3IMGA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.8 ang resolution in a ternary complex with fragment compounds 5-methoxyindole and 1-benzofuran-2-carboxylic acid
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
288
Chain Sequence
b'IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Application of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 95
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3imgA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3imgA01
1EFVA 1Q77A 3MLBA 3N9IA 2PG3A 1QRUA 5J5AA 1MC1A 2XRYA 1KORA 1KP2A 2QUHA 5LM3A 3AKZA 1X8XA 1O94C 1N78A 3Q10A 3IUEA 4YP6A 3ZXSA 3DLAA 1IVSA 4R0NA 3I05A 2Z09A 1GN8A 4MUKA 1H3NA 4F3RA 3FIUA 4DDKA 4EF6A 3FETA 2A7XA 4HK4A 1N2IA 3CA8A 2RE8A 2XRZA 3SZ3A 4MUHA 1TQ8A 3DPIA 3ILVA 1LW7A 4YBRA 1GLNA 2GM3A 2CYCA 3D6VA 3U1VA 1R6TA 3GUZA 1O96B 1M8FA 1GTRA 1H1TA 3RK1A 2X1MA 1QTQA 4WNYA 4ND6A 4MVWA 2JANA 1EJ2A 4P2BA 4UZEA 4CT0A 3CVUA 5TEVA 4ZT2A 4EG1A 4CDMA 4F4HA 2X0KA 3ZJVA 1MB9A 3MXTA 3VRHA 3N05A 2A4MA 5F23A 4U63A 3CLUC 1OBHA 1P7PA 1GPMA 3M5WA 5KCMA 3IOBA 1KKUA 2YXNA 1JEEA 3SDBA 3COWA 1LI5A 2HZ7A 4KPUB 1IQRA 4MW6A 1FFYA 4MVCA 1T9GS 1BS2A 2DPLA 1ILEA 4PY2A 3KT3A 4MWEA 4R2MA 3TQOA 4EFKA 5LFAA 4XFDA 3E27A 3ND6A 2A84A 2WQ7A 4EG3A 2AKEA 3Q4GA 1YIAA 1I6KA 5TEWA 4NDAA 3IVGA 2PZBA 3P0IA 4YP5A 1I6LA 1EXDA 4MUGA 1N2BA 3MMXA 4EG5A 1O5TA 1TYCA 2CFOA 1KH2A 3HZRA 3IDFA 5J59A 3X1JA 4H3SA 1NUUA 4MW2A 1N75A 2J08A 1Q15A 1TYAE 2D13A 3ELBA 4JYZA 2JAXA 1JZQA 2YWBA 2IP1A 4ZT6A 1COZA 3CLSD 4EG7A 2VTBB 3PRHA 3H97A 3LE8A 3DV2A 3CVVA 3INNA 1O95D 1NP7A 4ZT3A 4MULA 4DNXA 5TS2A 4MVYA 4ZT5A 2DUMA 1LI7A 3X1KA 1PG2A 1K97A 1T9GR 2OV4A 2Z08A 4CDNA 3IMGA 1YIDA 1IQUA 2ZUFA 1YUNA 2HMAA 3MLAA 2CV1A 4MUEA 4MAFA 3CVXA 1IQ0A 3RFFA 3MUEA 1MOPA 2D5BA 4ARIA 1MAWA 3G59A 5HUJA 4MUNA 3OP1A 5KHAA 3ND5A 4ND7A 3ZXIA 3AFHA 1WXHA 1YI8A 2DERA 3NBKA 4JFAA 1WOYA 3IOCA 1VLHA 3LCJA 4TS1A 1G59A 2NSYA 1KAMA 3JXEA 3VU8A 1UFVA 4ZCQA 4AS1A 1R6UA 1DNPA 3RBAA 3P0JA 3ISJA 4NAUA 1MJHA 4EG4A 1G8HA 3QTBA 4ZT4A 3RJZA 3TQIA 1V8FA 2QTNA 4MQ6A 1R6XA 5J58A 2CYAA 1XNJA 2ZUEA 2O5RA 2YWCA 2Z3VA 3FWKA 1N77A 4X0EA 5IHXA 2DEUA 4QREA 4GU5A 4J76A 1QJCA 1VBKA 3IUBA 4YMIA 1Q19A 1TFUA 3HFJA 1O0BA 1JIJA 2R5WA 4OUDA 3SZGA 1O0CA 2DETA 1U3CA 1WXIA 3TNJA 5DEOA 3AIIA 4MUJA 1JIIA 3CLRC 3CLSC 5HUHA 5K0TA 1PFYA 1MB2A 1NUPA 1T6XA 1EFVB 3FHJA 4ZCTA 2H2AA 3C8ZA 2QJFA 1G8GA 1KP3A 3KFLA 2BYTA 2J5BA 1B6TA 3CR8A 3N2YA 5KWVA 3L93A 3PXUA 4KKVA 4L2IA 2PZAA 3CLTD 1ZH6A 3UC5A 1EUQA 1A8HA 4PBSA 3LOQA 4HPWA 1EFPA 1VBNA 2PIDA 5FO1A 1YUMA 3FDXA 3P52A 4MW0A 1QU3A 1M83A 2YY5A 4DLPA 1O6BA 2NZ2A 4S1OA 3S3TA 1WXFA 1ZUNA 3IOEA 2A86A 1M8GA 2E21A 3P0HA 4ZT7A 4EG8A 4MW1A 5IJXA 2I1LA 3G5AA 4MUIA 2V0CA 2H29A 2QJTA 1N3LA 1ULHA 3RK0A 3COYA 5FO0A 2EJCA 4J75A 1SURA 2IJGX 1O94D 3KT0A 1O97D 4R2LA 3SEZA 1TEZA 3VGJA 1N2OA 4EGAA 1X6VA 4DJAA 2CT8A 3QTTA 1PG0A 2E0IA 1JILA 3FY4A 3IH5A 1OD6A 1OBCA 3A05A 1WY5A 3L92A 5DASA 4MVXA 3KT8A 3TZLA 4HJXA 4UZFA 1JHDA 1I6MA 3D6UA 1PFWA 3ZJUA 1CT9A 1WKBA 2BTEA 1EFPB 3A4IA 4K0RA 4XFJA 1PFUA 5BNZA 1ZH0A 1GAXA 5DK4A 3G6KA 4QRDA 4MW5A 3GLVA 5LLTA 3H9CA 3Q12A 1TYBE 2AZXA 3COVA 4KR9A 3TZEA 1S4MA 4AQ7A 2QJOA 4DE5A 1J21A 3NV7A 3QE4A 3IVXA 3KT6A 2DR2A 1MRZA 2A1UA 1IRXA 4NATA 3HL4A 1JEDA 3H99A 1H3FA 1KQNA 2DLCX 3IVCA 4DDHA 1H3EA 1N2HA 1IFXA 2CV0A 2J09A 1KR2A 3A04A 5JBNA 3TS1A 1KH1A 4JXXA 3CLTC 2VXOA 4ZCPA 4HJRA 3AL0C 1GTSA 2DXIA 4QBTA 1M8KA 3GMIA 3ZGZA 4Q16A 2GKSA 1O96A 1Y42X 4MW4A 3PNVA 5EKDA 4PBRA 1G8FA 2G36A 1OWOA 5TGTA 2PFSA 4DDMA 1EE1A 5FNZA 1OWNA 3N8HA 1N2EA 3SYTA 3F3MA 2D54A 1K4MA 4K03A 2CSXA 1WQ3A 4JXZA 1F7VA 1QU2A 1M8JA 3AG6A 2A1UB 2ZP1A 4XSVA 1O97C 1RQGA 3UY4A 2OQ2A 3FI0A 5K0SA 1VL2A 1QQTA 1KQPA 4I6EA 1F7UA 3FOCA 3BL5A 4I6GA 1U3DA 3HGMA 2IELA 4KPUA 2J4DA 1D2RA 2A1TR 4G6ZA 1NURA 3UOWA 1YULA 1NUQA 3HMQA 3OTWA 2QUJA 4KR7A 2PZ8A 1OWLA 4ZCSA 4ZCRA 2E18A 1KQOA 3IODA 1QRTA 5HG0A 1O95C 1U0BB 1F4LA 4A91A 1K92A 5DB4A 4EG6A 1J1ZA 2J07A 1M1ZA 1JZSA 4NZPA 4FZJA 2E89A 4RUKA 1T6ZA 3DO8A 1OWMA 3UK2A 4G5YA 3FH0A 3X1MA 1WXGA 1N2JA 2A88A 1QNFA 4OUDB 4Q93A 4MUFA 2QUIA 3COZA 1GZUA 1KH3A 2RD2A 2V0GA 2VTBA 2HGZA 3HV0A 1JIKA 1Q11A 1FYDA 1XNHA 3PNYA 4G5FA 4KR6A 2QTMA 3IMCA 1N2GA 4MWCA 1J1UA 2AG6A 4RPIA 3K32A 3SEQA 2B7LA 1JMVA 4ARCA 4NX2A 3SP1A 2O8VA 4MWDA 4L2IB 1PFVA 2CYBA 4NAHA 5H7XA 5AHWA 1V47A 1HYBA 1T6YA 1IH8A 2WQ6A 1WQ4A 2EL7A 1J20A 1NUTA 1NZJA 4JZYA 1JECA 3K9WA 1N1DA 3IMEA 4GRIA 3CVWA 2X3FA 4OJMX 4WSOA 1NSYA 3PNBA 4E1AA 2PXHA 3RHSA 3ZJTA 2CV2A 1XJQA 3ZIUA 4MLPA 3CLRD 3FNRA 1OWPA 2WB2A 1TYDE 1F9AA 2A1TS 1K4KA 1JGTA 1QRSA 1WZ2A 3A2KA 4MW9A 1U7XA 4YP7A 3FG9A 2QUKA 3H05A 3ND7A 4MWBA 1XNGA 1J09A 1KAQA 1WXEA 3CLUD 2WSIA 1ZJWA 1WJGA 3AG5A 3CVYA 1EUYA 4MW7A 2TS1A 2QTRA 1NYLA 1J70A 5H16A 1NUSA 2CUZA 1U7DA 4PBTA 1MAUA 4CQNA 4BWVA 3UMVA 1MBZA 1NI5A 3NBAA 2X1LA 1VBMA 4I6JA 3ZUGA 1IHOA 1M8PA 2JA2A 4U7JA 2GOYA 3H9BA 2C5SA 4U8HA 1I2DA
