3IMFA

1.99 angstrom resolution crystal structure of a short chain dehydrogenase from bacillus anthracis str. 'ames ancestor'
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
255
structure length
248
Chain Sequence
NAMKEKVVIITGGSSGMGKGMATRFAKEGARVVITGRTKEKLEEAKLEIEQFPGQILTVQMDVRNTDDIQKMIEQIDEKFGRIDILINNAAGNFICPAEDLSVNGWNSVINIVLNGTFYCSQAIGKYWIEKGIKGNIINMVATYAWDAGPGVIHSAAAKAGVLAMTKTLAVEWGRKYGIRVNAIAPGPIERTGGAEMAKRTIQSVPLGRLGTPEEIAGLAYYLCSDEAAYINGTCMTMDGGQHLHQYP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Short chain dehydrogenase
publication title 1.99 Angstrom resolution crystal structure of a short chain dehydrogenase from Bacillus anthracis str. 'Ames Ancestor'
rcsb
source organism Bacillus anthracis str. 'ames ancestor'
molecule tags Oxidoreductase
total genus 80
structure length 248
sequence length 255
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3imfA00
1CDOA 4BO9A 4JBHA 4NJMB 1CETA 3ZV3A 2BFOA 1K3TA 4WEQA 2DVMA 3HDHA 4YQZA 1DO8A 3VVBA 1VM6A 3WDSA 2Q4BA 3ZWPA 3B6ZA 3K31A 3KYDB 2CUKA 2OGUA 3O26A 1PJCA 1TT7A 2FR1A 5GZ6A 5HM8A 4KTVE 1MP0A 3JD2A 2VTEA 1YGYA 2CDAA 5KWEA 4FFOA 1C0PA 3ZHZA 2R00C 3SJUA 3DTYA 2VZ8A 3JYPA 5CPFA 2C54A 1FMCA 4A5OA 1WMAA 1E1KA 5A9RA 1UP6A 1EE2A 1GAEO 1UAYA 4YJFA 4AJEA 1X1TA 1ADCA 1H0KA 1HYHA 3H7AA 3HJAA 3F4BA 4DIFA 4YAIA 3EUWA 1HDCA 1LQUA 4BV8A 1Z45A 3E6AA 5F21A 2R2GA 1K5HA 1DOHA 3PGXA 4AJPA 1E77A 5FWNA 1O0SA 4NDNE 2GZ1A 3QWAA 3MJ4A 2W2LD 5CDGA 4JJGA 4TVOA 4BGIA 4DLLA 3PRJA 1MXHA 1PR3A 3ANLA 2Y68A 4OAQA 3RUDA 1HE5A 2AQ8A 4RF4A 2YYYA 4UVDA 2FOIA 1Y8QB 4Q3NA 5IZ4A 1XEAA 3TL2A 1DC3A 2B5VA 3ROMA 3RWBA 1QR6A 3RI3A 2HRZA 1MX3A 4EEXA 3NJ8A 4PRLA 4WNIA 2NTNA 2P4HX 3GN2A 4UUOA 5ER6A 2VRBA 3GDGA 1I32A 2D59A 3I9KA 3I4CA 5GMOA 1P3DA 4J4BA 1LDNA 4R9RA 3GEDA 2VOJA 1M67A 1YOVA 4OMUA 3JQGB 4IQ0A 4ALKA 1NVTA 3GMDA 3DB2A 1D1SA 1LDYA 4GGPA 3TOXA 3AM3A 2UYYA 4FDAA 4M8SA 1YKFA 4ALLA 4DLAA 5CPBA 3GHHA 1P45A 1BXGB 2EEZA 3L77A 4Q3CA 1VE9A 2WD7A 4BNFA 1BVUA 3FPCA 2Q99A 3OP4A 3Q9NA 3AUAA 3DZGA 3LQFA 1YVEI 4GKBA 5IG2A 2ZTMA 3NKLA 3RFTA 1ZEMA 1KERA 4OYRA 5CAEA 3FBGA 3ADOA 2C2XA 1ZJYA 2BGMA 1EQ2A 3BIOA 5TT1A 2AG5A 1XLTA 1ZK3A 1X0XA 5DN9A 1P0CA 5G0VA 2QRKA 1OZAA 1DC6A 1EVZA 3VDRA 4BB5A 5EN4A 4MIEA 4MKZA 4P4NA 1U28A 1Y8RA 3GDFA 1LA2A 4DC1A 3IJPA 2CVZA 4LVCA 2XXJA 3I5MA 1SB8A 5TS3A 4FQ8A 2D0IA 3DHNA 3KUXA 1PIWA 3LC7O 2XF8A 3KVOA 4MVJM 4DYDA 2X5KO 4PG8A 3AU9A 1HLPA 2E82A 2J6IA 3WGYA 3NAQA 2AEJA 4ILKA 4HBGA 2DPHA 4WNCA 2P68A 1C1XB 4DBVO 1IHYA 1HEUA 4H16A 6LDHA 3NTOA 1NPYA 3L4SO 4PG5A 3WJ7A 5J23A 3KV3O 3GDOA 1KEUA 1V3VA 4OSOA 2Q45A 4J0EA 3H9EO 1EVIA 5EESA 5BNFA 3GVXA 5KVVA 4PVDA 2PA3A 1PQWA 1I33A 3GNTA 1UP4A 5CDSA 4D43A 5IDYA 2Z1MA 3BTSA 4YJGA 4LGVA 4UUNA 3WMXA 1UDCA 3NDRA 4P22A 2QIOA 4R3WA 2AQHA 3PI7A 4CM4A 3I9MA 2Z1NA 3E82A 1R0SA 2J3KA 4ZQHA 2NU8A 5DT9A 1DLIA 5JC1A 3T7CA 4I5FA 4I5GA 4E13A 4E2XA 3ZWVA 2B83A 2C7VA 3HFGA 3TN7A 1ULSA 5KNLA 4YJFB 3E5RA 4BOYA 4L4XA 3S1LA 3V5NA 4TMFA 2D5CA 3I4FA 1Q7CA 2X22A 5FI3A 3BMCA 3F3SA 2P2SA 3RQSA 3ZHXA 5A04A 1PR9A 4UAGA 2WTBA 1HWYA 2O3QA 4ALJA 3Q0EA 2E49A 1T2DA 3GAFA 1XQ1A 3AWDA 4J1SA 1T2CA 2EKLA 4B7CA 1LLDA 4WE3A 4R1NA 4TWRA 2VCYA 5GY7A 3BMOB 5ITVA 1YBAA 4AJOA 3E9MA 4RQTA 2E48A 4HKTA 1VJ0A 1UR5A 3O8QB 3OJFA 4ZD6A 1N7HA 5G0TA 3P7MA 4RGBA 1A7KA 4WKGA 1GL3A 1B3BA 3EVNA 2NU6A 1UXKA 1ISJA 1H93A 3C7AA 5G4KA 2VQ3A 2X0JA 1YONA 3CMCO 4CMIA 5JAZA 5CFZA 3JQAD 5G0UA 5HA5A 3NV9A 1ORRA 3FNFA 1EVYA 1ZKMA 3G79A 5EPOA 2VRCA 4DMLA 1DC4A 3QY9A 3PYMA 4OKIA 4CL8A 5JY1A 4R9SA 2OP1A 1CWUA 2DU8A 3NDIA 4J90A 3O9ZA 4QECA 3IKTA 4AJLA 1AUPA 2WD7B 3PJEA 4GBJA 1B14A 4TZTA 1P1KA 2C7GA 2P5YA 3RC9A 3OIGA 2WD8A 1PX0A 1DFIA 1N9GB 2Y99A 3IC5A 3ZWYA 5IFLA 3CUKA 4JXKA 1RYEA 4JJIA 2Y1CA 1YBVA 3GRKA 4IGEA 3WOHA 1PJ3A 1WWKA 2Q46A 4BNNA 1U8FO 3D0OA 4NFHA 5JDCC 1PS8A 1NXQA 1NASA 4HX5A 3PIDA 4TRJA 3MOGA 3NGLA 1D8AA 3NRCA 4Z0TA 4BL5A 4EITA 2W8ZA 4A2CA 5FFFA 5TJ9A 2D1YA 3ABIA 4Y6SA 3WBBA 1GUZA 2BRUA 4RORA 5F1KA 1LLQA 2Q49A 3HQ4O 4F45A 1LSOA 1DIAA 4LVUA 5BR7A 1Y5MA 3H65A 1MFPA 3W4JA 2W2LA 4E4YA 3OECA 1HZZA 3MEQA 4JLWA 3CE6A 3PHGA 1KIFA 3B1FA 1ISIA 4L74A 4B7UA 2H5LA 1YQDA 3W4KA 2NADA 1M6WA 2Y93A 5AXBA 1H2HA 4B4OA 5TQVA 1G0NA 4AL4A 3ZWNA 2PV7A 3RD5A 3VKVA 1HKUA 4FD3A 3I9LA 3WIEA 4CV0A 4CM4B 3JYLA 5C37A 3RUIA 2EGHA 3JQ9C 4ESOA 3JQBC 5I7VA 4YT8A 2J3IA 1WPQA 4D79A 4WCFA 4AJIA 2QZ9A 2I76A 1YL7A 3KHUA 3OICA 5CDUA 1GTMA 2FPGA 3RU9A 4RVHA 3WSVA 1OFGA 3STHA 3AUUA 3ZU5A 3D5QA 3GEMA 4FFRA 1SNYA 3FR7A 4NBWA 1DBVO 3QVXA 2GD1O 1JQBA 2BH9A 5B4VA 1ENZA 1KYQA 2HMUA 4FSHA 3A28A 1XU9A 5JAIA 3VTFA 4ZA2A 4OOFA 3WLEA 3IDSA 2FPIA 4UVEA 2C29D 5K6AC 3U4DA 4D3FA 2YDXA 2I66A 5T6BA 2A4KA 2C07A 3V1TC 2R6JA 2X0NA 2JFGA 3L6EA 5TF4A 4LRSB 2AEMA 3PWZA 4E5YA 2X1HA 1Q0QA 5F1OA 1BG6A 4CMCA 4A0SA 2WM3A 4PZDA 4CM7A 3UAGA 4HFMA 1XR3A 3IUPA 3FF4A 2VUSA 4FGSA 4ND5A 1VPDA 1ZFNA 2GCGA 3OQ1A 1DDOA 1WDLA 5G4KB 4ZQGA 3BYZA 2EJWA 1E1NA 4C4OA 1XHLA 3RBXA 4OM8A 1ONPA 2RBEA 3FCOA 3JQCA 5LDGA 4BGUA 4E2YA 5C7IO 1C0IA 1QMGA 3BMQA 4RPJA 3E48A 2ZATA 4DBZA 1YWGO 4KP7A 1E1LA 1PJBA 1UP7A 2FHSA 2DKNA 1JA9A 1TI7A 2DBVO 2JJYA 3PHHA 