3IMGA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.8 ang resolution in a ternary complex with fragment compounds 5-methoxyindole and 1-benzofuran-2-carboxylic acid
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
288
Chain Sequence
b'IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Application of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 95
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3imgA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3imgA01
2X0KA 2DR2A 2QJOA 3D6VA 3PXUA 5TGTA 3LCJA 3GMIA 4YP5A 4CDMA 2A1TS 4ND7A 4EG4A 2HGZA 3PNYA 4JXZA 5HG0A 1F4LA 3KT8A 1EUYA 3AL0C 3QTBA 2JA2A 4MWBA 3FI0A 4MW6A 3IOBA 3A05A 1FYDA 1JIJA 2YY5A 3CLSC 5IJXA 1N2IA 1WXIA 5HUHA 2E21A 4NATA 3AFHA 1O95C 3IH5A 1U7XA 1KQNA 4AS1A 4MW1A 3CA8A 4QREA 4E1AA 3P0HA 4KPUB 1OWPA 2Z3VA 3UOWA 3ZJTA 4EG7A 2J09A 1MB9A 1N2GA 3HGMA 1M8PA 1PFWA 3MMXA 2IELA 3HL4A 4ZCPA 1QQTA 3OTWA 1GPMA 4G6ZA 1KH3A 3FWKA 4A91A 3DO8A 2QTMA 3CLRD 4U8HA 4MUJA 3SZGA 3HMQA 4WNYA 2DEUA 2A84A 3CLUC 1VL2A 1KQPA 4DNXA 2A86A 2JAXA 4ARCA 4XFDA 4AQ7A 2A4MA 1N1DA 2JANA 3PNVA 1IQRA 4R0NA 3IOCA 1GTRA 4EG1A 3IUBA 3FDXA 4MWCA 4NX2A 3IVGA 4ZCRA 1T9GS 3DLAA 4J75A 1H3NA 5TEWA 1V47A 4KR6A 3LE8A 4NDAA 3QTTA 1PFYA 5J59A 2IJGX 1PG2A 3P0IA 1NURA 1OBCA 4MVXA 1TEZA 1YUNA 1EUQA 2X1LA 3H9CA 3L92A 1P7PA 1ZH0A 4MW2A 4K03A 2PZ8A 2CT8A 1WJGA 2R5WA 4NAHA 2J4DA 4EG5A 2QTNA 3ILVA 1N2EA 1J20A 1OBHA 1WQ3A 1NYLA 4DDHA 4JXXA 3FG9A 1I6MA 1QJCA 2OQ2A 4NZPA 4X0EA 3RHSA 1J1UA 1O5TA 3MUEA 5LFAA 4DJAA 2ZUEA 1TYDE 2D54A 1LI7A 3ELBA 1R6UA 3SEZA 3G6KA 1K92A 2NSYA 3COWA 1JGTA 2BTEA 2IP1A 3KFLA 1N2BA 1KKUA 3ZIUA 3N9IA 5EKDA 1NUUA 3SDBA 1K4MA 3D6UA 5AHWA 1IQ0A 2DPLA 4MVCA 1MC1A 1KH1A 2DXIA 3DPIA 1G8FA 2A1UB 1LW7A 4ND6A 3TZLA 4MWEA 3A2KA 3KT0A 3Q12A 1M1ZA 2QUIA 3S3TA 3X1JA 2D13A 4ZT2A 2J5BA 3DV2A 3GLVA 2A1UA 1GAXA 3UK2A 1O95D 4BWVA 1N3LA 2WQ7A 3HFJA 2YWCA 4XFJA 2O5RA 2V0CA 1GTSA 1WXEA 4ZT3A 5DEOA 1O0BA 1U0BB 3JXEA 4MAFA 2GOYA 3N8HA 1K4KA 5FO1A 1TYCA 2HMAA 1NP7A 4MUFA 1NUTA 3RK0A 1YUMA 5DK4A 4I6GA 1M8GA 4Q16A 3GUZA 5FO0A 1QU2A 1QU3A 3COYA 1PFVA 3FHJA 1WKBA 2AG6A 1QTQA 4DDMA 1MAWA 1J09A 1H3FA 2X3FA 1NUQA 2RE8A 3CLUD 4K0RA 2WQ6A 1H3EA 2A7XA 3CVWA 2QTRA 1OD6A 4ZT7A 4YBRA 4MWDA 1O96B 3G59A 4MUGA 1MB2A 4MW5A 3SZ3A 5K0TA 1YI8A 1ZJWA 3E27A 1MBZA 2Z09A 4HJXA 4L2IA 4S1OA 4OUDB 1DNPA 3IODA 4ZT6A 1JILA 1WZ2A 1O96A 4PBRA 1O97C 1VBMA 2QJFA 1WXGA 2WSIA 3NBKA 3FOCA 3PRHA 2WB2A 1VLHA 4OUDA 2E0IA 3UMVA 1XNJA 5H7XA 1SURA 4MUNA 3AKZA 2A88A 4HPWA 4G5FA 2QUKA 3A4IA 4JZYA 3ZGZA 4ZT4A 4CQNA 4EG3A 3ND7A 1WOYA 4WSOA 4ZT5A 3ZXSA 1IVSA 1TQ8A 3IUEA 1KQOA 2J08A 5HUJA 1X8XA 3ZJVA 3ND6A 1JZSA 3UY4A 3U1VA 4MUKA 1NI5A 4H3SA 2YWBA 3SP1A 4HK4A 1T6ZA 1O94C 3SEQA 3TQIA 3HZRA 5DB4A 3X1MA 2XRZA 1HYBA 2G36A 3M5WA 1EXDA 3P0JA 3OP1A 3CVXA 2QUHA 5FNZA 1I6LA 4DE5A 2DLCX 2DUMA 1KORA 1O0CA 1U3CA 4JFAA 3NBAA 4CT0A 2E18A 4U7JA 4F4HA 1YIDA 1ZUNA 2A1TR 5F23A 1M83A 5TS2A 4DLPA 4ZCQA 1JIIA 2CSXA 1MRZA 1XJQA 1TYBE 2QJTA 1I2DA 1WXHA 1JHDA 1T6YA 2C5SA 2VXOA 1O6BA 1MOPA 4CDNA 3KT3A 5IHXA 3TS1A 1MJHA 1WXFA 3P52A 3G5AA 3CR8A 5BNZA 1IH8A 2PZBA 3H9BA 1U7DA 2D5BA 2RD2A 2J07A 2XRYA 3CVYA 3FIUA 1QNFA 2ZP1A 1IHOA 3H99A 3CLSD 4PBTA 3BL5A 3AG6A 4GRIA 1JEEA 2OV4A 3CVUA 4OJMX 1UFVA 1M8JA 2E89A 5J5AA 2CV0A 4YP6A 1J1ZA 2EL7A 4P2BA 1U3DA 1VBKA 4MW4A 3RBAA 1EFVB 4MULA 2B7LA 2CYAA 1ILEA 2BYTA 1F7UA 3K9WA 2I1LA 3VGJA 3CLTC 1F7VA 3IMEA 3IDFA 2CV1A 4MUIA 4MQ6A 1YIAA 3FNRA 2GM3A 1ULHA 1JZQA 4XSVA 2DERA 1V8FA 3RK1A 4G5YA 5KWVA 2QUJA 1TYAE 3Q4GA 1EFVA 5DASA 1G8GA 2PIDA 3PNBA 1KAMA 4MLPA 1N78A 1X6VA 4RPIA 1MAUA 4HJRA 1O97D 2V0GA 3ZJUA 4PY2A 3VU8A 1T9GR 1WQ4A 4R2LA 1T6XA 3N05A 4L2IB 1J21A 1NUPA 1KP3A 1N2OA 2CFOA 3TQOA 1XNGA 4MVYA 4R2MA 1PFUA 1EFPB 1GLNA 1R6XA 3C8ZA 3ISJA 4I6JA 4I6EA 2CUZA 1GZUA 3CVVA 3FY4A 4EG8A 3H97A 3LOQA 3F3MA 2EJCA 3A04A 1B6TA 1F9AA 1EFPA 1Y42X 1LI5A 1KH2A 4U63A 1FFYA 5LM3A 3IMCA 4MVWA 4DDKA 5H16A 5K0SA 1O94D 2H29A 1JIKA 2CV2A 1K97A 1R6TA 3AG5A 2NZ2A 3UC5A 4KPUA 5J58A 4EGAA 1QRUA 4KR9A 3AIIA 4MW7A 1TFUA 1IFXA 2AZXA 4ARIA 4NAUA 1CT9A 1NZJA 2O8VA 3RJZA 1OWLA 4EG6A 1JEDA 1OWNA 4MW9A 4KKVA 1Q77A 2CYBA 4F3RA 3NV7A 3IMGA 1IQUA 1NSYA 1WY5A 3IVCA 1I6KA 1COZA 2PZAA 1N75A 4MW0A 1OWMA 1N2JA 2DETA 1PG0A 4YMIA 3CLRC 1GN8A 4MUHA 3SYTA 4FZJA 1M8KA 5KCMA 4ZCTA 1M8FA 3K32A 1JECA 1N2HA 1VBNA 3ND5A 1QRTA 3FH0A 1OWOA 1A8HA 3IVXA 1IRXA 2H2AA 4TS1A 2VTBB 3RFFA 4J76A 1KP2A 2PG3A 3TNJA 3Q10A 4EFKA 1RQGA 5TEVA 3MLAA 1Q19A 4PBSA 5JBNA 1S4MA 4RUKA 1QRSA 3HV0A 1KAQA 4QRDA 3TZEA 1G59A 2GKSA 3COVA 2VTBA 4YP7A 1BS2A 1D2RA 2ZUFA 1XNHA 2PXHA 3COZA 4KR7A 3INNA 3FETA 1ZH6A 3MXTA 1YULA 4EF6A 3CLTD 3VRHA 4UZFA 5LLTA 3MLBA 2X1MA 3QE4A 1EE1A 2YXNA 2HZ7A 1KR2A 3KT6A 3ZUGA 3L93A 1N77A 4GU5A 3IOEA 4Q93A 1J70A 2PFSA 4QBTA 1Q11A 2CYCA 4JYZA 1NUSA 2Z08A 1G8HA 3X1KA 5KHAA 2TS1A 3N2YA 4MUEA 1EJ2A 4UZEA 3I05A 4ZCSA 3H05A 3ZXIA 2AKEA 1JMVA 1H1TA 1Q15A
chains in the Genus database with same CATH superfamily