chains in the Genus database with same CATH superfamily
4P31A 2H2HA 3W3AD 2FX3A 1FFBA 5SY9A 2X2PA 5CD1A 3IPXA 5CBPB 4RELA 3O3OB 2FB9A 1MC4A 5DGCA 1ZQ9A 2FSHA 4QYSA 1Q6YA 3CT4A 1BE1A 3IHTA 1X8XA 3EYAA 4L75A 3RPEA 3RS8A 3SDSA 2JB9A 1N9ZA 2MSCB 2IHBA 4EP1A 4LPKA 2W48A 3UJAA 4OGFA 3PQ4A 3ELWA 4YP6A 4NZZA 5LQMA 2B0JA 4IZOA 5I47A 3ROFA 4YPFA 1NX6A 1LK7A 4MUKA 2XY4A 4QIHA 3PS9A 1KDOA 3OICA 1M2NA 2O0HA 3AZPA 3G88A 1T0UA 2K2WA 2PZLA 2ZUCA 1T2FA 3FLBA 1UQRA 4II3A 3CCBA 3DFIA 4U02A 1E4EB 1Q3HA 2FR0A 1R1DA 3KQTA 1G20E 2GN9A 1W96A 2PXXA 3VO1A 3ZW8A 3D7KA 3A10A 2JLVA 4PGMA 1D2AA 1L5QA 4BIMA 1SVIA 5JQGA 3WX0A 2WPDA 4YBRA 1XN1A 2VS1A 3BRQA 3DNMA 2BMDA 4EAAA 2H1OA 1SIOA 2AZMA 4H0CA 5IARA 1XFAA 1OGIA 3WRXC 3LWBA 4LVNA 3L4JA 1HA3A 1SJ9A 2ENWA 3PGLA 1DIAA 3ZD9A 4BFSA 1COWA 3UFBA 4JKIA 1TAUA 1OXSC 2QWXA 3V4VB 3W8EA 3QPCA 2W2VA 3KZCA 4GO1A 1WF3A 4A4DA 3NJRA 2ZRKA 2X0KA 3MJFA 4HH4A 4RHUA 2C82A 3H17A 4DPLA 3ZJVA 3BWXA 2Q3CA 3M6MD 2O50A 1DZIA 5D3ZA 4WKBA 3W90A 3WP0A 4ND3A 1LTKA 3U4CA 3KSRA 4G56A 4H1HA 3AJEA 4D44A 1H0HA 1KKMA 1BYIA 1HEIA 3RREA 2BFFA 1P62B 1PBTA 3WQSB 1Q0QA 3MVEA 1M2VB 2Q6LA 2ST1A 4MGZR 1T4CA 4JA0A 1ZYUA 4TXMA 3UHFA 2ILVA 3QYFA 3I30X 2JRCA 1P5ZB 1CUHA 1O6FA 4H6WA 4M46A 1WMBA 3UAZA 2E9SA 4C2UA 1DQNA 4CBVA 1F48A 4PHTA 4QWWA 4M0UA 2IDJA 2X6TA 4RC9A 2ZRAA 3KZNA 4LNHA 4EW3A 2WQ7A 3NM4A 1IG0A 2VP9A 1FMCA 1TKAA 2FEKA 1WV1A 1I6KA 3AHIA 3B6EA 3S5UA 1GFIA 4C3ZA 3I45A 3JD3A 1M2GA 3L3BA 4IJQA 1I24A 3FCEA 1JT9A 1XL0A 1A5SB 1Z68A 2FRDC 4JMLA 1KJZA 3HVHA 4B6PA 2OGUA 2RARA 3LRPA 2WM3A 5IN5A 3BCHA 4B7CA 1B93A 3L7JA 3PC7A 2WB4A 5AMXA 3TLBA 4R1MA 2KB0A 1XZPA 4DCSA 2IU4A 5A5EA 3AJRA 4Y2VA 3RNLA 1GFSA 3C3DA 1XF9A 4PSAA 5EXPA 4G07A 1TYAE 4JYZA 3M3HA 2C8VA 3O8CA 3LXUX 4N39A 2YWBA 1EGAA 1COZA 1E2IA 2P2DA 3GCGA 1PT7A 1FNDA 4J43A 5NLLA 2HMYB 3RDPA 4B17A 4FFBB 4MMZB 1N1MA 4EVIA 1NV9A 5DHPA 3OEEA 4P4UA 4QAJA 1UBGA 2PSEA 3M4NA 1U9CA 3RRXA 2WFLB 4RVOA 3SHWA 3U3DA 4RZXA 2B5OA 4G86A 3WOVA 1ODTC 2BEJA 2J6HA 5CT5A 4X41A 4YEDA 3WL6A 2HV8A 4AZSA 3EAQA 1U1CA 3AFGA 2ZANA 2Q3DA 4DR1B 2FW9A 3OTIA 5KNCH 1E2FA 1AMNA 4B4OA 2HPVA 2SKCA 5KJEA 3CU5A 1XL1A 3NGLA 2YNMC 2ID4A 3GVPA 3QMVA 3WO1A 4MUEA 3B7PA 3WXMA 3CVXA 4N3GA 3MUEA 3U3KA 5LXTA 1YGYA 2VXYA 3FPSA 3MUFA 3NDRA 5EJAA 5DW0A 3GLIA 4C7VA 3VGPA 2O14A 4LG1A 5HUJA 2LKDA 4A03A 4UFOA 4CU5A 4D42A 3K0SA 3SDZA 4DB4A 4LF6B 3AEXA 1X1QA 2UV8A 4L15A 1P8JA 2XEDA 1H6DA 3K20A 1X94A 4TVSA 3LFUA 1RACA 2WYHA 3L7YA 5DHFA 4C6TA 2O19A 5LZ5A 3WRVA 4NYJR 3O2NA 3RVOA 4UFPA 4I19A 3O1IC 4JB2A 4NBKA 5EC8A 3VX3A 4L5YA 3BGVA 1QH8A 4HD8A 4NC9A 3TECE 4RD1A 2BI4A 4K6CA 5D7NA 4YP9A 3QXHA 4UU8A 4EHNA 4TYWA 1YB1A 1XELA 5H4HA 1P31A 2EGGA 1RXWA 5ECYA 4ZT4A 4ZQIA 1U0RA 2IYQA 2IUYA 4KQ9A 4Z0PA 2FWIA 1PWZA 2C7GA 4WH0A 2WICA 4W5JA 3P9XA 4G0NA 4UOZA 4BNHA 4TLLB 4FBGA 3HSYA 3RVSA 4KTTE 4D9HA 1B6GA 2RHOA 2B99A 2EGHA 3BIXA 3IIIA 5AK4A 4NMXB 1E3WA 4ZV9A 4COKA 2ZUEA 3LYHA 3GN2A 4BO1A 2DT8A 2BUCA 3EJWA 3NBUA 3RLIA 4WE3A 3S2ZA 2PQ6A 2DY0A 4OQZA 1NUHA 2RGDA 4MWSA 4RNCA 4RJKA 2A0UA 2C3UA 2HLHA 3VO2A 1U3CA 3ZIAD 2DETA 1WSBA 1ZGZA 3KLPX 5CH5A 3AIKA 2XQGA 3FZNA 4IJ6A 3QMWA 4Z1OA 1CUGA 1QCYA 2A3RA 3RCBA 3LXMA 1E1KA 4IHJB 3HYLA 3B8HA 3G8AA 2WF9A 5L3RA 1SRQA 2QKYA 1MB2A 3ZDQA 3KHUA 2AG1A 4H1WA 1QP7A 1QH1A 3BXXA 3AHDA 4RIIA 3F5FA 4TRRA 1FUUA 5B1IA 1JN0A 3WRWA 5JPDA 4D74A 2XSZD 2AOUB 3EG9B 3KFLA 3KZXA 4HAVA 4I1OA 4PHHA 3IBTA 3VZRA 2HKIA 1VE1A 4C0KA 3NOVA 2UZ4A 1QYCA 2HCJB 2VA9A 2REQA 4A9AA 4I1PA 3CLTD 5CEEA 3R4CA 4YJ2B 1PKEA 1Z0SA 1JI3A 3LX6A 2VDNB 1GYQA 4TOIA 3I04M 3PCRB 4AUKA 2WF6A 1N8NA 2NV0A 2O2SA 1IBRA 3L6BA 2ETXA 3O4GA 2PIDA 4P7GA 5FO1A 5ARCA 4Z99A 2JGNA 2OO3A 3EXHC 3FPBA 1VCMA 3R09A 2HPZA 4MKXA 1A88A 4JGIA 4QARA 4LOAA 1PJQA 3UMYA 1SBHA 1Z2PX 5HXAA 3KOYA 3GW8A 1S3GA 4JUBA 2HU7A 3Q6IA 1LBQA 1NXXA 1UPAA 3B38A 3S7ZA 1NBMA 1Z6PA 1W6RA 4UTXA 4B47A 2CK3A 4GMGA 1SBZA 5DK6A 3PDHA 4I4TB 4D8UA 2JHPA 1SHUX 4HTAA 2GWRA 4GNRA 3ZH9B 1VGRA 4DLSA 2DFPA 1PV1A 4UAVA 2PR2A 2G9QA 5JW6A 1IN4A 1QWSA 1YR9A 2JJ2A 4B82A 5L4LA 4HAUA 5IM4A 3LT2A 4NZYA 3T6KA 2G82A 4B5LA 2BFCB 3ZY3A 4ZI3A 1VRVA 3EVDA 3IEXA 3KSDO 3AY7A 4AUNA 5DV9A 2JAUA 2W8ZA 1LS6A 3GJSA 4WA7A 3T7EA 4CJXA 5KBYA 4EMTA 4ZU1X 2H2FA 2PL3A 4FCVA 1B8VA 4M87A 5EE5B 1NQTA 3L92A 4OMDA 5DASA 3F3KA 3GJ6A 2DQYA 2H5LA 5B7PA 1O77A 1W5TA 2BBTA 3G0CA 4XTCS 2O2CA 5CCBA 2VZEA 2G67A 3BMXA 1U3FA 4R40A 3ZJUA 2QRVA 4F45A 1RXSA 1J8FA 1EP1B 1SXJB 2TMYA 1I3MA 4MR8B 1ATIA 2H57A 3BH7A 3ZCPA 5JZMA 1ACMA 1IDN1 1PQYA 4N0EA 1I2ZA 1YF3A 3ZWNA 1GU7A 3T1VA 4EQ6B 2C2ZA 2H7VA 3TZHA 1LRKA 3I8XA 2WTMA 3DMGA 1MABA 4UVDA 2O2XA 1SKMA 3LDFA 3F7MA 2IOHA 2QJOA 4MIOA 4GKJB 3CWQA 4LMPA 2OFOA 2GF0A 2P67A 4QUDA 3HY6A 2QYSA 1GUFA 3OOYA 5AM2A 2YMMA 1GXSB 