3H5RA 4HADA 4J7CA 1LRJA 4D3SA 1M2WA 3R1IA 3ZN2A 1P9LA 2FWMX 4XB1A 4E5NA 4INAA 4W7IA 2C20A 2R00A 4Y98A 2GGSA 4I9NA 5MDHA 2V6FA 2CVOA 3HN2A 3WYBA 1GD1O 2B4RO 3B20A 2B69A 1ADGA 3PK0A 2XAAA 4IS3A 2AQIA 5HBRA 4JP3A 1TT5B 2FZWA 4XQGA 3AI1A 4AJKA 5IF3A 5U9CA 1O9BA 2ZYDA 2HMTA 4QQRA 1YRLA 3ENNA 4GMFA 1NWCA 4LRTB 1QP8A 2ZIZA 1SMKA 4GLOA 2TMDA 2X4GA 3NJ4A 4R5HA 5HWSA 3EW7A 3DC2A 4DXHA 3T4EA 3CZRA 4J0FA 4AJJA 4WLUA 4JBIA 5CEFA 1B7GO 3GEGA 1LSSA 4CMKA 3G49A 5COQA 1LBEA 4L4SA 3S2IA 5L45A 4QO8A 3GHYA 4Z3KA 5BSFA 3VOSA 3QWBA 1P77A 1XIVA 2NVUA 3R0IA 4HXYA 4TRNA 2O3SA 1EQUA 3GFBA 3LF1A 1KVQA 4FCCA 3SVTA 1JAYA 1WXDA 1NAHA 1OC2A 2JD0A 4K28A 4DPKA 3JV7A 3EK2A 5JXWA 4BMVA 1VLLA 3DBLA 4NFSA 4ALIA 4EJ0A 3UN1A 4PLTA 1F17A 3ZU3A 4YJHA 5EMHA 3GPIA 3LSYA 5I8ZA 3QVSA 3N74A 4R68A 3HFSA 4AJ2A 1VL8A 3JQ6A 5EL0A 3RUFA 4E5KA 1F12A 4GAEA 1ISGA 4B79A 4KQXA 4CLRB 4YBZA 1B16A 1U7HA 3RUCA 4YTEA 5ES3A 5A9TA 4EGFA 2XXBA 4E33A 2HMVA 3JTMA 1O95A 1FDTA 1T4DA 3JQAA 2YV2A 1BDBA 3VZRA 3D3WA 4WCFB 5KJCA 1DRUA 1JAXA 1KS9A 2ZTVA 2BMAA 2HUNA 5HRUA 2C5AA 1ZSYA 4HWKA 5L95A 2O3TA 3ZV5A 4N54A 1F0YA 1B15A 1PJQA 2Y1OA 3BAZA 1H6DA 4D0SA 1I0ZA 4YRAA 4EJ6A 2VYND 1DRVA 4DQUA 4ZQBA 3IQDB 3GN1A 4EYEA 4CM8B 1D7OA 1SC6A 4ZQFA 1GQQA 1XYGA 2GN9A 3Q3CA 5ICSA 3VC7A 3WNQA 1ISFA 2BLLA 3JQFC 4BV9A 3ZDFA 3WICA 2Q1TA 3JD0A 3PVZA 3TRIA 4A73A 1PEDA 4H15A 2DM6A 5GZ1A 3SEFA 1GV0A 1XDWA 2V7PA 3DZJA 2X7HA 4II2A 3PQEA 4IS2A 6ADHA 3OETA 3GVHA 1RJWA 1ZVMA 3NTQA 1S6YA 1C0KA 1PJSA 4WLOA 2NVBA 1S7CA 2YV3A 4LSWA 4ZN6A 3RC7A 1VC2A 4R1SA 3ANNA 3INRA 3CEAA 1X7DA 2CD9A 2HMSA 2ZCUA 3GFGA 3LLVA 5H82A 1RWBA 1F8GA 1SCUA 2X6TA 3EC7A 2PH5A 2Q3EA 3QSGA 7ADHA 2IZ1A 3JD4A 4XYEA 3ZU4A 5F3RA 2DPGA 4YEDA 1P0FA 4XYBA 3VZPA 1HYEA 1XKQA 3VAZA 1Q2XA 3U49A 1DIBA 3TQHA 2EG9A 4N5MA 3NGXA 4CV2A 1LRLA 4AJ4A 1T26A 1AHHA 3SLKA 4U0KA 2GF2A 5IZCC 5I9MA 3U62A 3SC4A 3ETGA 1YL5A 3G0OA 2P9EA 2GZ2A 3WNVA 2ZYAA 5HTOA 4OKNA 1QYDA 4JROA 3JQEA 1DRWA 4NNJA 3EAGA 1N1EA 4DQXA 4N18A 3LC2O 2VT2A 1WP4A 4NG5A 4FC6A 2JFHA 3OH8A 5T57A 2BHLA 4E5MA 1QYWA 4LSMA 5B12A 1OI7A 2G0TA 3D4OA 1YE3A 3RFVA 2X5JO 4DIBA 3HADA 3FTNA 4MIOA 4RF3A 3NT5A 3DEYX 4IUYA 4MVJP 3DXFA 4URFA 3OM9A 5ILGA 2AE1A 5COBA 2EWMA 1HYGA 2RAFA 1JLLA 1PZHA 3PLRA 1A9YA 3VPXA 4IDAA 1MC4A 2PD6A 4PLVA 2UVDA 2CFCA 2G82A 1PGJA 4DYVA 5F1PA 4OXNA 1H6AA 2HLPA 3RUAA 4B4UA 1FDVA 1D1TA 2VUTA 1DAPA 2CNBA 1GEEA 3WGZA 2NVUB 2B35A 3I9OA 3WTBA 3EZYA 1RM3A 3TZHA 4ZRNA 4PLGA 3IKVA 3DBLB 3L07A 5T8KC 1UDAA 4F46A 5AXCA 2V65A 4G2NA 2X0IA 1PJLA 3OQBA 1QG6A 4KOAA 2QW8A 1EUZA 1E7RA 1BW9A 5EQDA 3W6UA 5DF1A 4UULA 1KVTA 4AICA 4BO4A 4WLNA 2CF5A 3PP8A 3QIVA 1UXGA 4CMGA 8ADHA 1I8TA 1L1FA 4CUJA 4PIVA 1PL6A 1KVRA 1GR0A 1E7YA 2P9CA 3A14A 3C1TA 3GOHA 4O1MA 3MTJA 4QT0A 1ZJZA 3QV1A 4Z3DA 3Q2KA 1BXKA 1TXGA 2E37A 3PZBA 3D3WB 4RPLA 3QE3A 4BKOA 4BNHA 4JN6B 3QWHA 5BSEA 2ZB8A 3H9QA 4KUEA 1U3VA 1I2ZA 3H4VA 5G0SA 5IXYA 3H6KA 4G81A 5LDHA 1E6WA 3PPIA 3VKUA 4CV1A 1BDMA 4K6CA 1BRMA 3KB6A 3LT2A 1FDWA 1XCBA 4XYLA 2ZK7A 4NK5A 3VPGA 4GPD1 3PHJA 2E6UX 3BTUA 3KZVA 3DBRA 4WOJA 5KKAA 3ZWAA 5I7SA 2F1KA 1P31A 2D4AA 1K6XA 3R3JA 1DB3A 5JDCA 3PZRA 2WSBA 2ZTUA 3A1NA 1GZ3A 1SOVA 1R0LA 1KY4A 2YZ7A 4TVBA 3RU7A 5KCZA 1LQTA 3BZUA 1K89A 1EE9A 4IJUA 2GN6A 2H63A 4J6FA 4R1TA 1RYDA 4GX5A 4NU6A 2IXBA 3PFWO 2J5KA 5CP8A 3M2TA 2AW5A 3IP1A 4YAEA 2RH8A 3U5TA 3JQ8A 4F6CA 3I1JA 1NPDA 4LISA 3W8DA 3ZI0A 4A7PA 5DZSA 1N7GA 4XZ3A 3K2BA 9LDBA 1T25A 1LX6A 3UCFA 2OORA 3KEQA 1NQAO 4JJFA 1V9LA 3M1LA 1R4MA 2RCYA 4Q3DA 3B1JA 4J9UE 3WTCA 1OAAA 1MFZA 3GK3A 3B1KA 3TL3A 1ZK2A 5B37A 2Y1DA 3ZV4A 5A06A 5F5LA 1Y6JA 3AK4A 1HL3A 1ULUA 4IXTA 4RL6A 5A3JA 3NT4A 2OMEA 2DC1A 1ENPA 3W8EA 1KVUA 3MZ0A 3V2UA 1GYPA 2QRLA 3JQ9A 1ZUD1 4GX1A 3BTOA 3JQBA 2X5OA 1X13A 4H7PA 4DMMA 2P9GA 4P38A 1D3AA 1NWHA 3JSAA 4MP6A 4RLSA 3PYXA 1AE1A 4RVGA 1WZEA 4II3A 1N5DA 5JAQA 3VHRA 1YXMA 1NBOA 3EDMA 5B4UA 1X14A 3RC2A 4BO7A 1EDZA 3F9IA 1CEQA 1P1FA 4LMRA 5AQ1A 2VHVA 4CR8A 4QEDA 3LZ6A 2IODA 3ICPA 4NH4A 4U5QA 4DVJA 4L0QA 3WGTA 3NX4A 3LVFO 1P1JA 1HXHA 1U2DA 3LLSA 3JYOA 1LDMA 4NMHA 1U1IA 4CQLB 2OHXA 2VOEA 3DHEA 4PLCA 1YQXA 3W8FA 5K6AA 4RZIA 4DTIA 1U3WA 2VYNA 3WYCA 2QYTA 1KEVA 4Q39A 4GSKA 5H81A 1E5QA 2VNSA 4CQMD 2JL1A 1WVGA 1PS9A 3ORFA 3V2GA 2LDXA 4RF2A 2HAEA 3NYWA 3GQVA 3CIFA 5DBIA 1J4AA 2X23A 2PNFA 4F3YA 1I24A 2O7SA 3E18A 3GGPA 4J7XA 4QUKA 1J0XO 1VL6A 1ID1A 3QP9A 1P33A 4UEJA 4XCVA 1KOLA 1Q7GA 1E3WB 5AXAA 1GU7A 1DFGA 3F5QA 3MOIA 3PQDA 3ROKA 1NHGA 4BS9A 1O94A 3AY6A 5JDIC 5K0ZA 3E1KA 1B3RA 3W1VA 3C1AA 2DT5A 2ZCVA 1SPXA 4K26A 4Y6PA 3A06A 5JAMA 1DXYA 3VPHA 4GL4A 5I8WA 1A7AA 5EJ2A 3ETDA 3LT1A 4TROA 1NQOA 3TOZA 4DLBA 2B4QA 1E3LA 2OXIA 3KYCA 1NHWA 4UEKA 4BNIA 3FD8A 5H83A 5TNXA 1NX6A 5DBFA 5A3VA 3PHLA 3DOOA 1PJTA 1YBMA 2HRBA 3X2EA 4YQYA 2GERA 3WFIA 4A27A 3QRWA 4YT4A 3KETA 2IYPA 4W9NC 4J7UA 1GYRA 2PWZA 2JD2A 2GYYA 3WWZA 1ZEJA 3KBOA 4CJXA 1UZNA 2JHFA 2PZJA 2PTGA 3FNHA 2PKQO 4FB5A 2O3RA 1H9BA 3VH2A 3Q2IA 3X2FA 3ADPA 3NEPX 1IULA 1HT0A 2I3AA 2YUTA 3K2EA 5HS6A 1TVEA 1V8BA 2WMDA 3AI2A 3ZWWA 1UUFA 1HDXA 1YO6A 2NU9A 2VUUA 3ENKA 1YB5A 3QVWA 1AXEA 3Q9UA 2O48X 4FFPA 4BO5A 5LCXA 3CXRA 4BKUA 4IJKA 