1QIJA 1SBHA 4LOKA 2DR2A 1INLA 1NJ5A 4W7IA 4UM5A 3REFA 4B2LA 2ZQ5A 1JS1X 3WDLA 3WDMA 1E63A 4NP6A 5A02A 4QM6A 5GJCA 2R9VA 2HJVA 3B36A 2CK3A 2J3IA 4FS3A 4D2IA 2Q8QA 4L74A 1G8KA 4X1YB 1R8SA 1Z73A 4GBED 1JR4A 1F4LA 4YQZA 4F5WA 1HUQA 4BTEA 4K0KB 1NNUA 4KLRA 4EABA 2NO6A 1IJFA 5EYPB 2AXEA 4DG8A 2YJGA 3KHKA 4IP0A 3IBCA 1RLUA 3MIIA 4EA7A 5BWCA 1BXRB 5KMGA 4MV3A 4R7GA 3G2HA 2F9MA 3KWMA 3JSAA 4G09A 5U4QA 3VR2A 4D0SA 2GARA 1OZ0A 3JW8A 1NNEA 3VSAA 4LV6A 4EM6A 3DCNA 1OA1A 2R2GA 2WBLC 4CZ2A 1QHFA 2BFPA 3EVAA 2PSHA 3P0HA 4DZZA 4DUYB 3TN7A 1KO8A 2R6GA 2OCXA 1PFWA 5C1DA 3ED5A 1UADA 2ZG6A 2OFWA 1LGYA 2DPGA 1B6RA 4O8ZA 5EEGA 1I2MA 1JFFA 5F2EA 4CTNA 3Q0IA 1T8TA 2QTMA 1FTSA 2L82A 2ZSJA 2PMDA 2FQQA 5HZMA 5BSFA 3OPYI 16PKA 3LBAA 5AXDA 4GMKA 3K8QA 2Q4TA 1ZI6A 2H18A 2RKBA 3D6MA 3HJTA 3KEMA 4M9ZA 5COQA 4YAFA 5F5LA 3T5DA 1FVOA 4KI7A 2HJGA 1WMFA 2FW8A 4E88A 1E7SA 3DBRA 3EZ6A 4NU0A 4TN5A 2QY9A 3WGKA 1PDWA 1DV1A 1YQEA 4ZCLA 1R1DA 3GPIA 5BYAA 1J5PA 3D8HA 4R31A 1VJTA 5A5GA 3FZYA 2E3JA 4J9VA 1G4UR 1GUBA 4IJWA 4OK5A 3QPVA 4GMHA 1QWOA 3TL6A 2JJYA 3K71B 3Q8WA 2LRHA 5THXA 1Z7EA 2ZBQA 3Q5EA 1IIBA 4J7XA 5D5HA 2WNSA 5DHTA 3SYMA 1WLYA 3E9QA 3NXSA 4KXNA 2HRCA 4BVFA 1TEZA 3DUWA 3FFTA 1T9BA 3WLHA 3HCEA 4EYEA 4DILA 4B6PA 2H7XA 2QRKA 2Q2VA 1X1SA 2WSYB 5HDQA 3QKUA 2HRDA 1IXSB 4OLAA 2R5WA 2H5JA 2DECA 3TQFA 1E5TA 4FFDA 2VAMA 3VJLA 4F9EA 1BKDR 1XK7A 1QWSA 2X2EA 3H7IA 3EPJA 3ET5A 4Q6BA 2NPOA 3WGJA 1FDTA 4MV9A 3HBFA 4LRQA 1O89A 3AEQA 1XG5A 2AZMA 1FQJA 4BNZA 1KMHB 3HJBA 4Q12A 2D8AA 2I6TA 1MG0A 4RD3A 2OCYC 1EP2B 3ZCQA 2H2IA 2YQ5A 2JFFA 3ZCPA 2HV8A 1MB3A 4EFMA 4HTFB 2OQRA 1I3NA 4BMNA 1QX4A 1HOXA 1VMAA 1NAHA 4R9SA 2ZSDA 1W88B 3G6KA 2DFPA 3KEGA 3G13A 3K2IA 4XWTA 1W581 3K2QA 3BGWA 3ETLA 2C5HA 5E1OA 3VMMA 4IQ4A 4RDHA 1AV6A 2O8CB 3PC4A 1E9VA 4QULA 1GILA 3DR5A 2XLCA 3ELDA 4NZ9A 1U9ZA 1YI1A 2I54A 2YHIB 1JLRA 4ZHQF 1IEVA 1E4EA 4KHPB 3TX2A 4I36A 2O1WA 3EJ6A 3W2FA 1CY4A 1MC1A 3CPEA 3HV2A 3OZXA 1AQYA 1Y81A 5A2GA 5A5EA 2PX3A 2DXIA 3EG5A 4UJ5A 5SZKB 5J1SB 1YNOA 2JBAA 4YUAA 4KQ9A 3ERCA 2C95A 2GYUA 1ABBA 3VA7A 4IZ6A 2FWAA 2JGLA 3MS2A 5JNLA 4YRBA 4LF5B 1GPJA 4B8ZA 1ZJ6A 3A4TA 1OE0A 4RF3A 4EB0A 3BRWD 1Q20A 1SQSA 3OPNA 1L5ZA 4OQLA 4DV4B 3BMNB 4KNYA 3PHLA 2OBMA 1FQWA 3JWGA 4LHSA 4HVCA 3O38A 2D1YA 1EK5A 3PHBE 3GA7A 3DAPA 5LZ5A 5CNKA 5KNBA 3ESYA 3VR5A 5LQUA 1KWKA 3HFJA 4GICA 2QBYA 5A0TA 3FOBA 4QPCA 4YRZA 5EJMA 2IYZA 3GRUA 1PEAA 5DEOA 3TVDA 1HQDA 3ASZA 1T2AA 3RF6A 2E4UA 2J3LA 4QA9A 4EHJA 2M2IA 3QUAA 2DH6A 7MDHA 3ZD7A 3IE1A 2MU1A 1PJQA 2GOYA 1UKBA 4NYJR 3T1QA 4YRKA 1CRPA 2IYLD 3BK2A 3O4VA 4GLJA 3L49A 5CYFA 4CLOB 1DJQA 3LHIA 2RAVA 2C42A 4WW0A 5JFGA 3E22B 4ER7A 2OKCA 4DMFA 3R3JA 4I81A 4YACA 4D7AA 3MELA 4YRMA 1BA3A 1ZD5A 4NZMA 4JBIA 2FDCA 4WXHA 5FO0A 4GMGA 1KDYA 3TXYA 1MAWA 1LLFA 3MPUA 1X7XB 3ZDZB 2E5WA 1ULUA 2J9ZB 2MOKA 2Q1TA 1W34A 1WQ1R 1D1TA 1JB1A 1JFFB 2BGIA 2IKSA 1L7VC 4L5BA 4RQUA 2B99A 1BJTA 1QPGA 2XWPA 1C9EA 3ONVA 4AMUA 1TLTA 4BQEA 3PNLA 3O91A 4PGHA 1E58A 1XN1A 5B57C 3E27A 3A70A 4KP7A 2CWDA 4REQA 1F8FA 4PSAA 4GOOD 2FW6A 4B3TB 2HDNB 1T0HB 2F43B 2QDXA 4X6UA 4YREA 4IDDA 4ASUD 4J2HA 1SUEA 4AAYA 1DEXA 2AHRA 3EFBA 5KWSA 2Z9BA 4M0CA 4UPVA 1CNMA 3IP9A 4E2WA 1Y1LA 3NBKA 2CUTA 2PH3A 4XEHA 3F3SA 2C82A 5LQNA 4ACAA 3E9ZA 4OLHA 3UMVA 1CC1S 1CHNA 2H7CA 2X8AA 3C8DA 4A0QA 5I7HA 3VR0A 4RDIA 4FD3A 5C4GB 3D7RA 3OQJA 5F73A 5KCZA 4FX5A 5LC1A 4AB1A 2BDUA 1U8TA 1W4CA 1X39A 2X77A 5KAPA 1GM5A 3QFSA 5C0OE 4DLNA 3ICCA 1Q83A 2BFFB 3GHHA 5K45A 3MJCA 2H1WA 2L42A 3T9DA 4BUJA 1E2DA 4MK4A 2UUAB 2I71A 1E1CA 3ZJVA 2R85A 4P7FA 1JZSA 1R9NA 4FR0A 4WEOA 2NQ8A 4L5CA 1Y6JA 1X19A 1NI5A 1W29A 2WV9A 1RWXA 1JFVA 2FW7A 4BAGA 3K8OE 4HK4A 4HQOA 3KOMA 4FHFA 3LO8A 4O2AF 4NBNA 4WV3A 2R7MA 3Q7IA 1M1YE 2PZMA 3DOIA 4BX0A 4MARA 3ZGXA 1TZBA 4WDQA 1Q21A 5M3BA 4HYQA 1BEEA 1E2LA 1M1NA 1IN4A 1EI9A 5FNZA 4FHEA 5I51A 3NT5A 4FBLA 4UHHA 3PUVA 1CIPA 5D00A 2ZCUA 3SNHA 2JS7A 2I52A 1TQ4A 4BE4A 2FFRA 3HADA 4LBWA 1NT4A 2MIIA 4ICIA 3HPQA 3HWSA 1JEJA 3V1LA 2OKGA 3LDUA 621PA 4Z0PA 4NK4A 2A1TR 1QVAA 2IHJA 2Q2WA 3LUCA 3FD8A 2PNFA 4OB6A 5TS2A 3G88A 3MSXA 2X19A 4A92A 4F5EA 4PC3A 2FP3A 4HI0E 4WESA 2YTZA 1Z25A 3TQSA 1UBFA 1CR6A 1VA4A 4FR5A 5EVCA 4DLSA 5JSKA 4KMOA 4DARA 1HE5A 2DFTA 1QO0A 2V58A 4LJKA 5SICE 3E2IA 1HFKA 1GNQA 2I4NA 5AW3A 5ED4A 4DEVA 1AVTA 1F0YA 4CF5A 4ZC1A 3JQBA 3D3EA 3AW8A 2HF2A 4KQFA 5ARCA 1JF8A 5JSYA 4ETMA 4LHVA 3MT9A 1J39A 1UXGA 2Q1UA 1JMYA 1OFVA 1OFUA 3I52A 4AURA 3E8SA 3AR2A 4QBIA 5CM9C 2GJ8A 3DEFA 5DTQA 5H3CA 5AESA 3N28A 4UVIA 1Z5UA 1U6JA 2HJ9A 2JNWA 2Q0SA 3IIIA 4DIBA 3CLSD 1OC2A 4W1QA 2EFHB 1M2HA 5K4AA 4BNVA 2F55A 1NR7A 1Z5ZA 3CZCA 4KWCA 1Q2XA 4OJMX 4YFYA 5ILQA 1B2LA 1VGQA 2ONYA 2QAGA 3WX0A 1H6AA 8GPBA 3T9AA 3R7LA 2IZ6A 3CQ9A 5CYGA 4PG8A 3H3JA 3ZX4A 5IFKA 1DIHA 3GNSA 1L4UA 4P7GA 2OVBA 3RS5A 4EJSC 4URWR 3UK6A 1Q74A 3MQFA 3RUPA 4D0GA 4M54A 3OECA 2RGXA 3V6LA 5HS6A 1WNFA 1L7AA 2PX0A 4YAOA 3RK1A 2QX4A 4F6LA 3NHBA 4XJTA 1M2VB 3IJPA 3MPOA 1TT5B 2PRJA 4IGFA 3UK7A 4EX6A 3GY0A 1NI4B 1VHLA 1YB2A 4HFJA 2OGZA 2PRYA 1XA4A 1WQ4A 3NC4A 4JP5A 4P0PB 4KRFA 1NVBA 1Z4QA 1OQAA 3JD4A 3N05A 1J21A 3N53A 5EZ5A 4EY8A 2P6UA 1V4BA 3B53X 4QFBA 2Z1NA 4YDQA 5HX7A 1IY0A 