3IMFA

1.99 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor'
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
255
structure length
248
Chain Sequence
NAMKEKVVIITGGSSGMGKGMATRFAKEGARVVITGRTKEKLEEAKLEIEQFPGQILTVQMDVRNTDDIQKMIEQIDEKFGRIDILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQAIGKYWIEKGIKGNIINMVATYAWDAGPGVIHSAAAKAGVLAMTKTLAVEWGRKYGIRVNAIAPGPIERTGGAEMAKRTIQSVPLGRLGTPEEIAGLAYYLCSDEAAYINGTCMTMDGGQHLHQYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short chain dehydrogenase
publication title 1.99 Angstrom resolution crystal structure of a short chain dehydrogenase from Bacillus anthracis str. 'Ames Ancestor'
rcsb
source organism Bacillus anthracis str. 'ames ancestor'
molecule tags Oxidoreductase
total genus 80
structure length 248
sequence length 255
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3imfA00
1I2ZA 1EQUA 3R6DA 5TNXA 3SBOA 5I7FA 3HDQA 3NUGA 2HRZA 2RHRA 2PK3A 5JLAA 3COSA 2YZ7A 4YVFA 5ITVA 1NVTA 3AU9A 1PGQA 1X14A 2X0RA 3GNSA 3MWDB 3OP4A 3LLVA 5LC1A 3VPXA 4NFSA 3ZWAA 3UH1A 3VZQA 1PJ2A 4EGFA 2QW8A 4CLXA 1B0AA 5KKAA 1PGJA 4E2ZA 5ER9A 5JC8A 4YJFA 1SBYA 3A9WA 1ADCA 4GKBA 3RUAA 2EJWA 4WCFC 8LDHA 4R01A 4WLUA 1SMKA 4ITUA 4CMHA 4TZTA 4UUOA 3WBFA 2XAAA 8ADHA 3JQAD 4R4JA 3ASVA 1NR7A 2Y0CA 2DT5A 5JY1A 2NVUA 2J5QA 5IXSA 1XR3A 2O3QA 4EUEA 1GQYA 1XKQA 3M6IA 5IN5A 1H0KA 2HO5A 1JVSA 4P38A 2HK7A 1DSSG 2DC1A 3C7DB 4DREA 1JAYA 4BL5A 1TT7A 2DTEA 1FDUA 4OQYA 3RCBA 2X58A 3G49A 2HK8A 1IL0A 1YL5A 2OBNA 3F47A 3KYBA 2IDZA 5JCJA 4XB2A 5JAIA 1GZ3A 1PU2A 1UXHA 1V3VA 3ONDA 1C1DA 1LTHR 3E8XA 3V2UA 4UEJA 1RWBA 5TGDA 3ZNOA 4RPJA 2YFHA 3VH3A 3AY3A 4NZ9A 3I9JA 3RC7A 3H7AA 2W90A 3RFXA 2BH9A 4FFMA 2O48X 5KVQA 1A4UA 4J16A 2IZ1A 3GH3A 2O50A 1F17A 1T4DA 4NIMA 3W4IA 2V6MA 4OOEA 3EC7A 4FC6A 1R37A 2OZPA 2YY7A 4RVGA 1PJ3A 3LC2O 4GLOA 4IDGA 1I0ZA 1WW8A 5TT1A 3WGYA 1KEUA 4XQEA 4GH5A 1MXFA 4IJVA 4MVJI 1EVYA 4XX0A 4XGKA 2J6IA 4BNLA 5BR7A 5TQVA 4UULA 1CQJA 1DLIA 5IZCC 2XXJA 5H82A 5A9SA 3PQEA 5F1KA 3ST7A 4RDHA 1YQGA 1KC1A 3UW3A 3D4PA 2X5OA 4BB6A 2VNAA 3G79A 5CDTA 1N1GA 2X0IA 3A1NA 3WLEA 1MC4A 2ZQZA 3ZWNA 1GY8A 5COQA 1Y8RB 2VT2A 1U2GA 3PYLA 3IC5A 1SOVA 4MIYA 2JKVA 1OAAA 4R3NA 5B4UA 1PJLA 1WMBA 2FOIA 1DIAA 4GGOA 1K5HA 3RIHA 1D1TA 4J9UE 3TPCA 3W4KA 1E3EA 4NU5A 3L4BA 5LCXA 4BNXA 1ZK2A 3RJ5A 3Q1LA 3JQ8B 3HB5X 4R5HA 3RUDA 2GYYA 5TC4A 1V9LA 1YE3A 1ZEMA 3JSAA 4N18A 1Y6JA 2D59A 2Y1EA 5B37A 4QFCA 4EEXA 3CE6A 2B37A 1ID1A 1ZJZA 2VHXA 3LSYA 4CL3A 1IYZA 1DRWA 2AA3A 4KOAA 2Q45A 5KTKA 4BMVA 3GVIA 4TRRA 4DYDA 4NJOA 1H93A 3H9QA 4OO3A 4MVJG 1D4FA 4DLLA 1KEWA 1EDOA 5C7IO 3DHNA 4YAJA 1E3WA 3GRPA 1JU9A 1NBOA 1EUZA 4PLHA 4GVLA 3MOIA 4JX8A 2NQ8A 3AI3A 4YQYA 3HQ4O 4JJFA 3R0IA 3EVTA 3A28A 3ON5A 3O38A 2QHXA 4QXMA 4JBGA 1HE5A 2ZYDA 1Y8QB 3H2ZA 4AL4A 1V3UA 4JCOA 1O94A 1UUFA 3QVXA 4M49A 2GDZA 1IPEA 1DIHA 1MA0A 3ICCA 2J5KA 4JGBA 4YT2A 3HN2A 1Q2XA 4I5FA 2J8ZA 4LVUA 2X1HA 4YAIA 3OFSA 4L75A 5K6AC 2UUOA 3OEYA 5BSEA 2AQHA 4JBHA 2VCYA 4CMBA 2NACA 2WYVA 1H2HA 2IZ0A 2ZB4A 3RUCA 4BNFA 1T25A 1MLDA 5TLSA 3AOEA 4Z3KA 1UDAA 4BNNA 5FFFA 3WICA 3BHJA 3C1TA 3KUXA 4C7KA 5HTOA 4Y6SA 5IXYA 1DO8A 4II3A 1LX6A 2OOSA 1O0SA 3B1KA 2A94A 3RASA 4O59O 2IXBA 1SB8A 3IDSA 2ET6A 1VJ1A 4DUPA 1NVGA 4YB8A 4A0SA 1LLUA 3W8EA 3IS3A 4TVOA 3DHEA 5L51A 1PSDA 3WR5A 4UVHA 2CDAA 2PD6A 1ML3A 1T24A 3OH8A 2Q99A 4ALMA 1MG0A 1ZUD1 2GCGA 5JMWA 3M2TA 4ZQEA 1E6WA 3D7LA 4HWKA 3WJ7A 2AW5A 3JQCA 1ENOA 4JLWA 1GAEO 3JQBA 1P0FA 4RQTA 1TI7A 2WD7B 3C7AA 1J49A 4J4HA 4WASA 1C0PA 3AFMA 5C7OO 1QYDA 4PLTA 1BG6A 1LDEA 2G1UA 4M1QA 3SLKA 5FI5A 4CMAA 5U9CA 3D5QA 2Y1DA 5T67A 2NTJA 4GSLA 1RM3A 1PTJA 1UZMA 2NTVA 3F4BA 2DTDA 1MX3A 3PLNA 4D0SA 3B1FA 4CQMD 3BMQB 3VHRA 3ETGA 3BMOA 2E49A 3Q2KA 1TT5A 4HFMA 1N9GB 2EXXA 3NT2A 5FF9A 3K73O 4J3FA 3LLSA 4GPD1 1NQ5A 4EJMA 4E2YA 1F8GA 2JD0A 3D1LA 1C0IA 2C0CA 5JY6A 2E37A 4BO8A 4PCVA 3PPIA 2Y1GA 4L8VA 3WOHA 1SPXA 2CSUA 4WLNA 2X5KO 3PI7A 3WMWA 3R3JA 3C7CB 4YAGA 4INAA 3VPSA 4R1TA 5L4SA 1H2BA 1NASA 1MP0A 4CPDA 5EN4A 1NNUA 4BNIA 1T1RA 1EVZA 3I9MA 3SEFA 3D64A 4L76A 4B3JA 3EK2A 1CEQA 3I9NA 3HN7A 1UP6A 5FYDA 5I7EA 1Z75A 4IXTA 3WSWA 3DZIA 4PLZA 3DXFA 2C59A 5TJ9A 4KTTE 1XEAA 1ZVMA 3K92A 2FSVA 4YJFB 4K26A 4Z6KA 4E13A 4TRJA 5JO9A 2YDYA 1YB5A 3TDKA 4MIOA 2H6EA 1EFKA 1U28A 1XIVA 3FHLA 3N7UA 3UGKA 3RUIA 3WYCA 3TZCA 1ZSYA 3VH4A 1Z45A 1U3TA 4FFOA 3WJAA 3U4IA 4Z0TA 2NVUB 1E7WA 1ZJYA 4UVDA 2WM3A 3JQFA 3PQDA 1YL7A 3TSCA 1DFIA 3NJ8A 1LQTA 2ZTVA 1V35A 2Y68A 1N1EA 2YYYA 4N54A 3S8MA 2YW9A 3K6JA 4FD3A 3JQGA 3WG9A 4DMMA 2QX7A 3NX4A 2IZZA 3EYWA 1WZIA 1QYXA 3LC7O 4MVJH 1CETA 3C8MA 1Y1PA 3HADA 3ZHYA 1U3WA 2OP0A 4H16A 2ZTMA 3TOZA 4KDFA 1YJQA 4E2XA 3E82A 4ZJUA 4AJPA 3BA1A 4CQMB 4J7UA 5HA5A 4RCVA 3GLQA 1E7MA 4IDCA 4LRSB 3O26A 1K3TA 3RKUA 3DDNA 1TLTA 1I33A 4QO8A 1NPTO 2ZB7A 3F5QA 3OIGA 2HDHA 3JQ7A 1EDZA 2GLXA 5DF1A 5TF4A 3TZHA 1D3AA 1YB1A 1S6YA 4JBIA 4E5PA 2EP5A 2Y1FA 1G0NA 3QE3A 1VJ0A 1B3BA 3Q2IA 3HJAA 3AY6A 4S1VA 4D3SA 3IUSA 3SC4A 4XEHA 1PGNA 4IMPA 3ZU2A 3I9KA 4RVUA 2OUIA 3WTBA 3ZNQA 4I9UA 2Z1MA 4I1IA 5GZ1A 1PS0A 3TJRA 3TL2A 5JYDA 5A9SB 5CDYA 2HMVA 4XIYA 2PZKA 4UUMA 1VE9A 