3EA 2Q45A 5A05A 1U2DA 3GG9A 4DVJA 1ZSVA 4A27A 3AOEA 3V2GA 3ZHYA 4Z9FA 1ZCJA 4AJJA 4AJEA 4CM9A 4HV4A 1N2SA 1VRWA 3ENKA 4TROA 4XZ3A 3O4RA 4DTIA 1O5IA 1VSVA 2JFFA 1H6AA 5BNFA 5ILOA 1OI7A 2OFPA 2PGLA 1MGOA 3L6DA 4YCAA 4XQGA 1U2GA 2I6TA 1PWZA 2PD6A 4G65A 2BFOA 3C7DB 1YE3A 4ALIA 4WASA 2D4AA 1QXSA 1WDMA 3NYWA 4BNHA 4KOAA 1BW9A 1E1MA 1K6XA 1V3VA 4GX0A 2VUTA 5EJ2A 4OXNA 3INGA 2QYSA 3AI3A 3RUIA 4RVSA 5FFFA 4Y6RA 4BNWA 2OZPA 5A5FA 4CM1A 2PA3A 4R1NA 3SLGA 4BS9A 1UXJA 4LW8A 3FBTA 1U7HA 1DOHA 2EW8A 4FFOA 4CMIB 3RROA 3JQFA 3HDQA 1WVGA 3HFSA 2HMUA 5KJCA 1ZJZA 3JQAA 4XWYA 1P1JA 1QYXA 1GZ3A 1CF2O 3C24A 4E31A 1WPQA 5JO0A 5JFOA 1Z82A 2JD2A 4OQYA 5CEFA 2NQTA 1ISMA 3CE6A 2C54A 3U49A 4NU6A 5JDCC 2YHUA 3ZWPA 4D3FA 2PK3A 4WLNA 4YT4A 4PLHA 1EBUA 3U4CA 1G0OA 1MB4A 3DFZA 4BNGA 1R4NB 2H63A 2FZEA 2NV6A 4DXHA 3D3WA 1X7GA 1QMGA 1QLHA 5I9MA 4BKOA 3L0DA 4OH1A 4J90A 3ZDFA 2E37A 2HMTA 1ZMOA 5L95A 1LUAA 4LMPA 1R4MB 3DC2A 4HWKA 5T57A 3FWZA 2W2KA 3RC7A 3DQPA 1XG5A 4OOFA 8LDHA 1QYVA 3L4BC 4IJWA 3VZSA 2CVQA 2FSSA 4NI5A 2GDZA 5AQ1A 3DZFA 4NBVA 4RORA 4JJFA 4Q3DA 1YKFA 2C59A 3E9QA 4K28A 5TRTA 1DAPA 2J3IA 2ZYGA 2FHSA 3MOGA 2VHWA 1JA9A 2IEBA 3EZLA 3OMLA 1HE5A 4HFJA 1PSDA 2GZ1A 3RAJA 1KC1A 1XLTA 1D1SA 4YXFA 1WZIA 2C7VA 2AEJA 3OA2A 3ASVA 5BSEA 3ENNA 1E3LA 4BO6A 4I5DA 4O5OA 4PIVA 3ONFA 1YONA 3L9WA 2A9FA 4WE3A 5DULA 2PH3A 1P1IA 1YQDA 2CMDA 2VWHA 4IDCA 3AJRA 1DB3A 1R6DA 2QG4A 5C37A 1ZUD1 3EVTA 3K31A 1KIFA 1ONNA 4M49A 3E18A 2V6MA 1V9LA 2QZ9A 2VTDA 4E12A 1S7CA 1PGQA 2ZTVA 1PZEA 2HJRA 3FNHA 4O59O 1B7GO 2VHYA 3GC6A 4IGFA 2DKNA 4KTVE 4GX5A 2Q2WA 4J3FA 4L75A 4RVDA 3K73O 3C1TA 3R1IA 3HE3A 2VT3A 2Q99A 5F1KA 4ND1A 3ZU2A 4B7UA 1KBZA 3VH2A 4BKUA 3RUCA 4CLRA 3BHMA 2E82A 3GPIA 1GUZA 3WG9A 2FMUA 4E3ZA 4R68A 3P2OA 1ZXBA 2Z95A 4RF5A 1L7DA 2VRCA 3D5QA 3PTZA 3CXRA 5IDWA 2I65A 2X7HA 4TWRA 2BFAA 4GGPA 2CD9A 1FDWA 3AK4A 3PQFA 5A9SA 3GDOA 2J3KA 1JTVA 1F0YA 1U7TA 2B5VA 1HE2A 2C5EA 3ZWNA 4CM4B 5DP2A 4J2OA 4EBFA 1K0UA 2AG8A 4XGNA 3V2HA 2NVUB 1Q7GA 1GUFA 1X15A 2NVBA 3ZWVA 1NFFA 3KLPX 2B83A 1NR1A 4CPDA 4XD2A 1E5LA 2ZB8A 1BG6A 5TQVA 1X0VA 2VNAA 1UAYA 3ZU4A 4YPOA 3P19A 1Z7EA 4YWJA 2DBVO 3H9GA 2ZCUA 5IG2A 5F1OA 1EVYA 2AE2A 4NJMA 2NM0A 4RL6A 1SC6A 2HMWA 2X1HA 4LGVA 1NFQA 3PLNA 4FJ1A 4GH5A 1HDOA 3QP9A 4PLWA 3WJ7A 3SC6A 4B8WA 4ZQHA 2W98A 3GVCA 2OBNA 1EBFA 5JBIA 4CLEA 4FC6A 1EE9A 4S3MA 1YVEI 3HN2A 3KZVA 1ZIDA 1I2CA 5B4VA 2V7PA 4BNXA 3WGHA 4I9NA 1OBFO 2ZQYA 4CMEC 4RPKA 1HKUA 4NFHA 4WNIA 4Y6SA 1MC5A 4RJTA 3C8MA 1YJQA 3S2EA 4WNCA 3WGGA 4L74A 1PZGA 2GASA 1H94A 4CJXA 1A7KA 3FRJA 1DC5A 1HE4A 2WYWA 3HSKA 3ICPA 4MVJF 3VPFA 4YTEA 2H1SA 2NTJA 1J6UA 4P4LA 2RIRA 1Y8RB 5ES3A 3MWDB 3A28A 2PZMA 4HFNA 4IDAA 3MWEB 1U3TA 1W73A 3ZHBA 1VE9A 2O50A 3AUUA 2GLXA 2YJZA 1LQTA 3IJPA 3ROPA 4BMSA 4GQAA 5L53A 2X0IA 4W9NA 1C1XA 1H9AA 3AOGA 4X54A 1PX0A 4WK6A 4B3HA 2UDPA 3IIEA 1WZEA 2X0NA 1RM3A 3DZGA 1VLLA 2EERA 3IP3A 4GL4A 2VN8A 3PHHA 4HKTA 1TT5B 2Y1FA 4U6SA 1NQ5A 3PXXA 4AJ4A 5ADHA 3ABIA 3DZKA 4PLVA 1W6UA 4XA8A 5THKA 3E03A 1HRDA 3TNLA 3ICCA 3STHA 2AE1A 2UYYA 5FYDA 3EZYA 3NKLA 4ZHSA 4AJ1A 2O48X 4FSHA 1EMDA 3WX0A 4J4TA 4FD3A 4UAGA 3LVFO 4XR9A 4YAIA 5JAIA 5BQFA 3ETGA 1NM5A 3JD1A 1HLDA 4R1TA 1ADBA 1ADFA 3GZ4A 5I7FA 4JROA 4KMSA 1BWSA 4TRJA 2E48A 5CAEA 1ENZA 3ZWXA 2PH5A 4FIZA 2X22A 4FS3A 4WLEA 1PZFA 2X5KO 4PLTA 5CG1A 1K5HA 2OXIA 1I3MA 2X9NA 2F1KA 3S8MA 2YV1A 1AN9A 3GZNB 4L4XA 3SEFA 1JKFA 3F46A 2H6EA 3I9NA 4JN6B 1LSOA 1T4BA 4RVUA 3RKUA 3VVBA 4GWKA 2OORA 2HMSA 1HXHA 3TZ6A 4RF2A 5DCUA 1IB6A 3JQAB 1YRLA 3FR8A 1PJSA 1BDMA 5JC1A 1NAIA 4YRBA 1JU9A 3WJAA 4Z6KA 2Y0EA 4W99A 4O6VA 2Z1MA 4FPXA 4LRTB 1UDAA 2DTXA 4IJKA 4EW6A 1QYCA 2OUIA 3TZQA 4URFA 4OIMA 2Y1EA 4J1TA 3H2SA 3JQ9C 3OEYA 3M1LA 4YQZA 4GMFA 5L45A 4AJ2A 2PD4A 5IJZA 3GHYA 3ST7A 3OJLA 3ZI0A 1PL7A 1PJ4A 3MJVA 1UXGA 5G0TA 4L0QA 5BNTA 2BGKA 2JAHA 5JMPA 3VZQA 4LVUA 3UF0A 2NLOA 3DZJA 4OYRA 2B5WA 4FGSA 4E0BA 4RVHA 3GGOA 4QECA 3PIIA 5IF3A 4E5PA 4J1QA 4YQYA 4XJSA 3GEMA 1E0DA 4R9RA 5KVQA 4IJVA 1B8PA 1IE3A 4MVJP 3CH6A 1A9ZA 4PZDA 4ZGWA 1KY5A 4HNHA 3OIGA 3RFXA 5A4DA 2AG5A 3TQHA 4CMIA 5FWNA 4BV9A 1SCUA 4L4SA 4YB8A 1PL6A 1FXSA 1E6WA 2VOEA 3PPIA 3TWOA 1G6KA 5I8ZA 5KCZA 2CY0A 1LXCA 3A1NA 2XF8A 5COQA 3RUAA 2IZ0A 1KVUA 2ZYAA 4L4RA 1ENYA 2ZTLA 4WCFC 5C7LO 4YJDA 4XGKA 1YBMA 5DCWA 4Q3BA 3PHIA 5B4UA 5TLSA 3IS3A 4XGIA 4M89A 4YAGA 2QYTA 1M6WA 1Q0LA 4L8VA 4OHUA 4PFJA 1NR7A 1NWHA 2B0JA 2RBEA 1BHSA 2O23A 3PYXA 1JVBA 1A5ZA 1ZEJA 1RPNA 3G1UA 1DEHA 2BI7A 3E5RA 3JCZA 3V1YA 2NTNA 2HU2A 3UXYA 1YOVB 2OOSA 4LMRA 3BA1A 3WWZA 1KVRA 4YEDA 2YW9A 1P3DA 1QR6A 2O4CA 4BMNA 4MOWA 5TF4A 1YL5A 2ZIZA 3RFTA 5HRUA 1ZKMA 4EZBA 1E3WB 1NHGA 3IKVA 1DHRA 3JYQA 4U6QA 1IL0A 3OICA 3RCBA 1ONOA 5K6AC 1I5RA 4ZA2A 3VPXA 2IXAA 3PZBA 4OMUA 2C0CA 3HQ4O 3G79A 4E5YA 1B8VA 5KJEA 3SXPA 1C14A 4CM7A 4K26A 4E30A 2FP4A 3QSGA 3MJEA 4FN4A 1SB8A 4R5HA 3RU9A 3IAHA 5L7WA 2UVDA 5BSHA 