3KEQA 1C41A 3DMFA 4XOIA 3EVCA 4H6PA 4G01B 4CR8A 3E9CA 1JBKA 3K16A 3LX6A 4J90A 1QGZA 4YV1A 4L5JA 521PA 5CITA 2ZYAA 4R1UA 1PS8A 1CEYA 1T5LA 1BROA 3EGEA 3GLIB 2P9YA 4BJHB 3BRCA 3LK7A 2QPTA 3D7SA 2QTVA 3EPHA 4LQLA 2C58A 1S6YA 3FIJA 3ORQA 4GP6A 3LWZA 4QXOA 3P9IA 1JDJA 3I42A 3E5HA 1KH2A 3I6YA 1NV8A 3NB0A 4IH9A 4J9UE 5EJFA 4PCUA 1FYEA 3ACCA 2J0EA 3T1NA 4EHLA 2QG9A 3K9BA 4G0MA 3J81A 3PJGA 3DBVO 5AP9A 1TQHA 5BN5A 4XPZA 1XX6A 3EQ7A 1TI7A 2B4YA 2II6A 3IO5A 3PHJA 4D8WA 1TU0A 4PNEA 5AW1A 1GQOA 2DLDA 4BNHA 1HNNA 3OKFA 1YZHA 3K20A 2AWOA 2DPYA 1IG3A 4N7MA 3MWEB 1HO3A 2VRWA 1TFRA 2WHPB 3I5XA 1Z5GA 2ZS9A 1UEJA 4OHMA 3RC1A 3WO0A 5AW2A 2O06A 4MJXA 1I4LD 2HA0A 3EC1A 4ARIA 3OZVA 4OAPA 4DCOA 4YIKA 4MV1A 1XJCA 1TQ6A 3D4IA 3JQQA 2BMAA 4AULA 4D96A 1ZW1A 4MCAA 4URFA 4JL8A 3NV7A 1NKSA 4MROA 4ZOBA 4Z3DA 3UKDA 2BSQA 2H51A 1NTOA 4YDRA 3U49A 1IY8A 1XCMA 2D74A 2ZYVX 1U1GA 1V2HE 4GOMD 4B4OA 1DBIA 1NM5C 2AYXA 1XRSB 5FA6A 2YN4A 2FR0A 2DP4E 1UJ4A 3TAXA 4INAA 4CT4B 2FLKA 1YU9A 4LX0A 1UKYA 5CT6A 5L51A 1DOZA 3G5TA 1S2IA 2PVCA 1UXHA 1F12A 1UPBA 1NQOA 3A4NA 3QFCA 4R40A 3I09A 2AB0A 2Q3BA 4I3FA 3WZLA 5HKAA 1IZ0A 3L4SO 4J1NA 1ZM3A 1NU8A 4P98A 4RETA 5F1PA 4BWFB 4EA9A 3F67A 2QRUA 2YIMA 4FN5A 3SC2B 4M9SA 4UVEA 5FIUA 2YZGA 4UUOA 1YFKA 3O9MA 1SOAA 1HBJA 1AQ6A 1WNTA 1RLIA 1S4MA 4IXTA 4LISA 3TD2A 3U1BA 4F3YA 3WLLA 2FMHA 3O3CA 4P08A 5IJZA 3CX4A 2DKOA 3LL4A 4ZYXA 2N0SA 3G9ZA 2J67A 1Y8ZA 2CFRA 2FZKA 5ALVA 4RNCA 3HL0A 3OC0A 4IHQA 3IP7A 5DN9A 5FPKA 1H8ED 1QH1B 5A1TA 1L5SA 4BECA 3CH7A 4UZFA 1ZM7A 4DKXA 3QWBA 4DXHA 1JYSA 1MV8A 1PZXA 1NOJA 2J30A 4OQYA 3QI7A 1M7HA 3L1UA 4PXSA 4TLCA 5BSMA 2YXNA 3COSA 2F1KA 4YN3A 2YWDA 4HAIA 5C5IA 4YAIA 1UP7A 4OHFA 1H23A 2QLFA 3FHTA 1VSBA 2GSWA 1R9MA 3QENA 3T5TA 2XCSB 5CDGA 3IOEA 5JMTA 3PYXA 3UMSA 1XO1A 2DWCA 2YOHA 4ON9A 4D46A 2BKXA 2G4CA 2ZJ3A 5AI6A 1SQ5A 2VBCA 1XZCA 3ETJA 1J0AA 4CPDA 4ESEA 1FVXA 2ZUTA 1DUVG 2EU8A 2HUPA 4BNWA 4JYZA 5IDVA 5I3CA 4CMCA 1CJMA 3E5RA 4X24A 1ZNYA 3EPKA 4NEHB 5T64A 2XDQA 1WPGA 4W5OA 3ROXA 1K0UA 3RUIA 2QRLA 2K7ZA 1JTVA 3RNOA 1FDUA 2XIQA 4IQFA 3PLRA 4CE6A 5A6SB 1YI0A 3R7NA 3RFXA 1PWXA 3WTBA 2WKWA 4S04A 2VA9A 3ID6C 2HPVA 3CUKA 4MKXA 4B4DA 2HSGA 4QDOA 4XVCA 2ZDGA 1G9TA 1RHRA 3V5NA 1N9GB 2ZTUA 5G0VA 4GFDA 4QGSA 5CJ2A 1PKEA 1Z5VA 4IDFA 4RK5A 2R25B 4KUHA 2ZJOA 2P9FA 3DULA 2IIVA 5DNCA 1YDFA 3BSYA 1XZEA 4D8UA 1HC7A 1G6OA 3E03A 2NZ8A 5FPQA 1PWYE 1KJZA 3DB2A 5JJKA 1KS2A 5BN4B 3DZ8A 1Y8AA 3FVQA 4JOSA 5HOQA 5KDDA 2HQSA 2JA2A 2O8BA 1YVUA 3FI0A 3JASA 1CHDA 4FLEA 4QUIA 5SY4A 2VPYA 5F1KA 1OCEA 4NK5A 3PTZA 3QJ5A 2QW8A 4NE2A 4CIXA 4LF8B 4B3RB 4JLSA 5CEFA 4B9EA 4BVEA 3KKMA 3L05A 5FUWA 2HRBA 4H6WA 2HBRA 3ZBTA 5DLQC 3GQBB 3GA0A 3ULKA 3VO1A 1UL1X 1YR2A 4Z49A 4QOGA 3RIEA 1XL0A 4QAQA 3HPRA 1F9EA 3IR7A 4C6SA 4C21A 2QVLA 2DFLA 3OE7A 3N8GA 1RJDA 4IIHA 4CMJA 3ZJTA 3LLVA 2XT0A 4UTPA 2AJCA 3RTGA 1KBQA 1ICIA 1SQ6A 4NY1A 4RY2A 2Q45A 3ICPA 3HGQA 1Q14A 1YZTA 1L4FA 2AJBA 5BYBA 3MMXA 1DJLA 5I3ZA 4JLMA 4UXHA 5KJFA 3HHEA 1S3FA 2QXTA 2OV2A 4C4SA 1GPMA 1L4LA 3GJ5A 1GNLA 2DHCA 3K0CC 1X7HA 1PS0A 2LV8A 5EE5B 3DVSX 3WNDA 4EENA 1D7AA 4QPNA 4GOXA 5KQRA 3M1IA 3VKVA 3HMQA 2M1ZA 3F0TA 4HEJA 4BJ1A 3P2YA 4I55A 1CRLA 3R41A 3R6LA 4IMRA 3O03A 4Q4AA 3HCFA 1BXZA 4PXAA 1U0HC 1QAQA 1T6BY 1OX6A 3Q41A 1TKCA 3P45A 4OSOA 3I28A 4Q01A 1TTQB 4QTXA 5JVDA 2ID8A 3P71T 4TS9A 2BCJQ 2HNKA 4RS3A 4XM1A 2BH9A 1YRQA 3LE8A 4NDAA 3UV6A 2HA7A 1UBHS 3X44A 5CEEA 2J41A 4NSNA 1G5RA 3PPIA 2X0EA 5C5EA 1DXYA 1NVXQ 1VJRA 2D1RA 1V3QE 2OCGA 2ZT8A 4RYDA 3WB9A 1N6HA 3FPKA 2OUKA 3ESCA 4YP1A 2GBIA 1VPEA 4IEEA 1H4QA 1NF9A 4H1TA 2DJ5A 2Q9CA 3D7MA 2GEVA 1Q1QA 1GYQA 1O57A 3AONB 2FE1A 4LFBB 2Q46A 2O7SA 3OKAA 4RTPA 1I3KA 3VH3A 4YQYA 2D7CA 3RS4A 2UKDA 5EE1A 2A0UA 1DBWA 2J3JA 3AR4A 2F00A 2NNWB 1ISFA 4DAEA 2OHXA 2GT1A 3SXJA 3AILA 1UKZA 1SM4A 1IATA 5JJIA 4X1IB 3L07A 4AJKA 4LV5B 2NO7A 1VHWA 1PV1A 3AI7A 2EFEB 3EUFA 2B69A 4WADA 1SBYA 2QN9A 3F1KA 3RVPA 3TM5A 4O3FA 4Q1EA 4BV8A 3R0XA 3A27A 4Q3KA 2H1HA 3UJ9A 1X7ZB 5ELMA 5L53A 1JYEA 3GLFB 5AVTA 2GA9A 2YHUA 3AJ9A 1IXKA 1Z4PX 2WWFA 1UMBA 4LK3A 4Q4JB 4C1BA 1AQLA 4UEJA 3QPBA 3UBMA 3ZLUA 2GPSA 1KMNA 5H4HA 1JN0A 2LXNA 2V7VA 4HXEB 1L5QA 2FPGB 2OHJA 1N2BA 1G63A 1OHHA 1DQZA 1MA0A 1PT7A 1ZOIA 2JW5A 4GECA 2O7QA 2PJDA 3GMTA 4OJKA 4MR7A 2QMQA 4Y3UA 1LVUA 5KVAA 4HT3B 3BFXA 3N07A 2WJHA 3NDRA 1WDMA 3DDZX 3D6JA 3U3RA 4J2TA 4MHSA 4P7JA 2WWWA 2VAXA 4H16A 1ZK4A 2XZPA 4D3FA 4NBUA 4K8RB 2B98A 3DOFA 2EFJA 3L82B 2CSUA 2A1UA 4TXLA 4YRSA 4QYMA 1KYXA 3WLNA 4BWVA 2HRQA 2OCBA 3AVPA 2XAUA 4LDQA 4U2KA 5TDHA 1M2WA 1XTIA 1S02A 1IPEA 2CLSA 5ALDA 2ID9A 4QL3A 5CCDA 2QTHA 4EKGA 4BBAA 2VHUA 1MX5A 4YJGB 2HCBA 4BMXA 3MERA 2Z2YA 5K20A 1B0ZA 1OBFO 3AKDA 4PRYA 5FF9A 4CIAA 4BEBA 4IQGA 1ODFA 1U7WA 2QM0A 4OOEA 3L4JA 5LWHA 5C37A 2G40A 1WEKA 1IZYA 3F3YA 4Q34A 3DBLA 4TWRA 5AD1A 3ZY4A 3UFBA 1J9ZA 1M8GA 1OXSC 4R2IA 3D1VA 4BO7A 2PS0A 1RYNA 3AR6A 2GCOB 3U4MA 1M10A 3I04A 3BB1A 2HHAA 4MVJP 3UW3A 4CF4A 5MFPA 1UJ6A 4F2WA 1EDEA 4A16A 2IYUA 3ILSA 2E4WA 4V0NA 1U65A 3P4UA 3ZV6A 4XD7A 4Y18A 4E46A 1VG8A 2DBRA 3B20A 3V4SA 2UXDB 2WYIA 4H3KB 