1U4SA 1LDBA 2NTNA 2YQ5A 3OBBA 4J7CA 4L74A 1BDBA 1ONNA 3H4VA 4FBGA 2DVMA 4PRKA 2HU2A 4KDEA 1AXEA 1NWCA 3ZN2A 4AVYA 3GZ4A 3WB9A 3DAFA 3PDUA 3OA0A 1LSSA 3D3WA 1M66A 3KOUA 4J1TA 1NR1A 3IKVA 3M1LA 1EE9A 1NP3A 4FIZA 4FR5A 5A03A 4LSMA 5HRUA 2EGGA 1T2CA 5DN9A 3RFTA 2JCYA 1N5DA 3DOJA 4WCFA 4CMEC 2OMEA 5HWSA 3AUAA 4YR9A 5HS4A 4IM7A 5TSDA 4MINA 1P1IA 3ZU5A 1DHRA 1VJTA 2NLOA 3PTZA 3U0BA 4Z0PA 1MFPA 1MUUA 1Q0HA 5TX7A 2RBEA 1ZH8A 4W6ZA 1RM5A 3L0DA 5F5LA 2RH4A 2DKNA 4CJXA 1KVQA 2HMWA 4BO0A 3RUHA 1H9AA 1T2FA 3F1KA 4R1SA 4WNIA 3P7MA 4G65A 3F6YA 4R1UA 4XR9A 1I8TA 1PJ4A 4M89A 2CMDA 4JROA 4FJ1A 4HFJA 4WOJA 4AJ1A 1QG6A 3DTYA 5L9AA 1PGOA 4CM3A 3U9LA 3QSGA 4GAEA 2Y1OA 3V8BA 4UVEA 2LDBA 2XF8A 2PD3A 1A7AA 1PWXA 2VTDA 5L40A 2VOJA 3DBLA 3MJCA 3PRJA 1H6CA 2QRLA 1Z73A 4O5OA 2H63A 5HM8A 4YTEA 3WYBA 3NTQA 5DCWA 2D8AA 5H81A 4LISA 1E1MA 2HLPA 4PLVA 4J1NA 1DHTA 1YB4A 1U1IA 4GGPA 3FNHA 3RC1A 4DPLA 5JAQA 5MDHA 1E7SA 4E33A 1UP7A 4OKNA 1R4NA 2VQ3A 1J0XO 1EFLA 1NQOA 3DZBA 1CERA 3E48A 1ISJA 1O6ZA 1JWAB 3RJ9A 4FSHA 5FI3A 4GI2A 1AE1A 5AQ1A 4RJTA 4WOKA 3IP3A 3K96A 1R6DA 4B3HA 4ZICA 5TIIA 1RM0A 1R12A 5EIOA 1FDWA 4IDBA 1HYEA 1SNYA 1L7EA 3LF1A 1QYWA 1YONA 1JLLA 3WGGA 4E3ZA 4O6VA 1Q0LA 1YBVA 3VPFA 2HK9A 1P1HA 2NVBA 2WYUA 1Z7BA 3IJRA 4RPLA 2G76A 4U6QA 3NT5A 2HSDA 3JQDA 3U4CA 4CUKA 3JYNA 3OICA 1OFGA 3QWAA 4PGFA 4CLRA 2J5RA 4BO2A 1N2SA 4EUHA 2GR9A 1UZNA 3PXXA 5EINA 4R9RA 5B1YA 1X7DA 1M76A 1SB9A 1UR5A 3Q9NA 3RD5A 4RLSA 4J0FA 2AQIA 5A04A 3D4OA 2PZLA 1PZHA 3Q6IA 2GN6A 4HNGA 3AUUA 3V1TC 2C82A 5AXCA 3NGXA 4I9HA 4RZHA 3I6IA 3GR6A 1P33A 4MP8A 3PFWO 3A06A 4FFRA 5AVOA 1ZMTA 3EAGA 3JTMA 3IP1A 5H83A 1ZK1A 3VKVA 4FQ8A 5I8ZA 1T26A 3PWKA 2BF7A 2CVOA 2JCXA 4G81A 1K6XA 5C3MA 2NWQA 3UXYA 3BMOB 3VVBA 3C1AA 1OC2A 3HDHA 1Z82A 4CM5A 5CG1A 2BKAA 4EUFA 1M67A 3I3OA 4DC0A 1ZKMA 4RVDA 3UICA 1PQUA 4YBZA 4YJDA 3BAZA 3JQEA 2VNSA 4MOWA 3PGJA 2X7HA 1HDYA 4XGNA 4AJKA 1DC3A 3PHHA 4MJLA 3F1LA 1M6WA 3NDJA 1SO8A 2I67A 1VL0A 3GZNB 1GDHA 1A27A 1NFQA 1ARZA 1GR0A 3ZZNA 3AM3A 2X9GA 4A5OA 3O03A 3PHGA 2FRDA 4CM8A 1F0YA 2P68A 3WNQA 5K6AA 4LMPA 5C5IA 2BFAA 1XCBA 4M87A 3RBXA 2JHFA 4ZVVA 3H3JA 2DUWA 5KJFA 4WLOA 1TXGA 4UUNA 3ZWBA 3DBRA 3PZRA 4LN1A 3JCZA 4N5NA 4WEOA 3GNQA 3L9XA 1F06A 3OMLA 4JNKA 2Q4EA 2NVWA 2P9EA 1OOEA 2B36A 3QA9A 4PG5A 5CEFA 5ILOA 3BMNB 4PG4A 2RCYA 1JWBB 2GUGA 1Y5RA 2O23A 2DFVA 3ZDFA 4BNJA 3Q3CA 5IDWA 1CRWG 1YOVA 3OHSX 5KOIA 5AXAA 3GPIA 1Z7EA 4RGBA 1HE3A 3NDIA 1GYPA 5TRTA 5JW6A 3SLGA 1C14A 4JK3A 4L4RA 5IZ4A 2PR2A 3I83A 5THKA 5F5NA 4FJ0A 1U4OA 3DZJA 3KRTA 4Z9YA 4E2WA 4D43A 2W8ZA 2HMTA 4PN3A 3AUTA 2W2KA 4DQXA 3JQGB 2TMGA 4QFDA 3ZH2A 3BTUA 3C1OA 3PEFA 2BFMA 3PJEA 1GV0A 1WP4A 4FS3A 3LVFO 4D3FA 1KEVA 1Y5MA 2NU7A 3IMFA 3LT1A 3WWYA 5I9MA 4W7HA 3GVCA 2ZK7A 4DRYA 4TSKA 2VT3A 3E1KA 1FMCA 4PZEA 1H6AA 1GFSA 1ULSA 1DFHA 1A5ZA 1PS8A 3FBTA 1BVRA 3AU8A 1HWYA 4NMHA 4CM9A 4MDHA 2CZCA 1ZIDA 5T5QA 1LC0A 2O3TA 3PVZA 1OZAA 3K5PA 3EZYA 3INRA 4I5EA 9LDTA 4NH4A 4DLBA 4LMRA 1W6UA 2NSDA 2H1SA 4QO7A 2W2LD 4EBFA 1ZK0A 2YJZA 3D0OA 3UHAA 3GUYA 1H9BA 3JQ7B 3G1TA 1G1AA 1YDWA 2ZTLA 1F8FA 1GCUA 4LVCA 1EK6A 3MTGA 1RYEA 3UKOA 2YQ4A 2CVZA 3C24A 1UP4A 5JDIC 3DC2A 4PLWA 2EERA 3GVPA 1FXSA 3QWHA 3GMSA 2B5VA 3L77A 5DBGA 4CODB 5A06A 2E6UX 3TF5A 3NDRA 4B7CA 4BVAA 4B4VA 3Q0EA 3GT0A 4AJJA 2O2SA 5K9ZA 1E3IA 3GVXA 4DQVA 1JDJA 1A7KA 2Q50A 4BO1A 4FJ2A 3WGTA 3UFXA 2P5YA 1SC6A 3PYXA 3NJ4A 1NHWA 4OH1A 4IIVA 4NFHA 3CIFA 4YJGA 1NQTA 3AOGA 5CDSA 4EZBA 3CSDA 4IZIA 3VKUA 3ZHXA 4MP6A 1YVEI 1VM6A 2AEMA 4P8RA 4WCFB 2FR0A 4B4OA 4CL8A 4F46A 2B5WA 4RPKA 3ZHZA 1LDMA 1V6AA 1X13A 3HHPA 1XHLA 1D7OA 4KUGA 2V6FA 1PJBA 3B1JA 1HDCA 2OFPA 2ZB3A 1ZMOA 4BNYA 2EG9A 3H5RA 4FOSA 1K0UA 4A73A 3FNEA 4ROSA 5IJZA 3F46A 4BNTA 1W8DA 5IDXA 4NU6A 2SCUA 3E9MA 4D79A 3LK7A 2UUPA 3PHLA 2WMDA 3E5MA 3JYQA 1PJSA 5I7VA 4MVJD 3WGOA 1HLPA 4AJIA 3AY7A 1EVIA 2ZYAA 3PK0A 1R4MB 4YACA 1PZFA 5K0ZA 2PNFA 3I52A 1IHYA 4GX5A 3U3XA 5IF3A 1LA2A 2AMFA 4FW8A 3MOGA 2Q2QA 2Y66A 3GC6A 5KVVA 4Q3BA 2FZEA 3WIDA 4UAGA 2GN8A 3OECA 3NTOA 1XA0A 4NI5A 3WYEA 2YV2A 3VPHA 5DOVA 2PGLA 2R6JA 2BMAA 3S1LA 3DZGA 4OIMA 4DPMA 1B8UA 1NX6A 2ILTA 1ULUA 4QTZA 1R4NB 4U7WA 1K2WA 2EW2A 2C7GA 4Q3CA 3FCOA 4WECA 5TJHA 3KETA 3NV9A 4DC1A 4R68A 1KS9A 2ZJ1A 2PKQO 2BFPA 1E92A 3MJEA 1E1LA 1Z6ZA 3WWZA 2PKRA 2I5PO 3DHYA 3KVOA 2OXIA 2PY6A 3B6ZA 2DPHA 2X5JO 2Q1TA 2VZ9A 4NBVA 1U7TA 5KJCA 5KVCA 2GZ2A 2V6BA 1CQIA 1FDVA 4ND5A 4DBVO 1Y9AA 1ISIA 3OM9A 1L1FA 5JCXA 5CEEA 4CLOA 2WEKA 3TNLA 5DOZA 1GQ2A 4E5MA 3RC2A 2J3IA 3RU9A 3ROKA 1BXZA 2VHWA 1ZNQO 1QYCA 5IDQA 4K1LA 4CLRB 1LBEA 4L4SA 5U1PA 3UF0A 5C7LO 5B12A 1KVSA 3ITDA 1O5IA 2PV7A 2D0IA 2QIOA 2Y0DA 3IUPA 4NBRA 4RF2A 4ZU3A 4CMEA 4BGUA 1I5RA 1VLLA 2DPGA 5B4VA 1T2DA 1B14A 5JC1A 2C54A 2Y05A 3P2YA 5BT9A 4LCEA 2J3JA 1FF9A 3DO5A 3PWZA 4CLEA 1O89A 3STHA 4PLCA 4PG8A 2CDCA 1C1XA 1YJ8A 3OIFA 4Z9XA 3ZCXA 2YV3A 3PDJA 1RKXA 4R9SA 4ZN6A 4HFNA 2EF1A 1EE2A 4ALLA 1ZK3A 4Q3NA 4U8GA 3JD3A 3W6UA 3GAFA 4HP8A 4P4NA 4URFA 1SEPA 4OYRA 4OGWA 3E9QA 4EJ6A 4CMKA 4QQRA 3Q9UA 4CQLA 3FTPA 5EQFA 5IAAA 4TROA 3FRJA 3PYMA 3KEQA 1BXGA 1DDOA 4L9RA 1BW9A 1PQPA 2DBQA 3WXBA 4EEZA 1PL6A 4YJHA 