2NQ8A 1HRDA 1K0UA 4XR4A 4IINA 2TMGA 3OEYA 4O5OA 1TB4A 1QV7A 1PQUA 1DIRA 1LJ8A 4XRGA 3JQ8B 3QW2A 2UUPA 3IJRA 3L6DA 1NAIA 1I3NA 1PGOA 3FWZA 1NTOA 2ZKLA 1UZLA 5TX7A 3DR3A 1I2CA 3RJ9A 2O3UA 2J5QA 1R4MB 4W4TA 1B2LA 4BO8A 4KTTE 4YRBA 3DONA 3OBBA 3WR5A 1JDJA 5THQA 4LMPA 4JX8A 3UGKA 3ITDA 4DL9A 1SZJG 2PK3A 2NM0A 5CHEA 1ZXLA 3RSHA 5KJEA 3JQ7A 4JCOA 4BNJA 5B4TA 2BI7A 3FI9A 1E92A 1M66A 4CMAA 4CMJA 1FK8A 4CLDA 4EZBA 2YQ5A 1YOVB 1EK6A 1LLUA 4GI2A 4E30A 1QLJA 3ICCA 2QG4A 1P1RA 2VHYA 2HK8A 3RROA 5IDXA 3H5NA 5L7TA 2PH3A 2ZYGA 3C7DB 1MG0A 1RM0A 3FSRA 3HHPA 3QLJA 2V6BA 3GZNA 1R66A 4E21A 3KLPX 2GO1A 4D0RA 1PGNA 2GPTA 3NTRA 4IIUA 3TSCA 2Q2QA 3H3JA 3LT0A 2D3TA 4BUCA 4FOOA 4PLHA 4XB2A 4OL9A 5TIIA 2OL4A 3MJCA 4WJZA 5JYEA 4NIMA 2J5RA 3WS7A 3GY0A 3HB5X 4N5LA 4DRYA 4M86A 4NQZA 3JQFA 5TT0A 1R12A 1QSGA 1Y8RB 1WDKA 4R41A 4I08A 1DHRA 4G5HA 5F5NA 4MKRA 4Z9XA 1E0DA 1B8PA 4XYGA 3FNGA 2VN8A 3WGGA 3ZCXA 1DPGA 4EW6A 1RKXA 1U8XX 4L9RA 2C2YA 1WMBA 3WSWA 3Q1LA 4ROSA 1YL6A 3DHYA 1GZ6A 1UXHA 2P4QA 1IZ9A 4CODB 4BMNA 1WZIA 1ZZEA 2DFVA 3E9NA 4YA6A 1ZIDA 1IUKA 1TA4A 3RKRA 1IOLA 3VTZA 3ONDA 2BGKA 3OJ0A 5AYVA 3O38A 5JW6A 4XRRA 3PTZA 1Q0LA 1PZFA 1AHIA 3GG2A 3KYCB 2OOSA 4MOWA 1E6UA 1KETA 1J6UA 4RCVA 2OO5A 3JYNA 3N7UA 3ZWOA 5IZCA 1HE2A 4K1LA 3VVCA 1U4SA 3DAPA 4P8RA 4Q3BA 4U6SA 4BHTA 3S8MA 1ADBA 4YJGB 4WASA 1YS4A 4QO7A 3AU8A 4KMSA 3DMYA 3IP3A 3VH3A 2XPCA 4MP3A 5JY6A 1LC3A 1MGOA 3DZKA 4R16A 2ZJ0A 4CLOA 3LU1A 3RUEA 1PQPA 1DEHA 1JTVA 1YJQA 1PTJA 1YB1A 3PYLA 4BKQA 4FOSA 2EKQA 3NUGA 1T4BA 1IB6A 1ZK1A 2V6GA 4QX6A 2JAHA 4TRMA 5CG1A 3O4RA 2FR8A 4O6VA 3TFQA 4D3DA 1W0CA 1CYDA 3MJSA 1O89A 3BMCB 1Q7BA 2IZZA 4BGEA 5G4LA 2Q50A 4RJTA 5JSFA 4E3ZA 3UICA 2DTXA 1DC5A 4OOEA 4W82A 3KRTA 2DFDA 2RIRA 1P1HA 1I3KA 3DMTA 1PGPA 3WXBA 1Z6ZA 2EKPA 4YB8A 5FEUA 4PG6A 3GGOA 2DTDA 2D8AA 4AVYA 4FN4A 4IDEA 3WJAA 2HKIA 1MXFA 3C3XA 3FPLA 2WE7A 1MC5A 3QA9A 2FSVA 1JVSA 4J43A 2OP0A 5T8KA 4CR6A 4JNKA 3PDJA 4MIYA 4MO2A 1SOWA 1BWSA 1A4IA 4R3NA 4CQMA 1H9AA 5CEJA 4C7KA 3DQPA 2GRAA 3D4NA 2NU7A 4CMIB 4K6FA 2C5EA 4MVJE 1FXSA 3KSZO 1MA0A 5LC1A 1NQ5A 3I9NA 4B4WA 1WLYA 3HG7A 1XELA 3D4PA 1YQGA 3F1KA 3FN4A 4EUHA 1OOEA 1I01A 3EZLA 4XKJA 3PJDA 3ASVA 3TDKA 4R69A 1QRRA 3BHMA 1ZK0A 2Y0EA 2PFGA 4PGFA 3IS3A 4RDIA 1CQIA 4GWGA 4J3FA 3INTA 2C59A 3VDQA 3GZNB 8LDHA 3INGA 1NQTA 4Q3AA 1BVRA 4E6PA 4CMEC 1OMOA 1UAGA 2B4TO 3K8ZA 4FFMA 4KWIA 1BXZA 3ZV6A 4HFJA 3OJLA 5TJHA 4PG7A 3RASA 3DZBA 2VWHA 4CMHA 1L7DA 3DAFA 5L4NA 5L7YA 1YJ8A 3DZFA 5DCUA 1B8VA 4Z0PA 2A9FA 4BNXA 4HY3A 2OBNA 4WUVA 1LU9A 4IMPA 1ONNA 2A35A 4A26A 4DUPA 1R4NA 1FDUA 3IMFA 2NTVA 2Q1UA 1W6UA 2Y1EA 3KLMX 1Z7BA 4FFLA 3EVTA 1AGNA 3K73O 1Z82A 1UH5A 1E3JA 1ZXBA 3PHIA 3VPFA 2VWPA 3HSKA 4CLHA 3OFSA 4D45A 3DO5A 4RPKA 2CSUA 2PGJA 4NBVA 3V1UA 4CLXA 1QORA 5EINA 1RM4A 2HK7A 1Q1NA 3ZH2A 4U6QA 3U0BA 4LW8A 2GNAA 4JQCA 5JE8A 4IY1A 4G65A 2E4AA 4NR0A 4DPLA 5IN4A 4YR9A 4GVLA 4MINA 3QVTA 1M75A 2OBYA 1GQYA 2VHZA 4DREA 4YAKA 3IAHA 3AJRA 4TRRA 3UVEA 1HDYA 1XWFA 2I9PA 4XEHA 4BNVA 1U5AA 1KEWA 3IOYA 1E1MA 2H1SA 2Q1WA 4GX2A 3ZZNA 2POQX 1ZMTA 4ZJUA 3RUHA 4S1VA 2X9GA 3L9WA 3OIDA 1JKJA 4XWYA 5A4DA 1WW8A 3WLFA 4RVFA 3FNEA 3D1LA 5TSDA 4E12A 1NR7A 1HF3A 5BSGA 2PZKA 1E3IA 3GVCA 4IQGA 2EHDA 4TKMA 2BFPA 2FY8A 1ENOA 1UXIA 4YRDA 3R6DA 3W6ZA 2VWQA 3K92A 1Z7EA 3H9JA 1T2FA 4PCVA 4R1UA 1YB4A 3A4VA 2D5AA 5IAAA 5U1PA 3UW3A 4NJMA 4JIGA 4YJDA 1LEHA 3OA0A 1G0OA 4GH5A 3HDJA 1WAMA 3PIIA 1DJNA 1PU2A 2C82A 1Z74A 4BO6A 4CV3A 2A94A 2YV1A 1JN0A 1ZBQA 4IDGA 3WYEA 1MV8A 2CY0A 1FJHA 5C7OO 7MDHA 1P44A 4MP8A 1QYXA 5C7LO 4IBOA 1GFSA 4GX0A 4AJHA 5DDIP 4BKRA 2XOXA 1E3EA 4EUEA 2C0CA 2H6EA 2LDBA 2PR2A 4MVJD 5L40A 3S55A 5JDIA 3MWDB 4YXFA 5KIAA 1LTHR 2JKVA 3ZHYA 4YDRA 3RBZA 2JCVA 4NBUA 3BMQB 3KXDA 4B7XA 5IDQA 1B26A 3FBTA 1EEHA 1U5CA 4GKVA 3PFFA 4I9UA 4WEOA 3QWIA 4Q3EA 2FP4A 2EERA 4QFCA 1TLTA 4XGIA 4FR5A 1VSUA 3RAJA 5FF9A 3QVOA 1H6CA 4PG4A 4FGWA 1IPFA 4NK4A 5L53A 4W9NA 1QYVA 1C3VA 1W4ZA 4XDZA 1JWAB 1KY5A 2BKAA 5BQFA 5GZ3A 3B70A 3GPDG 3ZWXA 4CM1A 3AY3A 4RPGA 4B3HA 1Z73A 4D42A 3G1UA 3WMWA 3K5PA 3RVDA 4GGOA 2GN4A 1LDEA 1BSVA 4ZVVA 4EEZA 3DBVO 4D46A 5JNLA 1XGKA 4HV4A 3T4XA 3AOEC 1PZEA 2X9VA 1JU9A 4ND2A 4NHEA 4L75A 4NFYA 2QZZA 3ZGYA 4EDFA 1R4NB 3WQQA 5JO9A 1T2EA 3LT4A 4BNLA 2AHRA 4BNGA 4O59O 3U4CA 4C7JA 3E8XA 2HJRA 1XQ6A 1YH3A 1U3UA 1X7GA 3JQGA 4IZHA 2Q4EA 2I65A 3E9QA 1LDBA 3HZZA 4YAGA 2AEFA 1K2WA 3A9WA 4WCFC 1BXGA 1DHTA 1GV1A 2RHCA 4L76A 4WK6A 3VZSA 3AI3A 2FRDA 2I3GA 2VHXA 3ULKA 2VYVD 1E6EA 5B1YA 4BIIA 4IJVA 3ZNOA 2FR0A 5BSHA 1CRWG 4BQPA 3WGHA 5IN5A 1UJMA 4YJHB 3HNPA 1PSDA 5CDYA 5KVQA 1CQJA 3KEOA 3ZWBA 1SB9A 4TZKA 1PGQA 4KZPA 5ENDA 5C3MA 5G2OA 3WQSB 2O7QA 1YDWA 1VJ1A 5DOZA 2FN7A 2FPPA 4J2OA 4BGVA 4BNUA 5IXSA 1AXGA 3GUYA 3MJTA 4ID9A 4NZ9A 4IDBA 3DL2A 1E7QA 3E5MA 4O0LA 3JQAB 4IJWA 3FHLA 3KO8A 5I7FA 3KYBA 5BT9A 2WWRA 4UUPA 4ND1A 5AOVA 2DTEA 3ON5A 2B36A 2NLOA 1RM5A 1HSOA 1IL0A 1PWZA 1V35A 3ONFA 4J91A 4Z9YA 4RDHA 1J5PA 3DWFA 3MJVA 4M54A 4J16A 1EK5A 3OA2A 2PKRA 4FJ1A 3KSUA 4OIMA 3E03A 4W6ZA 4Y67A 1Q0HA 1B0AA 3UH1A 3CSDA 4QXMA 1ONOA 3CKYA 1DSSG 2NSDA 4IDFA 3DAGA 5ENVA 1O8CA 4IDCA 3ONEA 3ZU2A 5KOIA 1GY8A 2VZ9A 