3ZDQA 4MUGA 1RRPA 3IPRA 5T6BA 4MW5A 4Z4HA 1RYDA 2X2PA 4WFJA 1G2QA 1PLJA 5KYYB 1QR6A 2YC4C 4YT5A 5JS8A 2PL3A 4ROTA 1DVRA 4CIVA 3QPAA 3HDHA 4Z9BA 5A9SA 4Q4AB 4HRVA 4PAOA 5HRCA 3C3AA 4KO3S 2PZLA 2WJ3A 4JMPA 2OFPA 2CL7X 2UVDA 2RARA 4MR8A 3G82C 4IMPA 5DT2A 4PCVA 3RAPR 4RSRA 3WKAA 1OFUX 4UVDA 1I2ZA 2PBLA 4PLPA 5BYJA 3QA9A 2TRSB 1R4MB 1XTUA 1P62B 4P93A 1DO0A 3D1LA 5DTIA 4PZEA 4Z6KA 5JJBA 1XFDA 4RVCA 1V1RB 2RHHA 4HAUA 2SCUB 1BMQA 1P29A 4DMHA 4MUNA 3VR6A 3RC8A 3B5JA 3SLKA 4Q9DA 3X1XA 4EKDA 5H9WA 1D6NA 1Q17A 2L69A 3F6BX 4ZZIA 3IBYA 2RC6A 3OTIA 5HE8A 2QX9A 3DAYA 2H1CA 3LM8A 3SZMA 2NU9A 2YH2A 1Y5NA 4LRYA 1Y8CA 3GGGA 2Q0XA 2RHRA 3QU4A 2ORYA 3QOXA 1X8XA 2YMMA 2OK7A 2OPHA 1N0IA 4P82A 5AK3A 4KYVA 3ESRA 1RTKA 3BGIA 1UPXA 5DNUA 2VSQA 3TSCA 3ETCA 1YOVB 3WL8A 1VCIA 2JH9A 3Q6NA 1SCNE 4NPAA 1CQIB 2JL1A 4X95A 2VRNA 1O94C 3NVMB 1U7TA 4XW2A 1FUKA 5KOIA 3TQIA 2EW2A 4DUPA 2G6TA 3QX9A 4LZAA 1E69A 5L3VA 4PC1A 1YB4A 3O4GA 2HF9A 3X1MA 4B6GA 5BXQC 3C3MA 4JUCA 2DUUA 4KX5A 4BFSA 3TMAA 2JAOA 3EG9B 3P2OA 3H13A 5LA6A 3UZUA 1VB3A 4QZVA 5TPZA 4JC8A 3M2PA 3U5ZB 1U3CA 1UBUS 4WLEA 5FLKA 3RBXA 4KQCA 5I5EA 5JH7B 3CH4B 1SHKA 1NW8A 5TMPA 1M6VA 3E84A 3R3VA 1YZFA 2OGWA 3H1BA 5EJGA 3RROA 2MYPA 3T99A 3UAVA 4QOIA 1XVUA 4XYMA 3T6KA 4DVJA 3ENKA 3FBTA 3ZDFA 1F0NA 3A32A 1N7HA 4WBXC 4MR7B 1JT9A 1G8PA 2A67A 1ZK0A 1K7EB 3EIQA 3IPYA 4L8VA 3UWOA 4INZA 4EGSA 1OU0A 4OJQA 2HWYA 5AI5A 1OVGA 1Z12A 4OH7A 3V46A 2BFOA 3ZCSA 3NBFA 5AM4A 3MYRA 3QEMA 2VDKB 3PIRA 4RY8A 4M8IA 3EMOA 1T2VA 1YQDA 2Z5FA 1KZGB 5FOSA 1MNQA 2X5XA 2N46A 4DQKA 1U90A 1A5AB 1GCOA 3A1FA 3MTEA 4I5IA 4MKZA 3B2NA 2VSXA 1JLLA 1RM4A 1R6AA 1KZ6A 4H4DA 2HRZA 4DMKA 4AJ9A 4I4CA 2WICA 2XADA 4YECA 2GAFA 1U7DA 3AUUA 1ENPA 2Q5HA 1LXCA 2WWXA 4LZJA 3SEAA 3STXA 3PC3A 5I4CA 2M9MA 2BEJA 2CHEA 4IGIA 1GZ5A 4QPPA 2ZP1A 4JVLA 3S2GA 1U1CA 3ESXA 4BMDA 3PXEA 3AMVA 4O4LF 5ECGC 1JWLA 4OYLA 4ZRDA 3NIGB 3REOA 3UOGA 2WJ4A 1KOLA 3F4KA 5I4BA 3AVQA 3B7WA 5AM2A 4DMGA 3OIDA 3ZXYA 4X62B 3SMVA 3OUTA 3UHPA 1PJBA 2RJNA 3K92A 2B7LA 1F7UA 4LDZA 4WERA 1NIJA 5C52B 4ZTUB 3DMHA 3DBLB 1PUXA 4FMCF 4OIMA 1W6UA 3GOQA 3BAFA 1P6UA 3EARA 1EUDB 3WFJA 1RKQA 4X7RA 3I3SR 3DDCA 5AYVA 5LMUB 5HZKA 2VVTA 3OFSA 3EC2A 5JG7A 5DASA 3ORRA 1G8GA 5DWVA 4F1KA 3BQMB 1SD2A 1YZGA 3KZXA 3PE4A 3QXXA 1XE3A 1P9LA 4WLFA 1FFHA 5H9VA 3CEHA 3KQMA 5TGDA 3EY4A 2LKCA 2VUSA 4N1AA 4J0FA 1GPKA 4EPRA 1BVRA 3S29A 5AQ1A 2ORIA 1PGNA 1CUXA 1YBHA 3IPCA 4G8JA 4CM5A 5ADHA 1MRSA 4MJ3A 4IXNA 3BZBA 5AHRA 1PFKA 1U3UA 4WK4B 3A31A 5L4SA 3PQ6A 3DD1A 3HJRA 2W2QA 3D4PA 3BA6A 4PS1A 1QVZA 4G4IA 4A5OA 4DBVO 1PF7E 4XM2A 4EO7A 5JSZA 4IFEA 3JATA 3ZY2A 1UBRS 3OIYA 4I4TB 4HNUA 3HU3A 1CEEA 1U0EA 5HM6A 3TSZA 3CVVA 2BMJA 1MJFA 3DGFC 2NLOA 2UVQA 3IAM6 4JOCA 3CLHA 4IDQA 1ESEA 3LLUA 2F3TA 5G0SA 3I04M 1XRJA 4BMCA 1GTG1 5J40A 3QEAZ 1GZ7A 4ZCIA 4YY3B 1XTRA 2AKAB 2I91A 5EFZA 1AGPA 1QX3A 2JEOA 2RH9B 3GJ3A 3HVJA 3QKRB 5AOVA 1YFJA 1R0BA 3IMCA 2MSNA 2NU9B 1KSHA 3UYKA 1J2UA 5CA1A 1ZLYA 1QP0A 1RZVA 2V3CC 2LCQA 2ERCA 3LYLA 1E5VA 1QG2A 2FEAA 1Q2UA 2AF3C 2W2OA 1F0PA 4XDHA 5ECYA 2YWGA 4L73A 5TC4A 5C5DA 1M0EA 3UKJA 1REQB 2C7GA 5JFTA 3RT7A 2GESA 2WF6A 4H6VA 1T3HA 1TECE 4ZQCB 1WVGA 1YS6A 3E81A 4DS3A 1CJVC 4GSYA 1QRUA 4K6CA 1UP6A 3UV3A 4MW7A 3D3WB 3HM9A 3ELYA 1MHPA 4TL6A 4MLDA 4BNNA 3QG5A 3TTTA 3U19A 4NAUA 4JJFA 4R16A 1E92A 3LFHA 1RZRA 2H4WA 4PHGA 1P9OA 4KR2A 4JI4B 1ODJA 1W0KA 1Q77A 1U98A 5DBOA 1C4XA 1GR1A 2H8GA 3A1UA 3JWEA 1N32B 3L8CA 3N2ZB 1ZY2A 2I3AA 2ETXA 2CK3D 2VP2A 5AKXA 4K6OA 2P9QA 3FR7A 1P7WA 3EDOA 3QFFA 1CY1A 1II9A 2JFVA 4IXMA 4KK4A 3G17A 2XTAA 2VXYA 3AF1A 3KKPA 3EYAA 1JAYA 3E9YA 4A73A 5IN4A 3H8SA 5LQDA 1CUHA 4I50B 4MUHA 3K5WA 4O8CA 2ZTMA 4O2BB 4KN9S 1SCIA 4QRHA 3OFKA 2IYWA 1N2HA 5I01A 1R0KA 3FH0A 4Z4GA 1V16B 4KRXA 2XNKA 2PS3A 2R4TA 3GLQA 3JQ8A 1G5FA 8LDHA 4LC9A 3RU9A 4G85A 3SR4A 1CY2A 1YO6A 2XA1A 2ERYA 1BXKA 1QLWA 4KSYA 2D59A 2AV6A 1KP2A 4GBJA 3VR2D 5KNCH 1ZD8A 2G5PA 4TTAA 5K0EA 3AF2A 3T0FA 3TOCA 1W0JA 3LWBA 1W49A 5JBNA 5LDHA 1CF4A 1AK2A 2C1EA 1JLLB 2C2OA 2NXNA 4H7PA 4LSWA 3N6VA 3WWDA 5CXXA 3RF7A 2KB0A 3WQQA 4IDNA 1EWQA 1YJAA 4G67A 1FLNA 4LKOA 3NDIA 4HNAA 4DV0B 3O2JA 1OGYA 4II2A 2V6FA 4DQLA 5A05A 1NQXA 3U0VA 4IV8A 4AJ1A 3H3XA 3RQIA 2XSZD 4Y2RA 1C14A 5IAGA 1Z74A 4PRZA 1JL3A 4ZI2A 1ZIDA 1VHJA 5DO9A 4FW8A 3W1VA 2QRVA 1XDGA 3S99A 4CODB 4XRRA 3BSWA 4EHNA 2Q0HA 2BP7B 2F3PA 2COKA 1IM2A 1WMSA 2I9PA 2KLHA 3ZQKA 5JYDA 1V4NA 2ZAMA 2G08A 2Z6QA 1E6EA 4RZUA 3MINB 4NMMA 4OD0A 3KOWA 2W00A 4FXOA 2AMLA 3EPRA 1QMPA 1M1YA 3L1KA 3VX4A 4ND5A 2XB8A 4QTZA 1JR3E 1ZK2A 1R3UA 4HGOA 2NX2A 2BISA 3HDJA 1Q22A 4UXIA 1WWKA 1QQ6A 1XDUA 4BVBA 3DCYA 2DC1A 3FOWA 1EG7A 1ABEA 2H31A 3PEEA 3BE8A 3ZZTA 2Y67A 1UFQA 5DXFA 5BV7A 4CG1A 2WIAA 4D81A 4DTCA 5E6SA 3AHEA 1M2EA 4JMLA 4UZEA 2E6KA 2WIGA 3ABOB 3K9FC 2HF8A 4G9BA 3DTVA 3NVKI 2JLXA 3NTXA 3ZDXB 2OQVA 2CC2A 2IU3A 1S8OA 4K40A 4M21A 3SYLA 1LDBA 3LPLA 3VAZA 5JSZB 5A3VA 5JH7F 2QN6A 5L7WA 1IBMB 4FKBA 1DO8A 1XMOB 3TQRA 2GUGA 2HKIA 3GMIA 1NJGA 2PUTA 3DKKA 3MTQA 3QWHA 121PA 5C3UA 3JQ7B 5T8KA 3TOZA 4F11A 1YK1A 3EW9A 3M8KA 4XVRA 3AU8A 3BZWA 