2ZE7A 4M8SA 3BPSA 2O3JA 5DM4A 1HTTA 4UVGA 3DBVO 3H9UA 2AJCA 4F5ZA 5HZMA 1HETA 4QDXA 1Q7BA 2EZ8A 2P65A 1H3EA 1X13A 4YRPA 1GAJA 3DUWA 5C8ZA 4UPEA 2QNIA 3DV0A 5LMCA 4HMQA 2XMZA 3B5IA 3K9HA 2EXXA 2XV1A 2X9GA 2OHIA 2J4FA 1T2EA 1BH6A 1D9ZA 3KZ1E 4BJHB 5IAAA 1R8SA 2G0AA 3ITDA 4LHVA 3HA3A 3V4FA 4CW7A 2J3HA 5FQOA 3BMOA 2WIDA 3BMCB 5E1MA 2IK8A 3T5TA 4NEGA 3LOPA 2P2YA 3GUYA 2ZRIA 1CRPA 1FA9A 5IAKA 4XKJA 5KNLA 1G98A 2GXSA 2I9PA 1VJ5A 3HCOA 4FEYA 1FXWA 1HURA 2PBFA 1M2KA 3N8HA 2AYYA 4ZP1A 3F3MA 1K4MA 5E8RA 4Q3DA 4JI3B 1YB6A 2XRFA 5LQDA 5AFSA 1NN5A 3JARB 3O91A 4IINA 1YHZA 2D3WA 4PGAA 1BKSB 1U0HC 1KSFX 1FP4A 2HN9A 3E4DA 3E7WA 1KMHA 3FTPA 3HLYA 1V4VA 3L7DA 3PEUA 3ZZUA 5CM2Z 2FUG1 3R7DA 5L40A 1PJTA 3CX6A 4AKGA 3VI3B 3FOCA 3OAAD 4KQHA 3K09C 1Z06A 1RP7A 1VJ1A 3O82A 1C2TA 4Q6WA 1LUAA 2VJLA 4NTZA 5HFAA 3L0DA 4G6ZA 4CQLA 1CRQA 2E4ZA 2SHKA 2P75A 3NOOA 1IJFA 4KR7A 1XQYA 1YZLA 2PZ8A 3FYTA 3DPUA 3WGJA 5DEIA 3OCZA 2EBFX 3QKRA 4Q9LA 3V00A 2G70A 4MB0A 1NVVR 2FSPA 2VJBA 2PDAA 1U0BB 4AT1A 3B3QA 4OJKA 1DG9A 4X8HA 5C5EA 2B9VA 4L8GA 3C3JA 5KS2A 2MU1A 4YI3A 1M1YE 2IXAA 5HJ5A 4W4TA 5U4QA 1SFRA 4MZXA 4P7FA 1CUUA 1LS1A 4OQYA 4LBVA 2KBEA 2C5GA 1U11A 3KD3A 5LYYA 1KE1A 5JYCA 3DAGA 3OOHA 4N12A 3NTRA 5HE8A 4PPFA 2B37A 4TKLA 1P2TA 4RHTA 5CIWA 5AI8A 5KOHB 3HCNA 3ZKAA 3I8OA 2F8MA 2PCLA 1FRVA 2H52A 2IHYA 1C0IA 2Q0HA 1KVQA 2C5HA 2RHGB 2VT6A 3B2EA 4I1SA 3VHXA 2RD2A 3SOPA 5BQ3A 3K9CA 4NIMA 3VR4D 5T6MA 2WAXA 3ESXA 2VAVA 1U80A 4XB1A 4ZHSA 3HCWA 4U00A 5I7FA 1XXHB 1XVLA 3GPLA 3EPPA 4X3CA 1V3TA 1I5OA 2JAPA 4P81A 3ZWXA 4TTJA 4YRFA 5I7HA 1N57A 2C9BA 1OFIA 2RGBA 3AO0B 4HNAA 3BDIA 5J4HA 1WBBA 4Q4JA 5HF6A 2IEDA 4F5DA 1EXNA 2HNKA 2BP7B 4LTNA 3SP1A 1ML3A 3ZDDA 2XI4A 2I6FA 4M49A 1VECA 2X0JA 2ZXUA 1G19A 3C3AA 5K0EA 2PN1A 2HJRA 3UIEA 3NT5A 4U2FA 3AEZA 4XM2A 5EQFA 4CM9D 4HNRA 3R23A 3IBGA 1YZGA 1DXHA 1W47A 1SXGA 2ZI4A 2ZU0C 3F1LA 3R77A 4U5QA 3VPSA 4DUGA 2VRCA 3A1NA 4HNUA 3UCXA 3GRPA 3D3WA 3EGVA 1SOUA 3L1UA 3LCUA 2X9LA 3O0TA 4NH4A 5K51A 5T4EA 4CKCB 2EBUA 4E1AA 4OMCA 1FVXA 2ZQYA 3F67A 2PXHA 4FNOA 4IQ4A 5EINA 5GJVC 3C45A 4QVKA 2CV2A 2NUPB 1IBMB 2QRNA 3R3SA 1OWPA 3O3NB 4RD0A 5EAIA 5JS8A 1ECBA 2UUPA 1LRJA 1K0FA 2PKEA 5ICEA 2ISSD 4DADA 2RKBA 1FU8A 2A1TS 1JA1A 1GGVA 5F9MA 5CG1A 3OMWA 4KUEA 4HQ6A 3H9QA 4U39A 1KL7A 1OA1A 1XP8A 3R44A 3U7QB 1ZXBA 2HB6A 1DKLA 5EP4A 3BHNA 1CUEA 3KVRA 3LY7A 1OH8A 1LW6E 1KFCB 4LZZA 2NM0A 1ZJWA 1SVMA 5B1YA 4GLFA 3AG5A 5F4ZA 1C1DB 1KGSA 5AI4A 3IPCA 3E9MA 2BGLA 2CL7X 2CJYA 4MW7A 3LNTA 2J5XA 3TTSA 3ZDCA 2M1ZA 3AJ9A 4ENQA 1PKXA 4G5SA 4ZZIA 3QJGA 4YAWA 3ZGYA 4KACA 1U9JA 4H31A 1GILA 1TECE 2WJYA 4PC6A 5K8CA 3PR2B 4IUYA 4JU9A 1KZ6A 4YUWA 5DU2A 5K6RA 2C78A 3HSSA 3MJEA 3CSUA 2W8BA 4YLYA 1OQAA 2B1QA 1EVYA 2IIVA 3KR0A 5EMHA 3SZLA 4J0IA 1FX1A 1JEAA 3NWPA 1M8PA 4UHHA 4DV4B 4ZTZB 4UDOA 3GRYA 4DJEC 3BTUA 4HUQA 4WERA 4EY7A 2GPAA 4YR7A 1EFVA 5F2EA 1N36B 3OZEA 2V9CA 5J5AA 4FGSA 5BSRA 4PVDA 4BPBA 4OHPA 4RLSA 4KXLA 3NAMA 2PNJA 2Q4BA 5JARA 5K2MA 4Y2SA 1RQNA 2XB8A 4HDNA 4BRZA 1TCBA 5BURA 3SQXA 4DTIA 1HWYA 1R4AA 3GLFB 2YYZA 1U2DA 2OM6A 4QOIA 4LISA 2JFWA 3RIMA 3ZS9A 1NRXA 1T3ZA 2J9GA 2O8BA 4U7TB 3HE3A 1Y6GA 1H3NA 2FSVC 2IVFA 3H5IA 3P96A 1TZMA 1DC6A 3ZBQA 1NRWA 1TKRA 4ZA2A 2V5UA 4KQKA 5FEMA 3A4MA 1N0VC 3F1KA 1QYDA 3GYBA 5JAHA 1DO8A 1MVLA 3RASA 3C3PA 3N2KA 1EHCA 1AX9A 4GPAA 1UPBA 4JR1A 5CVDA 3GJYA 1Y4DE 2HNAA 2WZDA 3SYLA 2IDKA 3F7OA 4OD0A 3NT4A 3E0XA 4DV7B 3QNMA 4HPJB 2ZAGA 4LC9A 1QIIA 4Q9IA 1TUGA 3JV7A 3IJ5A 4ARBA 2X1MA 2JZOA 3D7SA 4ZREA 4URXR 3TW0A 5AW0A 4BNTA 5LP1A 4TYYA 1R15A 3BFPA 1XWWA 4M9UA 2FMTA 3GO4A 4WL0A 4B3MB 4KQIA 4PCVA 5JCZA 1RQ2A 3CG0A 5TEVA 2K2QB 2JGDA 3DW3X 3GBVA 4EDFA 3R9XB 4F4HA 5FOSA 1HPLA 1RYFA 1S0UA 4J3FA 4MB6A 4K0KB 1FJHA 3ONNA 4BFTA 3MXTA 1D7OA 1NM5A 4N8EA 2VYVA 2D1QA 4ANFA 2B8JA 2GUGA 5IT4A 2AEMA 3LP5A 5DOVA 3RVRA 1S2LA 1JR2A 4JEMA 5AVVA 5F7JA 3QA3E 3MPOA 5CVUA 4IRMA 2XMPA 4NCHA 5A7GA 2GD0A 5KWSA 5KNBA 5K0ZA 4JD5A 2H5JA 4OYHA 2M6LA 3TNDA 3DLIA 5EE9A 3WZMA 1Y3CE 3GP3A 3SVLA 2IPAB 4KLCA 3W1WA 1UWLA 1YMVA 2MYTA 4BFLA 4Y0AA 4JNKA 2WZBA 4QFDA 4NF2A 1XN4A 2PGIA 1SVUA 2I6UA 3BJIC 3EGXA 4MKGA 4E15A 2WMYA 3RG8A 4TV8F 1E9CA 2HF2A 2XUJA 3QHQA 3IVGA 3KIPA 2HEGA 4ATNA 2CXPA 1W35A 2PZBA 2FW0A 1NVWQ 3TX2A 4B0PA 1FDIA 1XTSA 1X7WA 3BTSA 3W5HA 3WJ7A 5BXYA 3EG5A 3TNFA 3PIDA 5HA5A 4CUKA 3NXSA 3L2OB 1X1CA 4K40A 3AU8A 2HPAA 3IDFA 1YC2A 2XADA 4C08A 1QQAA 4I5GA 3BWBA 4YJDA 4S1WA 4BN4A 3NLLA 2CN1A 3OHPA 3T5MA 3UMSA 1Z0FA 4D6XA 3I04A 5CB4A 4O5OA 1C30A 1PT9A 2VDWA 3B3AA 1Q15A 3FJYA 4L7QA 4QC2A 2WY2D 1I1OA 3U26A 2P27A 3IXQA 1GU1A 2BLLA 1Z15A 4FIDA 3NEYA 1FDSA 4JUFA 4J3NA 3JWPA 1SUIA 1AJEA 1I5EA 3TAXA 1O1YA 3T5PA 1A9XB 2WSLA 3L5KA 2AK2A 1Z63A 4Z4GA 3IXLA 3P2OA 3I8SA 1NE2A 4PZYA 1GGFA 4MHOA 1CERA 3L7AA 1V3UA 2VF2A 1UAGA 3EDRA 4LRTB 4M53A 3DV2A 1UK8A 5CXSA 2VBCA 