3KETA 1PQPA 3AWDA 4BL5A 5CEJA 4ND2A 5U1PA 5F5NA 3GDGA 4NH4A 2HO5A 2O3UA 4JCOA 1K6JA 2FR0A 1B16A 3GZNA 4J1NA 5CG2A 1SNYA 1CQIA 4WPGA 3GNQA 3F9IA 2V6GA 2X9VA 3ZNQA 4CMKA 5L9AA 1U4OA 4II3A 4CUKA 5JCXA 2EKLA 3OQBA 4CM3A 4A73A 4TVOA 4CM5A 1N92A 3JSAA 3MJCA 3OIDA 5CFZA 3DMYA 4OQZA 3PJGA 3CKYA 4GSLA 2ZB4A 2CNBA 4N54A 2AXQA 3WIEA 4KZPA 2VQ3A 3KM0A 4DYDA 2V6FA 2BGMA 3K2EA 4YJFB 4QTZA 4OGWA 2PR2A 5I7EA 3ONEA 3ZW9A 3EMKA 2X86A 5IZCA 5JS6A 4XB2A 1A7AA 1EVZA 4J4HA 3PHJA 1Z7BA 2PD3A 4B7XA 1LC3A 3HG7A 2Q1TA 1E92A 1ZSYA 5I7SA 2JD1A 4O1MA 4PLPA 2FWMX 2QHXA 3ZWAA 3NGXA 1X14A 4B8ZA 1F14A 4N7RA 2PZLA 5IFLA 1U8XX 5AXBA 1UAGA 4P4NA 3W1VA 3PP8A 2J5KA 4WLVA 1UR5A 2CDAA 2VUSA 1ISGA 2NU9A 1HDRA 4E2YA 2HCTA 4TVBA 2Q1WA 6ADHA 1GQQA 3R6DA 1H9BA 4XIYA 2TMGA 2O3SA 2IZ1A 2DTDA 3Q2KA 4LRSB 4QO8A 5GZ1A 2CF6A 4IJUA 1C0LA 4FGWA 2YQ4A 4NMHA 1LDMA 1E6EA 4RQTA 3UOGA 4IMRA 3D4PA 1R0SA 3ZH2A 5DBFA 3VAZA 2I5PO 3GVXA 1ENPA 4LCEA 1I24A 3QHAA 2HJSA 4KDEA 1YH3A 2W2LA 3FF4A 1YO6A 4TRMA 3DOJA 1N8KA 4R41A 3S2IA 2GF2A 2QW8A 1N5DA 2BFMA 3HDHA 4BO4A 3NUGA 3H6KA 4PG7A 5HTOA 2HRBA 2YUTA 1P0CA 1JKIA 2E6UX 4Z0HO 3DXFA 4XB1A 3V5NA 4D41A 1GCOA 5G4KA 1ZFNA 3D5TA 1KVTA 1Z73A 2HQ1A 1XQ6A 4BO1A 5KVVA 5TC4A 1PGOA 1T26A 5T67A 2EXXA 1MXHA 3O8QA 2EF1A 1DHTA 4LISA 2BGLA 2H9IA 4MDHA 1WW8A 2G1UA 4JXKA 1ZK3A 3NV9A 3HWRA 3DONA 4R4JA 4RLHA 3NTRA 2WM3A 3M2TA 5EQFA 1Q0QA 3SLKA 1ISJA 4CMAA 1H6BA 2BRUA 4NQZA 3DTTA 4R5MA 4DBVO 1RKXA 3EY4A 1Y8RA 1MUUA 5CPFA 3DR3A 4R1SA 2ILTA 4CM8B 5GY7A 4H15A 1NHWA 3NGLA 3RU7A 1UJMA 3ZU3A 2I66A 1M67A 4YR9A 2DT5A 4QT0A 4QO7A 3LLVA 3RUDA 4Q9NA 5DCYA 1E7SA 3WIDA 1PGNA 3BHJA 4CR6A 1UDCA 3LYLA 4HFMA 5AVOA 3GQVA 1OAAA 3FPLA 5JDIA 3F4LA 5A04A 5IN4A 4R3NA 1KOLA 4IPTA 3ZV6A 1N9GB 4YBZA 1TLTA 5U4QA 4F6LA 4D3SA 1EVJA 4ALKA 2Q1UA 4PLZA 5DOVA 5AXCA 3FHLA 4U5QA 3HJAA 4CM8A 3AFMA 3UCFA 5B1YA 3LT4A 2FZWA 1RM5A 5CP8A 3K9QO 2F00A 2Y05A 4JP2A 5JE8A 1QSGA 5ICMA 1OC2A 4INAA 3MZ0A 1T1SA 5G4LA 2EJWA 4J91A 3ULKA 3H8VA 3U4HA 1N7HA 3GAFA 2Y1DA 3BMCA 3EGOA 3W4IA 3WOHA 3PRJA 2RH4A 1OOEA 2NACA 5ER9A 1PR3A 1YDWA 1F8GA 3DAFA 4XCVA 2X23A 3WMXA 3DBHB 4IGEA 3JQ8A 5T64A 4DA9A 1HEUA 1ENOA 5I9LA 1KERA 2NWQA 1HE3A 5JO9A 3DOOA 2Z5LA 1U8FO 4K6CA 1YB5A 1U1IA 4YDRA 2GUGA 4E4YA 1A4IA 3L77A 2DFVA 1PGJA 3GVIA 2PZJA 1X7HA 4J2HA 1L1FA 4MVJH 4KP7A 1LDEA 1SO8A 2WD8A 1HL3A 1BXGA 1P1FA 3WWYA 1XCBA 3HDYA 3O9ZA 2XAAA 4GI2A 5C7IO 3PJDA 2D2IA 2G17A 4ID9A 1LI4A 3K2BA 1AHHA 3GG2A 2BFPA 3NX4A 5JDCA 3PI7A 1HYHA 4MP3A 3RKRA 2ZJ1A 1D7OA 1MG0A 1DO8A 3OF2A 3PIDA 4I5GA 4IZIA 1P9LA 3S55A 2P2SA 2EWMA 3KEOA 2XOXA 3NDJA 4JQCA 2VYNA 3FWNA 3JQ6A 1H2BA 4NU5A 1MG5A 4BO9A 1ZW1A 5EL0A 3K6JA 4DPMA 2WEKA 4IM7A 1ZH8A 2D0IA 4WOKA 3MTJA 1ZK4A 3MOIA 3CZMA 3VC7A 2NU8A 3KYDA 1EFKA 1E7QA 4FCCA 4OXKA 1I3KA 1XIVA 3U9LA 3W6UA 4B4VA 1G0NA 4ZU3A 2Q1SA 3WGZA 1X1TA 2Y1GA 1E6UA 2ZB3A 2VT2A 2PNFA 3O8QB 4TMFA 3VPHA 1YQXA 2AEFA 3ZV3A 4CMBA 4QFDA 1D8AA 1WDKA 3VZRA 3AFNA 3KLMX 4ZQEA 2OL4A 3B20A 5ER6A 3C1AA 2C2XA 4PLFA 3KBOA 1KYQA 3QE3A 4NJMB 4GWGA 3RSHA 4D44A 4YVFA 4NG5A 2HK7A 5A02A 4E2XA 5T8KA 4E5MA 3BMNB 4J4BA 5ICSA 4WCFB 4A26A 5AOVA 3NT4A 3GH3A 1V35A 2GR9A 1QV7A 4DREA 1JQBA 3WYCA 4FJ0A 1O6ZA 2OP0A 3EAGA 1B8UA 3A4VA 3PYMA 1X7DA 4ROSA 1LLCA 3LU1A 2B35A 3EYWA 3T4EA 1C0PA 3OEWA 2BMAA 3RQSA 2DPGA 2IODA 4CQMD 1N9GA 3PDJA 2Y93A 1PTJA 2NUAA 1UP7A 1CDOA 3COSA 4QX6A 1LDBA 2P9EA 5IZCC 2D1YA 5CDGA 1SB9A 1H2HA 5KJFA 5JPIA 1GFSA 1KC3A 1GV1A 2DLDA 3G0OA 4AVYA 4W82A 3B1KA 4CM6A 4EUHA 1ADCA 4K6FA 3KV3O 3BTVA 2AMFA 1A72A 1SEVA 3KSZO 3IL2A 3DBLB 4EDFA 4O0LA 1DFIA 3IUPA 4FFPA 3UCXA 4UUNA 2VWPA 3WFIA 4W7HA 2PTGA 3C85A 1G1AA 5DP1A 3LK7A 4BGEA 4J0EA 5HM8A 2V6BA 1U3VA 5EESA 4W4TA 4YYZA 2OMEA 4A10A 4RVGA 1GCUA 2XXJA 2X58A 1NQTA 1UUFA 3KSDO 5TT0A 1KEWA 4M55A 1PJQA 1Z45A 3SJ7A 3GN1A 5JNLA 1S6YA 2QIOA 5A9SB 1ZBQA 4S1VA 5A03A 2BH9A 4ZRNA 4Z9XA 4J49A 1T2CA 4BKPA 3E9NA 2D3TA 1HYEA 3H9UA 1ONPA 3JV7A 3O38A 1MFZA 3IC5A 3JYLA 4MVJE 1HSOA 3FBGA 4UVDA 1AXGA 3DAGA 4GPD1 2R2GA 4MVJM 1QORA 4W7IA 4PVCA 4EJMA 4CLXA 3F5SA 2ZJ0A 4IXTA 3GAZA 4DIOA 3JQGB 5DDIP 5BT9A 3TN7A 4D3DA 1J5PA 3TZCA 1SEPA 4G81A 4CQMB 2WWRA 4OL9A 2NU7A 1LSJA 4IIVA 3GGGA 3GMDA 1B0AA 3DZHA 2CF5A 3L07A 3UW3A 1E7MA 2X5JO 1X1EA 3DZBA 2V65A 1LLDA 2GGSA 3AUSA 5JSFA 1J0XO 3OH8A 4B7CA 3KYBA 2JJYA 3FR7A 2IZZA 4IDFA 4ALNA 3GGPA 1QYWA 1DPGA 1CJCA 4RPLA 1NVGA 1VI2A 3BIOA 5L40A 3JQ7A 1PGPA 1Y8QB 3HHPA 3H5NA 1DXYA 1QG6A 5DNAA 3RUFA 3GHHA 1TVEA 3GNSA 3H4VA 1PJCA 3LLSA 4C7KA 4BGVA 3WLEA 5JY6A 1ZXLA 2W90A 1ZO8A 2X4GA 4XJTA 1GEEA 2WYUA 1QP8A 1LTHR 4RZHA 4MIOA 4R9SA 3OHSX 3UVEA 1GAEO 4R16A 1Y9AA 1VC2A 3QQPA 1HDYA 3JQAD 1NPDA 3RJ9A 1MLDA 3AY6A 3MTGA 1C3VA 4LSWA 4CM4A 4B4UA 1R4NA 4PVDA 3KO8A 3S2GA 4E2ZA 2JKVA 4MP6A 5DT9A 2BHLA 5KNLA 3U4DA 3W8EA 4XYGA 3JQDA 1EQUA 1ML3A 1PJ3A 4CQLA 1PQWA 1YBVA 4LK3A 1HETA 1R0LA 1GL3A 2A4KA 2TMDA 2O7QA 3JQCA 3P5SA 4NK5A 4Z0TA 