1C29B 3NVAA 4Y9TA 3NGLA 3NKVA 5JQWA 3AZOA 4JLNA 1ABFA 3MTDA 3LSYA 2OXTA 2OCPA 3A05A 1P4RA 1SCUB 1VDMA 1ZOOA 3TQTA 4FYMA 2VPZA 5BVGB 4D26A 4F84A 1HDXA 4C4ZA 5FBRB 1P9NA 2WFLA 1E0JA 3C74A 2B9EA 3O2NA 4CTMA 3GN1A 1A1SA 3DZKA 3H83A 1P2DA 1NNLA 1CPYA 5ALPA 3BXPA 2Y6VA 4L3VA 4IZOA 3FNQA 4ND3A 1HETA 3T0GA 3J80A 3GG2A 4FCTA 4LBZA 1GV1A 2AOXA 1IPHA 2CMFA 2IPLA 2OB2A 3IT3A 5AVUA 3NIFB 5JO9A 4DC9A 1OZAA 2QRZA 3OVMA 2AEJA 3IFSA 4GR9A 4OOFA 5DISB 3PXCX 5JDCA 4D25A 4QBHA 2G1KA 4ZP1A 1ZUHA 1ZMTA 3IT2A 4NXMB 2GJ4A 1E1NA 1EYZA 1I7LA 2M6SA 1JVSA 4H60A 3SZGA 4EVSA 2RG7A 1PHPA 3ZDDA 2A84A 3WAGA 2D0IA 2IGTA 4TWZA 5HWSA 1KQPA 4PANA 1PWZA 3U3MA 3VO2A 1IUOA 3U4QA 4XWYA 3P5BA 4AKIA 1IXYA 2X2FA 3EXHA 1XTTA 2AI3A 2VJYA 4GGOA 1KETA 2ABWA 5KNBD 5CB6A 3R4CA 5K3FB 4AZWA 3CISA 3P8ZA 3IUBA 1T15A 2IUEA 2RKWA 3G0HA 4FYXA 5BRNA 3VTKA 3PG5A 3GD7A 2BCGY 1VL8A 1GVHA 2O3JA 3TSAA 3PS9A 1W48A 3PQ8A 4KRYA 1KFCB 5E0OA 4M2LA 4JT2A 4D44A 5JCOA 3M6MD 1E6CA 2HI0A 2X1LA 4MIEA 2FFQA 4TQ9A 1VIMA 3X1WA 4RFSB 4DCPA 4ER5A 5K8TA 4IBOA 3OZSA 1LC3A 2NVUB 1YHYA 4I4TF 3IHKA 2FZLA 5KTKA 1CUIA 2ZUBA 5FP0A 5IU6A 3PTAA 1QE3A 1D4ZA 4G5GA 1UDBA 3CRNA 3KB2A 3NAZA 5GAJA 1FXUA 3ILVA 3Q2OA 3WWOA 4WT7A 4BNXA 4IVPA 3K70C 2PGXA 2XZTA 1ZN7A 3QXCA 2Y0PA 3I9NA 3L9WA 5IC6A 4C7BA 2ECQA 2FGJA 2CKDA 1OXKB 2EHDA 2IHBA 1P91A 1HH4A 2WAXA 2A56A 3CSSA 4V0OA 3U39A 4Q7KA 1RC1A 2O4UX 3NDBB 2FWRA 5M5BA 1E94E 2OCIA 1E6UA 4KQ2A 1NOKA 4KMRA 4UOEA 4YV0A 2P27A 1XMXA 1GFWA 5JSFA 2O2CA 4H7KA 4MYCA 5ELLA 4PQEA 3OPQA 1U3GA 5DCLA 2JA1A 1NVDA 2ZIFA 4C4PA 4URXR 4DV2B 3B6KA 3SQMA 2JCXA 1E2QA 1WE2A 3ASYA 5FL7A 5FTJA 1XLUA 4N9QA 3DT9A 1HE4A 4LHXA 4TTRA 3FYHA 3KZOA 2ZJ6A 3ZLBA 1Z07A 4RZHA 3Q2KA 3DGEC 3MGAA 4ODIA 2YMLA 5K4GA 3OUUA 1NR1A 4TRRA 1KH1A 1N7IA 4D80A 1T2NA 3IBGA 2XCTB 4TMTA 2MJLA 4KODA 3ZK9A 3AESA 3U4HA 1Z6QA 2JIQA 5EIEA 4AO8A 4QDTA 1U28C 3GYGA 3R9WA 3UXEA 2R62A 3MLEA 5LQMA 4UM9B 4I50F 2HCFA 1ZOLA 3B1FA 2PSFA 2IEGA 4QWMA 4WCFA 5L9AA 2IHNA 1UT5A 1NR5A 2EIXA 1HKUA 1XPJA 2OHOA 5EP3A 2B8JA 4CMEA 4J1TC 4NCBA 3LCVB 5K0JA 1JHVA 3KL2A 1B41A 1N7GA 1RWKA 1SXJC 2EJWA 1BXGA 1K7XB 1YQXA 1EM6A 1NXTA 2H3EA 2J3QA 5EZ6B 4R1TA 1I2AA 1I0ZA 2DT5A 2ZRPA 2IXAA 4YP0A 4G5XA 4H2DA 5EE0A 3ROTA 1NXOA 3TEJA 3AFGA 2IVFA 3L1VA 3MWKA 1Z7GA 5CAEB 5EXXA 4GPAA 4B2IA 4BLPA 3B60A 3DZGA 1G1AA 2ZYSA 1MW9X 4LE0A 4BNTA 5CEJA 4QSMA 2HOQA 1WUKS 5EP4A 1DIRA 3BWMA 3IHTA 2O2ZA 3SM3A 1HMPA 1VOTA 3VVCA 2IV3A 3W2EA 1ZM9A 4CMHA 1P2TA 2R7KA 3EMKA 1H3FA 3ZW8A 1MIHA 4O2AA 1JPJA 1BN7A 1U2ZA 2QZZA 6YASA 5FCDA 4KVAA 1LK7A 2HGSA 3IR6A 3MXOA 1N5DA 1TAGA 4GIBA 1QO0D 4L72A 4MO2A 4P4LA 2JGRA 4XQ0A 1N1EA 4E2YA 4WBNB 1THTA 4EWLA 2BHLA 1FFAA 2VT2A 1J8MF 1EFUA 3RVOA 5FWYA 4CF3A 1AE1A 1CR2A 3EIUA 1Y9DA 3FNGA 3WGVA 5J4VA 1X7DA 1SQGA 5FOXA 1TVEA 1H4TA 4ALKA 4IDAA 4WD3A 4DGQA 1NJ6A 1KC3A 3K96A 2A9JA 3OHMA 1A98A 1XCLA 1VBMA 4EJSA 1CUWA 1PD0A 3LCCA 4OBEA 4JJ7A 1V11A 4RABA 4RJ2A 4TMWA 3ZI7A 1K08A 3K0EA 4C04A 5C51B 2W42A 1RLTA 2YIDA 2YXPX 1VLHA 3TRDA 5D86A 5EXTA 3I6MA 2E0IA 5B6JA 2I6QA 1XLVA 1C80A 4XYGA 3ZDBA 5JNTA 3RJ9A 4NZOA 3YASA 4LZWA 4QGGA 2H0QA 5D87A 3NIWA 3EZGA 5KX5B 4Q3EA 1OAOC 1R8QA 5BN3A 2G16A 4HPWA 5LLSA 1C1XA 2V4UA 1X0XA 4DXDA 5DYNA 5IJ9B 4LBVA 5J47A 4ZT5A 5KNLA 3OM0A 1F4VA 4KAFA 2P5UA 1VLLA 2QRJA 2WDZA 4AIIA 1RYEA 4MB6A 3K6SB 1NT2A 3F98A 3ZUPA 4H7DA 1QM5A 1GZSA 2PLNA 2R11A 2V65A 3MCAA 5IKXA 1YKFA 5BQPA 5HQ3A 2J48A 4F72A 3BUSA 2KHZA 3L7OA 3QKSB 4LGMA 5EFOA 5F76A 2YWBA 4EJ6A 5B4UA 3LF4A 2WTBA 4ZIRB 1DKQA 4GC9A 2GCPA 5AR1A 1YBMA 2ZTVA 4RHEA 1MX9A 2MHCA 2ZYDA 2XQJA 3UMMA 1PL6A 1SK9A 4TXHA 3QP9A 4XLTA 1C8BA 2B78A 3TOSA 2VDQB 1LUAA 4ILEA 2D5AA 2V7EA 4R1SA 2X14A 2GK3A 4BAZA 1X94A 3OP1A 1ZUNB 4ZC8A 2P4HX 3QY0A 2YJ3A 4EVRA 2C2ZA 1CDZA 2XDAA 1BGWA 2VXBA 4C4TA 1KORA 3RC3A 1O0CA 2H9IA 4B85A 2JRLA 1CWUA 1JVNA 2BRUC 1SU6A 2CXNA 3FVRA 4J3JA 2R6CA 4N39A 2ZJBA 2Q5QA 1BHSA 5LBTA 3LT4A 2PUDA 2IEIA 3I4CA 5EZQA 2BE7A 4QJBA 1DAKA 2E18A 3EGDA 4Q4CA 2AMFA 4UDNA 1K8ZB 1E64A 2DWUA 1TNDA 3DXYA 4KGVA 2PRKA 2ZRJA 5FWNA 2YXLA 3X1YA 2REOA 1Z18A 2WMNB 1VKNA 3AVOA 3L0ZA 3C7DB 4MKRA 3LWDA 4IDEA 3SKYA 4BXOA 3U6BA 4ZYLA 4HB3A 1JHDA 3IBFA 3UPUA 3AV0B 4Y0VA 3WQBA 3RS9A 3TIVA 2CJXA 5ENZA 1SUPA 1PGPA 3L7NA 3QBEA 3ZCXA 1WXFA 1KPGA 1A7UA 1UK8A 2GRUA 3DKRA 3A14A 4GI7A 1PG5A 4WCFB 2PSEA 1NM5A 3QJGA 4IIFA 3ZHOA 3JAKB 2AFIE 2HA2A 3EEOA 4U2EA 1LZKA 2J07A 2HMWA 3L6EA 3H2IA 4ZQGA 1I4DD 3ZZNA 3CW8X 2JI8A 3V8RA 3K8ZA 2AL7A 4WXEA 2R4QA 5ERYA 1A5ZA 2NAPA 3BBPA 1WHSB 4WLVA 1PJZA 3ROFA 4BV2A 1IOVA 1KVSA 1PI3A 1LJUA 2HLDA 3K0AB 1AK1A 3FDZB 1J99A 1VBKA 2NV6A 3E7XA 2XYQA 5CDSA 4NJMA 3W7AA 2VL7A 1GRCA 1TRHA 1N5RA 1KU6A 4XDGA 4MUIA 1SXJE 1D5WA 3QRWA 4GOJA 2P67A 4KBGA 3FZEA 1Y89A 1ZSNA 2XXJA 3NRJA 2QQGA 1P8JA 3OZTA 3Q4GA 4YJKA 2YQ4A 5FTNA 4B3MB 1G0NA 2JGJA 4WHMA 4XVQA 1LJ8A 4U9IS 4DUGA 2E7ZA 1Z6GA 3L8EA 2CE7A 4NQRA 2IP2A 4RPIA 3HHPA 1H2FA 4O33A 3WLMA 3FLAA 3VHXB 2QKYA 3OKPA 2P8SA 2AZDA 4IJUA 1W1UA 2O8FB 3L7AA 3FUWA 3JAWA 3EXIA 2VTDA 4HDCA 4IW3B 1N9KA 1GUZA 3TVYA 3ZNNA 3OQ1A 2Q6TA 6NULA 2WYVA 1EFPB 1V11B 4GVLA 1QVVA 3C8ZA 3LVBA 