3NT2A 3OJOA 3TPCA 1PL8A 3H5AA 2O3JA 1Y9AA 3L9XA 3P5SA 4Z6KA 4HNHA 3GF4A 4PRKA 5ICMA 5I9NA 1Y81A 5U4QA 1LUAA 1OBFO 1C1DA 3D64A 3H3FA 1PL7A 4XIJA 2QRJA 3C85A 4BNTA 1XG5A 3ZWMA 4NU5A 4WLVA 1FF9A 2HK9A 2Y66A 3Q11A 4UVIA 4B3JA 4PLWA 1SEVA 4CR7A 2B37A 4DWVA 3R3SA 5JCJD 2NV6A 2EP5A 5I7EA 3JQDA 3HDYA 1K6JA 4EBFA 5FYDA 2X0RA 1A71A 4YT5A 2B0JA 2OUIA 3ETEA 4NPCA 3SX2A 1EUDA 1EFKA 3N58A 4FFNA 3TZQA 1LLCA 1QLHA 3BMOA 4OO3A 1NVGA 1HLDA 1Y7TA 2PY6A 4ZRMA 1EZ4A 3O8QA 1PZGA 1NP3A 1R15A 4P4GA 1R6DA 3SBOA 3MCVA 1QYCA 3JCZA 1U3TA 4OHUA 2CZCA 3Q6IA 4WLFA 3WFJA 1MB4A 2BELA 4JGBA 4TKLA 3UCXA 2GR9A 4BNKA 3UKOA 4W7HA 4D44A 3GGGA 1TEHA 2Y1FA 1C0LA 1GUYA 1Y9EA 4ZICA 5A1TA 3D7LA 1Y5RA 4F6LA 2H9IA 3I9JA 3CH6A 2DLDA 1NNUA 4FJ0A 5CEEA 1OC4A 1X15A 2X58A 5L51A 1FDSA 2VT3A 3P2OA 2I99A 3GA0A 1KEPA 4PLZA 1F8FA 4XR9A 2JCXA 4DIOA 1BHSA 2A92A 2VZ0A 3BA1A 4MVJF 4QSMA 4GLLA 5DULA 3EMKA 3AUSA 1N9GA 5A02A 2ET6A 3GR6A 5JMWA 4DGSA 4YVFA 2NACA 3BHIA 4XYMA 1XA0A 4R01A 2I67A 4N7RA 5EQFA 3S2FA 3T7EA 3WG9A 3HUDA 1BW9B 3CMMA 4OJNA 4BO3A 4XQEA 5T67A 2DAPA 2JFFA 2NTJA 4NI5A 3I83A 1ZK4A 4HFRA 1QXSA 3G17A 4MVJA 4J1NA 1GEGA 3C7CB 4WPGA 2NUAA 4R51A 1NR1A 2IE0A 1EMDA 1GQ2A 1VL0A 3HB4X 1HDRA 4XDYA 3H9UA 2F00A 4LN1A 5TGDA 3PWKA 1X7HA 3GVPA 2WJPA 2CDBA 4ND4A 3BXXA 3IL2A 2YHUA 1LRKA 3UXYA 5JPIA 5T5QA 3KTDA 4CMEA 1MUUA 4M89A 5A5FA 2X86A 5TLSA 4BKPA 5JMPA 3ZNPA 3UHAA 4Z0HO 1DIGA 1GZ4A 3DZHA 3UFXA 3GMSA 3EGOA 5DCWA 4J1QA 1ZNQO 1I5RA 1I10A 4IMRA 4YACA 2IEDA 3U4HA 5KVCA 2O2SA 3PEFA 4I9HA 2YHIA 3DBRB 3GG9A 2YFQA 1KVSA 5FI5A 2OFPA 2HJSA 3V8BA 4J4TA 3V2HA 4GVXA 3DTTA 2IZ0A 4E2ZA 2Q2VA 3WIDA 2FMUA 1NFRA 2J3HA 2NVWA 4A03A 1U2GA 1GDHA 4XIYA 3F1LA 1YDEA 3GUCA 3SXPA 4J2HA 3RFXA 1SEPA 4FIZA 1C1DB 5ILOA 2HU2A 4O63O 1N92A 2HSDA 2YW9A 3L4BC 2V6MA 3QWFA 4YAJA 1XU7A 3ITKA 5L3ZA 1HSZA 3K96A 2DBRA 3VZQA 4XGKA 3GLQA 3WGOA 2G1UA 3H2ZA 1IYZA 1UZMA 3TF5A 1EBUA 1HETA 2ZQYA 1VSVA 4L8VA 2VYVA 2P91A 2UUOA 4BQRA 1K6IA 3I52A 3MJEA 4WCDA 1E7WA 4Y6RA 3KM0A 3CTMA 3I23A 1Z75A 4MJLA 1EDOA 2PD4A 1GPDG 3I6QA 1R0KA 4RO0A 4WGGA 2NWQA 3IUSA 4QTZA 4ZGWA 9LDTA 3D3EA 1DJQA 1NFQA 3CPSA 4E32A 3OJEA 4RPHA 1VJTA 1DLJA 2PD3A 4JK3A 1KC1A 4XGNA 3EHEA 1LI4A 2FZEA 3CZMA 4CM3A 1LXCA 4RVUA 1VKOA 2QHXA 2AE2A 4WECA 3KOUA 3EY4A 4PFJA 4KUHA 2Y0CA 3PWSA 2CF6A 1E7MA 3IIEA 1KC3A 2OZPA 3AUTA 4B8ZA 1V3TA 4MVJI 3AW9A 1T2AA 3ZW8A 1VI2A 3EYWA 4IDDA 5THKA 4AJNA 1UDBA 1IHXA 4FBGA 4RVDA 4IM7A 1T1RA 1V3UA 1G1AA 2I5PO 4IXWA 4RV9A 4FPXA 2Z5LA 3ROPA 4J9VA 4XJTA 2G5CA 1N1GA 4CLEA 1GPJA 1G6KA 4TQGA 3DBHA 4IIVA 3WGQA 1GADO 2HMWA 1TT5A 1A27A 2HO5A 4UEOA 2IXAA 4BNMA 3FR8A 1JKFA 4YPOA 2Q2WA 1GCOA 2VWGA 1JVBA 1CF2O 3L0DA 4AG3A 2EW8A 1I36A 1CIVA 3PDUA 3OEWA 5L7WA 1CERA 2BFMA 5JFOA 5KVSA 5ADHA 2BF7A 3DFUA 3LDHA 3ZW9A 2GSDA 1IPEA 4IZIA 3OSUA 5AVOA 4NJOA 4BO0A 3PGJA 1HDOA 2WYVA 2O2YA 3M1AA 5ER9A 2IRWA 2Y0DA 5JCJA 4GMGA 4B8WA 4UVHA 3U3XA 3PJGA 4OGWA 3UF0A 5T64A 1B8UA 4MDHA 1JWBB 1A9ZA 2HCTA 1ML3A 1JKIA 3KSDO 4ZU3A 2PZMA 4R4JA 3F6YA 1ENYA 3ZHBA 4RZHA 1I30A 2J3JA 3AOEA 1LC0A 1T24A 4U8GA 4Y9DA 3C8MA 2YHIB 4TSKA 5KTKA 4M1QA 4XD2A 3COSA 2Z95A 3RC1A 2ZB3A 4BO2A 2B5WA 1E7SA 3QHAA 2IYOA 2DUWA 3ANMA 3DFZA 3CINA 3ZNNA 3TFOA 1LDGA 3K9QO 4NBTA 4CLRA 4UUMA 2HQ1A 2QYSA 4PVCA 3AM4A 4BNWA 3BMNA 5KKCA 3MTGA 5EERA 1E5LA 3RKUA 4IPTA 4R54A 2QQ5A 2O23A 4FW8A 3GNQA 4XX0A 3I6IA 5I9LA 5MGBA 3K30A 3HWRA 3HN7A 4RQUA 5KJ6A 3LF2A 3TZCA 2UAGA 2GN8A 3H2SA 3P19A 4YYZA 5DCYA 1NPTO 3QQPA 5L4LA 1JW9B 3GVIA 5L9AA 3JD3A 2PGLA 1QKIA 3NDJA 2AG8A 4CM8A 2DBQA 1HE3A 1ZO8A 4LCJA 3TZ6A 2WYUA 5A03A 1XSEA 5JCXA 4PLYA 3JQ7B 4E0BA 5DP1A 2GASA 1ARZA 2D2IA 2RH4A 1W73A 4XA8A 3RBVA 3ROQA 1L7EA 2G17A 4OH1A 3W4IA 4KQWA 5BNIA 4AJ1A 4YCAA 2WDZA 1EUCA 4OQZA 1IE3A 1BMDA 3DOJA 5HS4A 4OQYA 1ISMA 2I6TA 1PS0A 3AOGA 4CM9D 2EIHA 4DPMA 2EP7A 2PKQP 4N5NA 5JBIA 4GQAA 5IJZA 1ZSVA 4ALNA 1QV6A 3AY7A 4GWKA 3S2GA 1PWXA 2AXQA 2GDZA 5G0WA 3DOCA 2BI8A 4CL3A 1DFHA 2PZLA 3C1OA 2O4UX 2BGLA 3LK7A 4RLHA 3PLNA 4WOKA 2IDZA 3PJFA 2BD0A 1HE4A 3SC6A 3GH3A 3WX0A 1ADFA 1M76A 1H6BA 1P1IA 2JCYA 3OHSX 1ZH8A 3VH1A 1F14A 4MVJG 4P4LA 3BTVA 2DUUA 4I5EA 4EUFA 1HZJA 4FC7A 4BO1A 3U9LA 3GAZA 4CUZA 4LCEA 1DIHA 1SO8A 3UUWA 2JHGA 4FS3A 2W2KA 3DBHB 4R5MA 4YT2A 2SCUA 5BNTA 3GNSA 2DQ4A 4KDEA 4WLEA 4UREA 3G3EA 2W98A 4NBRA 1X0VA 5DNAA 4CUKA 1I3LA 1V6AA 4GSLA 3WBFA 4XQ9A 4LK3A 4DC0A 4DQVA 2FSSA 1LSUA 3SJ7A 4XJSA 1EVJA 1U4OA 1CJCA 3RIHA 4E5PA 3UOGA 2VNAA 3H8VA 4B3IA 5TC4A 4PN3A 1WDMA 3RJ5A 3ZNQA 2EGGA 4UVGA 4E31A 1KBZA 2DBZA 3WQRA 5JC8A 2VTDA 3AFMA 4E2WA 4CLOB 2GLXA 2CVQA 3OIFA 3FWNA 2G76A 4HNGA 3D5TA 4L4RA 3U09A 2GZ3A 2WYWA 3GRPA 2ZQZA 4M87A 4PLPA 5KJ1A 4M55A 3TWOA 1H5QA 2CMDA 2X9NA 3G1TA 4QFDA 2AMFA 1A5ZA 1ZW1A 5A5EA 3LYLA 2CDCA 4A10A 4BNZA 1C14A 1V0JA 3PQFA 5C5IA 4BNYA 4S3MA 4CMBA 3TNLA 4ZHSA 4Z9FA 3GC6A 2NNLD 5EIOA 4I8XA 5A9SA 1MLDA 3VPSA 5A05A 1MG5A 3BMNB 3GT0A 5IDWA 5TRTA 3VH4A 4CPDA 2W90A 1EFLA 2Y67A 2ZTLA 3ASUA 4JP2A 1EBFA 4YWJA 5DOVA 2YY7A 4B4VA 3DZIA 2P5UA 2IEBA 3UCEA 3KYDA 2AA3A 2NQTA 1VKNA 4U7WA 2ZB4A 1A72A 1RPNA 1N2SA 3FTPA 3O03A 4I5DA 4D7AA 5CDTA 3F4LA 2J8ZA 4CQMB 3F5SA 1ISHA 1U7TA 1GUFA 4OXYA 1R37A 1J49A 