4DMMA 4Q39A 5EERA 1Y81A 1PS8A 3VH4A 3HNPA 3W6ZA 2C29D 2HDHA 3E8XA 2DU8A 1QRRA 3D7LA 3GEGA 5L3ZA 1VPDA 5G2OA 1HF3A 2QRJA 3PFWO 3U09A 3EUWA 1BVRA 5EINA 1NAHA 1WNTA 1H6CA 3BMCB 3L9XA 3EDMA 3U4IA 1O95A 3E6AA 1OC4A 2D59A 1FF9A 4XIJA 4D0RA 4YRAA 1C0IA 4OOEA 1K2WA 1PJLA 2UAGA 4RO0A 3GFGA 2NU6A 3E5MA 3QLJA 4MVJG 3DHEA 2GO1A 1DIHA 3F47A 4BQRA 4AJKA 1GYQA 4XYMA 1H6DA 3ROKA 5I8WA 3U0BA 3PZRA 3AW9A 5GZ6A 1TXGA 2AEMA 4JGBA 4H16A 4MKXA 5IDXA 1HT0A 2OP1A 2J5QA 4LVCA 3GMSA 1NWCA 2LDBA 4IUYA 4QQRA 4NBTA 1NNUA 1PIWA 4RZIA 4UEOA 3PJFA 4Z9YA 3V1TC 4A7PA 1DIRA 1KEUA 1BTOA 2IXBA 1NP3A 4FFMA 4PZCA 5A9RA 1EE2A 4ZJUA 5TT1A 2AW5A 1Z74A 2HAEA 2CDBA 4ND5A 2GN8A 4DMLA 1UXKA 1JAXA 1NPTO 2WSBA 3G1TA 4E6PA 2RCYA 1FDTA 2WDZA 5L7TA 3I6IA 3KHUA 3TDKA 3ZNOA 2PY6A 3Q3CA 4TZTA 2P5UA 3LF1A 3WBBA 4NK4A 4CV3A 2IRWA 3WNQA 4EYEA 1MX3A 2EP7A 3FTNA 2O4UX 4I08A 2J3JA 3ZWOA 2WTBA 2Y66A 1HDZA 4CR7A 3DHNA 5TS3A 5J23A 3UUWA 4R1UA 1TT5A 1ISHA 3AUAA 5K6AA 3PGJA 3PLRA 1DC6A 2HK8A 4HFRA 3RBVA 1DC3A 3NTQA 3TZHA 2DTEA 4BGIA 1R12A 4H3VA 5IDYA 4N5MA 2WMDA 4Y6PA 1PZHA 4N18A 2ZTMA 4RPHA 2P9CA 1A27A 4I1IA 1UXHA 3PDUA 3T7EA 3BHIA 4YJGA 1QLJA 2VWQA 3OA0A 1P33A 1HYGA 1DLJA 1GYPA 5KTKA 3RIHA 3R0IA 1LDYA 4YJFA 1JAYA 5BSFA 1PJ2A 1R0KA 3LC7O 4E5KA 3BMNA 2J3HA 5TIIA 3QWHA 1GEGA 1TEHA 4IQ0A 3S1LA 4BO5A 1LSSA 3W8DA 4BMVA 1K89A 3F6YA 1EEHA 3F4BA 3PFFA 4PRKA 3UFXA 3ITDA 2Y68A 1NPYA 4JX8A 1DJQA 5F1PA 3HN7A 2QZZA 1UH5A 4HP8A 2Y0CA 1I3NA 3NT2A 4Q3NA 5H83A 2VTEA 3ASUA 1LNQA 3C3XA 4L9RA 4M1QA 3LSYA 3GFBA 2W2LD 3RBZA 4CMCA 4ESOA 2W4QA 4UVHA 1DDOA 4JNKA 3OQ6A 3PYLA 5THQA 2UV8A 1M6HA 3WB9A 3PWZA 2AQKA 3JQ9A 5JAQA 4A0SA 1P0FA 4IY1A 1WXDA 1EUZA 1PEDA 2OO5A 2FY8A 3I83A 2O2YA 2OBYA 2P4QA 4IMPA 1TT7A 1M76A 3JQGA 5L4SA 3OBBA 2X9GA 4ZQGA 4D43A 4MIEA 4XR4A 3AOEC 1LLUA 3B1FA 3FCOA 2NVWA 2DBRA 2JCXA 1YOVA 2HKIA 3PQEA 4PZEA 2C5AA 4OO3A 2EGGA 1YBAA 2EGHA 2NTVA 2VHZA 4R51A 1V0JA 2RHCA 4JJGA 4D42A 4D45A 1YB1A 4UVEA 5C5IA 3CSDA 2AQHA 5CPBA 4DWVA 1PS0A 3TRIA 1AE1A 1LLQA 1Y6JA 3Q1LA 4NZ9A 5DOZA 4DPKA 1XU7A 1NFRA 1UZNA 5BNIA 3MEQA 3QIVA 3GPDG 1JVSA 5LCXA 3PWSA 9LDTA 1Y5MA 4FW8A 4CUZA 1MA0A 3OJEA 4AJOA 5EPOA 3I3OA 1Q0HA 4NJOA 4BOYA 1E5QA 4DUPA 2BD0A 2B37A 3I6QA 3JQEA 1R37A 3DBRA 1XELA 4ZD6A 1JWBB 5GMOA 3I5MA 4R69A 3SX2A 3L6OO 1EZ4A 1DRUA 2GERA 3SBOA 4P8RA 1ADGA 4IDGA 1VM6A 3W4JA 3U62A 1YJ8A 2DFDA 5DF1A 5HA5A 4DGSA 3DZIA 4WUVA 3HB5X 1PWXA 4ZN6A 2CSUA 3IKTA 5LDGA 3I9MA 4J43A 4DBZA 1TB4A 1Y1PA 5CDYA 1BXZA 2I9PA 4CQLB 2C7GA 2ZK7A 3TF5A 5DZSA 4J6FA 5T6BA 2BELA 2AHRA 1FDUA 2X8LA 3GUYA 4PCVA 5KVSA 2O3JA 2NVUA 4PGFA 3KSUA 4CL3A 1BXGB 4PN3A 4UUOA 1OFGA 3F5QA 4FB5A 2ZKLA 3GR6A 4IDBA 1Y8QA 1JN0A 1GADO 4ALMA 4Y8VA 3TOXA 5JYDA 5TX7A 2GNAA 2WD7B 3WTBA 1HDCA 4IDDA 3E48A 3ZHXA 4FC7A 4U0KA 1GD1O 4KQXA 4DQUA 1GYRA 2RH8A 5AXAA 5TSDA 5C3MA 3I9KA 1KEPA 3HB4X 3QJ5A 4TKLA 4HY3A 4NBUA 2JCYA 4DLBA 3WLFA 5B12A 1I30A 4GSKA 1P1KA 1VL0A 1CQJA 1U3WA 4AICA 1GUYA 3UCEA 2YHIA 3EW7A 4FFRA 4XQ9A 1GQ2A 4HUJA 4PG5A 3NDRA 2EG9A 1IZ0A 3INRA 2Y1CA 3O26A 1E1LA 1R15A 1YWGO 3RASA 3M1AA 4YACA 1EVIA 3CPSA 4E21A 5BSGA 3X2EA 4QUKA 4CLRB 1H0KA 1P44A 2WJPA 3KYCA 5TJHA 3DWFA 1JLLA 4YAEA 4CQMA 1LRJA 1QV6A 4IBOA 5ENDA 4U7WA 3HUDA 3RC9A 4KTTE 1A71A 3WQQA 1E3IA 4R54A 3MCVA 3GDFA 1IOLA 4ZRMA 3PQDA 2G0TA 3C7CB 5ENVA 1EFLA 1VSUA 1CYDA 3H2ZA 3UAGA 4XYLA 3ADOA 4J9UE 4GLLA 1DIAA 5DN9A 3U5TA 5CDSA 4WLFA 3Q2IA 1E7RA 4BUCA 2OHXA 3D3WB 1AGNA 3DOCA 2JD0A 3KYCB 3GEDA 1SOVA 4J0FA 4A03A 4NNJA 3AM4A 4XRRA 4M86A 4AG3A 1E3EA 1DBVO 4BO3A 1I36A 4UULA 4B3IA 4W6ZA 3GK3A 3F1LA 5F21A 5KOIA 1J4AA 4CV0A 1E3SA 1E77A 1NQOA 3EK2A 2B4QA 4BNLA 4K1LA 4YT8A 1LRLA 2P91A 4D46A 2E49A 3V1UA 1DRVA 2GZ3A 4ZICA 5JDIC 1TI7A 1CIVA 1VL6A 1V6AA 3Q9NA 4KUEA 4G2NA 3DBLA 4GKVA 4U8GA 3VOSA 5JW6A 3BTUA 3LQFA 4RGBA 1T2EA 3Q0EA 1P45A 2GRAA 4HBGA 2YZ7A 4L76A 3RUEA 3QWAA 3I4CA 3NAQA 4TZKA 2EV9A 3N58A 1O0SA 1ZMTA 4BO7A 4ND3A 7MDHA 4CLOA 1EUDA 2Q4EA 4L73A 3U3XA 4TKMA 4JIGA 4GKBA 4MKZA 2ZTUA 3H9QA 5COAA 1WP4A 5FF9A 2LDXA 2WE7A 2O2SA 3IOYA 4J1SA 1GY8A 1U9JA 3B6ZA 3GRPA 1M66A 1T25A 1J49A 2P68A 3OFSA 4XEHA 3BMQB 3IJRA 5L7YA 3INTA 3AM3A 3TZKA 1KVSA 4MKRA 4UEKA 5G0WA 1P77A 3GT0A 2GSDA 2B4RO 3PHGA 2J8ZA 1BXKA 4Z0PA 3GUCA 2HRZA 3IQDB 4YT2A 2RHRA 4PG6A 3QVTA 4MPDA 2FPGA 4CL8A 3RWBA 1BRMA 2YFHA 1W0CA 3ANLA 2PWZA 5JCJD 1JWAB 1EK5A 2FPPA 5TNXA 5A3VA 3KB6A 3WGIA 3WQRA 3FNEA 1ISFA 1UP6A 3H3FA 4M54A 1HZJA 1LSUA 1CERA 2YFQA 4RV9A 3TPCA 1LDNA 4Q3EA 1WWKA 4RF4A 3GN2A 4BNFA 2C82A 5EQDA 1K3TA 2AQIA 2FSVA 1LRKA 3HDJA 5U9CA 5L4NA 3VTZA 4E2WA 5IXSA 2DUWA 3BMOB 4UREA 4E13A 2YHIB 2NADA 4LCJA 1ISIA 3G49A 3VZPA 2O3RA 1I2BA 4IS2A 4WEOA 4RDIA 1U5CA 5JC8A 4EJ6A 3AI2A 4N5LA 4EUEA 2PLAA 2X6TA 3H7AA 1CEQA 2WE8A 3CTMA 3PEFA 4AJLA 4BHTA 3TL3A 3EC7A 5GZ3A 4IS3A 4F3YA 3JTMA 4E32A 5KIAA 1V3UA 3JD2A 1ZSNA 1RYEA 3ONDA 4J7UA 5JLAA 4XQEA 2DAPA 1Q7CA 2R00A 1VJ1A 4IXWA 4LN1A 5CHEA 