5F3RA 3DMTC 4NFYA 1E5QA 3K30A 4KWHA 2FSSA 2VYVA 5A1TA 3ONFA 3DEYX 5BSFA 1P3DA 3VZSA 1R0LA 3RC9A 4FFPA 3V2HA 2HCTA 3SXPA 1PJCA 5CDUA 3IKTA 3EUWA 3JD0A 2Z95A 1E6UA 3AJRA 3QQPA 3H6KA 2XPCA 1NVMB 3JQ6A 4IJUA 4MKRA 4GVXA 4DWVA 3MZ0A 3VTZA 4MIEA 1KBZA 2AEJA 1R66A 4BS9A 4F3YA 3DZFA 3OJOA 2E82A 2BHLA 3PP8A 5JCJD 3MJ4A 3DBRB 3IIEA 5FEUA 1HTBA 4D45A 2QYTA 1XU9A 5T8KC 5T6BA 5DULA 2WTBA 2FZWA 1GTMA 1KOLA 4DGSA 1CYDA 1ZSVA 3L6EA 4KUEA 4BUCA 1I2BA 1MV8A 3EMKA 2WE7A 1AGNA 4YRDA 2C7VA 4WKGA 3FWNA 4RVFA 2I9PA 3O8QA 1ADFA 1YOVB 1YQXA 4XB1A 3V5NA 1DRUA 1E3SA 2VUSA 1P1RA 2EWMA 1GCOA 5CPFA 3GEDA 5JMPA 5ITWA 1OC4A 4TRMA 2OHXA 3BMCA 3K8ZA 1I3LA 1W73A 1SOWA 3IL2A 3QV1A 4NJMA 3GF4A 1LXCA 4PVCA 5I8WA 5B4TA 1N8KA 3BTOA 4J43A 4UUPA 5JS6A 4A03A 2D2IA 3U4DA 1LRJA 4BKPA 5ICSA 1VL8A 1DEHA 1YGYA 2GERA 2VRBA 2YHUA 3MCVA 2PKQP 5DNAA 5EERA 2GPTA 4Y98A 4NG5A 1HETA 1QSGA 4HADA 3TRIA 2EW8A 3GDGA 5G0WA 4AJ4A 5I7SA 1PL7A 2WWRA 3KM0A 4DIFA 3FSRA 3Q11A 4CMIA 5THQA 4C7JA 3G0OA 3AM5A 5IG2A 3NKLA 1QRRA 2X22A 2FWMX 1EBFA 1NTOA 2A35A 2BD0A 2GN4A 1QV6A 3DL2A 4FFNA 4FGSA 1YH3A 2ZJ0A 4F45A 3ENNA 1LDGA 2JD2A 3DFZA 4IINA 3ADOA 2VHYA 3ADPA 5JDCC 1GEEA 1QLJA 3QY9A 3UAGA 3PJDA 1ZK4A 3ITKA 1GZ6A 2C2YA 3BZUA 2EKQA 2YFQA 3GUCA 1GEGA 3HUDA 2O4UX 2AQKA 1SEVA 1PJTA 1U8XX 3DR3A 4QEDA 4S3MA 4BIIA 3CMMA 2P9CA 3ZHBA 2CY0A 1WVGA 3WQSB 2PZMA 3ZNPA 1JKFA 4OMUA 4E31A 1LLQA 2X9VA 2NQTA 1C1DB 4ONEA 5TT0A 4MKXA 3HB4X 2OORA 3H65A 4W9NC 4RPHA 4K6CA 5CAEA 1WAMA 3FR7A 1EUDA 3PHJA 1P0CA 4BNUA 1U5CA 4D0RA 5F1PA 1S7CA 3ZV6A 3KB6A 5A4DA 5KJ1A 4YJGB 3K9QO 1R0KA 3T7EA 4XCVA 1X1TA 1NQAO 5DCUA 5JXWA 1UXIA 3KYCA 5KVSA 1R15A 2D1YA 4NBTA 5JAMA 2I66A 4QT0A 1IPFA 1B7GO 3GA0A 3I4FA 3TZQA 4EITA 4TMFA 5COBA 4IS2A 5JFOA 5C37A 1U3VA 3KSDO 1LEHA 3KLMX 4IDFA 3MJTA 5L3ZA 1LLCA 3F3SA 3VH1A 2BFOA 1JTVA 3CTMA 4UVGA 4XKJA 1YXMA 3A4VA 4WCDA 2WD8A 1FDTA 1ONPA 2VRCA 1DB3A 4O0LA 3KHUA 1O9BA 3MTJA 3VAZA 4BOYA 3ZI0A 1I24A 3OQBA 4DA9A 3VOSA 5L53A 3INGA 1EUCA 1ZW1A 4DBZA 4XD2A 5CDGA 3T7CA 4U6SA 1E6EA 3ASUA 2NM0A 3WTCA 2BELA 4AJLA 2CDBA 2TMDA 3OJ0A 4OXKA 4TVBA 3V1UA 1LUAA 3AM4A 2BI8A 4GL4A 4FN4A 4CM1A 5A5EA 1HE2A 1DC4A 1DLJA 1PEDA 2C07A 4J49A 2FPGA 1NYTA 4BO4A 5A02A 2WE8A 4ZD6A 2JD1A 4A26A 2VYNA 1UAYA 3CINA 1DJQA 2O2YA 2ZKLA 4XWYA 5T64A 3VVCA 3ZU3A 1JQBA 4B8WA 5L7YA 1IZ0A 4XYMA 4OXNA 5BNTA 1LRLA 5JDIA 4IQGA 1E3JA 2AQ8A 1GQQA 4CMJA 4RF4A 3PIDA 3HG7A 1KEPA 3JYLA 5HBRA 2P5UA 1HDXA 2EGHA 2HKIA 4O63O 5G4KA 3E9NA 1XQ1A 4NBWA 2GASA 3CH6A 1E3WB 3DMYA 2ZYGA 7ADHA 1ZEJA 3ZWOA 1N92A 4RPGA 3GDOA 4TKMA 1DRVA 4BNKA 2ZTUA 1EBUA 3CZRA 3SX2A 3WGIA 3WNVA 1DFGA 2R2GA 1YBAA 2O4CA 2X23A 1MGOA 2CNBA 3AOEC 4PG7A 5DZSA 5ER6A 3UUWA 3BIOA 4IGEA 3GHHA 1WDLA 4R5MA 1AXGA 4E30A 4B7XA 1WDKA 4BO5A 1U9JA 3PIIA 3GVHA 1A9YA 1I3KA 2B4QA 2EEZA 4YT5A 1GYQA 4J0EA 5L4LA 4IMRA 4W7IA 1Y8RA 4YEDA 2R00C 4R3WA 7MDHA 3CUKA 3HSKA 4IIUA 1I30A 1LU9A 1JN0A 2GO1A 1XSEA 3ZWYA 2UDPA 3R3SA 1NAHA 1SZJG 1XWFA 1ZSNA 5GY7A 1UDCA 3JQAA 2EKPA 4I9NA 1UAGA 1C1XB 3G17A 1NFFA 2FR8A 4P4LA 3LT4A 1NWHA 5IZCA 1P74A 2BRUA 1I2CA 1BMDA 1N7GA 4YPOA 2Y0EA 3CXRA 1V0JA 4NK5A 1QORA 1XGKA 3D5TA 3WQRA 5LDHA 3ANLA 2P9GA 4YDRA 1KIFA 1KVRA 3WDSA 5BSHA 1DC5A 4C4OA 2W4QA 1P1FA 1WZEA 1QP8A 2B4RO 6LDHA 1GADO 1ISHA 3FBGA 3BYZA 1GUFA 2CF5A 3GN2A 4AICA 2CF6A 3DBHA 4YJHB 1Y81A 4PZDA 4XIJA 4YYZA 5IN4A 3DWFA 4RF5A 2BGKA 3RI3A 1E7RA 3AI2A 4I8XA 2RAFA 1WNTA 3IJPA 1P77A 4PLPA 2G82A 4CM4A 1ENZA 4RV9A 2G5CA 2FMUA 2JFHA 4QX6A 1NHGA 4XRRA 3WLFA 3WFIA 3OETA 2XXBA 3L4SO 4W4TA 3FPLA 2HMSA 2VWPA 3IOYA 1YDEA 1DJNA 5EQDA 3ENKA 4WGGA 1U3UA 5L45A 2BI7A 1XQ6A 1KY5A 4D42A 4IQ8A 3H9JA 1I36A 2X6TA 3PLRA 5KCZA 4R41A 2O3JA 2O7QA 3BTSA 3NTRA 4FOOA 4HUJA 2DQ4A 1B3RA 3JQ9C 4IDAA 1DIRA 2B83A 4HXYA 1KY4A 1WWKA 2H5LA 1H6BA 5KIAA 5ES3A 4BV9A 2C20A 3U5TA 4OXYA 1TT5B 3NT4A 3WGQA 1HF3A 1UDBA 3O8QB 4FB5A 3E5RA 4ID9A 2C5AA 2VHVA 1B26A 3UN1A 1WMAA 1KYQA 4H3VA 3SJ7A 3BMCB 3UCEA 3SJUA 4M54A 3L6OO 2NU6A 3ROQA 3RWBA 2PH3A 1IULA 4NJMB 4B8ZA 1E3LA 5EESA 5I9LA 5JSFA 4BQRA 3LF2A 4JIGA 2A4KA 2VN8A 1NPYA 3MWEB 3S2EA 4WPGA 1I3MA 1O8CA 3X2EA 2P91A 5GZ3A 3GG2A 1R0SA 3GDFA 2O3RA 3INTA 4HV4A 3RAJA 4CR6A 4YT4A 4DVJA 2HRBA 3VZPA 4RL6A 4YAKA 1U5AA 2DFDA 2IODA 1AN9A 4D44A 1U2DA 4TQGA 1DAPA 4BGIA 4IJKA 4ALJA 2JFFA 3KV3O 4MO2A 1B8VA 2O3UA 2I3GA 4Y67A 3F5SA 1X7HA 4DXHA 1ONOA 4ZRMA 1C3VA 2HUNA 4HX5A 1M75A 2P4QA 4OHUA 1YL6A 3ULKA 4A27A 4BO3A 1LDYA 4EYEA 5A3VA 3W8DA 3DMTA 3OJEA 1LSOA 4J4BA 1PR9A 1T2EA 5ENDA 1HRDA 3VZRA 2AE1A 2FP4A 3NEPX 3E18A 3ETEA 1DC6A 4H15A 5CP8A 1CWUA 4MVJE 4BMNA 1N9GA 3F9IA 4TZKA 3GOHA 4U0JA 3GQVA 4GQAA 2XOXA 1DBVO 3PHIA 4JJGA 1CF2O 5HS6A 2NADA 3GG9A 2EHDA 1NPDA 1I32A 1GPDG 3JV7A 5TS3A 2A92A 1T4BA 1ZO8A 3RUEA 4NHEA 3UCFA 1VSUA 4AJHA 1JVBA 4HKTA 3AK4A 2ZCVA 4Y6RA 5IDYA 3IQDB 1LDNA 1M2WA 4I5GA 1PR3A 4BQPA 2CUKA 4K28A 5G0UA 5T8KA 2ZCUA 4E5YA 2I3AA 3GGGA 2IRWA 1UXGA 2ZIZA 4BKOA 3GEGA 3M1AA 1PZEA 5J23A 4WLVA 4BNVA 2VOEA 4BNMA 4PG6A 5EPOA 1OI7A 3FTNA 4CLHA 4E0BA 3KYCB 4FGWA 1IUKA 4G2NA 4E12A 3ONEA 5DBIA 1HSZA 1EQ2A 1K6IA 1PWZA 3GFBA 1HZJA 3ZWMA 2AXQA 1P44A 1XDWA 4KP7A 3ZWVA 3RFVA 3ROPA 2DBRA 2IEDA 4BGEA 9LDBA 