3PC8A 2QR3A 5IYZA 4LYJA 2PQMA 3NJ8A 1ZKDA 4JLMA 3INNA 1C81A 3KEMA 4DT1A 4YY3B 4ZT3A 1XZLA 4OEHA 3NHPA 3UWKA 3Q2IA 4LW8A 5IBCA 4HZIA 3R3YA 4HFJA 3P20A 3DL4A 3PGA1 1LSUA 2IW3A 2NU6B 3QU4A 3D9QX 3L7MA 1CW2B 1L5SA 3JQ7A 4XUGB 3NM5A 4IDQA 2XE8A 4R7ZA 1CY7A 4G4SO 4HWKA 2GBPA 2BE7A 2HRRA 1G0NA 1USVA 3KO8A 3PIIA 1K98A 2D5BA 2W2QA 4BNLA 4ZCLA 2YN0A 4X1IB 3GNQA 4Y2PA 2W6CX 3ZQJA 3CF6R 2C4KA 3LBNA 3TW6A 3H8SA 3PQ8A 1HDOA 2WWIA 4BX9A 3CUSA 3W06A 2QR2A 4ND7A 1C8BA 5DCUA 3VOAA 2B2CA 1KYWA 3AFHA 1HRKA 4RMGA 3ZXIA 1A50B 1IM8A 4FPXA 4LY3A 4TWZA 1K7CA 2HJVA 1QAMA 3QUQA 5ALZA 3WLTA 1MJFA 1E32A 2E1RA 3BXHA 4DIDA 4K6OA 3S28A 1V43A 2C92A 3PC3A 4G85A 1DGQA 4L85A 4GXTA 5ES3A 2I6QA 2DP4E 4LHWA 2FW1A 3LECA 4J16A 3EZFA 2WJ3A 5TXGA 4HPXB 1EAMA 4BNFA 4YDQA 5K0GA 3TQIA 4CMAA 3EQ2A 4YMTA 3CNEA 1V1MA 1ARZA 2CF5A 3OT4A 4LV8B 4R1OA 1A1SA 3OCCA 2CYAA 3BEDA 4BQSA 3ZK8A 3Q3JB 5CP8A 4TTPA 3TSAA 3RQIA 1G9SA 4D5EA 1L4YA 4LGCA 4JX9A 2Q2VA 1ADBA 4JYPA 5E6RA 1N4DA 3AERA 4E30A 2DEUA 1GGMA 3HM2A 1ADYA 3GRFA 4XAQA 3STTA 2Q5OA 1Q19A 4EHBA 1S89A 2OV6A 1J90A 1U9ZA 3C5HA 3JTMA 4S35A 4UD6A 1RRPA 5JCXA 5AW7A 3I53A 2PMCA 4MCIA 2PGDA 3NC1C 4FT2A 1ICEA 1Y3HA 4HFRA 2PRIA 1V8BA 1TU3A 3LDHA 4ALKA 1D04A 1PFYA 3DBLB 3NMUF 1BFUA 3V1TC 5JADA 2CXQA 3RT7A 3N2GA 4ITUA 2BHNA 1C0EA 2CJPA 4IL5A 1PX2A 3WQRA 3IAXA 1NR1A 4P9NA 1XZKA 4FMPA 2AN4A 2UZIR 4J0HA 4AQDA 2M2IA 1Y33E 2QN1A 4Q02A 3SQNA 3Q85A 4IHQA 4AWAA 3U19A 3T7SA 3OZIA 3U7GA 2AFIA 4KIGA 4LYGA 1BMTA 4PBSA 4V3BA 5EUCA 3RWOA 4Q3OA 4YJFB 4HPWA 1R00A 5EIFA 1VBNA 1LC0A 3NANA 4Q6BA 2JFNA 2PL5A 2DCUA 5JLAA 3TFQA 2GBIA 2NN3C 3VYUB 4AP9A 1TJ3A 1S7CA 2FPPA 2G5PA 3EZ6A 5G53C 2I52A 3ONFA 2XUHA 2IWRA 4X6XA 2FLWA 3G6WA 3MJTA 4GR4A 4OVKA 3TUZC 5C46F 4KJXA 2PIAA 2PD4A 2E6UX 2NTJA 1WXFA 3HP1A 3JATA 1G6Q1 4FXPA 1KQGA 2REXB 1LV7A 1XMVA 3AR2A 3QBVA 3CS3A 5BN3A 1A04A 1PJSA 1GPWB 2R8OA 1NXPA 4K7JA 3T99A 2QRGA 3HKBB 3TFOA 3AEUB 4XDZA 2EJCA 2YOHA 4RGYA 5A04A 1H2RS 5FBWB 3P9PA 1JEOA 1GDTA 4YRGA 1Y8QB 2PJDA 5E4FA 4EATA 3A4VA 5GAJA 1O6CA 1Z2EA 5CDTA 1PWEA 3L77A 2HUPA 4K8RB 4K86A 5ALWA 5ALQA 4BVAA 3A05A 1MB4A 2HTFA 3IUYA 1T3HA 4UQOA 4Y1GA 4BN0A 4E5KA 4EB6B 4DV6B 4HJXA 2NO7A 4LZPA 3HDHA 4XOUA 4ZOEA 3VV2A 1DJMA 1M1XB 5CA1F 2JGAA 3LHDA 3K0BA 3D8RA 2GSDA 2ZUTA 4G4JA 5F98A 1FLVA 4UEQA 3HDGA 1ND6A 1II8B 1O54A 1OZAA 3EH2A 4IQ0A 3BORA 2J9FA 5D3MB 4GUDA 4ZU3A 1SCQA 3DDHA 1T5TA 5GVRA 3FFTA 4B80A 5LIRA 1NVGA 1OKKD 2P6OA 4AL4A 4LXGA 2H1CA 3SZUA 1J21A 3HL6A 2YMQA 3DDCA 4F60A 3D5TA 4C4ZA 4C7XA 2A5GA 1IWBB 2OECA 1AG9A 1F14A 1L5HB 4NFSA 3HCDA 4FTWA 1XHLA 4NHOA 2OEPA 1JT2A 2XOKA 4U4AA 1KQNA 3RBZA 1SVNA 1LU9A 2BY4A 3KXKA 4UREA 4X61A 4PQFA 1L7XA 1XMXA 3W04A 1IFXA 1RKXA 3DSRA 3L0CA 1T6NA 1FTQA 4WNIA 3FOZA 3DONA 1H69A 2C3YA 1XSEA 4PICA 1OIXA 3ZX4A 1OT5A 2DBRA 3DMFA 2IT1A 3KYBA 1K7YA 2V03A 1L7QA 1OUMA 3OOEA 1OY1A 3ZHBA 5FWYA 1DWUA 4TN1A 1EVIA 4JASB 4QBTA 4W9MC 1QGDA 3ESRA 3HO8A 1OYVA 1QO0A 5BV1A 3OVMA 4PYNA 1LX6A 3IKVA 3JYOA 1BZYA 3DR5A 5TT1A 2Q6OA 2WSSA 2I67A 4XRRA 2QQ0A 5TJHA 1CZHA 5CDFA 2O8EA 3F98A 1RM0A 2WMDA 4G24A 4I1IA 1KJIA 3MWGA 1PQWA 4TV8A 1BCRA 3B7WA 1EE1A 2OQRA 3G0BA 3M1LA 5H83A 1RBZA 1AT1A 3N7AA 1DO0A 4M2LA 4AQYB 4K03A 1TD1A 2WEKA 2CXUA 3VTFA 5JJLA 1M8JA 3IKMB 4B9EA 4HQNA 1G21E 4BEWA 5FV4A 4HX5A 4AY4A 3ILSA 4CIXA 5KCZA 1VL2A 3D1LA 3GPBA 1TZ2A 1K6IA 2UYYA 3EZYA 1QHXA 5BPFA 3L6UA 5B4VA 1C29B 2CVPA 5BSTA 5LL6P 3WNVA 3G2JA 5KSYA 1D2RA 3MWDA 3C16C 2A1TR 2CMGA 4PO8A 3FLEA 3VSEA 2GS9A 3WO0A 1LBTA 4ND5A 4Q7MB 3VAAA 4Q03A 3KL4A 4X20A 3ZX5A 3USES 5ELLA 3BJRA 5DXFA 4WESA 1Y6ZA 4WKOA 5FAXA 1H2ZA 3I9V1 1D8TA 2ALJA 3NCHA 2ZKLA 1RS0A 1ZOIA 4DIBA 5I9NA 1TVEA 2ZATA 3GDGA 1UANA 2CSUA 1Z34A 3A9RA 4Q3BA 1JLHA 3BAZA 3WYAA 4IDNA 3Q3GE 4QU5A 3TMYA 1AE1A 2BCEA 3HY4A 1NW5A 3ZLBA 1B16A 3CJQA 4OB6A 1CETA 3FKSA 2QTAA 2GNOA 2Z9BA 2IYYA 4G5YA 3QBEA 2X1VA 2JIMA 1PR5A 3GQBA 1PLLA 4OHFA 3NIFB 4NMHA 3T3IA 3DFUA 5B2ZA 4ZYWA 2DFKB 3JQFC 1JPNA 4NENA 4MCHA 1FSZA 2BH9A 1MO5A 1P3DA 1ZJ5A 5IZ4A 5CVCA 2GN8A 2XA1A 1KH3A 1OXTA 3D6MA 2GN1A 3EBOA 2ZAYA 3M6AA 2WJPA 3BMQB 1HFKA 3G8BA 3QTLA 4PLPA 3AJDA 3CBQA 2E87A 3ZVNA 3Q8WA 1J1UA 2WHPA 1WMAA 1KZHA 2SCUB 1QP0A 1C5KA 3DTTA 1R8QA 1YKFA 2QR5A 3A3YA 1YL7A 2EBHX 1EK6A 4ZHQF 3BSFA 3UB2A 2C5LA 1MPXA 4N5HX 1UBLS 1T36B 3H2JA 4PNPA 4QDKA 5COQA 4ZZ2A 2N1MA 2O8VA 1OH7A 2H31A 1G8MA 3OQHA 3OZDA 1FVFA 2WU1A 1X87A 4HXGA 4M89A 2QAGA 3CVOA 3EBLA 2G09A 3PPIA 2GLXA 3K9WA 2FVXA 2DQZA 2M98A 1L4FA 2O2DA 4XPIA 4IWXA 2B1JA 5CA0F 5A5GA 3ZD7A 1RC1A 4NVRA 4WSOA 2QIPA 4W5RA 3D1JA 2B92A 4QU9A 3OZTA 4S3MA 1NXOA 1UAYA 1UT5A 2XGGA 3VBEA 2JFOA 4FMCB 1U6IA 2R68A 2RBEA 4IG9A 4CR8A 1GPAA 1UEXC 3TI7A 3G0HA 1Q3KA 1R64A 2ZBGA 2I4RA 4IH1A 1LF0A 3ZI7A 3GLHB 5EUQB 3ZD8A 1MOQA 2C4NA 5EP2A 1A7JA 2IRWA 1UK6A 1QRSA 2XGJA 4P38A 1DJOA 4YCBA 4W7SA 3TQRA 3VNQA 1QX4A 3NW9A 3AFOA 3QQPA 