4WKGA 2C20A 1LDGA 1MXFA 3KVOA 2DUUA 1ZK0A 3FD8A 2Z1NA 2BF7A 4MO2A 1RJWA 3TFOA 1T4DA 3D64A 3BMOA 3BXXA 5KWEA 4I9HA 2EKPA 4UUPA 1YGYA 1XHLA 3L4BA 1VJTA 1B15A 2XXBA 4I8XA 1CETA 4Q3AA 1Q7BA 4ALJA 3BYZA 5IN5A 3A9WA 3WGQA 1PU2A 4ZVVA 3LF2A 3QVOA 3D0OA 1L7EA 4RPGA 1C1DA 1RM0A 1GZ6A 1A9YA 3VH3A 2HUNA 2D8AA 1HSZA 4HXYA 4YJHB 5AXDA 2G76A 2VYND 3LT2A 3P2YA 4PLCA 2VRBA 1FDSA 2JFHA 1K6IA 3JYNA 3NJ4A 5EMHA 3JD4A 1YXMA 1U4SA 4BKQA 4ONEA 4KDFA 2YV3A 4A5OA 1E1NA 4AJNA 2Q2VA 3AU8A 3JQ7B 4CV2A 3G17A 2EJVA 1LJ8A 1W8DA 3WYEA 5G4KB 3WFJA 1P31A 3I23A 4GX1A 2DPHA 3CEAA 2QRLA 1EUCA 3PGXA 1HTBA 4TSKA 1KETA 1IULA 1AXEA 3GY0A 4XRGA 1ID1A 1LBEA 3I9OA 3LDHA 3UGKA 3LC1O 5BR7A 2IYPA 8ADHA 4KWIA 1YL7A 4LSMA 3UHAA 4YJHA 5H82A 5JY1A 1XGKA 1UXIA 4Y9DA 3GA0A 4J9VA 2G5CA 5T5QA 4CLOB 3AUTA 5JXWA 2B69A 1XEAA 1HLPA 1NVMB 1GR0A 2J6IA 2VRCD 4AJIA 2UUPA 1IHXA 4B3JA 4EUFA 2FR1A 4WCDA 3IUSA 2VZ9A 4II2A 4WLOA 4I9UA 4PG4A 4CMEA 4R3WA 2PZKA 1N1EA 1EQ2A 3WMWA 2ZQZA 3RJ5A 3I4FA 4D0SA 3BMQA 4F45A 3OJ0A 4O63O 3V8BA 3QVWA 3DBRB 2AA3A 1NYTA 3ETDA 4RDHA 1E7WA 1P74A 2O3QA 3E1KA 2JFGA 2I3GA 5A5EA 2Y67A 2D5AA 4BNMA 4YAKA 3D4OA 5G0VA 4ND4A 4FFLA 1P1RA 3DFUA 4ILKA 4EITA 3CIFA 2I3AA 3FNGA 1I33A 1IPFA 3OQ1A 2VOJA 1XU9A 2NQ8A 3G3EA 4RQUA 3PHLA 3WSVA 3T7CA 3FTPA 3JD0A 4YAJA 2VNSA 2J5RA 2G82A 3GNTA 3GLQA 4ALLA 2WYVA 3GVPA 5C7OO 2CVZA 2JAPA 1Z6ZA 4RPJA 1NBOA 5L51A 1AUPA 4NBWA 2XPCA 1U3UA 4P38A 2PV7A 1GU7A 3FI9A 3N7UA 1YDEA 4N5NA 5K9ZA 3CUKA 1XSEA 4IQGA 2C2YA 3AU9A 5H81A 2Q3EA 3KEQA 3RD5A 4JLWA 1VL8A 4F46A 4D79A 3QVXA 2X5OA 1WMAA 2JL1A 5ILGA 5A3JA 4CR8A 3Q9UA 3ZNPA 3F3SA 1Q1NA 4FJ2A 4XKJA 3ZGYA 4DQXA 1RWBA 4Z3KA 3QWFA 4GX2A 2GCGA 1D4FA 3W8FA 3JQ8B 1EDOA 3BZUA 1XDWA 2GZ2A 5B4TA 2VUUA 6LDHA 4DQVA 3AY3A 4XDYA 4WJZA 3WBFA 2ZCVA 4EGFA 4UEJA 3RI3A 3VPSA 1IYZA 3NT5A 4Y98A 1MC4A 1XYGA 3DMTC 3TFQA 5CEEA 5CDUA 1WMBA 3QRWA 2YDYA 1LU9A 1ULSA 4BIIA 3VHRA 2D5CA 4WLUA 1I32A 2HLPA 5MGBA 5F3RA 3D1LA 1W4ZA 1IPEA 3CINA 4EJ0A 1UZMA 4HX5A 1WLYA 3DO5A 3WYBA 3KUXA 4H7PA 3ZN2A 4BO8A 4XDZA 3RFVA 1B3RA 3KTDA 3QW2A 4TRNA 4UVGA 3UKOA 2OGUA 1KY4A 1ZZEA 3FN4A 4GBJA 5KJ1A 4DIBA 3T4XA 3JQBA 3ZWYA 3B1JA 1DRWA 5G0SA 1UZLA 2B36A 3PJEA 1HDGO 2IDZA 3ROMA 3WXBA 2YYYA 2YQ5A 4FQ8A 1DFGA 1NTOA 4XYBA 4JP3A 4FOSA 4DC1A 1MP0A 2E4AA 4BO0A 1R16A 1IZ9A 3OIFA 3SJUA 3LT1A 4NFYA 3LZ6A 3VTFA 3ZNNA 5AYVA 2IEDA 1N7GA 3DHYA 1C0KA 1XR3A 1FDVA 2I76A 1E3WA 4BNYA 2CFCA 2Q4BA 3WDSA 2GYYA 3ZU5A 2P5YA 3QVSA 1HDXA 1QYDA 1T2DA 3CZRA 4RLSA 4WCFA 1A4UA 3QWIA 2QQ5A 2JHFA 4DC0A 4OJNA 4FBGA 4R01A 3A06A 3OM9A 2VCYA 1I8TA 3WSWA 4Q3CA 2PKQO 3KRTA 1T2FA 2HK9A 4WEQA 3VKVA 4DRYA 1XKQA 3MJSA 4XQCA 1ZJYA 1TA4A 5T8KC 1I10A 3ZV4A 1P1HA 3NRCA 4FDAA 3RC2A 3NTOA 4P4GA 1HWYA 4MVJD 5IAAA 4BVAA 3RC1A 4BNVA 5JMWA 1BSVA 1E3JA 2RAFA 4IINA 4IZHA 1NXQA 4OKNA 4HADA 4DPLA 3TSCA 4EI2A 3OETA 1PJTA 2HMVA 3JQFC 4JBHA 4U0JA 3I1JA 4OXYA 1O94A 4DL9A 1ZNQO 2Y0DA 2A35A 3FNFA 3OSUA 4K9DA 4PLGA 5FI3A 2A92A 1BDBA 3R3SA 2P4HX 4WOJA 2HSDA 3ORFA 4CV1A 3JD3A 4J7CA 1FK8A 1ZVMA 5MDHA 3HADA 1AHIA 4CODB 2BI8A 1C1DB 1JW9B 3GRKA 3ON5A 4W9NC 9LDBA 2PKRA 1F06A 2AQ8A 3KXDA 4YJGB 1Y7TA 4YRDA 2POQX 5ITVA 1Y5RA 1SPXA 3Q11A 1PQUA 1PL8A 1EK6A 5LC1A 3IP1A 4MJLA 3VKUA 1T2AA 2O3TA 5COBA 1NASA 4XX0A 4BQPA 2VWGA 4F6CA 4FOOA 3K8ZA 1UP4A 2FN7A 3DB2A 2NSDA 4J7XA 4NFSA 4P22A 2ET6A 3AM5A 3I9JA 3F1KA 1T1RA 3GOHA 2O7SA 2ZYDA 5FI5A 4C4OA 3QA9A 3W4KA 4GVLA 1MFPA 4MVJA 4KWHA 1DIBA 2I67A 3DTYA 3WTCA 1F8FA 1GTMA 2Q2QA 1SZJG 3ZW8A 3ADPA 3GVHA 2H5LA 3ZWCA 4AJPA 4OM8A 1CRWG 1NVTA 1RM4A 5CDTA 1ZK2A 1YQGA 3H3JA 4D7AA 3ZWBA 1WDLA 1B2LA 4PLYA 2NNLD 3NJ8A 4QXMA 1ARZA 2C07A 3WGOA 2Q50A 1MV8A 2FPIA 2FOIA 3VPGA 4BB5A 1PJBA 1DC4A 3TL2A 4BKRA 5G0UA 3MJ4A 2P9GA 1I0ZA 5JAMA 4IQ8A 3IDSA 1U28A 4MIYA 3DDNA 1ORRA 3R3JA 4AL4A 2CDCA 3DEYX 3SC4A 2DBQA 1I3LA 3WGTA 1YS4A 4E33A 4WECA 3SVTA 1BGVA 1LX6A 4DLLA 4BNZA 4BNKA 4BNJA 1JKJA 3LC2O 4J16A 2PKQP 2B4TO 1H5QA 3ZV5A 5JAZA 4BV8A 3ZWWA 3BTSA 4AJHA 5I7VA 2W2KB 3E9MA 2R6JA 7ADHA 3MJTA 3BTOA 2PGJA 3I9LA 1PR9A 1D1TA 1ZEMA 5A06A 1JDJA 1I01A 3H5RA 3L4SO 5DBIA 5IDQA 4TQGA 1IY8A 1XA0A 3M2PA 4KUGA 3TOZA 5HS4A 5IXYA 4GVXA 2R00C 2YDXA 3V2UA 3C1OA 4GLOA 2VHXA 1DJNA 1VKNA 2Y99A 2QX7A 3IMFA 3H9EO 4RVFA 3D4NA 3JQBC 4I5FA 4NIMA 1IHYA 3PK0A 3K96A 1F12A 3X2FA 1LC0A 3I52A 4B4WA 3WS7A 4JK3A 4NHEA 4OSPA 3O03A 1Z75A 1SBYA 5B37A 4MVJI 2VYVD 3PVZA 3BAZA 3H65A 3DL2A 4BNNA 5TGDA 4EEXA 2FRDA 3EHEA 4NR0A 3DBVO 5F5LA 2DC1A 1NX6A 3ROQA 1T24A 5JYEA 2UUOA 1R66A 1DLIA 1OMOA 1Y9EA 3CMCO 3LT0A 1GV0A 4FFNA 4FR5A 3EVNA 3ANMA 4ZQFA 1KVQA 2JHGA 4GMGA 1XWFA 4JBIA 3K30A 3QWBA 2DQ4A 1GQYA 3HFGA 3S2FA 3C7AA 5KKAA 5A9TA 4XYEA 3DBHA 1IUKA 3ZZNA 2YY7A 5JCJA 2Q46A 4KUHA 5KVCA 4BB6A 4BNIA 3OJFA 4PRLA 3WQSB 4OKIA 5L4LA 4MP8A 5FEUA 4C7JA 2I99A 4CMHA 2CUKA 2EKQA 4PG8A 3ZHZA 1LQUA 4BNTA 3VVCA 1LEHA 2PFGA 5ITWA 1SAYA 1QKIA 1WAMA 1XQ1A 2GN9A 4MINA 3PWKA 2BKAA 4NBRA 1M75A 3VDRA 5EIOA 1CWUA 4YA6A 3WGYA 1V3TA 3L6EA 1DFHA 4BO2A 5K0ZA 1BMDA 1KS9A 2IE0A 5EN4A 1GDHA 3WR5A 2CVOA 3GF4A 1B3BA 3JYPA 3Q6IA 1BVUA 2Y1OA 4A2CA 2W8ZA 1BW9B