3ZE7A 3CRMA 1E6WA 4H0CA 3QUQA 4FEGA 3WP0A 5IT9A 4CKEA 3NGMA 4NZYA 3H97A 4U2BA 2XD4A 3HE3A 2FUNB 5B6IA 3V4FA 1F9AA 1XLTC 4F0JA 1LI5A 2AN5A 4MKGA 5HJ7A 2C0CA 3KJNA 1ARZA 3E5MA 1H1LA 5I7EA 4KQHA 4M6WB 3ZHVA 2WM2A 3Q9UA 4A6EA 4I3HA 5CLFA 1XRQA 2ODAA 3A2NA 4RULA 4IRMA 3PRYA 2BM0A 3S27A 3P2EA 3IHWA 2QX6A 3GPCA 2A0FA 4LYDA 4U6NA 3T06B 1G8MA 5GONF 3O4JA 4FT4A 3VI4B 1QS0A 3MN1A 3SIXA 4AUMA 1K97A 5KBYA 4C0LA 5KOJA 4WY8A 1NC3A 3ANLA 4JJZA 5DI3B 4ZKDA 3AG5A 1AUPA 5ITVA 5KB3A 4OFXA 3EZXA 2BFCB 1XRLA 3AHGA 3AFMA 5B53A 1SOUA 5KYXB 2ZSBA 3DVQX 3PTLA 4ENRA 3T94A 3ITDA 3CBGA 3DBHA 1KEEA 4MKHA 2IUYA 2EKQA 3C45A 4UM8B 1OWNA 1OU4A 3TDNA 2PX8A 3PEUA 5BQXA 1KYZA 2CYBA 2YBEA 2VQ6A 1D09A 3IDAA 2V8BA 2G72A 2ZRCA 3R7BA 2O57A 2P2LA 2P3SA 1IQUA 2CZCA 2IQIA 2WMDA 3LUBA 5FJJA 2HJRA 3UK1A 3HXQA 4TXNA 3W2GA 1YOBA 2M1XA 1V5WA 3E0XA 3HZHA 1IJBA 4LRWA 5DGHA 1HM5A 3CU5A 4LDNA 4XGQA 3RSHA 1WKCA 2JHPA 3TR0A 2IS2A 1DCFA 4BHTA 1XEXA 2GGSA 3B9BA 3MYYA 4N5DA 5ICFA 5KCMA 4IIGA 3AUSA 4PG5A 4XB6B 4EECA 3FVWA 3ND5A 2HA5A 5ALNA 2GWRA 3HCWA 1ZUD1 2JLAA 1CRQA 4U7WA 3RYIA 4AZ3B 3NAQA 4CM6A 1S8AA 1UZNA 2PGIA 2VZ8A 3DNMA 1MAVA 4TS1A 4OL9A 2ACEA 4P1ZA 3VH1A 3UG7A 2O07A 3OIUA 4WBNF 1G291 2PG3A 3D8SA 1DAPA 1C7EA 2BFDA 1Q19A 2W83A 4FE4A 4JR0A 1T1IA 3OE7D 1NSTA 2WIBA 4PXYA 1XRNA 3FRIA 4QRDA 4KVFA 4B4VA 3C48A 1S7GA 1WB9A 2QSUA 3RPEA 2P68A 2FPMA 1Q0QA 2FSIA 4O1HA 3CTPA 2V45A 3OOSA 4MZXA 1NG9A 1A7JA 4Z9XA 5D3KA 1QKJA 1E32A 1XXHB 4IILA 1M75A 4WOBA 3TBKA 1ZN8A 4JLAA 4BL5A 4ETNA 4PYJA 5B6PA 5F7XA 5BUZA 4QUBA 2H54A 4OGLA 4F96A 3C5WP 4ZARA 1A9RA 1YULA 4TZTA 1JDUA 2QGFA 1J5XA 1LNSA 2NO9A 3FTQA 2ZRFA 1BE8A 2YNMD 2C1ZA 1G98A 1K66A 3O8NA 4HQRA 2C78A 4RK1A 1EE1A 3GROA 4MRVA 4NJMB 3EVDA 3L6RA 1PYOA 1OBVA 3O1HB 1EBUA 4KE7A 4MUBA 3RLIA 3CBQA 5LYJF 4I9NA 4CLRB 3ZHZA 1CIJA 1GTZA 1RE1A 3GDOA 4P4GA 4W7HA 1DAGA 1R4AA 4W6ZA 5JDIA 2HSDA 1ZITA 2PKYX 4KITB 3U3DA 2IW3A 3FPAA 2C5BA 3GBVA 3GVPA 3PDUA 3LUPA 5GV8A 1EZ4A 3O6VA 4BATA 1U3FA 1KYYA 4QECA 2C0PA 5IW8A 4EYQA 1JWAB 1PNTA 2OAP1 4YRQA 4WK6A 2XOKA 2C4HA 3HUTA 4KRGA 1G21B 3KJGA 4HDOB 3AL3A 5J23A 1E3LA 4NMHA 2WF8A 3MMPA 2WY2D 1IBLB 1WCYA 5DI9A 4X00A 1WULS 2IDZA 5GZ6A 5KOYA 2QJOA 4JQZA 3P26A 2PUCA 1UDXA 3LL7A 1ZJ5A 3JYPA 3TKAA 2YXDA 3AEXA 2IEDA 1M2JA 4LC0A 2A1TS 1ZN2A 5FUXA 4PIPA 2ALJA 4N5IX 4DB2A 2Y27A 2GM4A 1D3AA 1LPPA 2Q3DA 2E5FA 4V0ME 2PX6A 4JHXA 3KXLA 1T5DX 2XVMA 3MJSA 3AERB 2EX1A 2GPJA 4U3JA 1AO3A 3KQWA 1G16A 2B4RO 2QEQA 2OFFA 3A11A 2XUKA 2NO1A 4XWGA 3AHDA 1T6NA 3IV9A 3PYMA 1EQUA 2YY5A 4IDGA 4RVHA 3S5UA 3UJHA 1YE8A 2P6RA 2NPIA 2QNIA 3MQ4A 3QK7A 4RLQA 3E2PA 4TQUS 3N2KA 4OXKA 4B83A 1DC3A 1EXMA 2X5NA 5T4EA 2ODEA 4IS2A 3W6OA 3MCZA 1QGUA 2C4TA 2QLBA 3P96A 4G24A 3IAFA 4OEHA 4HQNA 4AIRA 1MGOA 3CA8A 5JYEA 4JXKA 1M1UA 4EITA 1T4MA 5H70A 3V8MA 2IE0A 3QNWA 4EJ2A 5I7FA 1OT3A 1LDYA 2HJWA 4F7DA 2JFPA 3CX7A 2V54A 4XJSA 1L6RA 3P32A 3RARA 1TXGA 1JHOA 5BSGA 4JWKA 4ZI3A 2YJ5A 3I0NA 2PUAA 2BR3A 3LT0A 5EQTA 2EYQA 4JENA 1ZICA 4ZCPA 5LUBA 2ARKA 4MS4A 5GY7A 4QLOA 3GFGA 3TFOA 1GYPA 2VHYA 4RVOA 3KX2A 1U5BA 4EUFA 1P2VA 1SC3A 2R86A 3PQ5A 4QFMA 3ROEA 2UU9B 2AT1A 1JG4A 3FLBA 1JIQA 5IJ0B 3OU2A 3NHSA 3HL6A 4Y2PA 3LNTA 1LQUA 1ZCZA 4JKYA 4AYWA 2J3EA 5JASA 3DLHA 3HYNA 2HD4A 1U0NA 4RPKA 4BMYA 2O5EA 1AA9A 2JAXA 3OO0A 3L0PA 4YT8A 4AQ7A 3I2FA 1N1DA 1C1DA 4TWBA 3M5PA 1ZR4A 2V5UA 3E5NA 4PTYA 4A26A 1C3OA 2HIAA 4IXDA 5HK9A 3GYBA 3KPJA 1T36A 1NBME 5JNVA 3WL7A 1H3NA 2EFCB 2WFAA 3J7TA 4HUJA 3KLBA 4C0AC 4EJ0A 5JAMA 4EQ6A 2GJAA 5ALFA 2P6PA 2DMRA 4I1YA 5ENVA 4WQMA 1BWRA 2BFDB 5FPTA 3HC7A 3OZFA 2IXEA 4E4YA 4ZK2A 2PL1A 4ARSA 4EUEA 3WGMA 1U4SA 2FPPA 4B5KA 2VPWA 2WTNA 1A4RA 3FPLA 3TUJC 1PR2A 1VE6A 1WL8A 2PZ8A 3SY8A 3L4EA 3VDRA 1KL7A 1WW2A 2PCLA 3VDXA 3PQEA 1P0MA 3MC1A 5EWJB 1HMYA 1K06A 5FI1B 2QTZA 4MYRA 1KKMA 1ZONA 1NXWA 3G0IA 4XD7D 2RI6A 1Z4LA 3RTCA 3V1TC 3ZWOA 4DJEC 3RASA 2QRMA 4ND8B 3VTAA 4DLRA 3IOMA 2EP7A 1ZLXA 4TM7A 2QYTA 3WKBA 2H00A 4UKDA 4R71A 1QCYA 4ZOQI 1EDBA 2GJSA 2Y1FA 5COAA 5TT0A 1EJBA 3R5FA 4UU8A 1ZQ1A 4IGEA 4JQYA 2ZW9A 4IIBA 4ZVSA 4EMTA 1PUJA 5L7YA 1Z26A 2EGUA 1CZKA 3HLYA 3I2IA 3BKWA 2ADMA 4HVAA 4M0DA 1Q95A 3R8XA 1BS9A 2OD2A 4C08A 3STYA 1Y4DE 2VF2A 1T25A 4K6KA 3RH0A 3KDPA 3QY9A 2NSYA 4R9UC 4YJ3A 2AOTA 3HN6A 3JQDA 4PZYA 1UCFA 1FFXA 1NYTA 2CKMA 3BOSA 1HDCA 4JSYA 4OHRA 4QGFA 5FPYA 4DF3A 5IF9A 3CZRA 3E23A 3TSYA 3VR6D 3DZFA 2Q4OA 3MGBA 1RQNA 2NTVA 4BQRA 4G5QA 2Y77A 4HFMA 2X9VA 5EA2A 5EKDA 4PN7A 4PR0A 1MPTA 1O94A 2H57A 4Z0TA 2ORWA 3PITA 3SE0A 2MR5A 2DPLA 4G63A 5LP6F 4AT1A 1G7SA 2IZOA 2VSNA 1AUQA 1LX7A 3GK3A 2OV1A 3L04A 4Q3LA 3RYCB 2P75A 3MWFA 1SVOA 2FPRA 1IYZA 4EL5A 1X13A 4MA0A 2OOSA 2B0JA 3QEBZ 1PR0A 2HU7A 2VEDA 1Z38A 2OLEA 3IO3A 4L0DA 1U0RA 1SKYE 5HBGA 2GAOA 3EW7A 4MHOA 3K70B 1GAXA 4K3UA 2VUTA 3TPZA 5EWMA 4MO9A 3USZA 1KVRA 4GZ5A 4ZO7A 2EARA 3MA0A 3ROMA 4EI2A 3IDZA 4EAAA 1GITA 1DX6A 3E4DA 2JJ8A 5J3JA 3Q88A 2FMTA 1U8XX 3K0HA 4Y67A 1HDGO 3N2KB 4QBGB 1GQRA 5LBIA 4IOJA 3JXEA 4DR5B 3I73A 1E2UA 2XMSA 3N2GA 5TPZD 4BKOA 4NULA 4F2PA 1V0JA 3LW8A 2VBGA 1XWIA 1FOEB 4GE3A 3SE7A 4UVGA 4DA0A 4CKBB 4JEMA 