5AVSA 1BHQ1 1DI0A 4D80A 5CEFA 4LIPD 3AKDA 3WK7A 5L53A 2QVGA 3ZCSA 4QQ8A 2VI5A 5EWMA 2QJWA 3VU9B 4FQ5A 4UEJA 2YXEA 5LQAA 3AQIA 3QGMA 2W2LD 1GTVA 3RV4A 3RTDA 1Z0ZA 2Y1XA 2FOIA 4F4CA 2DOKA 4JWTA 2V7PA 1EZ4A 5DFAA 3RS3A 3LGXA 3UAYA 4HBGA 5AK0A 4FUTA 1W2GA 1ZW1A 4M98A 5AHOA 5H16A 4AWXA 4B3TB 1H2EA 1XJ0A 3DTVA 3WBJA 4AO8A 4ZWNA 4KQ2A 1XPOA 1DHTA 3H0CA 4URFA 3ZLVA 3ICQB 1G7RA 1L5WA 2CE2X 1YJQA 2ERCA 1PL8A 2J1LA 3FZEA 3CXUA 3PI6A 1KO5A 3FR8A 3GA7A 1GYPA 3PENA 5DHUA 1GGJA 1K75A 2ZAIA 2FW8A 3G13A 4MI1A 3AKYA 4LOHA 4O5AA 2WIJA 4D4MA 1FUEA 1PFGA 1HLPA 2HWYA 2X4GA 3LCVB 5JSYA 3W8NA 5JHHB 2ZTVA 1G20B 1DAIA 2WD7B 3R7LA 1NLUA 2VKQA 3CNQS 4CLRA 2H1VA 4RTRA 2H2DA 4C2AA 3K3PA 4Z9YA 2E6KA 2R5NA 2IYXA 3A1EA 3DVQX 1KP2A 2GJ4A 4HFMA 4TS4A 3HRIA 5BVHA 1JLMA 1G6HA 5AVQA 5ILGA 4E33A 1Z4OA 1JDVA 2AFRA 1ZR4A 1SOAA 1U1FA 2O06A 4NU0A 3QFRA 1VKOA 3DLAA 4YPOA 1DKOA 1IXYA 4K9KA 3WMGA 4XCXA 1U28A 2CLOB 2R7NA 2XGOA 4IDHA 3JCZA 4MVJD 2BE9A 2AOTA 2PUAA 2WT8A 1NVTA 1RYBA 2A7XA 2R00C 3A1TA 3KAPA 1PVDA 2I4IA 4J0JA 4TUYA 4ZKDA 3ZKWA 4TVKA 3FF4A 3L8GA 1U8TA 3D0OA 4IOLA 1A98A 3RUHA 5FWXB 2Q28A 1KEKA 1PUJA 1S2OA 2PKQO 3GDWA 3WWCA 4KR0A 4MAAA 1YR1A 2QNBA 1X19A 4BC0A 1DDOA 5FLKA 3HL0A 2ZYUX 3QY9A 4FD2A 2FMKA 4XRGA 3ETCA 4F7WA 10MHA 4ZMRA 1M34A 2GA9A 1OGYA 3GUZA 4NBTA 5DSTA 3U4IA 3FDJA 3C6ZA 4AWBA 3IQEA 3H3XA 1CB7A 4QQNA 4I55A 4G0OA 2YFYA 4CIAA 3IV6A 5EJGA 4K6KA 3OEHD 2H8GA 2QJRA 3C7KA 5DNAA 4R71A 2R44A 5ECDA 1QK4A 2OA0A 3UYLA 5IHXA 1HYHA 3IV9A 5JBQA 4ZT2A 2BV3A 1GD1O 1AA9A 2EDAA 3P2EA 3I5AA 4WXHA 5LLDA 1C8VB 4GZ3A 1ZRSA 4WQMA 4BX8A 4V0ME 4RPGA 1QK5A 1MB9A 4FC6A 1BDBA 1UC4B 2HCRA 3DMDA 5AW5A 3W78A 2V7TA 3QWBA 3IEIA 1VKZA 5J2TF 4OREX 1GR0A 3ER8A 3NAGA 1OBHA 3M5WA 3ZWOA 3IT3A 2CB0A 4BNXA 1XCPA 2ORWA 2POQX 1CUZA 1QG0A 1FRNA 1V96A 2FUNB 5FL3A 2ONKA 2J7KA 2W6QA 4BQIA 4R8LA 3K70B 4QOEA 1YBFA 4R1LA 1ECCA 3VAYA 1FFYA 2F3TA 2X76A 4KFRA 4DDTA 1ILEA 5ALTA 3A4YA 3HBLA 3DE4X 3KT3A 3WLEA 3TQCA 3DNFA 3KDAA 3OLCX 3SMQA 4Z8XA 3KELA 4IIHA 4I8IA 3EIWA 2A84A 4CNBA 1SBCA 5BN5A 4TLEA 2VPZA 1GRCA 2QL6A 1YIAA 5BT8A 3DJFA 2WWRA 3EAGA 3ZDAA 2BEUB 2WKWA 4NDAA 5TEWA 1W1WA 1A7UA 5IH3A 3SM3A 3BGWA 3GJTA 5DM0A 1L4EA 2QPAA 3PHCA 4ZVMA 1I6LA 2WIKA 3HKEA 1NJFA 3I4FA 4ETNA 1DRKA 3WHKA 1EB8A 3WYDA 2ECQA 2CCGA 2KYRA 3LGAA 1GIAA 1MN6A 4MLDA 4WZBE 3SC4A 2ZULA 4UNPA 1LVGA 1Z2OX 2QYTA 3KSUA 2ZCVA 2ANBA 2J87A 2ZVDA 4Y6LA 3WLHA 3Q9SA 2ISCA 2DMRA 5HKAA 4M9CA 4JITA 1E0JA 3NGXA 4IYRA 2NU7B 5IS2A 4EFDA 3P9KA 2JAXA 4A6DA 1UKAA 5E0KB 4E6EA 5JDCC 3E7XA 2IQIA 5SZJA 2GF2A 2QUAA 4INPA 1OCEA 2FWJA 2HIAA 3E7DA 4LVCA 5ALRA 2WAMA 2XLBA 4B7AA 4PLVA 3PJRA 2V5AA 3EWIA 4QJ3A 4RYLA 1G59A 4IDOA 2Y6VA 2ONZA 5C32A 1KO4A 5JTTA 5JU6A 4GP9A 2GD2A 1FTGA 3TTVA 3TUIC 3X44A 5IWCA 3F74A 4I2VA 1YB7A 3F96A 1AN0A 2B6HA 5T3YA 1F0KA 1QTIA 4QPJC 1BJKA 5KTKA 2HZBA 3CCCA 2HQ1A 2D7DA 4N01A 1TU0A 1K97A 1P61B 2DECA 2OV4A 2Z08A 4IV8A 4PONA 2W6NA 4KGVA 1R66A 3UCFA 3QWIA 4MGYR 5U4XA 3RC8A 2EKLA 2Q6VA 4MQBA 2JD1A 2IOFA 1BW9A 4HDMA 1K06A 5CUQA 4FHZA 1XYGA 5FUQA 2JGRA 1AF7A 1K88A 5ALLA 4ZYVA 1ZSVA 2V7XA 1WUTA 3BILA 3C97A 4HLQB 2OZEA 5IVIA 4ZAZA 2BGWA 4JODA 1G5QA 1LCIA 4LOKA 4BNDA 2R65A 1I7NA 2PD3A 4N0MA 1FNNA 4PQRA 4U7WA 5BWMA 4QXRA 1XVTA 1I13A 1YI8A 2PT5A 3N0VA 1RQ7A 2PSHA 4TS1A 3FHOA 5C1IA 5D84A 5JCJD 3UC9A 5BNFA 1KAMA 3WKBA 1S2MA 4DS3A 4D8YA 4F21A 3M49A 2N9UA 4TV9B 1E2BA 2JGJA 5FULA 3VR6H 4XDYA 3VTKA 1U7HA 4V2IA 1TA4A 5HE9A 3UTCA 1ODLA 3AEQA 3U9LA 4YMVA 2QV0A 1C9KA 2XYVA 3OIVA 4JT9A 4Q34A 3VZPA 4IKEA 1UBHS 3FCUB 1CZUA 4DSNA 2FFBA 3VR0A 2CNNA 4E11A 4YT4A 3OQ6A 2BCGY 3MYRA 3DZ8A 1NYQA 1N5OX 3EVNA 3SBOA 2C0PA 4W5WA 4IHAA 2ZJ7A 1TDJA 3REQB 4BRSA 2FDCA 1BAPA 2FK8A 2OV1A 3C7TA 1SC4A 1P39A 4IDPA 1GQFA 2PMKA 4V1CA 3KR2A 3ZV3A 5KTTA 3KTFA 3QLEA 3WL4A 1NN0A 4CDRA 2VBIA 3CVJA 3DB1A 3NTOA 1POXA 1KOLA 4V0LA 2R6FA 3R40A 3W4KA 3W7VA 1TFUA 2C5FA 2KJQA 2HSGA 4EWLA 3WGTA 1XCJA 3SJAA 3C8DA 5LU8A 2HRZA 4QYMA 5AK6A 2R1UA 3R6DA 5CA0A 3WGNA 1JR4A 1W6UA 4G37A 2A9FA 5FYQA 3RU2A 3IO3A 4OBXA 2VLIA 3RSHA 3CLSC 1TMKA 4WY2A 5JY1A 1DPFA 1JHZA 1W0KD 3OY7A 2DPXA 1DT5A 5B7NA 4LOLA 4R9UC 4EYGA 1XZJA 3CX4A 2R97A 2ZR7A 3P2IA 5HBRA 2FQ1A 1WUIS 3RYIA 3W3ZB 1BDHA 3WE7A 4YCNA 1PD1A 1BMFA 5F52A 1X86B 2CLMB 2QMHA 2MWMA 1O9GA 1W85B 1OFUA 1QQ6A 5KWVA 5COAA 5EVJA 3L93A 3P1JA 4HDRB 3H5TA 2GYWA 4AZ0A 3S8MA 1UC9A 2WTAA 2J9YB 5ESWA 4ZOBA 3OJEA 1MR3F 1YOBA 5DISB 4C7JA 4TVOA 1A8HA 4D4KA 4H7IA 2A14A 3RSSA 3K0CC 1YWGO 2C5BA 1GGNA 2C77A 1AHIA 4TLBA 1V9SA 3DEKA 2VAPA 5IK2D 4B35A 3I6QA 2ZT6A 3VPCA 1BJTA 3LUCA 5A4MS 5G0UA 3L0OA 3K6SA 2OXRA 3TW4A 3DOFA 2EZ9A 5FUWA 5CYPA 4ENPA 1YA4A 4OY3A 5CR9A 2BGIA 1NVBA 5AR1A 4Z2YA 4ZT7A 2Q29A 1KKLA 4I50F 5IJXA 1RYHA 4LOJA 3EXEB 5A1TA 1K08A 3Q3EA 3N8GA 2H29A 2GX6A 4PPYA 1U9YA 1EDZA 4D9JA 1IOVA 4UUQA 4YALA 1BGVA 1XVUA 2CZGA 2HQOA 3ESYA 