chains in the Genus database with same CATH superfamily
1AZSC 1JHDA 4P3XA 1GGFA 5HEKA 1YBFA 1E7YA 2VHVA 1O89A 2GBPA 3G2HA 3DPIA 3HP4A 4HQ6A 4KIJA 4X6XA 5GWXA 5A4AA 5LDDC 1QHYA 4NYMR 4CM9D 5I9NA 1G3UA 2XYGA 2EEZA 1J8QA 4EJSA 4F8YA 2E1PA 2EFGA 3JSXA 3LBYA 3U48A 1VIVA 4YHHB 1TC1A 1NC1A 1BXRA 2JCVA 2F1JA 3L49A 3PUWA 4IDEA 1XRPA 4FCVA 5CIWA 3UMVA 5A1TA 1N33B 1POXA 3ANNA 1O58A 4FDVA 1KPGA 3DDSA 4WJLA 5HQ3A 5IZ4A 2JC3A 5KHOC 4DV6B 1IOZA 1QP4A 3T3MB 3ZD7A 2VDUE 1DG9A 1LI5A 3CMMA 3HLTA 3MCUA 4CDMA 2HXYA 2B7LA 2M6SA 2WI8A 4K05A 1KDZA 3K0CA 3W2GA 4HH1A 1W76A 4DCNA 1P2BA 3CLVA 1TUIA 4GGOA 3RIXA 3ZHQA 2QBYB 3WNVA 4TWBA 4UHKA 1YNOA 2R6ZA 1Y6FA 1KAQA 4KR9A 2FR8A 3TUIC 1N1GA 1V16B 1QOPB 1U5AA 1ZK1A 2WV7A 4N5DA 5IWAB 4H0NA 1QIJA 3HB1A 3JZFA 4XUDA 3TQOA 3KS9A 4JUAA 3WLSA 2XA9A 3DTVD 3S1SA 3IBGA 2QZSA 3N2YA 421PA 2ECKA 2GPTA 3GFPA 4ZOQI 5CFPA 3IELA 1KEVA 4Z86A 1WP9A 4YRTA 5FB3A 1ZUHA 4R81A 2YV2A 3KR9A 2LUOA 3UICA 4D5GA 5KU7A 3RTCA 2GN4A 2HIHA 3SYRA 5I5EA 1AKEA 4ZYYA 4CDGA 1P1CA 1VA5A 2VLIA 3MB5A 4JAVC 3V3TA 1IJFA 1JSZA 1ZGZA 2ZB7A 4BCBA 4ED9A 4EEZA 4XVCA 5B3KA 2A94A 4Z3DA 2XE7A 1AKTA 2DBZA 1SIWA 1IMOA 3M9WA 4HQRA 3WQHA 5BUCA 2JLZA 5DBGA 1KAOA 1DXQA 3M6IA 3ZCXA 4CUJA 3T3NA 2YXEA 3AWIA 3JWHA 1ZVVA 1T9DA 3L5KA 3IP9A 4BRUA 2FDCA 3TMYA 3GLIE 2W58A 3KOUA 4MUBA 1PP4A 3UH1A 3KDSE 4XASA 1V4NA 1YB2A 3GCGA 3CX7A 1FJHA 3C8DA 3E3LA 4PHTA 2IC5A 4C87A 1OT5A 3AY7A 1YB4A 2ORIA 1YS7A 3CLSD 1IOVA 1Q7EA 1H2WA 3NDIA 3M1IA 4BNUA 2BFBA 1KAMA 2Z1DA 4FLMA 1W36D 3RGWS 1OBCA 4HLDA 1V8BA 2Y3IA 4KHZA 3G6KA 1LA2A 1SC1A 1EDZA 1G3QA 2JCGA 1I1OA 3ETEA 2RKOA 3IMKA 4N6OA 4CRWB 4FYVA 1GTRA 3RAEC 2PGAA 1KMMA 4AT1A 2OV2A 3WE7A 2HPZA 2JGLA 4Q7EA 4RY2A 4DR2B 1H3EA 2WU4A 4FTWA 4LY6A 2IYOA 2G04A 2OKGA 2EYUA 3JYOA 1M7BA 1NF9A 2DOKA 1U80A 3DMTA 5DW0A 5IX8A 3ZDEA 1WLSA 3ZIAA 1M34A 2BLLA 2JHPA 4FFBB 3CF2A 1BFDA 4RENA 4UUMA 1HZZA 5LUBA 1SHZA 1VKOA 5AIAA 1GLGA 1QHGA 3R6TA 4CLHA 4AKGA 3GPCA 1PFKA 3IOMA 3T0FA 1OAOA 1ZSVA 2TRSB 4IGIA 4DB4A 3AOEA 3ZHYA 4Z9FA 1ZCJA 1NTRA 4QEKA 4AJJA 1SQ0A 1GHTA 2GRJA 4EVRA 1MA3A 1SG9A 2C0PA 5AFSA 3LYAA 5IULC 2YCLA 3KJEA 4JKYA 4B3TB 1PW5A 4BTEA 4XIGS 1KYYA 2AFIE 1O5IA 2YJGA 1KMIY 3GJTA 2P5SA 4MUHA 4N6GA 2GYUA 2Q9CA 4YK7A 2OFPA 4AN0A 1ABEA 2PGLA 2W4MA 1E9DA 3QUAA 3WHLA 5JEEA 2Q6OA 3TVTA 3DO6A 3OESA 3OQMA 1U2GA 3A3OA 1H4SA 1YS9A 3B2NA 1EWKA 1PWZA 3EOBI 2ECPA 2P6NA 2AJ8A 4V0LA 1EH5A 2QDKA 4BX8A 1FYDA 1YE3A 4DJEC 1L4LA 1SK9A 2VK2A 4WASA 1YULA 1QWOA 1R9MA 3KKPA 2D4AA 1UDWA 1E8NA 2OGTA 3MHPA 1SRRA 2C2OA 2PSHA 4ZRDA 3TZEA 4BNHA 2BAGA 3B6IA 1G42A 3QKSB 4ZYLA 1AV7A 4OKSA 1NA5A 2IQ5A 3G9XA 3DWEX 4DM4A 3QMWA 5CNMA 1SXJD 2VUTA 2QZPA 4QNMA 5EJ2A 3W3AD 4OXNA 3P2KA 3K6RA 3TXYA 1LI7A 5FFFA 3OZUA 4RHEA 5CFRA 2OZPA 2Z58A 2JRLA 3FNIA 4CM1A 5EP3A 2I2WA 3FMFA 3T1YB 2FGKA 1LLFA 2IU6A 2MSCB 4R1NA 1O8BA 2UU9B 4JI0B 4MKGA 1UXJA 4M0CA 1JL3A 3KK0A 1WOYA 1YK0A 1U7HA 3OFNA 2VDOB 1TTHA 4TYQA 1KO7A 4DJDC 3HNRA 5E6RA 1L5KA 5KJCA 1U99A 1ZH4A 1ZJZA 2X4IA 3HV2A 2R5WA 1P1JA 4EYSA 2H1OA 1CF2O 1KK3A 1S3SA 1TZCA 2I6FA 1B6SA 1ZZGA 2WA1A 1EWRA 1Z82A 3F8TA 4MQUA 1E1QA 4ASUA 2NQTA 3AQ4A 4IVRA 3USCS 5BPFA 3L7DA 3U49A 3T3DA 4W1SA 3MPOA 2AZ4A 4PPQA 1XEXB 4WLNA 2QUJA 5IVPA 5LKAA 2BHRA 4AS1A 1B8OA 3EQ8A 2A4MA 5AM4A 3BFVA 3OMWA 4AZSA 2KS6A 3PNVA 3Q3HA 5EPUA 2BM8A 3ZS9A 1UMDB 1EYZA 4R7ZA 1X7GA 4RFSA 3I72A 3IJEB 5IUJC 4MWCA 4L50A 3GDWA 4OIFA 2CFRA 5JATA 3CJTA 3PE6A 5ERGB 3ZXXA 3D4BA 5IANA 1SU4A 1LUAA 1B0UA 3IQZA 3JQRA 4W9MC 1TMOA 3FHTA 2ETXA 2E18A 2GX6A 5EI5A 1ZD3A 3HABA 1TO1E 5SYAA 3FWZA 2I03A 4I1SA 3RC7A 4DUZB 2Q6VA 1EGHA 4OOFA 1UK9A 2CUTA 2XDYA 4PHFA 4L8LA 2FSSA 1UKEA 2GEFA 2GDZA 4B8YA 4NBVA 4RORA 4OJKA 3I2JA 5KS2A 2B8TA 1ZS9A 4FXPA 5KNBA 4Q3DA 2C59A 3F3KA 1OI3A 1R8YA 2A7XA 4TZ0A 1DAPA 2FWRA 4GHWA 4DLRA 1M1UA 3KQLA 2Q21A 4BVEA 2VHWA 2X0FA 1NATA 4EB6A 1QRDA 1I7LA 2PZAA 5CJPA 4EY6A 3OMLA 1G5PA 2NU6B 2VP9A 3RHZA 1HE5A 1IWPB 1Q1BA 3CRVA 4HH3C 4KPGA 5HCIA 3WGMA 1ZNXA 1E66A 5ANRB 2GI4A 1SJ9A 1VLQA 1WZIA 2AEJA 2EHJA 3OA2A 2PKCA 2MYPA 3ASVA 4OFZA 2GCOA 4NNOA 2J6CA 3SBDA 4O5OA 1DBQA 3DUWA 3LKVA 5JIBA 3OKPA 2WAMA 3IOBA 4KK4A 4NCIA 3H5VA 5LQCA 4WE3A 1JFSA 4BUJA 1ZIOA 3B7PA 2PH3A 3PR2B 5DRTA 5A6SB 1VDMA 3L41A 1TJ3A 2N47A 2VSQA 2J9XB 4IJ6A 4ND7A 4LBVA 4OU4A 5D3QA 3AJRA 1DB3A 4YUAA 1K8YB 3W04A 4BWYA 2CJWA 1PG5A 3EVTA 3K31A 3TBFA 3V2IA 2P75A 2GWHA 1M8FA 1YCGA 2QB5A 3F73A 2V6MA 4R6XA 4RIGA 2DH6A 4Q4DA 2P2ZA 2A5DA 2VJMA 3U3RA 2XJ9A 1BQEA 1RRPA 4KRFA 5ALQA 2ZTVA 1PZEA 3FNHA 4O59O 4BV2A 3U7HB 3LUCA 1T4MA 1JRLA 3T5PA 5EJ5A 1CUJA 2V5AA 4J3FA 3WKEA 3CZCA 4UZEA 5LQJA 3QELB 2ONYA 3OE7D 2VT3A 4NCAA 2ZJFA 1Z8DA 3E22A 5F1KA 4ND1A 3PC8C 3ZU2A 2NUPA 4PBRA 4BKUA 3RUCA 3B6KA 4I55B 1WSDA 