4OSPA 3JYQA 4KDFA 5CG2A 5COAA 1ZSNA 2O50A 4ITUA 4L73A 2X8LA 1D4FA 1O6ZA 1HDZA 1I3MA 1BGVA 5DP2A 3DDNA 1PJ2A 4FJ2A 3ST7A 3BHJA 4EI2A 1E3SA 5JLAA 3TZKA 1IY8A 2EW2A 2Q1SA 4X54A 1M6HA 1H94A 1NFFA 2PGDA 2EV9A 2ILTA 4W99A 2YFHA 1X1EA 5K9ZA 3M6IA 3AFNA 4ZQEA 3SLGA 2JAPA 2WEKA 1Y8QA 4RVSA 4HUJA 3HDQA 5L4SA 4U0JA 3MWEB 3WGIA 5KJFA 2EXXA 1VRWA 3OQ6A 2UV8A 2AQKA 4Y8VA 2Y1GA 3ZWCA 1HTBA 4MVJH 3I3OA 4I1IA 2WE8A 3LC1O 3P2YA 4OXKA 2O4CA 4MPDA 3K6JA 3TJRA 3WB9A 2YDYA 4MKXA 2W4QA 3OMLA 1GYQA 3S2EA 4BVAA 3QJ5A 2EJVA 2PLAA 1HDGO 2BFAA 2RHRA 2Y05A 2ZB7A 4HFNA 4RF5A 1AN9A 3RCBA 2W2KB 3L6OO 2YQ4A 2UDPA 2YJZA 1N8KA 5AXDA 3L4BA 1PJ4A 4JBGA 5ITWA 4KWHA 3M2PA 1ZMOA 2JD1A 3PXXA 2HDHA 1IZ0A 3C24A 3V1YA 4CM6A 2EF1A 3GZ4A 2QX7A 1SAYA 1I2BA 1U9JA 4IGFA 4M49A 1NVMB 1H2BA 4PZEA 4CM5A 4PLFA 4EJMA 4H3VA 3F46A 1T1SA 4CQLA 4ONEA 4PZCA 4K9DA 1A4UA 1NM5A 4BB6A 4J4HA 3DMTC 4Q9NA 3OF2A 1NYTA 2ZJ1A 3HE3A 4BMSA 1GCUA 1DAOA 1BTOA 4IQ8A 4KUGA 4HP8A 3AM5A 1WNTA 1UXJA 5JS6A 4ND3A 4XQCA 1F06A 3H9GA 1LNQA 1R16A 3F47A 3JD1A 4ALMA 1E3WA 2VRCD 1ZCJA 1C1XA 1Y1PA 1LSJA 3U4IA 4DA9A 5JYDA 1O5IA 4AFNA 3FRJA 5A9SB 5DBGA 4D41A 4J49A 1SBYA 5JO0A 2VHWA 1W8DA 3WWYA 1P74A 2GUGA 4CM9A 4J1TA
chains in the Genus database with same CATH superfamily
4HWSA 4NJMB 2HT1A 5AVWA 1Z4IA 2F1RA 3L84A 3M49A 3O9VA 1V8PA 4IHJA 2BM1A 4R9NA 5K99A 3ASZA 3RYCB 3STWA 1IXSB 2XMCA 3IH5A 3IXQA 3ZKWB 2G0NA 4YQZA 3WDSA 5CNKA 1XCMA 3B6ZA 3IUQA 3I37X 3K31A 1QANA 1IN8A 1TO6A 1FUEA 5KCMA 1VMAA 4EM6A 4KTVE 2CV2A 3SOPA 2H7XA 5AJUA 2VTEA 1YGYA 3WYFA 2A14A 3EZ9A 1JXMA 2O2CA 2ZSBA 4FR2A 4BXOB 3RS5A 4H1VA 1KNQA 1YZVA 2VZ8A 5CPFA 2C54A 1FVHA 2QN2A 1IOVA 4OGGA 4RTNA 1SIBE 2B8EA 1E2GA 1WMAA 5DHPA 1B6RA 1HFWA 3VR6H 1T4GA 1VGRA 1EE2A 1GAEO 1UAYA 1C3JA 4YJFA 2VA8A 3MJFA 1X1TA 3PFKA 3O93A 1Z5GA 4NYMQ 1R0ZA 2RGXA 1DCFA 4JKOA 5C8VA 3H7AA 3F4BA 1P5JA 4BZPA 4FZRA 3EUWA 1JFFA 4UHJA 1E2LA 1Z2AA 1J7KA 2XCUA 3CRZA 1Z45A 4PYMA 4BV8A 2IXFA 4TXHA 4ZVOA 3UT6A 1XCOA 2E9SA 2WWFA 3MWYW 3PGXA 5K51A 1UM9B 5FWNA 5GIOE 1BDIA 3UPTA 1P5ZB 4WOBA 3MJ4A 2HDOA 3U7JA 3ZUGA 2CB9A 3AXSA 4MRMA 4Y2PA 5HEKA 4A82A 4ARZB 5CDGA 1XYVA 3WA6A 4PW0A 1ECFA 2C2ZA 5A3QA 4OAQA 4DDMA 3DVLA 1DVRA 3OTIA 3Q8XB 3VXKA 3GQBA 4H7FA 2YYYA 1XA4A 4ZT5A 1WXWA 2IYTA 2H31A 2CXRA 2WINI 2IOYA 1KEEB 3VAAA 4EY6A 2PU7A 3D7NA 3SR0A 3RWBA 5LL6P 5IVKA 1QR6A 3S2YA 4HDMB 4ZDJA 4EEXA 4LE0A 2YJTD 2FWRA 2OK7A 1FRZA 2G07A 4JJ4A 4NV1A 4R7ZA 4DCJA 4TOIA 2VRBA 4ZVTA 2CGEA 2QAIA 3K6RA 5J4HA 1P3DA 4F4UA 2XVMA 4CRWB 2EJTA 2VRWA 3GEDA 4HDNB 2DWOA 4B80A 1I2MA 3ZCVA 2OLKA 1TJ5A 3DVQX 1Z4MA 3E3AA 3BB3A 4KZKA 3U4AA 4C4YA 1CUDA 3BMXA 3PQ3A 1ODCA 4ZDIA 4O29A 2WU3A 1D1SA 3HB9A 2H2HA 2K5UA 1RIFA 3AESB 3AM3A 4GGPA 1YKFA 4M8SA 4OLHA 4UMEA 2XNKA 2GYWA 2M6KA 4CKWB 4RZ2A 5I4BA 1BXGB 5I7UA 3L77A 3F67A 3NVDA 1OT3A 2ZG6A 3L40A 1QQ7A 1VE9A 4J29A 4MR8A 2WD7A 3EOAI 4BNFA 4C06A 5IG2A 3VU0A 2C7RA 2YXDA 1ULHA 3RFTA 1Z0JA 1Q84A 1HPLA 4AN1A 5A6SA 1BKSB 5C35A 4LY3A 2I8AA 2OYSA 1ZI6A 3ADOA 3FBGA 3HBNA 4JJEA 4S1TA 4TWAA 5TT1A 3BIOA 1OTXA 4RSHA 1XLTA 2XCOA 3A6HA 4R8VA 1JSRA 3KEFA 5JV5A 1P0CA 3JY6A 1QKKA 1EUQA 2HCRA 1MX1A 3OY2A 5HRAA 3NORA 3UJ9A 1IVSA 3HVKA 3URKA 3D3QA 2WSSA 5DCLA 1OFUX 4NAVA 2AZDA 3BRSA 3N2GA 1F7UA 1HFEL 2COUA 3LLMA 3C43A 1JVNA 1Y8RA 3GDFA 1LA2A 1Z6TA 1RQ2A 4ENPA 1AC5A 3IJPA 2CVZA 1J07A 2BR3A 1POWA 4JMLA 3V6LA 3I5MA 4X71A 5JZSA 4EJSC 3OEEA 3DHNA 1Q21A 1R0XA 3ZDXB 1YCDA 2PO5A 2ZT5A 3LC7O 3FOEC 3GLIA 5LNK1 1Z3IX 4PG8A 1VXRA 3TGLA 5CVDA 5HF8A 5AW5A 1EAYA 2YMPA 5EEHA 2E18A 3A6ZA 1LPNA 4ILKA 5IARA 2IV7A 4MVYA 1BQEA 2EKDA 3MN1A 2P68A 2XB6A 1GPYA 1C1XB 4ROTA 1XZQA 3DHVA 1ESEA 4DBVO 1IHYA 1UQRA 5AT1A 2YV5A 4YUYA 1HEUA 1KPHA 4DCTA 1EGVB 1NPYA 5EWLB 3LH5A 3VI3B 2X4IA 2WC1A 3P9PA 1WA5A 1SXPA 2G04A 1AZSC 3GDOA 1KEUA 3HM2A 4MGEA 5B1SA 2Q45A 3WMGA 4ANFA 2ASVA 2P9FA 1MJ5A 1O5OA 1Q74A 3S1AB 1QH1B 1IWPB 2Z2ZA 3B82A 1ZAYA 1C5KA 5KVVA 3JVIA 2MWMA 2GFHA 3ZZ1A 4FB4A 2Q5IA 1PQWA 3GNTA 1UP4A 4BEJA 1U0LA 4D8UA 4CKZA 2Z1MA 4B81A 4C14A 4ZCSA 1M2GA 4DHWA 4X62B 3EIEA 3I53A 1P7WA 3PI7A 2FPUA 2Z9BA 3FF1A 3QXHA 2Z1NA 3OLWA 1R0SA 1WCIB 4ZPJA 4EG5A 4I5FA 2HN9A 3VU8A 1QO7A 3C74A 1SPBS 4J0CA 3DDHA 3Q85A 5HVNA 1NNEA 4K5QA 2C7VA 3QHPA 4CXMA 5J40A 4DR7B 5IANA 4BOYA 3T61A 1XQ9A 4KN6A 4P3XA 1I4DD 3GLUA 3NHUA 2F1HA 4OI2A 4WBXC 5GJWC 4OLJA 2XEXA 2D5CA 1L7PA 4JJZA 4I50F 2AOUB 4L1KA 3SIWA 3QMPA 1QFXA 1RZ3A 2X22A 3BMCA 3DPUA 4KAXA 1Z0FA 2ST1A 5DTJA 3HDTA 3CJTA 4MQLA 3K1AA 2EX4A 4MR9A 4A3SA 1EKXA 1GQOA 1QG2A 1G17A 3HI6A 3ODPA 4FQ5A 2DB3A 1P4GA 4BV2A 2UZAA 3K4PA 4KR9A 1XQ1A 3V7FA 4TSFD 1BRTA 4K0KB 1DE0A 1E6CA 4TWRA 2HWUA 3BMOB 4HGRA 2RI1A 3C8ZA 4DNPA 2E48A 1XEFA 4FX2A 4I50A 4RSMA 2LR0A 1UR5A 2QT1A 3OJFA 1M2HA 4I5IA 2JFOA 2P2GA 3P7MA 3C16C 4QGFA 3GJSA 4WKGA 3JVEA 3AIIA 1B3BA 3M3DA 4REQA 1F5NA 4HQ0A 2XUIA 1MA3A 3MAGA 1O6FA 3RRMA 4HPXB 3C7AA 2WPDA 4FYIA 2X0JA 1OFTA 2GJAA 1NATA 1OAKA 3LFTA 4KRGA 4S1NA 3SHFA 3RTEA 1HBJA 1SN7A 2I1WA 4G1BA 5JAZA 1V5GA 1OFIA 4I2NA 3WOVA 4Q7KA 5HA5A 1ORWA 2ARKA 4MYDA 5BYBA 1CIPA 3NV9A 1CP3A 1SG9A 3FNFA 1P17A 4ND8A 3G79A 3QKTA 5FOTA 1UZUA 2ZBGA 4DMLA 3CRQA 4CL8A 5C81A 1Q0PA 3D6VA 1E2QA 1N6IA 