1WLYA 1FK8A 3QWFA 2W98A 1KETA 3LQFA 5JO0A 2C29D 2UV8A 3ZWCA 1BXKA 2CD9A 5A9RA 1P9LA 2BLLA 4BMSA 4HNHA 1ADBA 1PL8A 3QWIA 4IXWA 5JNLA 4KZPA 1HSOA 4XQCA 1IOLA 4J9VA 1G6KA 2QG4A 2Y67A 3B70A 3WSVA 3W4JA 3VDRA 4ZA2A 4L4XA 3RU7A 2FN7A 2GF2A 3EY4A 4XGIA 2UYYA 1GUYA 1RPNA 3D3WB 3HFSA 3LYLA 4M55A 3TFQA 1VRWA 4ALKA 1H5QA 4ND4A 4ZQBA 3ROMA 1NM5A 1YQDA 3WMXA 2YHIA 1QLHA 4PRLA 2P4HX 2PA3A 3JYOA 4FCCA 5I9NA 2AG8A 2QYSA 4JQCA 2HJRA 3RQSA 4CR8A 1C0LA 2Z5LA 4CQMA 3VH2A 1RM4A 1LSUA 3ICPA 1OBFO 1PZGA 1V3TA 3F4LA 5JDCA 4KMSA 4BKRA 2PH5A 1GL3A 3QWBA 4ZHSA 4Q3DA 3TN7A 4WE3A 1QV7A 4MVJP 3PJGA 1DIGA 3BHIA 3HDJA 4BNWA 1MG5A 3DB2A 2IE0A 2D4AA 2NUAA 4OM8A 3RBVA 4JN6B 5G4KB 1BGVA 4A10A 1FJHA 4QUKA 4BNGA 4NNJA 3BTVA 3U49A 1HL3A 1QMGA 5G0TA 3DBLB 1AHIA 2F1KA 3PFFA 1TB4A 4W9NA 4Z0HO 3U62A 4H7PA 4EDFA 3ZWWA 2GN9A 2JHGA 5FWNA 4CM7A 4YQZA 3MJVA 2VWQA 2DTXA 1MC5A 1UJMA 4JXKA 2RH8A 4DPKA 4PFJA 3RBZA 3I5MA 3QVSA 4O1MA 4UREA 1AHHA 3DOCA 3FWZA 1U8FO 4GWGA 4U0KA 2QZZA 4LW8A 3KLPX 3GAZA 3LT0A 2GZ1A 2EIHA 4QSMA 4XJTA 1HDZA 3LZ6A 2YUTA 1XLTA 3GFGA 4PVDA 3I6QA 3S2FA 1HYHA 1JAXA 1KC3A 3DAGA 3JQAB 3KZVA 3KO8A 1LQUA 2PLAA 3LC1O 3ZV5A 4XJSA 2OO5A 1X15A 4P4GA 3QJ5A 3HZZA 3AFNA 4N5MA 3S55A 4B7UA 4P22A 4A2CA 3K2BA 3WIEA 1CIVA 2I99A 4J2HA 5G0VA 3HE3A 1GU7A 3KBOA 4XYBA 4M8SA 1J4AA 4WNCA 1KVUA 2I6TA 3OIDA 3ZWXA 4B3IA 2BGMA 4RF3A 1XYGA 2CFCA 1DIBA 2C2XA 4A7PA 4TKLA 4DYVA 4FC7A 3DBHB 3TOXA 1XG5A 4OJNA 4ZRNA 2Q3EA 1IY8A 1PIWA 1JW9B 3A14A 4XRGA 3DOOA 4XDZA 4CM4B 6ADHA 2UVDA 4IZHA 3U09A 1HEUA 1P45A 4I08A 5KWEA 1BRMA 3H9UA 3OEWA 1GUZA 1WPQA 3X2FA 2DLDA 3QLJA 2Y1CA 4ALIA 3TWOA 3OA2A 2PD4A 3JD2A 2G17A 3VDQA 2Q2WA 1LI4A 3C3XA 1ISGA 1K6JA 4IPTA 4NK4A 4J1QA 1ENYA 1YO6A 1Y7TA 3UOGA 3VTFA 5CG2A 3KXDA 3OF2A 2WYWA 5T57A 4CM9D 1ZFNA 3CMCO 5JBIA 4E4YA 1D1SA 1SCUA 2V7PA 4PLGA 5EMHA 3FI9A 4YXFA 4AJOA 2AG5A 1ZXBA 2AEFA 3GNTA 3AWDA 3O9ZA 3RVDA 3QHAA 5L95A 5DT9A 2UAGA 3QIVA 3VPGA 4E5NA 2IXAA 5BNFA 1FDSA 1M6HA 2WJPA 1JA9A 1BWSA 3KSUA 1B15A 2B4TO 1NFRA 5CPBA 3H2SA 4ILKA 3GRKA 3CEAA 3WQQA 1MXHA 1VKOA 2FPPA 1OMOA 2R00A 3P2OA 1E5LA 3TFOA 5JPIA 3AUSA 4RDIA 4CM8B 1J6UA 2JAHA 3H9GA 4Z9FA 3NAQA 1BVUA 1UH5A 3KTDA 3OQ6A 4WK6A 2IYOA 4AJNA 4AFNA 4LSWA 1E7QA 4F6LA 5A5FA 4ND3A 5DDIP 2D5AA 3N58A 4XYLA 1TA4A 3EW7A 1QXSA 1ORRA 4HFRA 4FDAA 4KQXA 4DTIA 2EV9A 4N7RA 3QW2A 1H6DA 5G4LA 3WS7A 2J3KA 4RZIA 4DIBA 2Q49A 4Y8VA 2JL1A 1ZXLA 2HJSA 1VSVA 3LT2A 4NR0A 3S2GA 4OAQA 4ZQHA 1UZLA 4RLHA 4LCJA 3NYWA 1JKJA 3VC7A 3LU1A 4CV1A 1VI2A 2POQX 1Q7CA 4BHTA 5CEJA 3H3FA 5G0SA 3K2EA 3R1IA 3ZW9A 1JKIA 2IYPA 2W2KB 4LK3A 3ZU4A 1CJCA 4DLAA 4CR7A 3WFJA 2LDXA 4OSOA 1QKIA 2NU8A 4BGVA 4M86A 4Q3AA 3TL3A 3GK3A 2VZ8A 4BO7A 1A72A 2GRAA 3NGLA 1KERA 2Q1SA 3OQ1A 3HDYA 4WJZA 3GZNA 3B20A 3H5AA 2HAEA 1EK5A 1U7HA 2WDZA 4Y6PA 1DXYA 3GMDA 3JQ9A 3DAPA 5L7TA 1IB6A 1H94A 4XZ3A 1PGPA 2YDXA 2J3HA 3EHEA 1LRKA 2NU9A 5CFZA 4GBJA 4J2OA 1J5PA 1T2AA 2D3TA 1RYDA 5GMOA 4GKVA 4IBOA 4LGVA 3GHYA 1WXDA 2X86A 3OJLA 4KUHA 4J6FA 1LNQA 1XELA 3SVTA 4ALNA 4XA8A 4OQZA 4Z3DA 4RQUA 5IFLA 2QZ9A 2VZ0A 3KYDA 3BMNA 1EVJA 1EMDA 4CLDA 3FN4A 4GLLA 5JYEA 4QECA 4IS3A 1BDMA 1HZZA 1AUPA 1HYGA 1DOHA 3GEMA 3D3EA 3ANNA 4ZGWA 1T1SA 1A4IA 5BSGA 3L07A 5U4QA 3GN1A 2B69A 3ORFA 1YRLA 3EZLA 2H9IA 3EDMA 1LSJA 4WLFA 5AOVA 3WGZA 2GNAA 1NXQA 3MEQA 5AXBA 2JAPA 5BNIA 2DBVO 4BO6A 3W1VA 4YRAA 4CM6A 2JJYA 2ZB8A 1ZZEA 2BGLA 5KKCA 1YKFA 4FPXA 1F14A 2YHIB 4AJ2A 2RIRA 5AXDA 1E0DA 4MPDA 4RVHA 3WGHA 4BO9A 5MGBA 1B8PA 2OBYA 1Q7GA 2VTEA 4RVSA 3RUFA 4OL9A 2B35A 3FPCA 4R16A 3QP9A 2DM6A 4YAEA 3ZW8A 3OJFA 4DIOA 3L4BC 1BHSA 2QQ5A 1G0OA 3QVWA 5JE8A 4B4UA 2FY8A 4GWKA 3WBBA 1GD1O 1L7DA 4J91A 3PJFA 5KJEA 1IZ9A 1VKNA 1IE3A 2IEBA 2JFGA 4ND2A 4E21A 4YRBA 2EJVA 3ABIA 1W0CA 3PQFA 1R16A 5G2OA 2PZJA 4HBGA 4E6PA 1IHXA 2Z1NA 3RROA 4GMFA 3O4RA 4CUZA 4GMGA 4RO0A 4B4WA 3I9OA 3JYPA 4HY3A 2AE2A 1N7HA 3H9EO 4L73A 5ILGA 1Y9EA 2PWZA 4F6CA 3FD8A 4R69A 2PGJA 3N74A 4IGFA 2DBZA 5ADHA 5KNLA 3ETDA 4BKQA 1ZCJA 4DQUA 2PFGA 2QRJA 2VYVD 4R1NA 4EJ0A 1CDOA 2Y93A 4BKUA 1ADGA 4PZCA 4CV0A 2I76A 3TZKA 5F1OA 4J7XA 1QR6A 1A71A 3ZWPA 3CKYA 3PGXA 3PZBA 1NAIA 4IUYA 3CPSA 3ANMA 4W82A 3LDHA 3BXXA 4CMCA 2DAPA 4MKZA 2I65A 1D8AA 3U4HA 4AG3A 3EVNA 4OSPA 4J90A 1GPJA 3DONA 1UXJA 2QRKA 1E1NA 5EJ2A 1K89A 1E77A 3QRWA 3W6ZA 2V65A 4AJEA 3EGOA 1E1KA 2VUTA 4OKIA 2G0TA 3DTTA 4BV8A 4Q39A 3KEOA 1HLDA 3ZV4A 3H5NA 4CLOB 1PJQA 1VC2A 2PTGA 3FNFA 3PWSA 4JJIA 4K9DA 1GV1A 2FR1A 1P1JA 3E03A 3MJSA 3RKRA 1R4MA 2C5EA 2Q4BA 2PGDA 2ZATA 4JP2A 2O7SA 3AI1A 4R54A 5KJ6A 4I5DA 3HWRA 4IDDA 1ENPA 2B0JA 1TVEA 4XR4A 2VWGA 3V1YA 2VHZA 2W2LA 4CV2A 1X1EA 3GGOA 4KWIA 3GGPA 1F12A 1MB4A 3I9LA 1I01A 5CHEA 4GX2A 3I1JA 4PIVA 1GYRA 1ZBQA 3OSUA 3NRCA 2X9NA 1HDOA 3ZNNA 3FF4A 4LRTB 3JQ8A 1I3NA 1O95A 3QVOA 3CZMA 1MFZA 4G5HA 3H8VA 3WX0A 4CQLB 3JQBC 1Z74A 3L6DA 1X0VA 4DL9A 2EKLA 2A9FA 3GY0A 1BXGB 3DBVO 4ND1A 3KSZO 4L0QA 1BW9B 4NDNE 4MP3A 1B2LA 1PS9A 1A9ZA 4CV3A 1VL6A 3TZ6A 3RSHA 5COAA 2HMUA 4NPCA 1HKUA 3FNGA 2DU8A 2GSDA 5JAZA 4YWJA 1P31A 3T4EA 2F00A 4D46A 2OP1A 1HE4A 1UXKA 2GGSA 5BQFA 1KVTA 4DMLA 2ZQYA 4GSKA 4NBUA 2Y99A 5F21A 1ISMA 1Y8QA 4MVJM 4D7AA 1YBMA 4PLYA 4WLEA 