2O2EA 3UENA 2CE2X 3LUFA 4CEJB 3IP5A 4N48A 1FMCA 5LZ7A 3TFWA 221PA 1JJFA 3BD7A 1PFVA 3NTUA 2ACWA 4AFNA 1KP9A 2LR0A 3A6HA 5AJWA 4AF8A 3VPFA 3FPSA 1ECBA 4DJFC 4NE9A 2AS0A 2IXFA 2F64A 3GCZA 4FFMA 1JR3A 3FJ1A 3KQSA 5JWRA 1CP3A 2IYFA 1O96B 1H85A 3GJ0A 5E3IA 3TNDA 2O3TA 1CUUA 1ZD4A 1PW5A 3X2SA 4Y1RA 3O90A 4KWEA 3PDIA 3PGKA 4QOFA 1T0BA 3KLPX 1OI3A 4L2IA 3KYCB 3T1VA 4ZK6A 1DNPA 1GHTA 3F7TA 4CKZA 3NHZA 1B73A 2QF7A 1KI7A 1KXZA 1SIUA 2LWIA 4GP9A 2IWHA 5EHQA 1JILA 3QUBA 1H1DA 1F4PA 2QIOA 1VE9A 1XL1A 1KQ3A 3WLQA 1C3OB 1I1HA 1V7CA 2P2SA 2GCGA 1QPBA 3B3QA 3L46A 3RSOA 3FPGA 1EVIA 2RGNC 4ZYVA 1W59A 2G70A 2FPXA 3M5CA 1IZ8A 2FXIA 5JMPA 2OQIA 4PAMA 3KD2A 3ELUA 4FDVA 1XFAA 1NW3A 2A9FA 1Y4AE 1PFQA 2GPBA 3OQHA 4Q5IA 3AR5A 1GPLA 1HQYE 1PZNA 5BOVA 4LPKA 4AY3A 4JL6A 2Z4TA 3F8SA 1OMOA 1NKTA 4JEHA 4MXDA 2X58A 3BJEA 1C3JA 3BTOA 3M6LA 1XIVA 4GHWA 4XQEA 5CYOA 7YASA 1R8XA 3TLXA 4MDFA 3E82A 3H18A 4ATNA 3LQ4A 5DT9A 4U9HS 1SBIA 3PI7A 1FDRA 4IZHA 4HFRA 2CLHB 3PDJA 4O4LA 2NN3C 3T3EA 3WGHA 5JZVA 2G9VA 1XD8A 2BI4A 4B7UA 1ANKA 5FUQA 3SEQA 3Q3VA 4WRRA 3LK6A 2FA9A 1C3XA 2DG2A 2AMYA 2ZTSA 4R1LA 4TYYA 1PO7A 2R96A 4CMKA 3HZOA 4UHDA 5DHUA 2C07A 4AG3A 4KIFA 2XRZA 1OIVA 4M0EA 4C87A 3U3JA 1RRMA 4URUR 4TLLB 4YCJA 3KQYA 4FYYA 3WLOA 4HUTA 3VNSA 3BPSA 1IEQA 5F98A 5BRAA 3SN6A 2ECFA 1RFGE 3PUIA 3EXEB 3RIXA 4YCSA 4HAOA 3GFFA 2XUQA 5AVOA 4JFAA 2R8YA 3C70A 3GLHB 4S35A 3SVZA 4X6XA 3UT6A 1ZJZA 1J5EB 4D8VA 3GBPA 2BHSA 3MWJA 1QRRA 4MYDA 4LJRA 5G53C 4N4AA 4JNCA 3F7OA 3UJDA 3IA2A 4PE5B 3R5HA 4F5ZA 1NG1A 5FTKA 1BH2A 1RJFA 2VNHA 4EYGA 5TQ2B 3BTVA 5D3MA 4LQ4A 1I0LA 1R00A 1KI9A 2QTFA 2ZI6A 2WILA 4NBRA 5F35A 4OJNA 4NEQA 4NZZA 3GLGB 4NV1A 1AG9A 3IAEA 3PUYA 1W2WB 2P6OA 3RFUA 1FRVA 4B71A 1LPNA 2F90A 4B3JA 1SUFA 1KNXA 1U7UA 1H2XA 3LT2A 2JEYA 4YJDA 4C3ZA 2KE5A 3WNVA 2EFDB 1N33B 4DYVA 1MORA 1CQWA 2A30A 3BRSA 5CVCA 5EIBC 3V7FA 5I8ZA 3RVNA 1K89A 3VTZA 3SYKA 3RSLA 4FXPA 3CVYA 5IABA 4XIIA 1FMJA 1RZRD 4GPTA 3PVCA 1H2HA 3GZTB 4FB5A 2M32A 4UFNA 4AJNA 3V3TA 3UFXA 4BE7B 4G5SA 3O83A 2GA8A 4AY4A 1OZFA 3IC5A 4HMOA 3KKZA 3LVQE 4FHCA 3ICOA 4M46A 5K8VA 1X7WA 3DDUA 2XEDA 4B40A 3ZWQA 3FGOA 4QU8A 2TMKA 1B8NA 1XOIA 1CZHA 2YINC 5G4KA 3VGJA 1DG1G 2Q6LA 1PV2A 3L8YA 5HIMA 1FMFA 3ODPA 2QVXX 4RVDA 3JVIA 3EUEA 2DQYA 4EF5A 1KAOA 5K0NA 5FX2A 5IMSA 1YQ9A 4E2XA 4DMMA 1VE3A 5BNWA 1NVUQ 2CF6A 5ISMA 4M1TA 4DT1A 1ZJJA 2HNBA 1CS0B 2NSHA 1OAAA 1L7EA 4LTNA 5L3SB 1PR6A 1L5HA 4OKNA 1L4HA 2AE1A 2C31A 3E3MA 3WRYA 5FLXA 1W0JD 3JD3A 3VU8A 1T9GR 1BQEA 2GPWA 2ZPAA 4FP9A 5IBPA 3ZU2A 3JVEA 1D1SA 4DR7B 4L2IB 2FPUA 2WABA 2R00A 2VDOB 3W3AH 4IMJB 3BM5A 3ZGVA 2J9FB 2QT9A 2G0AA 2SNIE 3WA6A 4CDRA 1PX2A 2QX7A 5HKBA 4M9QA 4W9MC 4J4HA 3RUCA 2HHHB 1WLSA 4G97A 3FB1A 3TMKA 3JYOA 1N1MA 1RYMA 1Y7LA 3FY4A 5CVUA 4R3UC 2WPDA 2P1RA 4JGIA 3R0QA 4C20A 5JSHA 1K3UB 1UJBA 1KE1A 4I08A 2H9YA 4MV7A 2BMEA 4ZZ2A 4P5EA 4YUZA 2QZ9A 4PQGA 3O8OB 3EUWA 5B64A 1TVMA 1BDMA 2A50A 1QYVA 1S8FA 3G8AA 3NBQA 4OM7A 4A5SA 2X6TA 4C0HA 1HURA 2C4WA 2ONCA 3ESZA 3UC9A 4CFSA 3AP2A 5TQJA 4ZEMA 2IHTA 4HNQA 4A0RA 3LFTA 3CO5A 3O8DA 4HLDA 2R1TA 2C61A 1HDOA 3IEPA 4NJEA 3SM9A 4BUZA 2E1PA 3T3MB 4R2WA 3LQ2A 5EUMA 2UYQA 2JD1A 2NZJA 2YFHA 5AOCA 4ZI7B 4C6TA 2GZDA 3UC5A 3UN1A 1SXGA 4PQRA 1TJ5A 3F5MA 3T7KA 4FNMA 3TLMA 1IMJA 3AIIA 3R2JA 4HNGA 1UOQA 3RU2A 2XUJA 3ANXA 5ELXA 3KVNA 2B7BA 3DTVD 2YOFA 9ABPA 2ISQA 1KDZA 5H80A 4Z5XA 5JNUA 3T38A 4P80A 4KKVA 1Y0BA 2C4KA 1NULA 1ZM2A 1GFSA 1G20B 3TIXB 2EQAA 2H1SA 1C0EA 1S9DA 4OI4A 2JCBA 1ES9A 1MXFA 2DFDA 4G4SP 2ACVA 5TMBA 1W36C 2HCTA 2FDXA 4NCHA 3BQ9A 1UM9A 3OOHA 4UAGA 2WJ6A 2FUG1 3W5BA 4CI0B 5D6OA 2OHIA 3V8BA 3T7EA 2IIBA 2NWQA 2YN0A 5AVRA 4KKXB 4RZQA 2Z0MA 4P4SA 3BWBA 4CT5A 1J2YA 1DBVO 1OWOA 1XMSA 5FBHA 4CEIA 3QYAA 4N8DA 5HA5A 4OQMA 1XCGB 2PIAA 3LVFO 5FD8A 4B2PA 1Z4IA 1Q92A 4PSCA 5K8CA 1GPYA 2NU6A 4A2PA 2PXXA 4QAJA 3DVAA 4Y2TA 2ODBA 3BMOB 5HS4A 2WT8A 1YGPA 3HDTA 5DGTA 5DTRA 1U0GA 4X64B 4WXPA 5KSYA 2BDTA 2GF2A 4DLBA 4UTXA 1H9AA 1EDOA 1YZLA 1BX0A 1BS1A 1D2RA 1HFJA 1PQPA 3IDOA 3L8GA 3IEIA 3V4ZA 4CLHA 1EVKA 1OSNA 3COZA 3A3NA 5IVPA 5KNDA 4J1SA 3TW6A 3IEVA 2CY0A 2FJPA 3I2HA 1DDGA 4OQDA 4Z9FA 1UT8A 2XCQA 3HKDB 3MT0A 3RWOA 1FB5A 1ID8A 3OE4A 4JLBA 3MXTA 1ORTA 2WYOA 4FLMA 3PX7A 3AKCA 2GN4A 3EX7C 2NXWA 3N0XA 3VSDA 2EWWA 4BPBA 1Z13A 2R6R1 4X20A 5TVKA 1MENA 4GLOA 2UZ4A 1L7XA 2HDOA 4FCWA 1AURA 3K9NA 4TRMA 2VLIA 5G4KB 2E2WA 3LD9A 3LHDA 4URHA 5AVSA 2EJTA 4DIDA 1LWOA 1EX7A 1PBTA 1SBZA 1NX9A 1YQWA 1CD5A 2PRZA 2WIFA 3L7BA 2B7CA 4B6OA 3UWMA 5E4FA 1ZD1A 3OCJA 1F38A 2H4HA 2NXCA 4MIKA 4DR4B 2GHQA 2AA3A 2YW2A 1ZNZA 1OASA 4DXAA 3DCIA 1N2SA 2I2FA 3PHGA 2HHJA 2R6ZA 2Q3CA 4FWBA 2G67A 3HABA 3DZBA 3UCFA 1PJ4A 1GFZA 4P4UA 2VF4X 3TQHA 3Q2IA 3SZOA 3ZXIA 3TW8B 3G85A 4JB0A 3UKOA 3UB4A 1VP3A 4KO2S 1M33A 4CNQA 2HEIA 3LT5A 4KL8S 4FQ5A 1QFSA 3P5SA 4C78A 1NVGA 4PZCA 1K5PA 1XUOA 4W1SA 4HP8A 4KO4S 1VSVA 4ND7A 4N82A 3N0WA 2BBOA 5I9LA 2VNSA 1YJQA 3B3AA 3AUJB 4DWWA 1KA9H 4X3OA 2HO5A 5BV2P 2VDRB 4RS4A 1NQWA 1UIRA 3O4HA 3OLVA 4GQBA 4LWPA 4X84A 5EJ5A 1R8JA 3RIMA 2NTNA 3DJFA 1YU6A 4CNBA 1GQSA 2HBYA 1J24A 1RZ3A 