4J90A 3O9ZA 1L5KA 4PO3X 1HNWB 4CE6A 1VE7A 2AZXA 2AMLA 3VR5D 2PUDA 5ITZB 1RADA 2C7GA 2P5YA 3T6KA 2G80A 3OIGA 4OQLA 4YJKA 4BFXA 4JLAA 2HYIC 1EESA 1DFIA 3ZHOA 3SJAA 4F38A 1KAQA 1DX9A 1G7SA 1SBTA 3ZWYA 1G7TA 1YMVA 3C97A 2I4LA 2P79A 3EIQA 3IULA 4OA8A 4IIFA 3NU1A 5KC9A 2Y1CA 2PKYX 1YBVA 2JATA 4S1WA 4BAZA 2F6RA 4IGEA 2EGUA 3GJZA 3SM3A 1YMUA 1WETA 3N6VA 3NXSA 4BQOA 1XP5A 5ITSA 1QZUA 2Q46A 1XZNA 2AXEA 3D0OA 2Q6LA 2IYLD 4Q7MB 2R11A 2R6CA 1CV2A 1PS8A 4BGDA 1I2DA 3PV0A 1NXQA 2C5BA 2CYAA 1VOTA 3IODA 4Y2JA 1KTVA 4LQDA 2CD7A 3FMGA 3ILXA 3NGLA 1U2SA 4H4DA 1JZQA 1XFAA 3GFSA 1JQ3A 3HY4A 3GLFB 1OLUA 4BL5A 4A2CA 1WUJS 4P2BA 4MO9A 1M8GA 5AIBA 5DM70 4LY9A 1GUZA 1PFKA 1AMUA 1V6CA 5F1KA 1TMYA 2I2XB 1HK7A 1XLUA 1PJ8A 3ENQA 3FFTA 4KXMA 5CM2Z 3WP1B 3F96A 4Z1MD 1DIAA 1NW7A 2VNKA 3RFFA 1FNBA 5JWOA 3IT2A 4QTUB 1KHHA 1H0HA 2W2LA 3K0FA 1HZZA 1W85B 3AF4A 4ZALA 4GOND 3MLBA 3TVDA 1R5BA 2J9RA 3B1FA 4IF4A 4Y6OA 3DFIA 3M9XA 3T1TA 4ZVLA 2C9YA 3FBWA 1RP7A 3AZOA 4YV0A 2F48A 2XKAA 4MWOA 2X0EA 3LCJA 4QTYA 4QU8A 2UUCB 2NUBA 1ZH6A 3KAJA 3V55A 5KU7A 3ZWNA 1XTSA 4P0QB 1RJ9B 3B3GA 4ISCA 1HKUA 2Z6QA 1FU8A 1WY5A 2GJSA 2QVZX 3I9LA 4FD3A 3JYLA 3WIEA 3B60A 4LSGA 1DKNA 2EGHA 3JQ9C 2F1OA 5DBOA 2NU8B 5TGZA 4YT8A 2FK8A 2J3IA 2Z5GA 3WO1A 4HH3C 4PNZA 2XYVA 1F6DA 4JJ8A 4AJIA 4ZCQA 3TUIC 1GTMA 3VA7A 3U4MA 2JFXA 2DMRA 3GXOA 3O74A 3O5AA 4JOBA 3VYSB 2VJKA 3N8HA 4TYPA 4AMVA 3GEMA 4NE9A 2XZOA 1ZR2A 2ZJ6A 5CNIA 5JZBA 2OFWA 4CKYA 3LPNA 2P2LA 3MMXA 4ZP1A 5HFNA 3D6NB 3DMNA 3VSAA 5B4VA 2C9DA 2R44A 3ROFA 2A1TR 5JAIA 1P2SA 1YFKA 3TAUA 3KSMA 4ZTUB 5AUOB 1DPFA 3HWWA 2MTBA 3RF7A 2IU6A 2QM0A 3AF2A 1HDEA 1NVWQ 3K32A 1OTYA 5KNDD 6ABPA 5DN6A 2FPIA 5HKAA 4RW0A 4NNOA 1IWBB 3CS3A 3BQNB 2OZLB 5K6AC 2Q7OE 2ZIEA 3EG5A 4R71A 1PSWA 1XD9A 4R0NA 5BN4B 3GLIE 1AB5A 1IEWA 3IB6A 4LRSB 1PV1A 3PWZA 3AR2A 1A9QA 2X1HA 1Q0QA 3OIYA 4Q24A 5KPJA 1JS1X 1R8QA 2Z2IA 3L6RA 3VSCA 3E84A 4A0SA 3OZGA 3K2QA 4XPZA 4HFMA 2OLEA 4AP6A 2HSEA 3GD7A 5AVRA 1XEWX 3FF4A 4ZGBA 5A0TA 1XRNA 2HJGA 2VUSA 3L43A 4ND5A 1VPDA 2BZSA 3MWJA 3OQ1A 1DDOA 4QOIA 3TD9A 4AP5A 2VJQA 1JA1A 5JASA 3WGJA 4RENA 1MX9A 4GOKA 1O94C 2EJWA 1IMOA 3DE6X 4RKEA 4XWKA 2IH5A 4FMBB 4GBED 1DAHA 2RBEA 3FCOA 3FMOB 1V1MB 2RKOA 2QRPA 4BZWA 2R97A 2X3FA 1FXUA 2JFWA 4BCDA 1L5SA 3ISTA 1AVTA 1UJBA 2ZATA 2O5VA 2FE1A 2HSWA 4NBKA 2RB4A 3Q3VA 4KP7A 4US2R 1IN4A 2QGFA 1UP7A 4MI9A 1S9HA 2DKNA 3V2IA 5ED4A 1I94B 1JA9A 1TI7A 1YC5A 2DBVO 3A1TA 3H5RA 3BH7A 4HADA 1KU0A 3AHCA 3I0ZA 3B8EA 4J7CA 4LVNA 3KQKA 3VHLB 1GL7A 1TL7C 1TAUA 2R751 1LRJA 3MT9A 4Q02A 5IC6A 4ARBA 3R1IA 1MZPA 2FWMX 4XB1A 4Y1GA 3QLEA 3S0JA 3Q6MA 3ZQKA 3RR2A 2GGSA 2ZUUA 1YZTA 4HDQB 1T9HA 2XIQA 3I2FA 2CKMA 3WP0A 1ADGA 2XAAA 4NMLA 1W1WA 1JTEA 2H1LA 2J1LA 4HQOA 4JP3A 4LJ7A 621PA 5FTLA 4RVCA 1V16B 3H9BA 3AI1A 4YGYA 3KU4A 7REQA 1M2OB 1OX6A 4A36A 5JXGA 3GRRA 1P6XA 4ZK6A 1B6TA 4Z8YA 1P5HA 2Q0QA 4LDRA 1KSJA 3HYSA 5ELXA 1XV5A 3SBEA 3LPMA 4NYMR 1UOQA 1KYZA 1BS1A 1QP8A 2OGWA 2AI3A 3DYIA 3FAZA 4N9QA 5F1YA 2B3DA 8ATCA 4RZSA 1P7ZA 1SMKA 2ZBDA 3C4QA 3TRFA 4GLOA 3UUGA 3NJ4A 3P0JA 2R6HA 2C92A 3ZBPA 5AMXA 5BOSB 5HWSA 3VR4A 3EW7A 4RVOA 2HX1A 1VGVA 4QOEA 3MFQA 1CZKA 3K1TA 5AI6A 1PAUA 3GDHA 3I04A 3IHTA 3NC0C 4WLUA 1B7GO 1MW9X 3KR2A 2EBWA 1LSSA 3L8YA 4EF4A 4Q21A 2Y77A 1LBEA 1NUTA 2D0PB 4RZXA 1C30B 3UMJA 2BKLA 3LOUA 3V4SA 5H9VA 1B93A 1JHQA 2SKDA 1DZ3A 2JGAA 4Z3KA 1YFJA 4AG5A 2AR0A 4LDZA 2ZS9A 4R1LA 3WWEA 3EIOA 3LF1A 4X8MA 4RAOA 1LWOA 3LYUA 1XZMA 3W8RA 2QZSA 1NAHA 1OC2A 2V1UA 3JV7A 1G1MA 3IIMA 5GVRA 2XCLA 1OXSC 1NONA 4BMVA 4YRTA 4EJ0A 4ZEVA 1T8SA 3EMDA 1F17A 4PLTA 1NDQA 4XCQA 1NJGA 3ZU3A 2IS4A 1XRJA 2GCOB 4ZYWA 1NT4A 3P9ZA 1ECJA 2OBFA 3UMMA 1GGHA 1K27A 3EN0A 4R68A 4RMGA 1ILWA 3KDPA 3ELUA 3PICA 4MULA 5D00A 3P2EA 4JI6B 1RRKA 2W8BB 5KDLA 3RUFA 4E5KA 5FBHA 1PNRA 1B16A 1U7HA 3CRNA 3DSRA 1QRTA 5A9TA 1RQ7A 4EGFA 1S2IA 1UPTA 3WWCA 4NTZA 3JTMA 3KEMA 1O95A 4S0ZA 1FDTA 4GKJB 3TR6A 3S8YA 1BDBA 3VZRA 2AX4A 4WCFB 5KJCA 3FCCA 4KR0A 1L7AA 2FMIA 2FPGB 1JAXA 3LWDA 5AUNB 1SXJA 4XX0B 2HHJA 3EX7C 4HWKA 1PYDA 1XN4A 2A0KA 1GQRA 3CF6R 3NETA 4NOJA 3Q9SA 5LM3A 2ODNA 2N3ZA 2Z83A 4OQEA 1UPAA 3WMRA 1WB9A 3H5TA 2Y1OA 1RRPA 3RUPA 4D0SA 4YRAA 4EJ6A 5AVUA 5LOVF 1YE5A 2NXJA 1DRVA 1T8YA 2HIHA 3IHLA 4ZQBA 1XPJA 2WWWA 5D86A 4XW2A 4CM8B 4EYEA 3BE8A 5KZMB 2WM2A 3FGNA 3ZZMA 1XYGA 2FMXA 1OT5A 5SZJA 1FZQA 3HY6A 1CS0B 2OBXA 4LYDA 5ICSA 2BLLA 4DDWA 3ZDFA 2QRNA 1GZDA 1FCJA 2NUPA 4NPAA 2Q1TA 4O08A 4UTVA 4QGHA 1G63A 4XUGB 4YROA 4EFLA 2BBTA 2F4VB 4Q15A 1FYFA 2WRZA 3O83A 3QXCA 4IS2A 3RDPA 3V8EA 4ZIRB 5K4HA 5LOVA 3LPCA 1G8FA 1O94D 4KC0A 2YRWA 4ZCLA 3CUUA 2YZNA 6YASA 5DI3A 4EQ6B 1V8ZA 2IXGA 5LYYA 1PR2A 3HB1A 4TL6A 1PLKA 1QFJA 2QZ4A 4XYEA 4IRUB 1W46A 4WK4B 2DPGA 3JAWA 4XYBA 4P33A 3IQZA 3EGDB 1VMEA 4R2HA 4RD0A 3U49A 3MLAA 1DIBA 5IS2A 1GNQA 4B2PA 3BOSA 1KI2A 4AJ4A 3PJRA 3GWGA 1SIUA 3SLKA 5IZCC 5I9MA 3U62A 3SC4A 4A2WA 3WDLA 4G5RA 1O08A 2G1AA 1VMDA 3G2LA 4JZKA 2JGJA 3WNVA 5JCPA 1LTKA 1OGIA 2XYRA 3UZUA 3JQEA 3G0BA 4IDNA 4NNJA 2PXHA 1UBEA 2FPLA 3FI0A 1N1EA 4DQXA 3CSUA 3WLMA 4N18A 2R9VA 5JCZA 5LPNA 3AJAA 4A8JB 5JMTA 4BPRA 3OH8A 2ZOSA 1PYOA 4XFKA 1PTJC 1QYWA 4MS3B 