1C0KA 3UCXA 3DZHA 4E32A 4N5LA 1LC3A 1ISFA 4OOFA 1EZ4A 2NNLD 2OGUA 1QYVA 2DUUA 1RJWA 4IDEA 2AHRA 3HFGA 1HDRA 4EW6A 2GZ3A 3M2PA 4K6FA 2WSBA 4YCAA 1X7GA 1X0XA 4YT8A 4D3DA 4Q3EA 3D4NA 1V8BA 1GZ4A 1YWGO 3DFUA 3W8FA 4MVJA 5L4NA 3G1UA 3P5SA 2FPIA 4WEQA 5DBFA 4WUVA 4TWRA 4YA6A 4XDYA 4ZQGA 4XYEA 4Q9NA 2E4AA 4D41A 4XQ9A 3QVTA 3T4XA 5DP2A 3SC6A 4BB5A 5DCYA 5A3JA 3AW9A 5L7WA 1Q1NA 2X8LA 4IJWA 5DP1A 1SAYA 5A05A 4KQWA 3JQFC 4EI2A 4ESOA 1WDMA 2VUUA 3I23A 4PLFA 3ZGYA 4NQZA 2VWHA 2Q46A 2VRCD 2GD1O 2EP7A 1TEHA 4CMGA 5GZ6A 4II2A 1W4ZA 4Y9DA 4BNHA 4BNZA 5ICMA 2V6GA 4CUJA 3G3EA 1P1KA 4XYGA 1HXHA 4GX0A 2Q1WA 3GPDG 4CMIB 3C85A 4UVIA 4FFLA 1Q0QA 1LJ8A 3DZKA 2HQ1A 1VPDA 2X0JA 4KTVE 4ZQFA 3I4CA 4U5QA 2WD7A 3DQPA 4J4TA 4MVJF 3ZV3A 4TRNA 4UEOA 5ENVA 1HDGO 4XQGA 3IAHA 4IY1A 5EL0A 2YV1A 3V2GA 3TQHA 2E48A 3BHMA 3E6AA 3P19A 2CVQA 2NV6A 2X4GA 4RORA 2JCVA 1LLDA 2VYND 3BMQA 1PQWA 2X0NA 3KYDB 3L9WA 3UVEA 4IQ0A 1B16A 3S2IA 5AYVA 4B79A 1DAOA 4J1SA 1DPGA 4E5KA 1BTOA 3HNPA 4X54A 2Q2VA 2O3SA 3FR8A 3K31A 1BSVA 1I10A 2P2SA 4JP3A 1XU7A 4GX1A 2Q1UA 1HT0A 1E7YA 4W99A 3JD4A 4UEKA 1Q7BA 5A9TA 1PX0A 2OL4A 1YS4A 4R51A 1EEHA 2FHSA 5LDGA 3JD1A 2D5CA 2RHCA
chains in the Genus database with same CATH superfamily
2QVYX 3BJIC 4V0RA 4IFBA 4OXIA 2HO4A 5TNXA 4O4HA 5GQSA 4ARZB 5I7FA 4OV6B 3EX7C 1EWKA 3HDQA 1NOIA 3R40A 3RS4A 4HDMB 3IQZA 3OLVA 2Q5CA 4CKWA 4DV7B 2AVNA 1NG1A 5CJPA 2RHRA 4IH4A 1G2OA 2I62A 4ARVA 4FDMA 4LFAB 5LC1A 2QT9A 2X0RA 3GNSA 4OLHA 4PS0A 3VPXA 1PI3A 2VPXA 1FMTA 3ZWAA 3UH1A 1JYEA 4J1TC 4FOPA 3TL6A 3UAVA 3KEGA 2QW8A 3OUUA 2PZEA 1LD3A 3ASZA 4X3PA 3REOA 1OF1A 4E2ZA 5JC8A 1RYHA 2QMHA 3BF8A 1SBYA 3IUBA 4YJFA 1ADCA 1ZCBA 4GKBA 3VR4A 4CT5A 2EJWA 8LDHA 5AW3A 1RE1A 2GZRA 2WIDA 4OQDA 3W9YA 3ZCPA 2JI9A 1UBEA 2XAAA 2F17A 3Q8KA 3T3IA 3V8QA 4NMXB 1NR7A 1OXTA 3GEBA 2JGRA 4QFMA 4RM2A 1W35A 3U31A 5HJ5A 5JY1A 4MX8A 1K3UB 4N5IX 4YASA 1VSQA 3E7XA 1P2SA 2H2HA 2OCKA 5IW8A 5IXSA 3EVFA 4P0TA 2PWBA 1EG2A 5IDVA 1PG5A 3UWOA 5IN5A 2CWWA 3ROXA 4NL4H 3VYUB 2G6BA 5AKGA 1SJ9A 2AJBA 5EWMA 2DC1A 3PCTA 3C7DB 5EMKA 3TFWA 3WE7A 3WMRA 3KVRA 3DVSX 4R6WA 2QN2A 5DV9A 2HSZA 2DTEA 2W2PA 3OFND 5CFMA 4BY9E 3EPPA 4R71A 3U5ZB 4HH1A 3G49A 1GLVA 4O4HF 4Q93A 3K4HA 5F33A 1YL5A 3A6DA 3ZX4A 5PGMA 3KYBA 1T34A 2WWGA 4GLFA 1SXJE 4XB2A 2PX5A 3PKIA 1KYZA 1SXIA 4AD8A 4DRXB 4M1EA 3JALB 4NHOA 3E8XA 4V3BA 1J5XA 5CLFA 2VDJA 4LE1A 3TAXA 3VO2A 4KWTA 1ZL2A 4NCHA 4P7JA 1DQZA 3VH3A 1FX1A 3AY3A 1Z6TA 2FZGA 2Y0BA 4RULA 4JGGA 1E60A 4PONA 5C8YA 5BY2A 3RFXA 1O1YA 4MYHA 2QD4A 5DWVA 2GMWA 2HV8A 3NOVA 2BBWA 1ZA2A 1PR0A 1YQTA 4FFMA 5KVQA 1M7BA 1NOJA 1A4UA 2VHJA 4DLRA 1AKTA 2QAGC 2R5WA 1ZN7A 2F8TA 5FBRB 3OLWA 2AF4C 1MRNA 3R5SA 4V0NA 3QGMA 3UEOA 2BC9A 4EAAA 4F7DA 1QBGA 5KS2A 4LHWA 3LRTA 5CXSA 2JGLA 3LC2O 3FLAA 1U90A 3WGYA 3VA7A 1UMKA 3CT6A 4UW9A 1EZZA 4B33A 3I64A 4Z54A 3OPXA 5AOBA 2GCIA 1MQSA 5FPSA 3VVLA 4ZOQI 1SXPA 3RIEA 3ZXSA 1DX9A 3O8CA 1DLIA 3LGXA 2NQ2C 1OLUB 3FF1A 4UE6A 2BMWA 1JUDA 4OXRA 3CRW1 4O3FA 4ZAGA 2JJ2D 2ZREA 3B7WA 1GPAA 4HX9A 5A9SA 3VVMA 1XWIA 4HO1X 4KV9A 1UJ2A 4MV8A 4WXRA 2OSVA 4RCZA 1KYIA 4RS3A 1S8OA 1AU9A 3VJRA 3AZOA 1RTKA 4RSRA 4DCMA 1BQ4A 5CJ2A 3D4PA 2OA0A 1VLVA 3RDPA 4B83A 4AYTA 1N1GA 5CDTA 1EDBA 3HM2A 2Z6QA 4LY0A 1GY8A 2BPOA 4JT9A 1Y8RB 2P65A 3V4ZA 2YWXA 4QGGA 4RVCA 3AP1A 2BEUA 1SOVA 2XUJA 3GRUA 3WWCA 4R3NA 1OAAA 2DX7A 4OX9Y 3T3OA 4HCJA 2FOIA 3LQRA 1W59A 4HDQB 5DGIA 1K5HA 3EWIA 4CEJA 2J6HA 1KIMA 2HHCA 1AQLA 2W2VA 5D3MA 1TJ3A 5AKEA 4DABA 2J0VA 4RLQA 3W4KA 1E3EA 2H2GA 4BLWA 1IWBB 5IU6A 2BKUA 1XDSA 4M8NE 2A1UB 1ESZA 3RUDA 5AKZA 4PANA 3ZZTA 2IZ7A 4XASA 1AMNA 5C3UA 2F43A 3DE6X 4N18A 1OI4A 1PYDA 3L3BA 1Z88A 1PJZA 3X1XA 3NHYA 2VBGA 2HLHA 3FSGA 3OIWA 3VZDA 4DNQA 3E3LA 3MJDA 4KOAA 5FBLB 5BVGB 5KTKA 2XRFA 1KSGA 5DT2A 3TB6A 4BMVA 4QBHA 4KRFA 3QPVA 4DYDA 2G4LA 3ZE7A 1D4FA 4UEWA 1CUAA 1WE2A 4AO6A 1KEWA 1EDOA 5TV2A 4IILA 1XTKA 2CYAA 3WAGA 5JAOA 1R6AA 5AHXA 2GK6A 2BGJA 1TAHA 4ACBA 1EUZA 1MOSA 5JISA 4GVLA 3HKCB 3A9SA 1GVNB 3TE6A 1SKYB 2A5LA 4X1YB 4YQYA 2CFIA 2XGMA 5CNJA 2RC6A 1XCPA 1BCRA 2B6NA 1EP3B 1JSCA 2QMUA 4FR0A 4G9BA 1DKQA 4ZMRA 1C30B 3LOQA 4JCOA 1ZNYA 2P40A 4GZ5A 4JR0A 4RTPA 1KKMA 1U1DA 1UUFA 2O52A 4G37A 4M49A 4X6YA 1UZUA 5D6OA 3HJBA 3W06A 4J0JA 3TQOA 4FCTA 1MA0A 3QG1A 1H1TA 2WC1A 4JGBA 2J5KA 3G9ZA 2LPMA 3NDBB 2PZAA 1VI6A 2H7XA 2XV1A 1UBGA 2ZBPA 1ZM3A 4N0QA 2X1HA 3W04A 2A58A 2BMVA 3OFSA 1XZCA 5K6AC 1QGUA 4HB2A 2B21A 2EJTA 1AGPA 4QA9A 4Z1MA 1FXUA 4NDAA 3RVJA 4B3MB 2QENA 1ZUNA 4PZUA 2MWMA 3RUCA 1JLKA 1Z5OA 2B1QA 3ICWA 1RYNA 3GNLA 1ZONA 3B48A 4GRDA 5EIHA 1DMRA 5AVKA 5I9IA 2WP8J 1G5RA 1C7EA 3EC1A 4BNNA 4C6HA 1E96A 4UOZA 4A8TA 2W93A 1CUIA 1DU4A 1G21E 3DFKA 2WVJA 3QG5A 4Y6SA 2JLZA 3D4LA 1BXRA 3E7PA 5CLLA 4DT1B 3L82B 2VDKB 4WK2B 2OOSA 3EPRA 3KYJB 2H3HA 3H86A 2GAFA 3RASA 1YASA 1Y6RA 1KH1A 3EPKA 1B8NA 2WSSD 2K4MA 5G40A 3COPA 3OPMA 4MYRA 1V71A 2FFRA 2QRNA 4Z51A 3ID6C 4QUJA 4X7MA 1C3OA 1SOAA 3IJEB 5NLLA 3W8EA 4ETIA 1SXJC 2KLBA 4ZGBA 2ZUEA 3R7WA 1V8PA 2WR8A 2C4MA 4HDNA 4TPKA 2J09A 5ALJA 2E5FA 1ZX1A 3C5CA 3DAYA 3EH1A 2Q5QA 3FNIA 3O8RA 4IH9A 2E5LB 3PDHA 5ANRB 1TCVA 2X1MA 5I4CA 1ZUD1 2B8WA 