1HR0B 5GIOE 2GZHA 4JH0A 1JHAA 1XLUA 3GJ8A 3GJ7A 2N3ZA 1X80A 1E5QA 1PZHA 2FPSA 3FMIA 5DSZA 4YJHB 2PRZA 3B3JA 2YC4C 5EZ6B 2NU9B 1P72A 4GEGA 1NX9A 1PG0A 2RH8A 3FVWA 4P58A 2XIQA 4R98A 3UUGA 3K9FC 4L08A 1Z37A 3FY4A 4FN5A 2WM8A 3OZVA 2FA9A 2JBWA 1VL0A 3KT8A 3VUEA 3PF8A 2NXEA 1KTVA 1P2VA 4OXYA 1SNYA 3UMMA 3PNOA 3E81A 3VSCA 2BTEA 5CG2A 5HHTA 1CHNA 4ON9A 2MOKA 4M0DA 1HMYA 4KK4A 3JU3A 4Y1RA 3ZJYA 4B75A 1J97A 3UUEA 5DULA 5AOBA 3VSAA 4Q9AA 2RJ3A 2YQ5A 4DBVO 4NAVA 3LPMA 1WO8A 1LJUA 1VE3A 4R1UA 1JKIA 5CURA 1CY1A 2J0VA 1JH9A 4AQ7A 5TMEA 3CB2A 4BNJA 1RHMA 1E18A 2HA3A 1XIVA 1E3MA 1NA5A 1KERA 2BRUA 1ORTA 2NUAA 3LZ6A 4PNZA 1DELA 1EQUA 4M8NE 5SY4A 5TY0A 5ICCA 3FDZB 1KQ3A 1XVVA 1MV5A 1QTRA 1SC1A 2EF1A 3KRTA 4AKSA 1WCV1 2BISA 4DDHA 1C4KA 1FLAA 1UDXA 2EATA 2VDLB 1XZBA 2ZQZA 3KJHA 2DHCA 3MA0A 2R6GA 4MS3A 1MORA 4YPVA 5FHQA 2O0LA 5AESA 3E9ZA 5JTUA 4ZAVA 2MDTA 1TJ5A 4J49A 5EWLA 5EXXA 3GT7A 3D4IA 4RPLA 4Y2TA 1THMA 4Z9AA 2OD9A 4X91A 3ZH2A 3SX4A 4KK3A 2G71A 2PLRA 3NH6A 4H27A 5T7BA 3QWHA 2DXIA 3TDKA 4E3ZA 2GJSA 3OKFA 4TLAA 3RYFB 4BJ6A 3N0XA 5JROA 4K46A 4UTZA 1FXSA 1GV1A 4UBKA 3ZGZA 4CMIB 4TSFD 1CS4C 4WACA 1CF9A 3AM4A 4JBXA 3V1LA 6ADHA 5TQ0B 1IUNA 4S12A 4ZJUA 1KY5A 4FYVA 4LDQA 1J22A 4R9NA 4EK9A 2ODNA 1JJFA 3MCZA 1D2EA 2G07A 1K0UA 4E22A 2VQDA 4R05A 2Q3BA 1ZU5A 3DTYA 4FZ3A 1DX9A 121PA 3GT0A 4JJZA 5AUQA 1TVMA 2XXJA 4KO2S 4H3VA 1W0JA 5AVTA 4DG9A 4QYXA 2ACEA 1H8EA 3N8IA 1NXTA 5K1ZA 1RWQA 3LA6A 5DCYA 1FX0A 1VE9A 3H1FA 5EWJB 1JG3A 1EWYA 1G60A 3L6RA 1MO3A 5G4KB 4GMFA 3AX6A 1BFKA 2B8NA 4HNSA 3E03A 3SSOA 2C1XA 2VL7A 4JL6A 2VJDA 3Q41A 4QE3A 1LF5A 5EJFA 3U17A 3EVBA 1UKZA 3AF4A 4Q3NA 1ZL2A 2FR1A 1WLSA 3MRVA 4BECA 5IKEA 5JD4A 3NWJA 4F97A 5B4TA 1PFQA 1M6YA 4ZCSA 4QLBA 2RIRA 2RMKA 3AWIA 5EJ5A 4HSEA 1H23A 1CDDA 1V3QE 4YNBA 1RAFA 2V1UA 4MQFB 4D4HA 2QN9A 2AVNA 2WDPA 2YS7A 3OJCA 3AYZB 3VKGA 3EOBI 1B0ZA 1NKTA 2B2XA 2JHFA 3VYVA 1YVRA 4WFQA 2A4KA 2SKDA 3JYNA 3WMXA 4HN2A 5H3HA 3ED1A 2I2XB 3QF7A 3R7AA 5T64A 2BF7A 4DPKA 4B46A 3M5CA 2RI0A 3GYGA 5E6SB 4C89A 3CI0K 3NI2A 2UDPA 4JP3A 4XWYA 3OKCA 5IW8A 4HGNA 1DAHA 2EG5A 4GQIA 3MMPA 1NW9B 2JBAB 3R0IA 4LX8A 3B8EA 4GDMA 3HA2A 2NGRA 4YGXB 2BELA 4GM4A 1GPYA 1Y81A 3PG5A 1IY0A 3CPJB 4HXFB 3HB1A 3QE3A 2GEVA 1Y6FA 1LI4A 5DCWA 2I71A 2I2FA 3AYXB 4NPHA 3RSGA 1OJLA 3AMVA 4M1WA 5JNWA 3PJGA 1AO0A 4DA8A 3EFBA 1D3AA 1EXMA 1H2AS 2CXSA 3PNYA 3AHJA 3TFWA 1HM5A 3CGGA 4KNWA 2JIBA 2ANCA 3R9KA 5EQJB 3ZHXA 1M72A 3DM9B 2YNMA 3PC6A 4QHYA 3ZTWA 3C3KA 2AF4C 1E8NA 4DV3B 3F97A 3ZE2B 2W4IA 3JQEA 3P9ZA 5E2AA 5JMPA 4DCCA 3WLFA 5IJZA 5JISA 4P54A 1YDEA 2VJMA 3OCYA 4N5NA 5I9TA 4BE9A 3TPCA 2PT7A 3FSJX 3UPUA 5IBRA 3K4HA 3BJMA 3UK7A 1SC6A 2XPCA 1UPUA 1QQ5A 4V03A 2CNBA 4EL0A 5ITWA 4DBLE 4ZICA 3CEMA 5K8LA 3CNHA 3ZNNA 4B3JA 1G21A 3AGPA 2JGMA 3CLHA 3TRHA 2ZI5A 4RJTA 1YBHA 2CUNA 2CFIA 3WHLA 4OFZA 1K6JA 4RD3A 1RI2A 3ANSA 4YUAA 1RMYA 1V1RA 3EWSA 1NXVA 1OH5A 1RQRA 2G1UA 4OJMX 3SIPA 1C9YA 1NP6A 1OXUA 4LXYA 3N2IA 4Y18A 3CMMA 3ZCTA 1QBKC 4PIVA 5KYXB 3RS5A 3HXQA 3W5CA 1XJQA 4EB0A 5DGTA 1B7GO 2VPTA 2WTBA 721PA 3KG2A 1F60A 5AW2A 4TKVB 2CL6X 2UYHA 4B3HA 2JL1A 1KZYC 4KWHA 1SBYA 1JJVA 1UJNA 3WGGA 4TTSA 1UOQA 3QXXA 3VTZA 4DA6A 1DDIA 1NNSA 2A30A 2PL1A 4IP0A 4AO7A 4U1RA 1I7QB 2NXWA 5JJBA 3TM4A 1TADA 3NDBB 3CCFA 2VT2A 3WIDA 3MS4A 4ZOLA 1N5DA 1E7SA 1VP3A 4NU8X 5ECWA 2X0DA 1RXVA 4O8ZA 3UJ3X 3O47A 3A25A 3A2MA 5A3VA 1CJTC 5D1NA 2C94A 3RFXA 1EGQA 3VMFA 1ACLA 1RWOA 1KI7A 1M9NA 3FTDA 3I5UA 2Z1MA 4NBLA 4YUYA 3G82C 4CCYB 2FEMA 1J5XA 3AU9A 3OM0A 5EUMA 1OYYA 1EDDA 1Q7CA 1XAJA 4LHSA 1E2UA 2I9KA 2EWMA 1NI5A 3Q3CA 5K4AA 3FZQA 1G3QA 3PKZA 4LDNA 2QN8A 1SGWA 3ADOA 1QKKA 1XD8A 1BKDR 4AXXA 3CUVA 4BTEA 1H85A 4LXHA 2W2XA 5IAOA 3RYTC 3MGGA 4G63A 5K8UA 4ZANA 2HGSA 3H11B 2FPLA 1QZTA 3DVSX 2AKYA 2RETA 4LCJA 1D6SA 4ABYA 4GXQA 1PR3A 1Y9EA 4OHWA 1YHYA 2XTMA 4I50A 4IRXA 3P0RA 1XZQA 4KWEA 5AVKA 4B6FA 1KPGA 3HACA 1X77A 1G64A 1O94C 1XTVA 1L4BA 1MB3A 1B3BA 4EEZA 3TOSA 4EKDA 3GCDA 3OG9A 5J2UF 3EGCA 2OSVA 4RQAA 1WDKA 4BGEA 1E92A 4R8KA 3TB6A 1PS9A 1YO6A 2WR8A 4UEOA 1L5GB 1PHRA 2DHEA 3KQQA 3O8OA 1KEEB 1XV5A 1H4TA 1SWWA 4M7RA 4PFJA 1RHRA 1S9HA 4P4GA 2D5IA 1K66A 3SC2A 2Q62A 3WGOA 4FFDA 5U1PA 4IIDA 2JLCA 3AQ4A 5B6PA 3IYLW 4UHCA 2GM9A 2V97A 3MBOA 1AM4D 2AMVA 4HEA1 4BNKA 4JXKA 4C0AC 3CF4G 1R74A 3CKKA 3IJRA 2CYCA 3AGQA 5FBZA 4YCCA 1YVEI 2ZK7A 1EFAA 1X7YA 4EJ0A 3PKJA 2GGSA 1MNAA 1I4EB 1N6NA 1NGSA 1JHOA 3QUCA 5DGIA 3FGOA 2ZZKA 3HCFA 5K3FB 3ZWDA 3OP4A 2JANA 1V11A 1PT8A 3B9BA 3HBAA 1T2VA 1LBSA 1EFLA 2VZ9A 3D3NA 5EY5B 4DDVA 3RTGA 2V7UA 1C2YA 3OZXA 2RHBA 4TL6A 2IH2A 4NJEB 3UT0A 2W4MA 4KH0A 3UHAA 2VZ0A 1YD7A 2RB4A 3NNSA 2P40A 4YS6A 3LQRA 3MTDA 4ROSA 3NRJA 5A6SB 3V80A 3RIYA 4CM1A 1MKYA 5BNWA 2JIPA 1CNFA 4FOPA 2CJFA 3DDOA 5B57C 3PE3A 2XHEA 3WSVA 1J9ZA 5LYJB 1KKUA 2H4JA 4RSGA 4XR4A 2ASVA 2EP8A 2AK3A 2QRJA 