1GUZA 1KHTA 2WJHA 1NQWA 2XLBA 4KXQA 2IDMA 1BJRE 1NLZA 3R5SA 2FMUA 4K2HA 4PX2A 1MTZA 4R68A 5BSRA 4S2UA 5K8VA 1IN1A 2FF5A 2VJKA 2YNMD 5A6VA 1L7DA 2VRCA 5FBKA 2CNDA 1HTWA 5IDWA 2Q6TA 3E70C 4YMSA 3QM1A 3UMYA 5JRJA 4AY2A 5A9SA 1D9ZA 3VKGA 4Y6OA 3FY4A 3TQRA 3NHKA 3CVYA 3JS5A 4XX1A 1F0YA 1L4HA 3BRWA 3R0ZA 3X43A 3C4VA 2QROA 2AOTA 2AG8A 1W6RA 1Q0ZA 1PVDA 3FLAA 1Q7GA 4YRQA 5E4JA 1WUIS 3T34A 3ZWVA 1NFFA 1DQRA 5FRDA 4DY6A 3SDSA 1YCDA 4IGAA 4JT9A 1NR1A 4P4UA 4XD2A 1E5LA 3Q7EA 2XDQA 4OTZA 4P4SA 1Z0UA 1X0VA 3VR5D 4IHQA 4BU0A 2VNAA 1UAYA 3AQIA 3GFFA 3PEVA 4E7PA 4YWJA 4QJ4A 4Z53A 5AVRA 3A7DA 2I7CA 2O2HA 1PUXA 3UQZA 5C31A 2WV9A 2QLBA 1ZUNB 1XB2A 1VLMA 2VKTA 1H1DA 2RONA 1NBIA 4CXMA 1EVYA 1NNLA 3E3OA 4JJEA 3QKRA 4RSMA 1NVEA 1QTRA 2CBGA 3KAPA 1FLAA 4WK4B 2NM0A 4EJSB 2WAOA 4C0WA 1NVDA 1SC6A 2DY0A 2H06A 4BDTA 3NM6B 1NFQA 5BMVA 2YJNA 5CLHA 3SC6A 1Z37A 4JB2A 2C5LA 2RJ3A 2PZFA 3SZUA 3GVCA 2HWWA 3WLQA 4ZZ0A 4E3WA 1QGUA 3QFTA 1PBTA 3U81A 1BOFA 1G59A 4E46A 2PS9A 2AH5A 3HN2A 3G89A 5TEVA 1QO0A 1Z36A 5B4VA 1O08A 3D7SA 5FBLB 3GRUA 1PO7A 4I9NA 3G2MA 1OBFO 2ZQYA 5DN6A 1FTNA 1Z29A 1E3DA 2F1HA 3IP7A 3DEKA 1Z6YA 4FR2A 5LA6B 4LHYA 4WNIA 4Y6SA 1MC5A 4IIYA 1OYVA 1YJQA 1USWA 2JFNA 2PUJA 3C8MA 3E15A 4YI5A 3RTGA 3WGGA 4L74A 3ZI4A 1PZGA 4GC9A 1NP7A 1HPLA 4CJXA 3SS7X 3MCZA 4QULA 1DC5A 3EW9A 3D6HA 4MVJF 1M0WA 3ICPA 2PLNA 2RHGB 4ETNA 2NTJA 5ES3A 2P9BA 1AS3A 3B1YA 3A28A 3K1JA 3IPXA 2PZMA 2II6A 4HFNA 4WBXC 4UPEA 4XVUA 4U7DA 3QSYA 1U3TA 1W73A 3V9PA 3ZHBA 5L3SA 2ZEJA 4W6QA 3H9BA 1LQTA 4KRGA 1CJTC 2AJCA 1U3DA 2CYCA 3IVRA 4KPUB 3LWDA 4GQAA 2A1UA 4BMSA 2X0IA 2P8SA 4MAFA 3IIKA 1G16A 2NYVA 4W9NA 5ALIA 1JB1A 1WXFA 2OQ2A 3AOGA 4N5HX 4X54A 2PL5A 4B4KA 1BDHA 2LNDA 1PX0A 4WK6A 1HZZC 3DEJA 4V02A 2PAAA 1Z4IA 1WZEA 2UDPA 2FSPA 5A1JA 5DRYA 3K20A 3E0XA 1ODJA 1GXSB 1DP4A 3MTBA 3UOAB 2EW1A 4R2LA 2ASVA 2XBLA 1XZMA 5ARBA 3H17A 5AESA 2DY1A 2Q8QA 1E9AA 4YMWA 4GL4A 2PUEA 3QPVA 1SVUA 3CZ9A 5ADHA 3DZKA 4LJ7A 1NJ6A 4PLVA 3KQVA 4Q4HB 5KYNA 4XWWA 1EHIA 2YX1A 3SIXA 2B20A 5ESWA 2GT1A 3ICCA 3I2GA 3B78A 3PXGA 3WA6A 1Q84A 3EZYA 5FYDA 2JI9A 3V8VA 5DM0A 4C4TA 2RGWA 1H8HD 1EMDA 1D2GA 3F3MA 1ATIA 4LDQA 4MW6A 3ZUPA 4DM7A 4FD3A 3NEAA 4UAGA 3U7RA 1FW8A 1EHYA 4HH0A 3IR5A 2WMYA 4K3UA 1K8QA 4L0MA 1EXMA 5DBHX 3NHJA 3OUUA 5LMUB 4EKEA 2WB2A 3ID6C 4M1WA 2UYGA 4ZCTA 1ADFA 1ADBA 1V3QE 4MV9A 3NS7A 4KMSA 5LJLA 3ZZTA 1E2QA 2REOA 3EEYA 3KQNA 1NQXA 4LPSA 1BWSA 1B6RA 2XX3A 1R50A 4HBZA 1ENZA 1PD1A 5IKPA 4FIZA 4QDKA 3UAWA 3QH4A 1SUWA 1K98A 1QH1B 4PLTA 5CRIA 3QMVA 4O2RA 1I3MA 2F8TA 2XNDA 1P8AA 2YV1A 3GZNB 4L4XA 4RVOA 3I9NA 3FDFA 4X5OA 1T4BA 1XQVA 4DV1B 1C3XA 1NVBA 2P6UA 4N0MA 4QOEA 2IK8A 2ZPTX 3BAFA 3TZ6A 3DUFB 4RF2A 1JEOA 5HF5A 3FCUB 1T9GS 4HAWA 5IT9A 1Z22A 3M4JA 2EFHB 3RAGA 5K05A 2Y8EA 1PJSA 2FGJA 1NAIA 5EC8A 4YRBA 1BCRA 2WTNA 2Y0EA 4H17A 4J2TA 3MGKA 3CNEA 4JYBA 2EARA 4W5JA 1WXWA 3DDUA 2HADA 1JQ5A 5JVDB 4CNQA 2DR0A 4L5YA 4ZV4A 1W5TA 2FQYA 1QZ3A 4AY4A 2R8YA 4KZKA 4DLWA 1UM8A 4DUGA 2JIDA 4K40A 2FZ4A 1KU6A 4HDRA 2PZ8A 5GTDA 4URFA 1W2GA 3KPYA 4RSHA 4FDUA 3LOUA 1F1JA 1Y3CE 3U26A 3AHIA 2O52A 1HDEA 4C9BA 1RRGA 3MTAA 3WL5A 2FI1A 4RL4A 3W34A 1Y6RA 2GN1A 1ESCA 1Q83A 5IJZA 2R6CA 2H31A 3ST7A 1NC3A 1A82A 1PJ4A 1Q1EA 4E6EA 2VAVA 1LWOA 1UXGA 5G0TA 3KKZA 2BZGA 3CF6R 4LJRA 5AJHA 4QGFA 1E79D 4LVUA 1KGDA 2PR7A 3DZJA 5GIOE 1T3SA 2AV6A 2B5WA 1V26A 2FCRA 2XCLA 2AFHB 3PIIA 1E6CA 4ZOBA 2IYXA 4FI3F 4EX7A 3TXAA 2IYSA 2WVHA 3HWX1 3LK6A 4TS1A 2FNAA 4R9RA 3QEJA 1B8PA 1IE3A 4S0XA 4B6RA 1C9YA 2I3DA 3HPQA 5FOTA 1EJ6A 3N75A 2RHOA 3BFJA 3TINA 3OIGA 2AMYA 5A4DA 3V7UA 2AG5A 2BCGY 4BV9A 2QRNA 2H7VA 3CVUA 1UT5A 3F78A 3DVQX 3FUVA 1G6KA 5I8ZA 1FTWA 3A1NA 3QLTA 3UG7A 4D9IA 5C7LO 2ZYAA 4WCFC 1ENYA 2CXTA 4P0QB 4MS3B 3UJ3X 3L40A 5GONB 2XWQA 1WHTB 3FFAA 621PA 1AC5A 5KQMA 2DETA 4XGKA 1HH4A 1YBMA 5FAXA 1MVOA 3ZWQA 5B4UA 5JI2E 2XKJE 5CNIA 4XGIA 4M89A 4YLEA 2OXCA 4KXNA 1UEXC 1M6WA 1QRAA 1Y1QA 4HVLA 1NR7A 1E99A 2COEA 1XDDA 1N57A 2RGDA 5E9QA 1RW4A 1P0PA 4Y2QA 2JGFA 1ZOSA 3DW1X 1QE0A 3DE3X 2BI7A 3AVVA 1ZAKA 4RHXA 5HFNA 3TJMA 3F9RA 3HXMA 1G8SA 2OK8A 2Q4TA 4BFCA 5A0TA 2HU2A 2G7MC 5D3MB 4CKWA 5AKXA 2IYVA 4YEDA 3KWLA 4EG5A 2R1ZA 3N2EA 3P4YA 2O4CA 5IW8A 1QTQA 4Q15A 1I6LA 3O84A 1BFKA 4PHCA 5TY0A 4BMNA 4KFCA 2F2TA 3ND7A 4TLMB 3VU9B 2B34A 1Y7PA 1BD4A 1AF4A 4MYSA 1NHGA 1T9GR 4D4MA 1SUSA 4W63A 3JYQA 1FX0A 3E7PA 1I5EA 2C1EA 4YRGA 1GPBA 1OVMA 5INTA 4LFAB 1V8DA 1W2HA 2H9YA 3O47A 2C61A 2DPYA 4LY0A 3PZBA 3VPXA 2B8WA 3HQ4O 3LQRA 3G79A 4AZTA 3NV7A 4KV7A 4CKEB 4E5YA 5K99A 1DCTA 3RRBA 1KP3A 3QSGA 3DS8A 2ZVQX 4JLAA 4FFWA 2UVDA 4YPFA 4EGCB 5LWHA 4RCZA 4ZTUB 3FGNA 2E4XA 3LBFA 1WTAA 5KTSA 2GCOB 1R6BX 2NT4A 3REGA 4JMPA 5U1PA 3THOA 3TSWA 4L1KA 1JR4A 3GDGA 2HO5A 4NH4A 2OFOA 4DJTA 1LPMA 4MDEA 4EL5A 1UDRA 1TE2A 2G63A 3P96A 1JR3E 4N0DA 4OK5A 5SY6A 3WHPA 1VYVA 2ZUTA 3W2HA 1UFKA 1W7AA 4BP1A 3HKBB 1A8UA 3R7WA 2IBSA 