2GCGA 3ZVLA 4NAHA 4HWKA 2AW5A 3PPWA 5I5EA 3ASYA 2BFNA 3N75A 5C8VA 1GAEO 3DDSA 2PLFA 4JWTA 5ALQA 1OBVA 2G25A 1TI7A 3QELA 3WZ2A 3T61A 2GAAA 4CNBA 3H83A 5C7OO 2CXSA 1QYDA 3HCNA 4PLTA 1E2MA 3SLKA 4M1QA 4I81A 4QOFA 4LFBB 5U9CA 5AJTA 2ZFUA 3QVMA 4ASUD 4W7SA 2NTJA 2FZLA 3AXSA 3LBFA 2VPPA 1K75A 2PRYA 3OU6A 1Q12A 2VP9A 3OCJA 4RA9B 5EY5B 5A4FS 3WRYC 3EA0A 3EULA 3ETGA 1EA5A 1FDOA 3QU7A 5AJWA 2WKPA 4ENWA 4IIFA 1FDIA 1UT6A 1TT5A 4PNPA 1DJPA 1N9GB 4P36A 4BEJA 3KKKA 4WHMA 1IXYA 4TV8A 5T3UA 3Q7SA 3L8CA 3TQCA 3DKIA 2VLBA 4QJ4A 4I1PA 3D1LA 3OLCX 1E9VA 1QCZA 3C14C 2C0CA 5JY6A 2QR5A 4CL0A 4MCAA 5ADVA 1UF9A 1O8BA 3UJ9A 3KOMA 1XN1A 1UBLS 1VI5A 4L08A 3V4SA 4TX1A 2D1TA 4RMHA 4CCYA 1CUHA 3KQSA 4MI9A 3LGAA 4LKOA 2B8NA 2FXIA 2RFLA 3L0BA 3RS7A 3BE6A 4AUMA 3IEIA 2WIGA 1CY4A 3SEFA 3KCNA 4QULA 3ZQ4A 3CLHA 1XRQA 3QKSB 2HFJA 3VU9B 4CKWB 1NBMA 3PE4A 4PTYA 4NCKA 4OAPA 5KAPA 2GFQA 1DEXA 3IIKA 5I7EA 4PLZA 5KHAA 4KR2A 1Z15A 3T8YA 4MV9A 4DR3B 3OKAA 4KTTE 1T9DA 3PD1A 3ABZA 3K92A 1KYYA 1YZYA 4YJFB 2C2GA 4QD3A 1U0SY 1JEAA 1GCGA 3FYDA 4TRJA 1Q14A 5JH7A 5LQAA 1JDBB 1TLFA 1U7UA 3TDKA 2H6EA 1KTIA 4EUSA 3QUAA 3ESXA 3FHLA 4TV8F 2PLNA 4L4ZA 3BWMA 5D85A 1ZSYA 1Z6QA 4PY2A 1U3TA 3KU1A 3B51X 3QF4A 3F6EX 3U4IA 3U7EB 4UUBA 5HKOA 1EIZA 1Y3FE 1ZJYA 2GESA 2IY9A 2WM3A 4TN5A 4ZHQA 1JJFA 3JQFA 1GUAA 4YHBA 1KDPA 2PT6A 3PC4A 1DFIA 3HRKA 3NJ8A 1LQTA 5IF9A 1VMDA 1BE0A 1UKCA 4RANA 4WFKA 4Z0NA 1V35A 2Y68A 1N1EA 3FIUA 3FZYA 3GT7A 4UD6A 4ZIRA 2YW9A 3K6JA 1JPVA 1MAWA 1F4VA 5EKXA 2CHUA 4DNFA 2JS7A 2QTRA 3NHPA 4WRRA 3TBKA 2IZZA 3EYWA 5A3SA 3D6JA 3H8WA 1QYXA 3UKDA 3LC7O 1QS0A 2Q3DA 3FHOA 3HXKA 3I42A 1LS1A 1SU4A 3SZMA 1SC4A 2ZTMA 2HDWA 3FE2A 4KDFA 2PJRA 4BFWA 5LWQA 1C29B 4EG6A 3CBQA 4AJPA 2P1RA 5J58A 1M5UA 1QHFA 3FTDA 4HQRA 3F78A 4P0QB 4J7UA 5EIXA 1S8NA 4I4CA 1VBNA 3LBYA 1ZITA 2ZI3A 1A5SB 2Q1XA 2P0EA 3CZ4A 3UMCA 1TZJA 5C8YB 1TLTA 2W37A 3TCXB 5LFAA 4M53A 2ZB7A 3F5QA 3ZDRA 1R50A 2HDHA 3GFTA 2GLXA 3I1IA 2Q9BA 4JVSB 3EASA 1OAOC 4RIFA 5DF1A 5E9JA 3SYMA 3TZHA 3CVXA 3N2EA 5DNYB 2VDLB 2B98A 3PGA1 5AVSA 4NCAA 2EIXA 2JVKA 1KOGA 4C3UA 5A1JA 3QE3A 4YAWA 2PA0A 2V0GA 3V8PA 2QRPA 3ABSB 4GZLA 5HOEA 3DEZA 4GVPA 4H08A 3SF0A 4QZVA 3C3AA 3IUSA 2O2IA 5AHWA 5CB0A 1PNQA 1RRPA 1SVSA 1ZJ5A 3P4YA 3ZU2A 3K9LA 4RVUA 2Y2UA 4HAOA 4LYGA 2IGTA 3SHFA 4AMZA 5CA0A 2B61A 2QJWA 3AP3A 2GN1A 4I9UA 3ZNQA 5C8XA 5FX2A 2QVZX 4I1IA 4DV0B 3TJRA 1BMTA 3TL2A 4CEHA 4KXWA 1IXKA 1ZBDA 2CJYA 4B7ZA 2HMVA 4C7VA 5A9SB 5H3CA 1VE9A 1TAGA 4G25A 2NTNA 3JZMA 2YQ5A 1QOPB 4OQFA 3ILVA 3S28A 1E2GA 1XTUA 3G8BA 1JNXX 1E2LA 2RGNC 2DVMA 4K3UA 5CX1B 4ZAXA 5FCDA 5J9FA 4CDMA 1NWCA 3ZN2A 4AVYA 3V55A 1ZRHA 4JBXA 3WB9A 3H17A 1FUUA 3BIFA 1M1ZA 2BEUB 3CH7A 4J1TA 3FMIA 3IKVA 5I9BA 2QRZA 1EE9A 1HM5A 5A03A 5HRUA 1EJ6A 3RFTA 2JCYA 4IEIA 4CMEC 5HWSA 1F2DA 4YR9A 1IEQA 2Y6VA 1OD6A 4MINA 1P1IA 1Q44A 1YNSA 5B58T 5BRNA 1ZY2A 3FWKA 2QAJA 5TX7A 4I1RA 1CXZA 4G09A 3CW8X 1ZH8A 4ZVTA 2IDJA 2RH4A 2F43B 3FUVA 1KBOA 1O57A 2J9GA 1KJ9A 2HMWA 1D6MA 4YCDA 1FB5A 1H9AA 4OBWA 4CJXA 5DNUA 1J07A 1VPTA 1K06A 1PK7A 5FDFA 1UOQA 4G65A 3F6YA 4R1UA 5DWQA 4BLSA 4QG7A 5IKMA 4XR9A 2D1SA 4LV5B 1PJ4A 5HCUA 1X3SA 3B6JA 4FJ1A 3WDMA 4AN0A 3E9DA 1O97C 3DTYA 1JJVA 1J56A 2W58A 3AJ9A 3LCJA 5CIYA 4YH1A 3HU2A 2VKQA 2Y1OA 1BKYA 3K6RA 4N6NA 2IA5A 1AHNA 4CG0A 4D4GA 2PQMA 4C5BA 3AO0B 4UVEA 2X8AA 2ODEA 2XRYA 1A7AA 2LRHA 3PF9A 3RYHA 2Y9PB 3MJCA 3DBLA 4ITVA 2E4YA 1X7XB 2QRLA 3IP9A 5HM8A 1ZGHA 1MVNA 3AUYA 3DB1A 1I4WA 3H5WA 2PSSA 2UKDA 3V8MA 2XQGA 2XVMA 3WLIA 1BCRB 5K8IA 2PX2A 4CZ2A 3PFKA 2FMXA 4YRSA 1OFUX 1O4VA 3VZCA 3R3VA 4J1NA 4GGPA 3PNKA 1NJSA 1Q1GA 2Y1KA 1MW9X 4JBLA 1U3DA 3IV9A 4DPLA 5MDHA 1E7SA 4E33A 4MWSA 2QAGA 4W5RA 5IVKA 1J0XO 1OZGA 1SCAA 4CHGA 4BPBA 1NQOA 3A8TA 3DZBA 3HNOA 5HIAA 1V5WA 4IVRA 3IOBA 3N2IA 3ZD8A 4F12A 3QVUA 4FSHA 4RK0A 5D84A 1E5VA 3PT5A 1HG0A 1JJAA 2A9QA 1C8BA 2Y4OA 2ZBUA 3C2QA 4TN1A 2VAPA 5KDDA 1ODKA 2BCJQ 2IUUA 3TD2A 4B3RB 1FNBA 1IOWA 1QIJA 4HD8A 1L7EA 2ZU0C 5F9MA 2JGJA 2Q3HA 2ZQ5A 5JADA 5F35A 1L5QA 1QRUA 1JLLA 5A4JA 3N8IA 4H27A 5JSUA 2XJ4A 3KLOA 1YC2A 2ZSBA 3FPAA 4P58A 4DKJA 1ZOOA 2CV1A 4F1KA 2HK9A 2NVBA 3AR8A 3H16A 1IY1A 2WYUA 1Z7BA 3HY6A 2R97A 4HF7A 5BR1A 3NFYA 2AFIB 1RRFA 3KNZA 3TNJA 1BXRB 2ZE8A 4O08A 1AF7A 2FPPB 4MWGA 4N3AA 1KE2A 4RFVA 4AROA 1W9MA 4HNQA 5BSVA 3DV0A 5D8DA 1BU5A 4B45A 3ETCA 2A9VA 2VJBA 4NJEA 3RABA 1C3OB 2J5RA 4LV6A 3WIVA 1R10A 3ZYCA 3K70D 2ZBRA 1OBOA 2GR9A 3R7WB 1HDIA 1Z25A 2QZPA 3SY8A 4ENQA 2ONYA 3F74A 4RLFA 3AR4A 4DJTA 3IR5A 3Q9NA 1DTWA 3BH0A 2HCJB 2YWJA 4F1JA 2MYPA 2BKEA 1A3CA 1PZHA 4FSDA 5EUBA 1J1ZA 3W5HA 2H52A 3R24A 4TYMA 3AUUA 3PUYA 4J03A 5AXCA 3NGXA 2J7KA 3MWFA 1E98A 3HJUA 4L7QA 3EE6A 3WHPA 5E1OA 4FFRA 3P94A 1QE3A 4YXWA 3TGLA 4OFXA 3OLZA 2IHVA 2FSHA 1RQLA 3EAGA 1CY6A 3JTMA 3KZMA 1E32A 4L22A 1AGYA 1I9CA 2PUHA 4AW9A 1QTIA 2FN4A 1M7HA 3LUCA 3U17A 4XWKA 4ZVUA 3SICE 2C8KA 3PWKA 4G81A 3W2EA 1CKEA 3CUUA 3A3PA 2V3WA 5B5SA 3DLCA 1UXOA 5J1SB 2MMGA 1ESEA 4Q7JB 4PC3A 4J75A 4U2KA 3C1AA 1OC2A 3HDHA 1G8MA 2FSIA 4Q4JB 1E6LA 1SRRA 2WTXA 1N5LA 5AJXA 3UICA 1C4XA 5TQ2A 3UMJA 4YJDA 1YJ5A 1QF7A 3QHPA 3R0QA 2QG6A 1UM9A 3TIFA 4DIDA 2X7HA 4XGNA 