3NHSA 1XZHA 1T2VA 2Z8ZA 1OI7A 4KQFA 4QARA 4R2IA 1II0A 4S24A 1JV2B 4XDHA 2O0MA 1YE3A 3RTGA 5LYJB 4DIBA 3DW1X 3K70B 3E9CA 1Z37A 3DWEX 1JEDA 2JGDA 4RF3A 3DEYX 4C6SA 4ZCIA 5FNVA 4QLAA 4B31A 3HCAA 2FR8C 3HV2A 4RK5A 3TW0A 4BLQA 2WNSA 3OM9A 4QPJC 5FBKA 1GGNA 1J09A 1RI4A 3RBAA 2FF7A 3AXTA 3PLRA 4GLJA 4OFBA 5IWCA 3K0SA 2X1LA 3QW4B 4EPYA 1MC4A 3OQIA 4NAUA 1RFLA 1Z5NA 2UVDA 3ZLJA 2CFCA 3VKHA 1N3YA 2G82A 4FWTA 5DYWA 1PGJA 1NBMA 3EE6A 3I01M 4OXNA 5AJYA 5F1PA 2HLPA 2FPKA 2IUFA 5FLYA 2F90A 3MK31 3TQRA 4F56A 1FDVA 2VUTA 3DV9A 4FMCF 5HCUA 4BFYA 1QF9A 1NSYA 2B35A 3TLAA 4AX4A 1BX0A 2P77A 3D1JA 2ZJBA 4PCLA 2NO7A 4BMXA 2QPLA 4B3MB 1N0WA 1TK9A 5H3CA 4KH0A 4ZRNA 3IKVA 3L07A 2O8VA 4WTOA 1XZPA 4JI5B 3QPCA 1ZI9A 3DDZX 4JC0A 5AXCA 3RVLA 1FFXB 4URVR 3A31A 2A0YA 4JI2B 1QX3A 4XVUA 1QG6A 3HXLA 4Y2UA 5FUVA 1E7RA 4MZDA 2PRJA 5EQDA 2IHVA 5I4KA 5KWSA 1X9IA 2JCSA 3OUTA 2PAAA 4BO4A 4UZEA 2CF5A 2AXPA 4CMGA 1J2TA 4XB6B 1KH1A 1XNJA 3T99A 4DCOA 3A14A 1E94E 1HURA 2O8DB 2BBSA 1ZJZA 3QV1A 5BYJA 5ALDA 1T91A 4Z3DA 4QAQA 3Q2KA 2R8OA 3D3WB 3PZBA 2RJ3A 4RPLA 5HW0A 3VR6D 4PC6A 1NL3A 1K8YB 1V2GA 2AG0A 4BU0A 2C4UA 3GO4A 4OB6A 1V9SA 1Y3IA 5L3SA 3LQ4A 3H9QA 2BIFA 1RXCA 3EARA 1I2ZA 3H4VA 4MKGA 1Z2DA 3JALA 4FEAA 4ZYVA 2HADA 1JBQA 1E6WA 2GJ8A 2IKSA 1PNQA 4IXNA 1DINA 1W2HA 4Y2GA 3H04A 4P1ZA 1REQA 4LZZA 3R7WA 2WJVA 1G5PA 1JDBB 3FSEA 3VU9B 3L0YA 4HQRA 2OC9A 2D62A 2YJ5A 2ZK7A 4NK5A 4GPD1 4KE8A 2QBYA 3FHOA 4MW6A 3KZVA 5EP4A 5JSQA 4XTCS 5KKAA 2V7TA 3OF3A 1AKWA 2D4AA 1FS6A 3M4YA 5DNCA 1DB3A 4QJ5A 1RR6A 4LF7B 2DWPA 4CNBA 1BXRA 3H2BA 1GZ3A 1SOVA 1JYSA 4TVBA 3U7HB 5ALOA 4EQZA 1U2ZA 1Z5WA 2E1RA 5ITZA 3H84A 3DGFC 3R23A 3DM5A 3ZYCA 3K2IA 1PR0A 3VI4B 1VPEA 4W5TA 4AI6A 3AF6A 2IXBA 3OTGA 3NCHA 5BY2A 5JAPA 3NS7A 3NZEA 4ZOBA 2JHPA 3O4IA 1A50B 2F8MA 3M2TA 4YAEA 3U5TA 3JQ8A 2B34A 3P1JA 4RJJA 1SCUB 5EE1A 3EIWA 4JOSA 4LISA 4A7PA 5HQTA 2CYBA 1MO3A 4XZ3A 5KAPA 4UQOA 4F5ZA 5TVKA 1T25A 5KOHA 4UTRA 2YR0A 3PCXA 2WOOA 10MHA 1NQAO 2J07A 1V9LA 3OOJA 1KJQA 4Q9AA 2RCYA 5BWOA 1WHSA 3MT0A 1SBIA 3NUQA 4RPCA 1OAAA 5YASA 4C5AA 1B8NA 5B37A 2Y1DA 4EG7A 3ZZUA 3WI7A 5FV7A 1Y6JA 1ESZA 1X2EA 4MV6A 5K5EA 1J9GA 3QUQA 1P91A 3A2KA 1ENPA 2HD4A 3COYA 3W8EA 4BQNA 1QQ5A 3GGCA 4GP9A 1H0RA 2C94A 1P1BA 2JAXA 2XNDD 4ER3A 3F7TA 2LGJA 5F2OA 2I6SA 4FHDA 5BN3A 3BTOA 1V2HE 3JQBA 4JYZA 3PF9A 4U7PB 4Q7LA 2H7VA 4P38A 1KH3A 4S2EA 2WHPA 5HP4A 1YQUA 3DOFA 4II3A 1LW6E 1VMKA 3H4TA 3OURA 1NBOA 4AXBA 4C1BA 2NN3C 1X14A 5B4UA 1JR3A 1N6RA 1QCDA 1W0JD 2H2IA 3HLKA 3IDZA 1P73A 1EDZA 3F9IA 1P1FA 1P39A 1L1EA 2YOHA 4JUIA 4QBTA 1NUPA 5KAMA 4BKUA 1QJ4A 3RF6A 1D2GA 5KYUB 2WU4A 3LRTA 4L0QA 2FH5B 5BQ5A 5BSTA 5BVHA 3NX4A 3LVFO 3U61B 1FSZA 3IR5A 1RYNA 2AYYA 2XHEA 3O3MB 4IIHA 5EJAA 5T6MA 3V8QA 2ODWA 3JYOA 3CKLA 2WAXA 1FS4A 5IH3A 5FX2A 3AHGA 1M33A 4NMHA 4CQLB 1VL5A 4D9JA 4HDAA 1ZM3A 3MUNA 1PSZA 1BS9A 4HJXA 2VYNA 3WYCA 2EDAA 2PGOA 3GP3A 3AR7A 1Z63A 3SZMA 1SM4A 2A59A 2VDUE 3NW9A 1E5QA 4X6XA 1H2XA 3COWA 1PS9A 1AKNA 2LDXA 1EDEA 2HAEA 1D0IA 3KJGA 3VNRA 3GQVA 3DAHA 3C98A 2G09A 5DBIA 3T4PA 1J4AA 2X23A 3IIKA 4MV7A 3ZVRA 4ECEA 2PNFA 2O7SA 3GGPA 2R6R1 1MABB 4PO8A 1TAQA 4X20B 4UEJA 3QP9A 4NZZA 4ENUA 2FDXA 2W71A 4JJ6A 5AXAA 5DYIA 2CHUA 1D2CA 2GNOA 3KPWA 3PQDA 2Z09A 2ZYHA 2I7XA 1KFCB 1WKCA 2YVKA 2IFTA 1CU1A 4OBEA 3KHSA 4P86A 1ODSA 2DT5A 3QIAA 1SPXA 3W1VA 5BSKA 1KQFA 3EPKA 3S1SA 3SEQA 4GL4A 3NP9A 3ETDA 1IM5A 4RD4A 2FSGA 4QL3A 5DTMA 1DADA 4M98A 1E3LA 2FN8A 1BZYA 4BNIA 4KBFA 4XVQA 2A1IA 4FYYA 5H83A 4Z1OA 4N48A 4PQFA 3RYHA 3DOOA 2KLBA 2HRBA 2WG0A 2N0SA 4C5CA 1Q1EA 3JQPA 3SEAA 3WFIA 2NSLA 4MV9A 4NS1A 3O2NA 1II8B 2IYPA 3AIMA 3GL9A 1GYRA 2WVAA 2FZKA 3MUFA 2VP2A 3V8MA 5KOJA 3WWZA 5JJ5A 3MMSA 4PSVA 2C2BA 3C2QA 1W4LA 2EKBA 4C0BA 2W6QA 4IYRA 3TE6A 3WK5A 3QKIA 1E58A 3HB0A 1WHTB 1Z47A 3LPAA 1XZEA 2PTGA 4K9KA 2NSHA 2PH7A 2BEVB 6GPBA 4CKEA 1XJCA 5F35A 1GTVA 1H9BA 2PR7A 3COZA 3VH2A 3ZK7A 3GFVA 1CUHA 3G2JA 2HF8A 1W4CA 3OFKA 3W2GA 1DCTA 3A6LA 3ADPA 1F8UA 2I3AA 1T5HX 2OXFA 3NXKA 1GTZA 1V7PC 5HS6A 3WKBA 1TVEA 2NZYA 4DQ0A 3AI2A 3NTUA 2WHYA 4RTQA 3ZJ4A 2B99A 4X94A 2BY4A 2IY9A 3BXZA 2RHLA 1YB5A 3ZD8A 4OX9B 3IHWA 3Q9UA 2PVPA 2QTRA 4XM2A 1OQAA 4KYIB 2GM3A 5LCXA 1OB5A 2VBFA 3CR7A 4ARUA 5CB6A 4N01A 1GU0A 3GB9A 3A2MA 2BR5A 4OTZA 4WRRA 5DIZA 3G89A 5AW4A 1UJNA 2YUIA 1KOGA 4O5OA 4GXTA 3OLZA 5CHYA 4WY8A 1DIRA 5TQJA 3HUFA 1AK2A 3QW2A 1I3OA 1PR5A 2UUPA 3IJRA 1G7RA 3L6DA 3FWZA 1NTOA 1E3DA 1NOJA 3PC8C 1AO3A 1A8UA 1I2CA 1C7IA 2FRDC 1MB9A 4BLUA 2DKFA 2WIJA 2AFRA 1ESCA 1H8ED 3NTXA 3TOVA 4Q6BA 1R4MB 4W4TA 4OHBA 4KTTE 4MK4A 5TQ2A 3NIGB 2FXIA 5KMGB 4DV0B 3R8CA 1QWSA 1N5JA 4LMPA 4R8LA 3TK1A 5BR8B 1EGQA 4DY6A 2BTQB 3WHIA 3ITDA 4BTLA 4OK3A 3W05A 4Q4AB 4FYHA 4HWPA 5CHEA 2FJUA 1JT2A 1NZFA 3JQ7A 1CUYA 4D9GA 3EAQA 2BI4A 2HXSA 4XD7A 3FI9A 1E92A 3EVFA 3PNSA 1Z4JA 2F3PA 3NKFA 3WLRA 4EKGA 2P90A 3FYUC 4I36A 2QRZA 1E63A 2IV3A 2F64A 1LLUA 4GI2A 5DMHA 2QGNA 2WF8A 3WLJA 4DLPA 1P1RA 2XDQB 1KY3A 2RGNC 1OR8A 2H07A 3H97A 1X7WA 2EBFX 2ZYGA 4DM4A 5JFTA 4RM3A 2Q3DA 3HHPA 4JIMA 2V6BA 1KHTA 2Q3CA 4LXQA 1T43A 5A7FA 4D0RA 2P6UA 5L3QB 3KOZA 2J67A 4W7SA 2AC7A 1B4DA 2OFOA 3G1WA 3S2UA 2ZUCA 1R50A 4LXYA 