1XL1A 4B6FA 2H0RA 4CMKA 1XFAA 1BKDR 1QH9A 1ZJ6A 4CUKA 1A9OA 1T5BA 2VBCA 2A58A 1S9DA 4CM3A 1X3SA 3RU2A 3E84A 1PYGA 3L0OA 4TVOA 3PBKA 4CM5A 5LUAA 3DFIA 2GWRA 3M5PA 3MJCA 3OIDA 2X9QA 3DMYA 2AFVA 3PJGA 4JODA 4LOHA 5HK8A 2ZB4A 1HA3A 4GYYA 3EJWA 4N54A 5TMEA 3WIEA 4DMKA 2VAWA 1EJBA 4KZPA 5DPMA 2JPDA 1QGOA 4LXGA 3CU5A 3E58A 3EEIA 2FZCA 3N7AA 4YJFB 2BCJQ 1Z5ZA 5F3DA 3TCKA 3R9WA 2P2YA 2ILVA 7ABPA 1S0UA 5I7EA 3LKBA 3DBOB 3ND6A 1K9VF 3R0JA 4PQYA 3PG5A 1Q0PA 3ZW9A 5JS6A 4XDHA 1ZJJA 2GS9A 4PXSA 1EVZA 2B99A 4J4HA 3PHJA 1Z7BA 4JLDA 4KFUA 5P8WA 3R75A 3DE6X 3FOWA 3Q15C 1ONSA 5EWMB 2FLWA 1RQNA 1LPOA 2EBFX 4P81A 1ST3A 4FE3A 4PLPA 2QTWB 2EJTA 3O2NA 1O54A 2PWPA 1JJIA 4IZ6A 4PC1A 2FWMX 1FQOA 2PVSA 3WAKA 4DCUA 4EM6A 2CHFA 4MRPA 3VPCA 4F2HA 4DUYB 1X14A 5FPTA 2I29A 4N7RA 3MRTA 4JYAB 1U9IA 2FE4A 1UAGA 1X7ZB 2IYQA 5CHYA 3R74A 3W1VA 2AOTB 4DADA 2CDAA 2VUSA 1ISGA 1J0BA 2AMJA 4H1UA 2H5IA 1QF7A 2HCTA 1FP4B 2NXNA 2VAMA 4TVBA 4ZVLA 2Q1WA 2DQSA 3JR7A 1Y7HA 4M98A 5F7JA 1CC1S 1N8TA 4MJXA 2C3MA 2FEOA 3FMGA 3NM5A 3ILYA 2CXUA 2IZ7A 2DTDA 3RW9A 4D3ZA 3OOHA 4LRSB 3A1VA 1WPGA 2D7CA 4IJUA 4NMHA 4X1YA 4C43A 1E6EA 4NF2A 3QOYA 4NE2A 3UOGA 4TTQA 1Z2AA 5AHXA 3D4PA 2PS3A 4NCHA 4OEHA 5ABPA 4K9NA 3HCRA 4QRDA 1ZMRA 5ENZA 1ENPA 1G8YA 1SWWA 4KDEA 2FXIA 5EIHA 2FG5A 1YH3A 2PGOA 2CGEA 2BGIA 4PFKA 3I6BA 4UNRA 4Z7JA 4JLKA 4K9SA 6NULA 2NOAA 3DOJA 1YIDA 1TX4B 3EISA 5F9MA 3BQNB 4Z9BA 5KSPA 3IPRA 3GA5A 2IPLA 5D3ZA 4EHLA 4Y9TA 1Z2EA 4WZAA 1AGYA 2PUDA 3WRVA 3OQOA 1DAGA 2WIFA 4KQKA 3Q3VA 4PG7A 3TE6A 3FOCA 2R8PA 1SR8A 4KGXA 2WF6A 4P33A 4WMLA 1JKIA 3T5TA 3C3PA 1KEEB 4LRUA 2X7JA 1ZFNA 3D5TA 1T26A 5T67A 2FUEA 2WHEA 3ZDXB 2MT9A 1UBTS 2BGLA 2H9IA 4EO7A 1WXGA 1WW8A 2G1UA 3QYJA 4JXKA 4CEHB 1W49A 3BGDA 3NV9A 1AV6A 1DKNA 3HWRA 3OTGA 1AO0A 5KSOA 3ZI7A 1R0YA 2A9VA 3E3AA 4RLHA 3KR0A 3KTAB 5CYPA 3M2TA 4WESB 1N6KA 5CA0F 2JFYA 3RRZA 4CMAA 3GD7A 3E53A 5F2OA 3JAMA 3TNDA 2CFOA 4NQZA 3EVGA 1S3GA 1Y8RA 1V11A 2YZKA 2ZAMA 3MT8A 3WGUA 1LVUA 1ZN8A 2IU3A 5BQ3A 4HR7A 3VNSA 1NIPA 1YRHA 3G9ZA 5GY7A 4H15A 1NHWA 1I7NA 2PYIA 1UJMA 2Y77A 4PXAA 4R8KA 4YO7A 5LSAA 1ZGCA 4TSFD 4ZC1A 1N34B 1D6SA 1ZU5A 2I66A 2DPXA 1EJ0A 1DUSA 3L8FA 4DA8A 4CETA 3GLFE 3IB6A 4YHBA 4QT0A 6REQB 2OE2A 2WC1A 3D6NB 4IVQA 3RUDA 4DB2A 3WIDA 1RPZA 2MJLA 2D00A 3FCCA 2VZEA 4R1OA 2GJ4A 4I5IA 4QYIB 4C4SA 2ZOSA 3COZA 1AKYA 1UDCA 4HFMA 4P92A 1F9EA 2I71A 3I6ZA 2WICA 4YASA 3GLGB 4OQMA 2Z8ZA 3ZV6A 4GEKA 5CGQB 1RXEA 5LQSA 1N9GB 3RRNA 1Y8ZA 3RSSA 2LZ0A 2Q3HA 4D3SA 2LV8A 3LG2A 3K9LA 5BQ5A 5M04A 4M0KA 1P7ZA 4PLZA 3WRXA 5JNVA 4MEBA 3QJGA 5JQGB 2H17A 3HJAA 4JSYA 3AFMA 3RTBA 1H1LB 1E2UA 1UK7A 3MN1A 5E7JA 3UK7A 3ZJ5A 5AUPB 3WV5A 1W93A 2FZWA 4WVLA 5KPDA 4XOUA 1M8PA 3K9QO 2F00A 2D13A 2Y05A 5J5AA 2ZS9A 5FV7A 3UB2A 4UDXX 3TL6A 1TCCA 3LHDA 5ICMA 2YBEA 4Q93A 1KBOA 1OC2A 2P35A 4KCGA 4ZMSA 3PSHA 1T1SA 4X0EA 1B93A 3RC3A 3U4HA 3X1JA 1N7HA 1IHDA 2DCUA 4ZIRB 1E59A 2IGTA 2K5UA 3BMCA 3IYLW 3W4IA 1RBMA 3T41A 2RH4A 3DG9A 1H85A 5CB4F 3S8YA 3AYZB 1OOEA 3NORA 1PR3A 1EFDN 4MW4A 1YDWA 1QAQA 3GJ6A 4WOPA 3U39A 1G3IA 5CB4B 4N01A 1EB9A 2P2NA 1YUNA 1YNSA 1G3MA 3AV3A 1HE3A 5TMDA 2A0KA 3MGBA 2Z5LA 1YB5A 3CUSA 2J9YB 1GTZA 2O05A 2DFVA 3M6WA 4MGIR 1DQPA 2PZJA 3QPBA 1L1FA 4F4JA 2WD8A 4L28A 3WIVA 1MOPA 4S0ZA 2CFSA 4DNOA 4U5XA 2BKXA 3ROQA 3WKCA 1GR1A 2H3EA 3KAJA 2XAAA 4GI2A 2D2IA 1QOZA 3Q4GA 1XA4A 4LE2A 1LI4A 1AHHA 3L01A 3TLXA 2J0QA 1ZGGA 4FMCB 4UHJA 2ZJ1A 1MG0A 3OF2A 3PIDA 1T9CA 4GT1A 4S1PA 2MCFA 3R3WA 1UPTA 1P9LA 1NG9A 2P2SA 1RYBA 2ASEA 1BIFA 3D3QA 3K1AB 2XMRA 2P3SA 3QHPA 2A5FA 1QRUA 1GQOA 1KJJA 2BJVA 2CLKB 4EDHA 4H1WA 1FFXA 5K0GA 3C5VA 1JMVA 4KRYA 1C8VB 4NU5A 1MG5A 3OCJA 4BO9A 3NUQA 3BJRA 2HQRA 2H1WA 4TLDA 4NE7A 2WEKA 1N75A 4IM7A 4V0OA 1JGTA 5D5QA 5ALOA 2XHEA 4Q16A 2XOKD 1P9NA 2DFLA 4NV0A 3MTJA 1ZK4A 3TTVA 1OHHA 2NU8A 2OESA 3VQTA 5LOVB 1RP7A 2GCIA 4V0NA 1QIKA 1IUOA 1TM5E 1I3KA 3UAOA 3W6UA 2CE7A 4H1TA 1J99A 3PNBA 3S7TA 5BSUA 1KZYC 4F4UA 4F96A 1U9IC 3KWMA 1BS2A 2VT2A 3O8QB 4OB7A 4TMFA 4P9NA 2GZAA 2GVDC 2V7TA 2NUTA 4RZXA 1D8AA 2SECE 3VZRA 5AVQA 2XSZD 2ZUSA 1PD0A 4ATNA 3DNMA 4IJQA 1S02A 5D5PA 3C1AA 3R3YA 1OH5A 1V8PA 4NJMB 1DTEA 1YQ9A 4GWGA 2FX2A 2KHZA 3MTDA 4RNCA 2H1HA 5ITZA 3PC8A 1F4VA 4NG5A 3DDCA 4RKQA 4PGHA 4R2IA 5T8KA 1P3Y1 2OCAA 5C1IA 2OVBA 1E4VA 5ICSA 3WL7A 4YWHA 3AG5A 1UWCA 4X90A 1XRJA 4GG1A 1B00A 4TV8B 4A26A 5BPHA 1IIRA 1DE0A 1ZL2A 5E7IA 3GH3A 2XKBA 2JEZA 1JQBA 3WYCA 1EWYA 1M6YA 1PR2A 3EAGA 3S2SA 4NU8X 4WK2B 1X7DA 3A1TA 5DSTA 4ROSA 4ZOEA 3LU1A 1W30A 3BGVA 4KBYA 4PSKA 1QIMA 3OEWA 2X9LA 4H31A 2DHCA 1USIA 3MWLA 3RQSA 5A6SA 1CQXA 5KSYA 3K70B 2Y93A 1PTJA 1Q3HA 4Y1RB 1OJ7A 4KR2A 2X77A 1WSBA 2P9EA 1AKQA 1GTL1 2H08A 2P1RA 3S7ZA 3IIIA 4Z1OA 4F56A 3K2QA 4M2LA 3B6MA 1H42A 3ZCRA 1CIJA 2BEWB 1GV1A 1XEXA 2IOFA 2G0AA 1WF3A 3G0OA 4W82A 4AVYA 3KU1A 1ADCA 3KV3O 2DXIA 4FGUA 2NO6A 2PCJA 3OT5A 2WG0A 4QARA 3PRHA 1KQPA 1XO1A 2WNSA 