2W11A 3LNTA 4ZJYA 1YCHA 3AJAA 3O75A 3PRHA 4FI3C 2C5BA 3F1LA 4RY2A 1M6WA 3MMNA 3LUKA 2I67A 1VL0A 1SHJA 2AZXA 1BGWA 3DWGA 3NCTA 3B6MA 4LZLA 4RY8A 2I1LA 1WSBA 1IY9A 1ZIOA 2O0JA 2DKOA 4OQQA 3ZZNA 1KA9H 1R8QA 3CJQA 4X94A 1ISSA 1JJIA 1HE8B 3L0PA 2PTHA 3O03A 4ME6A 4YLGA 3RANA 4CM8A 5K6AA 4BWVA 2Q0HA 1TEZA 1EM6A 3CW2A 3RBXA 3AF1A 2J9YB 4BEVA 2JHFA 4ZVVA 2ROQA 2B9VA 1TXGA 2J7PA 4CKEA 3A1VA 3SK0A 4RENA 3WSTA 3A3KA 4NWIA 3ABOB 3RG2A 1ECJA 2NMVA 3BHNA 4CQNA 2J5BA 1QF6A 1C9EA 3LHIA 1SD2A 3AFOA 1K8YB 2P9EA 4GZ6A 1THTA 4N82A 2ZRGA 3BMNB 4PG4A 1RVDA 2GUGA 2Q28A 3K35A 1XDZA 2DFVA 4TLAA 4FYIA 1NLUA 1SRQA 2RJ3A 2YWRA 3LFUA 5IDWA 2D1QA 3FHCB 3IPLA 4ZQCB 5JH7B 1YOVA 3OHSX 5KOIA 5MFPA 4KGXA 1VPVA 2XE4A 1GYPA 3FZQA 5F1YA 1UPFA 3Q3VA 5CCXA 3VNVA 3W0LB 3KHKA 5BPHA 1K9SA 2QN6A 3DJFA 3QF4B 2CE2X 3K9WA 4TLLB 4F4IA 3E05A 2PXCA 1SXJA 3MBKA 4OQMA 4ZHQB 5IZ4A 1EDEA 3I83A 1TZ2A 1M34A 3QNMA 3PQ2A 4WXHA 1G9SA 2W71A 1NL3A 1U98A 3NP7A 5F5NA 5THKA 3SSMA 2CUTA 2WVHA 3VJLA 1E3DA 2R96A 3IAUA 3L7IA 1F8YA 5I4IA 4ZIRB 2HWXA 2TMGA 3BTUA 4M6WA 4O4IA 5DNEA 2O8EB 1M8GA 1QFSA 2C5SA 1W75A 2NU7A 4ZVSA 4NYIQ 4HG2A 4DRYA 2OCYC 2ZWIA 3GVCA 2ZK7A 5E2IA 4TSKA 1T9HA 2QSUA 2BSAA 1FMCA 4G0YA 5TPWA 1GFSA 3AR7A 1ULSA 3LYHA 4LQCA 5HMMA 1DFHA 4AB1A 1A5ZA 2HMAA 1UMCB 2YJ6A 2OV3A 3CPHA 1HWYA 2EG5A 4CM9A 3PJRA 5KQRA 3IB3A 4RETA 1NMYA 4TOIA 3PVZA 4YDQA 2FGKA 3K5PA 4G89A 4AY4A 4C7OB 3ZQJA 4QRHA 4LMRA 3WRYA 3M4YA 4YO8A 5CFLA 1AKMA 3FOCA 3G6KA 4QO7A 3LPLA 2EOAA 4BTLA 2IHZA 3GUYA 1H9BA 3TVYA 5EYPA 4QNNA 1I7LA 4DMHA 2JBWA 4HTAA 2P1DA 2Q5JA 3ECSA 1G1AA 3FOZA 5DBHX 1FLVA 4KFTA 2ZTLA 3ONVA 1F8FA 1RP7A 4DM7A 1FMFA 3HACA 2YRWA 1RYEA 3GD5A 1UKYA 4GE3A 4N01A 3UKOA 4ARCA 2BJVA 2R5NA 3C24A 2AC2A 1G5FA 2FA9A 2YIDA 1XN4A 3AKZA 3F4KA 1BGXT 3SC2B 4FMBB 4WBXC 3GVPA 4LXIA 5DBGA 1QZ3A 3TOCA 4O4IF 5CA0B 2E6UX 3DP9A 4G4IA 5FBVB 5T4EA 4N5HX 4BVBA 4B7CA 1Z4MA 4CEHB 1GU1A 2CZQA 1I14A 1WA5A 4R2XA 2DKFA 3GJ3A 4AJJA 4G1FA 1GSHA 3D2AA 5K9ZA 4NZYA 1A7KA 3S1SA 3SKYA 4DV1B 5BSMA 3UB3A 3O6VA 1IBMB 3BM5A 2JEOA 1I2AA 3NJ4A 2FI1A 4OH1A 4ZGGA 2C2KA 4XJXA 2DHEA 5J63A 1T43A 2YN2A 1NNLA 4DLWA 1GTG1 1XZLA 1UKEA 2C4WA 2PS0A 1TUIA 2P9FA 1JZTA 4ZFNA 5KNDD 4Y2QA 2ERCA 4A0HA 3VKUA 2G1PA 4Q4CA 1XK6A 4YMWA 4MP6A 1YVEI 2QLMA 4P8RA 1P4RA 4DDHA 1TJPB 2FR0A 2R3SA 4CL8A 1XF1A 4LWQA 1E3TA 4RPKA 3ZHZA 4D8WA 5FTLA 3N5CA 3SQLA 3HHPA 5KUTA 1W93A 3ZCRA 5CM8B 1Q91A 5FTNA 5HK9A 1U9IC 4KUGA 5HGJA 5JAPA 2V6FA 3R75A 3F8SA 1HDCA 3B6IA 3D1JA 3DNPA 2WG1A 1FLDA 1L3BA 3H1FA 4WZZA 5EE1A 2BHSA 1RE0A 3UT5A 1DRJA 4A8PA 3QBTA 3BE4A 3IV7A 2NZUG 3SP1A 3TSYA 2NT4A 3UY4A 5IANA 2WB2A 3QHQA 3QM1A 4ZI5A 4E5SA 1CCWA 1FRQA 3M1YA 4MVJD 3LDGA 4ZT6A 2MYTA 2AR9A 5TMPA 3K4PA 1HLPA 2VO1A 2II6A 2ZBQA 2UVPB 2ZBGA 3AY7A 2YZNA 3LWBA 4MAMA 5A4IS 5HPYB 4ZT7A 2FPKA 3S99A 2PNFA 3AG5A 3MGBA 4MYUA 3VNSA 1IHYA 4GX5A 3U3XA 5FBWB 3WKEA 4EYQA 1LA2A 3EXG1 2AMFA 4XB6B 3RYHB 4FYYA 1YDMA 2RH5A 3B8EA 3IILA 3ROEA 3J80A 1P3Y1 1VLJA 3I8OA 1M8FA 2OC9A 1J20A 3KCQA 1T5OA 3OQNA 4AQ7A 1BU8A 2WFLA 3QKWA 4Q3BA 1ULBA 2FZEA 3QLUC 5EIBC 2WSYB 1FMJA 3RRFA 2GN8A 1T6YA 5DYGA 4MQUA 4XIGS 5EUQB 3DEHA 4ZHQF 1MKYA 4R0NA 2OILA 3IUYA 2BFWA 1QUEA 2JIZA 3PEUA 1ZMRA 5DOVA 3OOEA 4OIMA 1IAVA 1OAOA 4RGQA 2ILTA 3C97A 4U7WA 3GZTB 2EW2A 2ZJ3A 3OY2A 1TQ6A 3L5KA 2G1AA 4Q3CA 3DTVA 2GNOA 3FCOA 4N3CA 4WECA 5DU2A 4LJ8A 3NV9A 4BIMA 1HT1E 1G21A 3B53X 3C74A 2EKBA 2QY9A 5D1NA 1NF3A 2BFPA 1S3IA 4C87A 3NOXA 4D4HA 3A6JA 2REOA 4YCBA 2AB0A 5AI6A 3OE5A 1JLLB 3FMPB 2VJLA 3LHKA 5JS7A 1E2FA 2DPHA 3SJBA 2Q1TA 2ZUCA 4ND8A 4DRZA 5JUWA 4RKEA 2VZ9A 3RSLA 3QE0A 3HPRA 4NBVA 5EVCA 3IAEA 2GZ2A 1RBYA 1ZW6A 3F5FA 1OGIA 3HKEA 3KQPA 1Z2PX 2ANCA 2LVBA 1MNQA 1ZESA 1R0RE 5CEEA 2PVPA 1WCXA 1JH8A 4LDAA 5DOZA 1VJDA 5E6RA 3V4VB 4DJDC 5KTMA 2VJOA 2IYLD 3BCUA 1ESMA 1P2BA 4TGLA 5H16A 3DV0B 4JJ8A 1DAGA 3IELA 4GPIB 1AKYA 1QYCA 5JNTA 4NJEB 5BW5A 5IDQA 2I3ZA 2I2WA 1YVPA 1LBEA 4DEVA 4RIHA 2YWCA 1MR3F 1NOKA 3W2IA 3A1FA 1RZVA 3F3MA 4XWOA 3VNUA 4CMEA 3EGVA 3SZLA 3H5TA 1PL0A 4CL2A 2YXLA 1JIKA 1J8DA 2H16A 2ZM5A 1DTWB 2C54A 4BBJA 5BT9A 4DA6A 1XTZA 5JVDF 4FKZA 3DO5A 1FF9A 4WACA 1MW8X 2PGXA 3STHA 3WHIA 3WK9A 4EJFA 1SKAA 2OGSA 2NNWB 2CXRA 3HN6A 4PG8A 4MUJA 3NUQA 3ZCXA 1N6HA 1R1DA 1AXRA 2FUG1 2MTBA 2YV3A 3INNA 4LJ4A 5F3DA 4ZMBA 1U2DC 2HRDA 4ZN6A 3KIPA 1EE2A 1JR2A 3HA2A 4Q3NA 2FPIB 3ZTWA 4EO7A 4U8GA 1OTYA 5AKYA 3TRKA 2OZEA 2OYRA 1RAAA 4KPFC 5E1MA 3S3TA 4JH0A 3CBGA 1EFPA 3Q9UA 2PSHA 5I8PA 2RGAA 3KHSA 4ZDJA 4TTJA 2JI6A 3EN0A 2DUNA 1I4EB 3AHFA 3FRJA 3PYMA 2CXUA 2BUBA 1MB0A 2P27A 2R11A 3NANA 3ZI7A 1PQPA 4YJHA 4EYKA 1U94A 4UFNA 4NFYA 1V26A 2A8YA 4FHFA 3EMDA 3NIBA 4TLDA 3DE2X 3GQBA 1SA0A 1E0SA 1H2ZA 1JR3A 5TQ2B 1G55A 5A1TA 5C5EA 2ZIEA 5FLEX 1EK2A 1KQ3A 3IBSA 4MMZB 5AIAA 3VZSA 1KORA 3WLNA 3CNBA 3ORYA 3PUKA 3DYIA 2OXEA 4V2UA 2NZWA 3G7UA 1FZQA 3TKLA 3WIBA 4JUCA 1O6CA 3FCEA 2D62A 3ZZUA 1PFKA 3D6AA 3V80A 3JQ6A 4N49A 4OXQA 4LF9B 4X1IA 4XFKA 3VX4A 2XBLA 5AJYA 4AKGA 4G0NA 2XCSB 5CDFA 5I9SA 5FOTA 3ESAA 3KL2A 3UXEA 4F3YA 3DT6A 4N65A 5CW1A 3D4IA 3ENWA 3U7QA 2BHLA 4D0LB 3PP8A 4LWOA 2JCGA 3QUCA 2HSGA 5JCJD 4ARBA 2QD3A 3RV3A 5E4YA 1TO6A 5AD1A 