4LRQA 2R60A 1AUVA 4BJ1A 5EUQB 1RYFA 1J20A 3B36A 3HWSA 4J1TC 3I05A 3ZY4A 4KREA 4YRRA 1H1LA 3R41A 4N5LA 4M86A 3LCRA 4Z2YA 2CFSA 2JLVA 4BU1A 4N7JA 1HC7A 3P9NA 5DI9A 4OGLA 5F5NA 4UOQA 1TEXA 4BX9A 2EQBA 3MUOA 1OXUA 3C48A 1FBTA 4MKRA 4Z9XA 1E0DA 4YCNA 2FG7C 1TQHA 2HEGA 2VN8A 1I0IA 3WGGA 1K7CA 3L41A 4FOPA 4OUKX 4N47A 1BU5A 1NLFA 1WMBA 2C2YA 4Y6GB 3QFFA 2WWYA 4CCYB 1DWOA 2CWDA 4ROSA 4F8JA 5K45A 3QPAA 1G21A 2J48A 2PQ2A 1V4NA 2P4QA 1DAMA 2AF4C 3PSHA 1X6VA 4N3GA 4JSTA 4YA6A 2RG1A 4N0DA 5FT9A 1IUKA 2P9JA 1G19A 5GONF 1L8OA 1IOLA 2CNOA 4UPEA 3L7CA 3ONDA 3N0WA 2W93A 2EFCB 1UPCA 1KE2A 4I6EA 3V8NA 1BEUB 1Z56C 2F43B 3H17A 4MQBA 1IBCA 1QFSA 4KLCA 5JW6A 3ZY2A 4D0LB 1Q0LA 2F67A 2LIPA 2HOQA 3BJMA 3CUTA 3G2QA 3KYCB 4RCVA 3ZWOA 1J6UA 1FNDA 1L5VA 2OO5A 3N7UA 3PDWA 2A1UA 1Q7RA 1RNLA 4TRNA 5HGXA 4P8RA 2XZLA 4BHTA 3G0GA 3MW8A 4YJGB 4WASA 2VNIA 2GK7A 4HB0A 4DS3A 1T3TA 1TA0A 2O2JA 5F4BA 1VKHA 2MINA 2QN7A 3AU8A 2WVGA 3DMYA 3FDXA 2XPCA 3L1VA 4HUQA 1D1PA 4IWNA 4MP3A 1QFYA 4OQ4A 4CLOA 3IBSA 3IV9A 4PYKA 4PYIA 3H2HA 3DFFA 3AHHA 2D5IA 1VG0B 1YJQA 2GXUA 2B4YA 5HDBB 4DV6B 3ZDCA 1H3NA 1JR3E 3DLIA 3MCUA 3MGAA 4I4NA 4I99A 3OE7A 521PA 1Z13A 1G60A 1ZK1A 2V6GA 4DB2A 4QX6A 2GYVA 3C3PA 3QSYA 2CDRA 2VK4A 5CX1A 3SIRA 2QM8A 1YUNA 5CG1A 2QLJA 1TU4A 2O0LA 4KW7A 1O89A 3TXYA 4KIGA 4BGEA 4M4SA 5G4LA 2Q9CA 1SA0A 1G20B 3D9QX 3OZRA 5K0SA 1DRJA 1HEYA 4BWFB 1U2QA 4E3ZA 1PX2A 3IT1A 1M8JA 3UICA 4RE6A 1XQYA 4W82A 1G41A 3ECSA 4XLTA 1UIRA 4MH0R 1I3KA 1J1ZA 1R5NA 1ZIXA 4D8TA 1FFEA 2DULA 1JE1A 1H05A 2EKPA 2VCEA 3G0CA 3BFJA 1R8XA 4V39A 4YB8A 5D3QA 3HBAA 2BPOA 1QU3A 2DTDA 1VCOA 4IKPA 4KO8A 4IDEA 5KNCA 2A5JA 1MXFA 3AP2A 1V41E 3C3XA 2Y2VA 4KJXA 2FEPA 4BJ3A 2WE7A 3H1AA 1Y63A 2WJGA 3P96A 2OGZA 4Y2QA 1DJPA 2I6GA 3EUEA 4UPVA 3KWMA 2FSVA 1O9HA 4QDOA 2IOFK 5E9QA 5T8KA 4MO2A 3NAGA 4P83A 4QTXA 1SOWA 3CRVA 5ERXA 3OHPA 4DUGA 1MHPA 1JR6A 3DQPA 2GRAA 2OG2A 3LMKA 4U7FA 3U16A 2C5EA 4MVJE 2MSKA 4YCMA 3TBHA 5LQUA 1NQ5A 3I9NA 4B4WA 1RYBA 2GVDC 2WM8A 2GHIA 5GV8A 1JJAA 4RHCA 421PA 3F1KA 3LY9A 5DO9A 4EUHA 2QXTA 2GPBA 2NV0A 5HKOA 5HJEA 5JATA 2O8FA 3EZLA 2ZJ5A 3ASVA 5FNZA 1QRRA 3RT7A 2V3CC 4DR5B 3TS1A 1B23P 2Y0EA 2YV4A 4RDIA 3IS3A 4GWGA 4KLAA 2JI6A 4X7PA 2XWJI 5HYVA 2J9ZB 1D0SA 3DDCA 3HA5A 3INTA 3GZNB 1T9GS 1TJ4A 5G3YA 3R7FA 4C22A 2J0VA 3CH4B 8LDHA 4NAHA 3FFXA 3SQLA 4E6PA 1BDJA 1J42A 1XYYA 3NEYA 4OXIA 4CMEC 4QDUA 1B43A 4YN3A 2B4TO 2CLMB 2JBWA 2ZI7A 1BXZA 3EZGA 3GT3A 4G26A 4I2VA 3TQTA 4DKXA 3ZDDA 3MWEA 3DZBA 3CLUC 1Z33A 1KI6B 4UFNA 4YIKA 3W2HA 6CHYA 1XXHB 5KSOA 4Z0PA 4Y6LA 1HT3A 3IALA 4HY3A 5BRAA 3BAFA 4WUVA 5AWFC 2WJWA 3EXAA 3FPEA 4W8HA 1LH0A 2J4CA 3VKGA 3K09C 4A26A 4CU2A 1R4NA 5K4AA 1FDUA 4YK7A 3SZUA 4V2UA 4ZC1A 4HB3A 2Y1EA 1P4RA 1RCTE 1Z7BA 3KLMX 4FFLA 3X44A 4EPWA 3K73O 4JC5A 2XQGA 5FUBA 2R84A 2W2MA 3KSAC 2HSJA 4XX1A 1FMJA 1B1CA 1H69A 3HJCA 4P4NA 3OFSA 5E4FA 5EWJB 3A1SA 2QVCA 3RIGA 5CA1F 4B5KA 4LXGA 4LYYA 2HNBA 3ITNA 4R6XA 5CBKA 4H7IA 5H8WA 4NBVA 1S89A 4EMUA 1GIAA 1NBIA 3GCXA 1QORA 3BGVA 4CLXA 1E2IA 2H52A 4RFSA 4PM4A 5LP6A 5JBQA 3H2JA 4KPGA 4GPTA 1X2BA 5DW3A 5EXPA 3VSBA 2GNAA 2AJLI 3GJ8A 5B36A 4HQ6A 3FCYA 4WGFA 2HY7A 2VQFB 2HHCA 4PGAA 2TMYA 3EC1A 2E4AA 4EHIA 2Z6VA 3GRYA 3M8KA 2F17A 2W58A 4GVLA 4MINA 1D8TA 1EWRA 3P9SA 3QVTA 3VHQA 1PD0A 2QTGA 3ABQB 1GQYA 5BP7A 1KQPA 5CA1A 1IEVA 5D2CA 3SS7X 5DXAA 1L4HA 4QNRA 4ER7A 1CR1A 3AJRA 4TRRA 4EHDA 4XJXA 3W5UA 2GA9A 2E4YA 2I9PA 1TM2A 1U5AA 5JBNA 4KQ1A 4D0GA 3IOYA 4A4DA 4RU1A 2H1SA 2Q1WA 1LV7A 2IYVA 5LDGA 3PUVA 1ZMTA 3X1JA 2X9GA 2XH8A 2ZVJA 3FVVA 2EZUA 3H6GA 5A4DA 2I1QA 3KK0A 1A5AB 2YCLA 3GLVA 4ZOAA 5FOXA 5JLJA 3FNEA 1TM3E 3D1LA 4YGXB 5K3FB 1XCJA 2BDTA 1E4VA 2ORIA 3T0FA 4DLWA 1WV0A 1ZD1A 3F3KA 1HF3A 5BSGA 2ZYUX 1A5SB 2JANA 2BFPA 3CNBA 4AS3A 4DG8A 1UXIA 3W6ZA 2HCFA 1Z7EA 2CCKA 4WFJA 3SJZA 3DE5X 2GCNA 4E2FA 2BZ0A 5CJ2A 5HJ2A 4YRMA 2AZMA 1U3FA 2QQFA 3ILYA 5IAAA 3UW3A 3BIXA 2C95A 4JIGA 2A78A 2JZCA 4OY3A 1SUAA 3FIJA 1NF8A 1M0WA 3PIIA 3BE6A 2GRJA 3RODA 2C82A 1Z74A 4F91B 4BO6A 4CV3A 1FIUA 5HOEA 3RRJA 2CY0A 1W1UA 1L4MA 4NYJQ 2DFKB 1P44A 4QD3A 2ONYA 2VF8A 4QUHA 4IBOA 1Z2OX 4AJHA 2XDYA 3AR8A 1G21E 1XVIA 3F2IA 3G2OA 3PUJA 1E3EA 5ICFA 1ISPA 4EUEA 2WAMA 2PR2A 2ZI6A 4L78A 2B7CA 4Q16A 1UBHS 5DPMA 4EFMA 4FYWA 5H59A 2RGBA 3SQDA 1KEKA 3S55A 5JDIA 3AEQB 3FYTA 5DV9A 2KW5A 3IKLA 5ALTA 3S2SA 5KIAA 4JYCA 1LTHR 1KK1A 3HGMA 4XUDA 1U7ZA 2A6PA 2C2KA 3BWDD 1GSHA 3RBZA 1RAGA 4MW0A 3CN9A 3KXDA 5IDQA 1TTHA 2FWAA 4WEOA 3N6RA 1I9CA 4X44A 1OH8A 3QWIA 4Q3EA 2FP4A 2HI0A 1XQWA 3W0LB 2FN9A 3AG5A 1COWA 4IIJB 4JU9A 4QXPA 3IEIA 2VKTA 3UT5B 4D5GA 4K6MA 4FGWA 1G55A 4NK4A 4CT5A 3BFVA 4DNFA 3PWTA 1T10A 3CLUD 2WNIA 1P3JA 4FLFA 2QTTA 2WUVA 4PS1A 4C20A 5IJ9A 1M2EA 2J85A 3REQA 4MV8A 4RPGA 4CM1A 4B73A 1Z73A 2QF7A 3SZ3A 4D99A 3G2NA 5DRYA 3G1UA 1ULZA 1U7WA 1GM5A 1U0GA 2HK6A 2VVTA 1Y9DA 4ZVVA 1OU0A 4V02A 1P4AA 4R8MA 1M7BA 2OSBA 1Z4LA 3VNUA 2X9VA 3QMWA 4ND2A 4B7ZA 4HSEA 1NBAA 1R9NA 1U3GA 4PFQA 2AR9A 4UOZA 2QZZA 3KUUA 4C2UA 2FUG6 2XA2A 4JHLA 3ZGYA 4LKRA 1E1RA 5JO9A 3I6YA 1QP0A 4XWAA 1GPBA 3K16A 4RACA 2I2BA 4O59O 4TS4A 4YJ2F 3E8XA 5B3JA 3U4CA 1YH3A 3VISA 2FI1A 2PHZA 2Z8YA 1U3UA<