3KSZO 4GOLD 4ZVMA 3RBZA 2AC4A 4EYSA 2EG5A 5JY6A 3VVLA 1ZK1A 2V9PA 3M1LA 5HUHA 2DY0A 3LECA 5HCIA 5IBCA 4N9WA 2R3SA 4V03A 2WHXA 3OAAD 1TCBA 1OI4A 1Y1SA 3JWIA 1Y1QA 3H6GA 2FFBA 2PNJA 3LUGA 1QGYA 4YR7A 2JZCA 1A5SB 1VHDA 2LE0A 1SU8A 3TTSA 5FL7D 5AW0A 1J0DA 4Q1CA 3UOWA 4BX8A 3F2VA 1NONA 3H1GA 4D3YA 4CMIB 2J09A 3WLIA 4EG7A 4I1PA 4XQCA 4Y7DA 2VJCA 3IKJA 3WHPA 1BMDA 4MVJE 3SX0A 3PCRB 1EX1A 2PMBA 5U4XA 4G1EB 4FMDF 4MWZA 2BEUA 4RHUA 3ZWXA 10MHA 3LBFA 3CFAL 1SXJA 3LXMA 1DTSA 2OO5C 2GHRA 4BC1A 1J7JA 2ZB2A 3DO8A 4TYPA 3BERA 1DCKA 5DVZA 2HIMA 5EMLA 1FNMA 2VYCA 3ENNA 1ZD2P 1BC5A 5K3OA 1PTJC 4WFIA 2DCMA 2H4XA 4RD6A 5DH9A 1UC8A 1XJ5A 5C8VA 1F17A 2YFQA 3KRTA 3DXXA 4ISBA 5DFAA 3WGTA 3R3ZA 1Y1PA 3OY2A 1JH8A 1OLSB 4CQJA 1VL0A 2A9QA 2PTHA 1JIXA 2FZWA 2R6AA 3STWA 2JKYA 3C24A 4BEVA 1JLHA 4ERNA 3OOYA 4I5FA 5LB2A 1PW7A 3KAKA 4PRLA 1D2EA 3TLEA 1YNSA 3EZYA 5FYDA 3ZE2B 3FDXA 5ADWA 2ZIEA 4ZVQA 5ICCA 1X1CA 3H2YA 1G5PA 1KFEB 1O8CA 3RS2A 1G9XA 3I37X 3HK2A 1R0WA 3EBOA 4UNRA 3DO5A 1RHUA 4IQ8A 1HFWA 4R2KA 4BLWA 4XIFA 4E7PA 2NU6B 4YPVA 3LC2O 4J0KA 2NUAA 3JWJA 3AY3A 1L3BA 1YUBA 2C97A 1B0UA 4HL6A 1TKRA 3V8QA 2XQGA 1XVAA 2BLLA 2QW1A 3B85A 3L7KA 3W6ZA 1C7QA 3MNFA 1L8QA 3E0QA 3PUWA 4NYJQ 4PPGA 2OLJA 2VNAA 4FDMA 3IDSA 3UMYA 4EBFA 4E94A 3L43A 3BEDA 2BBTA 4H35A 5BYKA 1Z6AA 3AO0B 3H2BA 4N40A 1R15A 4WLOA 1XZBA 2O5CA 4F6CA 9GPBA 1CB0A 1T1RA 2BGMA 2KLBA 3AP1A 3IELA 4GWLA 4AZ0A 4DDHA 4IFTA 2XT6A 3ELWA 3LLCA 5HRAA 1HV8A 2PN1A 2VKQA 4RA9B 1WETA 2ZEJA 5DNYB 5TS3A 3FCCA 2A5YB 2DOKA 2E82A 3FWYA 3GPLA 1EM8B 2OYSA 5P8WA 2GPAA 3O1JC 4ZVVA 1L8OA 1QKKA 2ZREA 1ENYA 2FRDC 1TYDE 4IH4A 4IIJB 3SOPA 1C7ZA 4CM9A 2XXBA 1I2BA 1NUHA 3GFBA 4DRXB 5U9CA 3CIFA 1N6OA 3B3FA 4AKTA 5IXJA 1KOGA 1GFIA 5C7YA 4XKJA 4MP8A 2YFKA 1XSEA 1Y4SA 1U5AA 1YK0A 4LF7B 3KFLA 1L5WA 2ZJYA 2B94A 1J42A 3COJA 3CF6R 2ZI7A 2Z8YM 3N0TA 4WE3A 4AZSA 2IF2A 2NSLA 3WFIA 3ON5A 1JT2A 1JBEA 1MQ9A 3ANTA 2YZMA 2XYGA 3PNKA 3QIAA 1LA2A 4K9OA 4Q47A 1P74A 2C3PA 3NWPA 4RXTA 5TQ0A 3ZTWA 1SB8A 2NZVG 1CF2O 1T8WA 2PU7A 3HWWA 3W5CA 4UHFA 2XGGA 4MQ5A 1E7RA 3PWZA 1KSGA 4U6SA 1DFIA 1EWRA 3KJIA 1QQAA 1LW7A 1XDSA 4IHJB 4GKAA 3SS9X 3LTEA 4OO3A 4JGGA 5GVSA 1UDWA 2BEKA 4JD5A 3JQGB 4LY9A 3TLCA 1U8YA 4FI3F 2BSAA 4BCDA 3GEDA 1DIOB 4RY9A 3KBBA 3WOVA 3FPEA 1RPJA 5E3HA 4CCYB 1SWVA 5BV0A 4E5VA 1AF4A 2R8RA 3ZZ0A 2X8WA 4DNPA 1G7RA 5IAAA 1FXWF 3WNZA 5LQSA 3E6AA 1USUA 3Q15C 2OAEA 4NYIR 1A76A 1HE3A 4XSGA 2NQTA 3K30A 4HXFB 1MXHA 1UOOA 3CCBA 2P77A 1XZKA 5KOHB 1P80A 1YZKA 3PGXA 3NH9A 4NOLA 3R7FA 4P33A 1MEEA 4X5OA 3HVRA 2QP4A 3MD0A 1E1QA 2VNJA 3EXFB 1LVHA 4DGSA 3CRQA 4LFAB 2BBWA 2DBZA 1EFTA 2ZIVB 3UJ7A 5B36A 5K09A 3EHEA 1QU3A 1GDDA 4NENA 1WKBA 4DDMA 1XZIA 2I0FA 5JCPA 1NF8A 1OXBB 1UXKA 5TLSA 1C30B 3B6ZA 4E5SA 3ZHCA 3VOAA 1JEOA 4JGBA 5HKOA 1EFLA 2P2ZA 2HMVA 2FI1A 2RBGA 3O8LA 2WI8A 3C3CA 4PAQA 5CGQB 5FBZA 4ZO9A 5KDOA 3PU6A 3HB9A 2ASEA 4JT4A 4FOPA 4OUDB 1KK2A 2M98A 1QIDA 4FI3C 4A0HA 1L6IA 2IDKA 5KYNA 1KY2A 2J4FA 1PDOA 3GUVA 1QXSA 3AYZB 3N6RA 2OZVA 3AZPA 1MJGA 3DW1X 4CM1A 4OI1A 4B35A 1O87A 3KWJA 5LJIA 4O4HB 1ENZA 3KOOA 1XK6A 2JRCA 3B13B 3CCFA 1N9ZA 2OEPA 3MTGA 1B3RA 3V34A 5MF6A 1YQGA 4DMUB 1T2CA 1OXUA 4E5YA 4JKOA 5L4LA 3IUPA 1SN7A 3WGYA 1IOWA 1E3IA 1GNVA 2XMPA 1Y3FE 4RHXA 2IOQA 2QD5A 2H2WA 3INGA 4V0MA 4X93A 3WGQA 3ECAA 4JJ6A 3KZVA 2HMTA 2IUUA 4EG3A 3QU7A 1JEYB 3RYFA 1RPZA 4K9LA 3R76A 1G2OA 5AKKA 5ALRA 2ECPA 1EX9A 3TTYA 4RXUA 4NZNA 2ONZA 3VTFA 3HJAA 3U4CA 3EIEA 4I9FA 2WPNA 3WGLA 4CUZA 5JS1A 3ENZA 2GASA 4B84A 1QLJA 1DKPA 3T7JA 3KSBC 4DUGD 3G2PA 1Z0AA 3L0SA 3KWLA 2G9ZA 4OY3A 2CNDA 5BWLA 1JNYA 3I12A 5CGZA 4OXRA 4MEAA 5ADUS 4EW6A 3D7KA 4Z7JA 1B6SA 3DE4X 1CQPA 4YB8A 3A36A 2X3YA 2B9VA 3EA5A 5JSQA 2I2CA 4TV9F 1PSZA 3RIHA 4AXXA 4ITRC 2HY7A 1V9CA 1BDHA 1A4UA 2Y0CA 1G41A 2JLVA 2FR1A 4R4JA 2I87A 2VWHA 4YI3A 3T7CA 3O3NB 4FZRA 5CUQA 3KSAC 5KSPA 4PPYA 1CUBA 4YJFB 4F3KA 1Z5NA 4K86A 5FQOA 1OKKA 1TW2A 1Y6RA 3UAZA 4DBLC 1YDHA 3JALA 2BE9A 4UHEA 3RAJA 4IIEA 2VJLA 7ADHA 3TZKA 1FTNA 3TLZA 4B3HA 2PMKA 4JFRA 3OIFA 4PYNA 5EKXA 4C2AA 5I48A 1XR3A 4C2BA 3NV9A 3H1PA 4NC9A 3Q8MA 2L17A 1J8YF 5KTPA 5TE9A 2XQFA 4MDEA 1EJ0A 1KY5A 3G1TA 3CFYA 1NBMA 5GVRA 1XWFA 3BJZA 1W5SA 4TUYB 2FTKE 3UTDA 1EUCA 5KVVA 4D0RA 3OBBA 2FMUA 4FZVA 4WVFA 1F2UA 1A5TA 2F3RA 5I7AA 5J2UB 5AJHA 1GAWA 1Z2PX 4UE2A 5BR7A 1JKXA 3P0RA 3FOAA 4A1OA 4UARA 3P19A 2VRCA 4GRAA 3ROQA 4OPMA 4CMGA 1DLJA 2B8NA 3I1YA 4ID3A 4A6PA 5JR3A 3PE6A 4EHIA 2HL6A 3ABSB 2EBHX 2JIRA 1M1XB 3GVIA 3GXBA 2JLSA 4GE0A 3R75A 3N86A 2XVYA 1YRWA 1LBTA 3VR3D 3IXLA 3IOYA 4I1IA 4DNFA 1UC9A 3ACDA 1KO1A 2IEYA 1QHHB 1U2QA 1XRPA 3OJ0A 1MDFA 1EFVB 4MULA 5LYJA 4DN6A 5GONA 1A88A 1THZA 4CETA 4E30A 4DTIA 4KE8A 1QC5A 2GNOA 4NFHA 4BZXA 1Y8QA 2W9XA 1OV6A 1OLUA 2EX0A 3NOOA 5FKJA 2X7XA 2EKBA 4R8SA 4UE6A 3PEWA 1UBCA 2H7VA 3W6UA 1DKOA 8MHTA 5JZSA 1YR8A 1RHMA 3L6UA 2QQ5A 3C5EA 1H05A 2YV4A 4JODA 3DKIA 1RHQA 3VNAA 4BKQA 2BGKA 2OLKA 3I9V1 5B1YA 4KX3A 3RAFC 2QV0A 5DNAA 2CD9A 3LQKA 2Y99A 2G88A 4R69A 1RAEA 3PXGA 4DADA 3ZQJA 4YMGA 4QPJC 3HA5A 4Y7CA 4IIJF 1ZVMA 4QYTA 1OOEA 1PGOA 2ZYUX 1XAGA 3PEFA