2R3SA 2GD6A 4IOKA 1RJDA 4I46A 2OPHA 3TRFA 3JWHA 1P29A 4MQUA 4B6RA 3OQMA 1Q91A 1Z4MA 4MVCA 1P2BA 1UAAA 3MOSA 4RKEA 1A3CA 4URVR 2AG0A 5LFAA 3NQ41 2XQFA 3OLZA 2Q2NA 2QMOA 2BSAA 5LVAA 1IZZA 1ZMOA 2PAFA 4M6WB 1PJ4A 2QW1A 1SWVA 2DLDA 3DW1X 2ZR8A 4IJ5A 1J99A 5H3CA 3MD0A 5AWFC 2OXTA 5IF3A 3FNHA 3O8DA 2Q5HA 1RAAA 4YP5A 4CLOB 3EVAA 4IR7A 4DUZB 2ZW9A 4N7MA 1Y3BE 2IBMA 3OO0A 2GF9A 4HAXA 3CR7A 1QONA 1VKRA 3UGJA 5H59A 2IEZA 2QTVA 4IFTA 4N49A 1U0JA 4CLDA 1MIOB 4EHIA 1C0LA 1VZ2A 3V9PA 3ZWQA 3KQOA 4W1RA 3WXBA 2EVWX 4ENTA 4Q1FA 5HF5A 4MW2A 1AUPA 4M1EA 1N75A 2XQVA 4ZRMA 1HO3A 1A9SA 4RFSA 2IV3A 3EEQA 1WSDA 3CLSD 1LJ8A 4DSZA 1KXZA 1RHQA 3PEVA 3AK4A 1Z73A 4PG4A 1G2PA 4BRWA 1TXGA 4UEKA 1LWOA 2ZBRA 1HDYA 2XB9A 1J07A 4J9UE 4KG7A 4EQZA 3K8ZA 4G1EB 2I7XA 3LHFA 3IEKA 4JJFA 3OU7A 2HHJA 5CCEA 5HKLA 4RWZA 5LQRA 4YWHA 2REBA 2RHCA 5FIUA 3P32A 4QXOA 4C06A 4EVRA 3T35A 3SWWA 1XCBA 1O95D 5KYTA 3Q8KA 4K2AA 4B6JA 4JI7B 1NW4A 3OKAA 5AICA 4A23A 2PBRA 1ZBQA 3I2KA 3K09A 1JSLA 2FWAA 3N5CA 5H02A 1P7YA 3WBBA 4JROA 4Y0VA 3R5FA 3GX1A 1W8DA 3HJTA 4DQUA 1SXPA 2VP3A 4OYRA 4V0MA 4ZYZA 1XCGB 4LCBA 1JAXA 2APJA 1FFDA 1FRFS 1CS0B 4FCTA 1R0CA 4HUJA 4ZQFA 4TMWA 5IT9A 3VR2A 2IYOA 1N2XA 2PT9A 4IY1A 1ZN9A 3C6QA 3PJFA 2XCQA 4H4CA 3MLAA 4AAYA 3GBSA 5J9FA 1FMFA 3WAKA 4HGQA 3B9PA 3UKJA 1KJYA 3G59A 4CEJB 1L7MA 2VJOA 1JWLA 2P5YA 1V71A 1DOAA 1ZMBA 5FDFA 2XZOA 4AI6A 1V2GA 1Z8NA 1YH3A 3ANNA 5KPDA 3NFYA 2C4HA 4Y1FA 2YXBA 4B3IA 4CM8B 4JFAA 3TIGA 3ANLA 4DUPA 4DYHA 1DRWA 1UCFA 1H0KA 1XEXB 2WIGA 1YZHA 4INAA 4J0EA 4LXXA 5SZKB 5DYTA 1EUDB 1E2NA 3PU6A 3KOXA 4NQZA 2WNSA 1G8PA 4JUAA 4RVCA 3P0JA 1G2IA 4MP6A 1VJRA 5K0LA 1GPBA 2VPIA 3RQSA 5E38A 5ERGB 4EJSC 3ZWCA 1ZNZA 1GADO 2YYAA 1RWKA 5REQA 4A15A 3HJRA 3C3BA 1IM2A 8OHMA 2X6RA 5J58A 5TE9A 1V6SA 2LDBA 5AHXA 1IZ9A 2XGSA 3CRMA 4F5WA 4WK6A 5SYNA 2QZPA 1JJBA 3ZI0A 5BRAA 4GKKB 1YZ3A 2OE2A 1G38A 1FZQA 2FZVA 2I3ZA 2OFWA 4HWGA 5H3LA 2R2GA 13PKA 1O8BA 3HEBA 3KLBA 1HNNA 1I10A 1JSXA 2H7CA 3TLKA 5IJ0A 1YQUA 5C9ZA 4KLRA 3VXKA 2WJ4A 2Q6TA 3F4BA 2HRBA 1L4GA 3GEBA 4RVNA 3T3EA 4UBOA 1MEOA 1K5DA 5I7OA 3QE2A 4QKQA 3EMVA 4U6QA 2QT1A 3KJIA 3OUTA 1E2EA 2ZDGA 3TW8A 3N0RA 4ETWA 2AG8A 4P0PB 5L7YA 4HAYA 3HWWA 2GHRA 5JASA 4ZVRA 1ZD2P 3H16A 2WV9A 3H8JA 4P86A 4F2WA 1SVLA 1IN5A 2C4VA 3X1XA 4RBNA 1WZNA 4G5GA 4B85A 2RK4A 4W9NC 4CGZA 3BSWA 1QAOA 1VIMA 3KUDA 4ND8A 3WAGA 4MTLA 1PK8A 1UDAA 4E7PA 2QSUA 2JCXA 1MT0A 2JS7A 1VCIA 1N6IA 3H83A 4MDHA 4NRDA 2WWVD 3WKCA 2I80A 4TQUS 4TTTS 1XMQB 3PPVA 5MN6A 3M1AA 3ML1A 1A8SA 1WCIA 2ZBPA 1XYVA 2XQJA 3PD1A 4PG6A 4RTKA 1H5QA 1DXQA 2Q8NA 3WDSA 4E1VA 4I7EA 5DM1A 3A14A 1CLUA 3E2PA 2OGFA 3FNEA 4BLQA 2RGAA 9LDBA 5JQGB 5EXTA 1UQUA 4N18A 5ICFA 4MHSA 3T7DA 2ZETA 4WXMA 5TR9A 3I1FA 3WDLA 2LCFA 2QX9A 3S3TA 2W0MA 1ZUNA 1N9GA 3NHBA 5KINB 2VBFA 1AKUA 1QIFA 2GN0A 3E5MA 3RW9A 2O2EA 1XKTA 5I4BA 1Y1TA 3IE0A 1Z6GA 1WW8A 5DXAA 4W1SA 2A5DA 3STUA 6ABPA 2ZE5A 3VMMA 1R18A 9ABPA 1SUBA 2IP4A 1GTZA 1X1DA 2G9VA 5FTLA 2PKQP 4GKBA 2H1WA 3Q9LA 4ZGGA 3WFZA 1QIEA 3OUUA 3VOTA 1F0NA 1II9A 1YL5A 1AS0A 2XDWA 2VATA 1N0WA 3CKMA 3LZDA 4NE9A 4EGAA 1T9HA 2G40A 2P9ZA 3N2NA 5EG5A 3M9WA 1X7GA 5HDQA 3ZJ4A 3FMFA 2K4MA 3IH5A 1NJ2A 3B6JA 1OD6A 2LRHA 4GYKA 5JHGB 4DJJA 1UFRA 1VIYA 1CNMA 1I6MA 2HWXA 2WPNA 3BBPA 3D6UA 4AG6A 3L4EA 1T4CB 4XEUA 4C9BA 1GCUA 1AZTA 1NWCA 2F8LA 4FX5A 1EFPB 1V8OA 2GASA 4KQMA 3A4IA 4TMKA 2HSJA 4YCMA 4Z3OA 3KPUA 3A9SA 3S6JA 5C18A 3FYSA 4TROA 3B3GA 1LXCA 1L4KA 2HPHA 2XWQA 4MIEA 4MRNA 4Z4EA 4JBYA 2PUCA 5I9LA 2H4FA 1IBCA 4N4AA 4KN8A 1TVCA 2I2DA 3GMDA 5E1DA 3OZBA 4Y2HA 2F3QA 1V3VA 1CB0A 1GUDA 1U2SA 2D0PB 4RK0A 4CLXA 1XTIA 2I78A 3SEAA 3KT6A 4D99A 1P2DA 1VB3A 2BONA 4JT2A 1ADCA 5CM8B 5D3QA 4E4RA 3WJAA 1S8NA 7MHTA 3JQBC 1RKQA 1Z5VA 4Y9TA 5JT1A 3DMYA 1MIHA 3H99A 3L7KA 2G28A 1P3Y1 2G04A 3SSAA 1XOIA 5FPPA 4OHKA 2O1XA 3SICE 3OTGA 4MO9A 2CZQA 2VQ3A 4ZAFA 1CQWA 2YW9A 5EEHA 1OE0A 1CZRA 1JG2A 1HY3A 4MJ7A 3U0VA 4ND4A 2FRVA 2A0KA 3B1YA 2WWTA 2J3MA 1Y48E 4D79A 5KSZA 4RV4A 2P7IA 4HLNA 2L69A 3I2HA 1Q50A 3NTLA 4RVGA 5G0WA 4WECA 2YIDA 2RH9B 1HG0A 1ZCBA 2YVAA 4E3WA 4GC9A 1E2GA 3MTBA 4GX5A 3VYWA 2Q6IA 3VAZA 3DL2A 4H6VA 5E8JA 1ATZA 1QQ7A 4PBRA 3R76A 2ZIAA 3Q3HA 5IJWA 2WF5A 2YIVX 1X7DA 4RO0A 3AESA 3DZGA 4W6ZA 5I9IA 1U9IA 2WV7A 1S6YA 4WZAE 3UXYA 3EDOA 4AM8A 4D9NA 3HJNA 4PAMA 5HCIA 5AXCA 4WMLA 2MYUA 3MBKA 4M0EA 4GQAA 1Q7TA 4RY8A 5A4KA 1A9YA 1KBOA 1NBEA 4HDAA 4LZAA 5EKXA 3PEYA 3ELUA 2JFGA 5D5PA 5JSQA 2ZP1A 1KI3A 1W0CA 5FI0B 1QQTA 3SR0A 2O23A 5BORA 3T12A 1GQQA 1RRMA 1DBVO 5LXTB 1JFRA 4WXRA 1RJGA 3O21A 3V7WA 1YR3A 3GLIB 5C7LO 4JNCA 1TVKA 2H85A 1MH1A 2AG5A 3AUAA 3UMBA 2XUAA 3R1IA 1Z0UA 4KDRA 4C7OA 3MPUA 4UM5A 3RH0A 4UU7A 1NUQA 3AB8A 3JZMA 4C6TB 2HOQA 4E2YA 1YASA 4DGQA 1OV4A 5KYWB 4O6VA 1I0ZA 3MS7A 1D2HA 3RC7A 4LRYA 1QH8B 3BWVA 4W7IA 3CIOA 3S1LA 1F8XA 5JATA 3BWDD 3OMXA 3QJYA 