4D45A 2MT9A 1WXQA 5T8KC 1HH4A 2X0KA 3X43A 3O90A 2LXNA 1U7XA 2QEQA 3GMTA 3RSFA 1XDDA 2DWOA 2ATEA 3R5JA 1KOLA 4DGSA 1CYDA 3EUFA 3WO1A 3W6OA 3L6EA 4QDJA 1C9JA 1CNFA 2UZ1A 2Q6IA 4B1FA 1ODCA 4KN8A 3Q8MA 3E9ZA 4DLZA 2C7VA 2A88A 2CJPA 2Z2XA 1JIQA 3C45A 3VJMA 4LC1A 1BX1A 3Q0IA 4NYIR 1ADFA 2OHFA 1YOVB 3V5NA 4X95A 1E3SA 4AO7A 4UARA 4EB8A 3KG2A 5JATA 1L5YA 4L28A 5BQOA 3VU1A 4DZZA 4PCLA 1G19A 2HN9A 3KSRA 3UK0A 5CIWA 1M34B 3QV1A 4XLLA 4L5AA 1LXCA 2ORED 1CUFA 1XAHA 2C9YA 4U7JA 3R7DA 3UJDA 5I8WA 5KWVA 1TAUA 5CLHA 2B34A 2R44A 3LQYA 2BTOA 4FBMA 3IHTA 4M6WB 3BWYA 4LSGA 5HNKA 2D2IA 4NCNA 2CLEB 5ICSA 3OG9A 4Z4FA 1U0BB 2NU7B 2PRZA 1JA1A 1PV1A 2RSLA 3ZJVA 4TS4A 4D8VA 3RRNA 4TL9A 4C05A 2GPTA 2A86A 1W4CA 3QFCA 3BVPA 5D2CA 4Y98A 3S27A 2ZULA 1N6PA 2MSEB 1HETA 2RK4A 4NG5A 2VJNA 3RW9A 3T38A 3TRIA 3GDGA 4Y9TA 2WWRA 4GKJB 3Q11A 1GKIA 1GNLA 5ES4B 3EEFA 2BGIA 3G0OA 2ZUFA 1ZAYA 3L6RA 4RQAA 5DBOA 5LMZA 2FWMX 1FUKA 2CNWD 5BYKA 4R0VA 2P2NA 4FFNA 5A4KA 1YH3A 2X2PA 3BE5A 5EYPB 1LDGA 2B8EA 4NICA 3IVCA 1FP1D 3N86A 3B12A 4IINA 2R87A 2IHBA 2YINC 3CA8A 5EP1A 1GG9A 2G4CA 2XT0A 3ADOA 1BZYA 3ADPA 3OQJA 2WLTA 1GEEA 1GL7A 3P0IA 4N6OA 2GKOA 3RYIA 3LSTA 3B8HA 3ZCVA 4DWJA 3GCGA 3GRYA 4EW1A 1GZ6A 2GCEA 1M1YE 1VE1A 2WJYA 3I2IA 3BZUA 3EA4A 3AF4A 3INYA 3TZBA 5IKPA 1VXOA 3R7AA 1KI3A 1RLJA 1PLKA 2BVNA 2OCDA 4ZI3A 5IWAB 1CVRA 5SY9A 2EC5A 3HUDA 1JYSA 2O4UX 3WKBA 3THYA 4E15A 3ND5A 5D00A 3OOWA 1U8XX 4S3MA 3VR5A 1N5KA 4QEKA 3B1WA 4FONA 2JAXA 2P9CA 2QUAA 3H2HA 3ZHBA 1WVGA 5SY6A 2PZMA 4OMUA 1R00A 4YUZA 2X9VA 3RS5A 4ONEA 4DHEA 5CB6A 4MKXA 4DDKA 2GWHA 3HB4X 2OORA 3AIIA 1PR1A 1B0PA 5CFQA 2I3BA 3DLBA 3FR7A 2AV6A 3SZUA 3VR3D 1D09A 2CL5A 2QUIA 1LB1B 4KLAA 3KB6A 2EJBA 5TVKA 3DZCA 5A4DA 5ITZA 1GIAA 4XCVA 4CRWB 2QU8A 1VQ1A 1KO4A 1UXIA 2I4MA 4RSGA 2AMYA 2KSQA 3EGXA 5UKDA 1SUBA 1LVUA 2VPTA 1Y4SA 3FTFA 2GEVA 2WHQA 4A6XA 1IIBA 1V7ZA 2VPZA 3Q12A 1YB2A 3DFIA 4QT0A 5SV2A 1IPFA 5GIOE 3HVRA 1CZKA 4Z4CA 2B1GA 3CS3A 3MT9A 3OZWA 1K3FA 2ZT6A 5K05A 5ALSA 2ZWMA 3CZ9A 2VXYA 3KSDO 3KLMX 1E4VA 2OQVA 2ZJZA 2EJUA 2Q07A 4FI3F 4C0XA 1LLCA 5AVUA 3KT3A 1QZZA 2BFOA 3F9CA 3GWGA 2OO5C 2XYQA 1O77A 3OAAA 1OXUA 1N0VC 2WTEA 3IOMA 2ZIXA 1V6CA 1IJFA 1ISRA 1DB3A 4O0LA 3KHUA 1YZGA 5CT8A 5EQJB 4BOYA 2DPYA 3ZI0A 4GPBA 3ZXIA 1I24A 2J0SA 5EEGA 3GELA 4H77A 3ZR4B 4BLPA 1U81A 4LF4B 2C9MA 4K6KA 1EUCA 4CXMA 4DV4B 1SULA 3G2IA 4RJLA 4D8XA 5CDGA 5LR6A 3HCWA 2WSMA 1SIOA 1E6EA 3FUXA 4DUZB 2C58A 4FM9A 2NM0A 2D54A 4N5DA 3WTCA 2BELA 4UMEA 4O2AF 3A04A 2HA5A 4HPXB 4JBYA 4XUEA 1V41E 3V1UA 1LUAA 1VJ5A 1WMFA 3AKYA 4OSEA 1W2GA 1HE2A 4J49A 2C07A 1QZXA 2CN1A 1T10A 4BO4A 2XRZA 2WE8A 3JZAA 4G5GA 1AKUA 1PE0A 2VYNA 4DCVA 1UAYA 2IYYA 1OXBB 3DG9A 4XWYA 3TTSA 2OHHA 3DTVB 5EKDA 2BGNA 1PT6A 4N0PA 1NJ5A 2XB6A 1LQ2A 4XCQA 1XMOB 3IOEA 4OXNA 1PAUA 2W4MA 4GPTA 1LRLA 2R1TB 1PFVA 3ZE2B 1E3JA 4KAFA 3OF3A 4WVFA 4DR4B 1VTKA 4FBLA 3D7RA 3HG7A 2JGFA 1JHOA 2B30A 4PR0A 3UK7A 4CDNA 4DZTA 1WV0A 3QENA 1DBWA 2D1RA 3E7DA 3JSXA 1ZI9A 4DNPA 1J0CA 4PC1A 4ND8B 2CLLB 2QN9A 2Q7XA 1XQ1A 3E9NA 1AA9A 1R27A 2YRXA 1D4OA 4LDRA 2ZYGA 4XARA 3OQMA 3I61A 1ZEJA 1H0HA 4PZYA 1AZTA 1SY7A 2OSBA 4BNKA 3SX2A 1DFGA 2O4CA 2Z9CA 1PJAA 2X23A 3QKRA 2CNBA 3AOEC 3DDZX 5DZSA 3ZCUA 1Z4LA 3BIOA 1TYDE 4KAXA 4KX3A 3V6MA 4RK7A 2ZUTA 1AXGA 5K8JB 3UFBA 3SS7X 4B7XA 3KVYA 1Z22A 4BO5A 1S2GA 4RHYA 2NSLA 1A9YA 2IYQA 2ZRCA 2L2QA 1Z0ZA 1GYQA 3NONA 4IICA 1N2XA 5BN3A 5L4LA 4QDKA 2C9BA 4W7IA 1MGPA 2R00C 2GKGA 2J1LA 3JZDA 1F1JA 3S70A 5AUPB 3THXA 5F9FA 2RB4A 4LBWA 2GO1A 1U9IA 1J90A 1HY3A 1XSEA 2F90A 5GAJA 5HQ3B 4MW2A 1A0OA 5L6MB 2CNKA 2VJQA 1XWFA 3GRVA 4N0EA 4ZC8A 4S0XA 3KQTA 4P4LA 3TLXA 3FGZA 3OCZA 1UBFA 4FQ7A 4MA5A 1ZNWA 1I2CA 2X42A 1W2WB 1CTQA 4TXMA 2Y0EA 2RCNA 3DWEX 3LUDA 4HNAA 3IRUA 1VFPA 3HTXA 5LDHA 2R47A 4NH0A 1KVRA 4OU5A 2WV7A 1EFPB 3ENVA 4AKSA 4R2WA 1COWD 4TV9A 3TG2A 3CWCA 3R7FA 2I6XA 2JATA 4ZEMA 2P2CA 2R7KA 2ZI7A 3EZFA 1CBUA 5IVDA 3FBGA 1IWOA 4YJHB 3X1YA 3ZBTA 4YYZA 5GIPE 1ODSA 2W4IA 3LXXA 4M0FA 3ZH9B 4G0UA 2TECE 3GQBB 1SA0B 5AI5A 4D8TA 3BDIA 3QLUA 1HX7A 3WL4A 4I8XA 4OXXA 3ZVRA 3LWDA 4FMDF 1WNTA 2QX6A 1P77A 2WLSA 3IJPA 4ILEA 3TSWA 2IFTA 3WV4A 4D4KA 2RE8A 1P2UA 2G5CA 4C6TB 4P83A 4QX6A 3K5WA 3CR7A 5E9QA 3GIWA 2FPWA 3B3FA 4TYQA 1JI3A 3VYTB 3WLFA 2FG6C 2NG1A 3K8OE 4J29A 4OMDA 4X1IB 2HMSA 1UBNA 4F0JA 1TECE 4HAUA 4IO0A 1JIVA 2QTZA 5EQDA 3U7IA 3W5AA 3MTIA 4P3NA 3HJCA 2PIAA 5DM4A 1GOTA 4K3VA 3W1WA 1QANA 2Q6TA 2CYBA 1QCCA 3RHTA 3H9JA 3LH5A 3MTQA 3DLHA 2O3JA 1OY1A 2W6NA 1OT5A 4ZCSA 2BISA 3ADCA 3VR0A 1HGXA 2KE5A 4AWXA 2J59A 3AVQA 3HA3A 4KACA 1RZRA 3OT4A 3KQLA 1RTTA 3QKTA 3JVIA 4R1PA 1DIRA 1XMJA 3WK6A 3ZE6A 4FZVA 4D56A 5MN6A 3EZ2A 4YRFA 1OLXB 1E59A 2O7NA 1H6BA 2PWPA 4TV9F 4NBKA 5ES3A 5KIAA 4IQ4A 1LBHA 1TQ2A 2UZ1B 4IUCS 4JASB 4AKEA 2XMQA 3HRHA 1HF3A 3ZUGA 5LNK6 3KKNA 5EJ9A 2FUNB 3IIIA 3IT3A 3C5EA 1PT8A 5C81A 1CLEA 5I7UA 2H1IA 2N9UA 3H2IA 1B26A 1XVUA 1I51A 3UN1A 5HUQA 1JFFA 4ZAVA 5CURA 2Q1YA 3PHBE 3ROQA 3L6OO 2NU6A 3RWBA 3B3AA 4TXNA 4YC7A 3K94A 1U31A 5JAUA 4AF7A 4DANA 1D5CA 2V7BA 5FADA 5CBKA 5I9LA 2J6BA 4GO1A 3KU4A 4KBYA 3SYNA 3B1YA 3GG2A 4NS4A 1XLWA 1Q0UA 1R5OA 1FPMA 4H6PA 2DWPA<