2XIJA 4FYKA 2IHYA 4NOKA 4O0LA 1DFIA 4ZVKA 5SICE 3IUPA 4Y2VA 2OXTA 4UUNA 2VWPA 2DZDA 2BKLA 2FR8C 3H86A 1W44A 1N0HA 3DCIA 3VC2A 3O2QB 4W7HA 3D6MA 2PTGA 4OK3A 4K9PA 3FFXA 4RANA 1SURA 2GILA 3IE0A 3KKOA 4BGEA 1ICEA 3MVEA 2J3MA 2JFWA 2OCGA 3ZTTA 1QC5B 2JNWA 2PJDA 2LIPA 1J5XA 3KZKA 4TTRA 3THSA 1IN5A 5IABA 3AEYA 3TG8A 1GCUA 1XTZA 3GYBA 3IV7A 2ZETA 1UBRS 2Y9PB 4AUKA 4RXTA 4EWLA 4ND8B 2Q5FA 1LPAB 4PTLA 1EFVA 5FWXA 2GEJA 4NONA 3LA8A 3Q7IA 2B1IA 1UKCA 5A9SB 1E2PA 1USGA 2R96A 4NOLA 4QPPA 4BKPA 1FS6A 2OHIA 4L27A 1HYEA 2WUVA 5I9SA 5GADl 2WUGA 4JMLA 5D51S 1ZH2A 3PLAE 5GJCA 1GWNA 1FVXA 1M10A 1HSOA 3FBGA 1TVMA 3A70A 4DC9A 4D82A 2IEAA 2IUSA 4M76B 5KQSA 2QMQA 3DAGA 3K0FB 4BRZA 3VU1A 4P6VF 1MOQA 3LVQE 1NRIA 3O1HB 1REQA 3QFRA 2P65A 3MK31 4OHMA 3F5SA 4CLXA 1SCUB 2PX6A 3AMVA 4DAEA 4IR7A 3L0BA 1P7PA 4KO4S 4H6VA 3G02A 1H0HA 4O2AA 2GN0A 1C41A 1YJBA 1AA9A 1QZXA 1U8EA 2WWRA 4OL9A 4IIVA 1P18A 1B0AA 3L07A 3ZXSA 2V3CC 3G0DA 3V97A 1LLDA 4MUMA 4XWKA 2ZRBA 1RLOA 5JSFA 4WY2A 2R60A 3K09C 3OH8A 1V95A 2VUIB 4EHDA 1IHUA 1VE5A 4V1CA 4D9CA 3O8CA 3FDZB 2O20A 1KH3A 1QYRA 4IDFA 4ALNA 1QYWA 1U2GC 3R6GA 4JB0A 3CLHA 3MMSA 1CJCA 3C45A 2JBWA 5ALTA 5ELMA 3BIOA 1F9AA 1N7JA 4ML3A 2O8EA 1Y8QB 2B9VA 4UNIA 2GJAA 3UK6A 2HB6A 3BILA 1DXYA 2WUDA 5A0FA 5DNAA 1DCKA 3DCNA 1XCOA 5BV8A 3GNSA 3KOYA 3OOEA 5B7GA 2P40A 1MTOA 4QL3A 5CM2Z 2QSZA 3FWPA 5K8CA 1GFWA 5LYJB 1AIPA 5BMOA 1ZXLA 4S1OA 2CEAA 1I1NA 2X4GA 2AJDA 1FP1D 3C8UA 3F0TA 4X8MA 4Y2RA 4GI1A 5BSVA 5IPFA 4R9SA 2JGEA 2YZ2A 4WXPA 4R16A 3RADC 2HGZA 4PPYA 1XRSB 2ZSKA 1NPDA 1CX9B 2IIVA 1BVHA 1MLDA 3L2OB 1QPBA 4KSYA 5GAJA 1M0SA 4PVDA 4LYAA 4N3GA 2OMKA 4AWBA 5KNBD 3U4DA 4XYGA 3ZCUA 3IHLA 4RM2A 1DPFA 3JQDA 2OV3A 4S2EA 2WPNA 3O7WA 2ZIUB 4FGLA 1IRXA 2FB9A 3VR3A 4LK3A 4BATA 1F4LA 1THMA 3VPDA 4EG1A 1SHLA 1DOAA 3KWJA 4TX1A 1Y81A 1YE8A 5DWDA 5EERA 5EZSA 3PKIA 4IF6A 3EVAA 1XVLA 4ZDKA 1VPDA 2QRJA 2E4VA 4HB0A 3EUWA 1BVRA 3H1FA 4QREA 3B38A 5CLQA 1H6CA 5HF9A 1X8XA 2G1AA 1UBFA 3EDMA 3GLKA 1L4KA 3E6AA 4N6NA 5AW7A 3PHBE 1FF9A 4DV0B 1NVXQ 4MV1A 2PMWB 4BECA 4CZ2A 4WZ6A 3QTLA 2QVXX 4XVQA 1T6XA 1KJNA 2EFEB 5EVCA 3QLJA 1BDJA 1NRXA 2VP5A 2ES4A 2GO1A 3DE5X 3F47A 4IW3B 4MVJG 4MYHA 3ZY4A 3QKUA 1GYQA 4M6WA 2C9YA 1Z3CA 3SYMA 1H6DA 2ZVJA 2REXB 3FOAA 2PX2A 3NBUA 4KXVA 2VDQB 2HA3A 5EYPB 3K6KA 3ROKA 4CGZA 1N0VC 1MB3A 3KPVA 1LY1A 3AW9A 5IJ0A 3QBJA 5JYCA 2WHQA 4Z4EA 3DYVA 1TM2A 2KE5A 4MKXA 1ILEA 1HT0A 1QQ6A 5HZHA 1HUQA 3GMSA 1NWCA 4HEJA 3UXMA 3ZCTA 4MMXB 1B23P 2LDBA 4DV5B 2JH8A 1NSTA 2C4MA 2XUAA 3Q8WA 3WYAA 4RZIA 4B46A 4ZC8A 1IXZA 2WAAA 3AJDA 1C4WA 4A7PA 1KEUA 2IXBA 5J4YA 1NP3A 1JMKC 2QQFA 2AW5A 3H2YA 4MRSA 1Z74A 1OLSB 2HAEA 1W46A 1OAKA 3LX6A 4K7JA 4ND5A 4DMLA 4F3RA 4B3SB 4KPUA 2GZRA 5DNVA 1EG2A 3GRRA 3G8BA 4NG4A 4B6EA 5CFQA 4JENA 5KHLB 5L7TA 5JCOA 3ZK9A 2CSXA 2PY6A 3CS3A 1TEXA 1XMPA 4TZTA 3HUUA 3LF1A 4GICA 1JJVA 4BNDA 4QWWA 2IRWA 3G0BA 2QTAA 4QFMA 3WJ1A 4B9AA 1G38A 5EZ6B 3GFQA 2FEXA 4RWEA 4LYEA 3PC3A 4LNUB 4WIAA 3MINB 3DHNA 3CPEA 5KREA 3DOIA 3HC7A 4ZO6A 1KP2A 3OKAA 5FNVB 1JVNA 1RWNA 1X3LA 1P91A 4R1UA 3UUWA 4RMJA 5K6AA 1XWIA 3PLRA 4MLDA 5FNVF 2XKKA 2HK8A 1GG2A 3IPLA 3NHBA 4HFRA 3RBVA 1N0WA 2GXQA 4R2MA 2B7BA 1E2HA 3CH7A 4ZDJA 1R12A 1OB2A 4RMHA 1D4ZA 1UMCB 2NSJA 1OBHA 2FWIA 4JL6A 4RPHA 5E4TA 2CLCX 3PFIA 3N70A 3FMPB 3IJ5A 4I1IA 5SY4A 1UXHA 3T7EA 2C31A 5LP6F 1KFKB 2P6MA 4P3OA 5DSXA 2OM2A 1EJ2A 1WL8A 2EVWX 4Q5IA 4TT3A 3MJRA 2ZIGA 1FRQA 1GYPA 3U4MA 1IDN1 3JYHA 5I3ZA 1W85B 2W9XA 3IUQA 3V3KA 2IX3A 2XUZA 4B75A 5BSFA 1O5OA 3DAYA 3LCCA 3FI0A 3OM0A 4PYQA 4F4HA 5FBVB 3IXLA 1BX1A 2BFDA 2WOOA 3Q41A 4GU5A 1GEGA 1J2EA 1TEHA 3IAM1 3FVVA 4IQ0A 2Y2VA 1DZIA 2WUEA 1LSSA 4Q12A 3S1LA 3KB1A 5JFTA 1G17A 3F6YA 1Q44A 3O8RA 4MDYA 1TO6A 5L8VA 1V96A 1BHQ1 3PFGA 5CLJA 1DJQA 2NZ2A 3NBKA 5F33A 1UQUA 2Q0QA 4MQ6A 3DUFA 3JVEA 1EK1A 4XEUA 4CEJB 5IP5A 2W6MA 1PK7A 4Q3NA 2RK6A 2O57A 3ASUA 2DPLA 2XT0A 2AI2A 1LNQA 2VH2A 3SICE 4ADSG 4CMCA 3NOOA 1MAAA 3RBZA 4KX5A 2YWHA 2UV8A 5AI6A 2AQKA 3HB0A 3JQ9A 4CDNA 1JHPA 5BSWA 1VG8A 1F2VA 1Z6TA 2PSJA 1EZ1A 4D8VA 1P0FA 3MLBA 4Q24A 2ATCA 2B2NA 1UANA 5IHPA 2COKA 2IT1A 3PNMA 1NXPA 3VDMA 1ULTA 3NAGA 2MMGA 1T0HB 2FCAA 2O2YA 3I83A 4HNQA 4WNAB 3D8BA 4MS4B 1U7PA 2HA2A 4IMPA 1TT7A 4HAYA 5L4SA 3OBBA 4TWIA 4NCXA 4MIEA 1JU4A 5DYTA 4ACAA 2WVAA 1Y3HA 1LLUA 3AOEC 1K5DA 3P27A 4YFVA 1ZVKA 4PCUA 2YVQA 2H29A 1OA1A 1YOVA 2JCXA 3DPSA 4PZEA 3QI2A 4INZA 4PNPA 2HU5A 4JGGA 1YBAA 2QPTA 1L5QA 3BK1A 2CCKA 4M9UA 4RBNA 4YMIA 1TTPB 1Y1TA 2RHCA 1Z13A 2MMCA 3BB3A 4IRXA 3LLCA 2AQHA 1NXOA 2CFTA 2XQFA 4LOLA 4Y2TA 1JR3D 1VECA 2FUKA 3FTCA 4PTYA 2FXVA 5EZYF 4PF1A 3AR3A 1X1CA 5HE8A 4MYRA 3Q1LA 2C58A 1NFRA 1UZNA 3L7MA 5TARA 3T5AA 1LH0A 4DQ0A 1JVSA 3PWSA 2OA0A 2OFFA 1Y5MA 1MA0A 4RDCA 2XITA 1DQNA 3OJEA 3I3OA 1Q0HA 1L3IA 1Z6QA 4PWYA 4BOYA 4RNDB 4BUZA 5LNK6 1EXVA 1GZVA 1SKYE 4MB0A 3TPZA 3DBRA 1G1MA 4P7FA 4WTOA 2MSWA 4ZD6A 1E9BA 4K