1AGPA 1RW4A 3ESBA 3GPIA 2O8DA 5L3ZA 1X7HA 1BDMA 1RYNA 2IY7A 5EP3A 4CV2A 3I2FA 2HL6A 5BUZA 4GYJA 1JQAA 2JGEA 2R6HA 4MYTA 3NTUA 4U9IS 3PFKA 2O2HA 3KEFA 2WA2A 2RHHA 2XBLA 3OUZA 3X1WA 4MEJA 1YOVA 3DZKA 3DXFA 5KREA 4W63A 2P2ZA 4RIEA 3NIBA 5UKDA 4Q9KA 2P4QA 3K6KA 3OU6A 2OCYC 2Z95A 3PEFA 1KHHA 4ID9A 3L18A 5CLJA 4EW2A 3K5WA 5CFNA 4Q93A 5F51A 4MAMA 3JY6A 4DNFA 3RS2A 1X7ZA 3L84A 4YAJA 5JD5A 3DCJA 1TAGA 1X0XA 3VA7A 1K5GA 1EFCA 2C9YA 1JSRA 2X8JA 1IBLB 2QTMA 4DLLA 5EHQA 2IZ1A 4AY3A 2HK7A 2YY6A 4ESHA 1T1JA 3FRIA 1D03A 1ABEA 1ODCA 3E5NA 1AV7A 3NBMA 4HL6A 3OLWA 4RIHA 2IV7A 4DMHA 4P33A 2F8TA 3LBIA 3K32A 4UXIA 1E1QD 1ZOLA 3A1FA 1KVTA 4Z53A 1MG0A 4JR2A 5DIFA 3RM3A 1Z45A 2PZEA 1OTYA 4QUIA 1IH8A 1BHJA 1GLGA 2A50A 1TRKA 2Q3HA 2YJ5A 4HY3A 1U5BA 1JEQA 3QZUA 3ZLTA 1R0BA 1E9EA 1GQSA 2YOFA 3KSBC 4JZYA 3EMDA 1XLWA 3FPHA 3IILA 1HDGO 4YRNA 1WB9A 1DB3A 2A6PA 3LOUA 4GZMA 2AUTA 5LBIA 4HNQA 6YASA 2C7OA 4GMDA 5K4GA 3JD4A 4ITVA 2X58A 1EVKA 2SICE 3KBBA 4U9HS 4UKDA 3UZUA 5DW3A 2A0XA 3ZE8A 1QF6A 2KX7A 2QMYA 1G5FA 1CIJA 2EV9A 1ZDMA 4J1QA 4REOA 2I3BA 1TF5A 1Y37A 1LVUA 3NX4A 1CJVC 4L8LA 4FFMA 1BD4A 2HMVA 4HWPA 1M7HA 2VUIB 4RL6A 3RB8A 1GN9A 4JBGA 1EINA 1ADGA 3HS3A 3HXOA 5KVQA 1F38A 3U80A 1OREA 2QUKA 3QQ5A 4OH1A 1N3YA 4C6RA 5CLFA 2ZBEA 3FAZA 3K0AA 3K1JA 4LNUA 3RT1A 5KSWB 1TU4A 5D6NA 5A3RA 1M2WA 4QQRA 1Z75A 1Q95A 2C9CA 2WSIA 2X8LA 3E22A 4OSPA 2GYYA 5BSEA 3E7FA 4PAGA 1J9GA 2OD2A 3VDRA 2ZI7A 4UE6A 2IHVA 1J0EA 2RG7A 3NAQA 4POAA 4G25A 3FYUC 3NP7A 4B2PA 1ORIA 3G0DA 3QP9A 3SJZA 1SK9A 1TRHA 1SCUA 1NUSA 1EZZA 2QRVB 3INYA 2R1ZA 2FSIA 2OP0A 3A37A 2ZUBA 2EFHB 3ZHSA 2JH9A 1A71A 2HMSA 1NMQA 3OPXA 3EPHA 4B09A 4HDKA 4DQKA 4RULA 2V4UA 4AD8A 3ICEA 1E1CA 1G8JA 1EE9A 2O5CA 1HMPA 3M5DA 2JA2A 4G1FA 3RK4A 2NVWA 4QSHA 3D8TA 1MABB 2OCLA 1GSOA 2AR9A 2XQIA 3FJOA 2IQ5A 3K0FB 4MICA 4O4JF 2EQAA 4RGBA 3GDHA 3BD8A 1G3MA 4X45A 3GJ3A 3I1YA 1NIPA 4LSZA 4GBMA 5EZ5A 4TMFA 3Q2OA 4JCOA 3CH5A 5L3SA 5G1NA 3Q10A 2E82A 1RE1A 3MG9A 4GNKA 5FPQA 5GM1A 1L5MA 2DGDA 3ZV7A 4F8YA 5FOVA 5CW1A 1IK6A 3RIEA 3QX7A 3H5LA 3ANXA 4RU1A 4NYJQ 4L5AA 3BH0A 2TRSB 3MOGA 3P45A 2GTHA 2WK1A 2ZQ5A 4AICA 3L0BA 1H2HA 3PEWA 4MDFA 1Z0IA 4AF8A 5DWVA 4DNPA 4PC3A 1SA0A 4GLBA 4TT3D 4ASUA 1F8FA 1C3XA 2XRZA 4I1RA 1U6KA 3KQHA 3BFVA 3GFSA 4CEIA 2RGNC 4OAPA 3PX7A 4N76A 4IXJA 1ODFA 1Y1SA 2AQHA 3QOXA 4KV7A 3KB8A 1US8B 4JC0A 2V7QD 5B3JA 3D6VA 3DWGA 2XB4A 3SK0A 4EB6A 1R6TA 1BTOA 4YT5A 3GFGA 2ZJ3A 4BB9A 3VJLA 4Y2XA 3U3XA 3PQ2A 1FMTA 4GI7A 3QKUA 3KOZA 2AN9A 2NAPA 3QUTA 4XARA 3O94A 3AEYA 3GZNB 2PRYA 2HA0A 2WHYA 1TTPB 4GR5A 5FXMA 1P73A 1HT1E 1EWKA 4PFSA 3WYNA 4PZLA 3D3EA 3DA8A 2ZRQA 4KFCA 5FA8A 3O90A 3RJ5A 2CNKA 4CF3A 2P6MA 3RVDA 2YYSA 2QROA 3VX4A 1NY6A 2J3KA 2ZT8A 3EIXA 1A8PA 3VRHA 4YCLA 3A1DA 1FP4B 2QMUA 2YDYA 2YYYA 4M8IA 3WP1B 2Z3WA 4KYIB 3GLGA 1N7IA 2FWRA 1MX9A 2GUWA 4BBJA 4UARA 4M0PA 1H9CA 1V5EA 4C0BA 1CX9B 1DFGA 2TMDA 3AL2A 4IXWA 5SYMA 1PGPA 1IBSA 1XRQA 3VR3A 4DREA 3OQOA 3VZBA 2FLKA 1ADFA 4V39A 3T1TA 4TYQA 1E9AA 4CQLB 1GTG1 1T9GS 4G1CA 1I4DD 2D1RA 1MW9X 2P78A 2IZ0A 3QVTA 1VSBA 3L05A 4MWEA 5DBFA 3TIVA 5HQ3A 4UQPA 4ZEVA 3JS5A 2GBGA 3MCUA 3QKRB 1WXDA 4B81A 1HG1A 2Y4OA 2GBFA 4EY5A 4UTVA 4UBNA 5BYAA 4IEFB 2CHUA 5GJCA 2C96A 2CXNA 1K2VN 1AGRA 1I51A 4CG2A 4FGZA 2GPYA 4NQRA 1E2PA 1L1FA 3EVTA 5E1OA 3IAM6 2EFYA 1JDSA 4Y6SA 3IFSA 1RHJA 2NPIA 1BX0A 1KP9A 3L9WA 3O4HA 4Q3KA 1ZONA 4L8WB 4YQEA 2BEVB 1T8PA 5M2QA 1O5TA 4LYHA 2C9DA 4B5KA 2HJHA 1UMDB 4RKFA 3H0EA 1A27A 3RYCA 3G2NA 2MSKA 1WXQA 5T41A 2AWNA 3UQYS 3V1KA 5C8DA 1MTZA 3L8ZA 4CV0A 3UWSA 3C7AA 5K4HA 3BC1A 1LGYA 4WBNF 3SIWA 1UBJS 4NG5A 3MXOA 4LJAA 1CR4A 1XYYA 3BD9A 3U9TA 4AIRA 2GR9A 2NVUA 5BMVF 5KIAA 1LNSA 4M86A 4G65A 3VHXB 4QD3A 2VVTA 2QN7A 3PRHA 1VG9B 3QKSB 2OAEA 4C7KA 2Y27A 1RBQA 3FTCA 4DFDA 1J24A 3A1UA 2BN4A 2CLHB 4UUBA 1CPYA 1KIFA 4JJEA 4QBHA 4EPXA 5BQXA 2H1LA 2Q4RA 3LE8A 1SQ0A 1MTOA 4JYMA 1YVPA 3UGTA 4FFOA 3NFRA 1JDBB 2UUAB 2ZZNA 4IKOA 2GLUA 2DHRA 2VH2A 4DA7A 1VLQA 2YN4A 5HW0A 1HFJA 2AX4A 3E1GA 2YHSA 1PG2A 1AQNA 1TKCA 2JI7A 2BWJA 5JZ9A 3CI0I 4GSYA 1BWSA 4ENVA 4Q7QA 5JCOC 2BKLA 1K8ZB 1YIDA 2GMWA 2PFGA 1IB0A 2PUTA 3A26A 4PG7A 1QGAA 4I9NA 3PPYA 1KY3A 4A27A 2BDEA 2QY9A 3L8CA 5TVKA 5LR6A 4DR3B 1GFZA 4R2WA 2PVCA 4NARA 1YZFA 2EW8A 3FPAA 1ISRA 4QGBA 3KEQA 3ETGA 3WMWA 1KGDA 3V97A 3E84A 4HMOA 5ALOA 4EKNB 2H18A 2GI4A 4FYIA 4NCKA 5KI6A 3LLUA 2BHLA 4JX8A 4UMFA 3IBSA 2G1JA 2QGNA 3LRTA 1USWA 4JB0A 2PHZA 4TKZA 2GEFA 2ZJ8A 1OVGA 3LUBA 4BP9A 2PLWA 3W3AH 4F8JA 1GY8A 2P9CA 4REQB 5LQUA 2BW0A 3ZDXB 5IUJC 4ER5A 4R4JA 3QTBA 4YDSA 3COJA 3DZIA 2ZVPX 2FN4A 4JJKA 3UFXB 2IYNA 3NHAA 1T9AA 1EXWA 1Q1BA 1E7WA 1NJGA 1LPPA 1YMQA 2FMHA 3GEIA 3LQFA 3HNOA 3BAFA 3B6IA 4HX2A 5D1HA 4DNQA 1T1SA 4OA5A 5JJIA 2JASA 4LVOA 5TT0A 3ILXA 4GU5A 4MB2A 4CM7A 2HQRA 3PGVA 1BEZA 1WHTA 1WHSA 2FXIA 1JWAB 2HSEA 4J4BA 3SZGA 4C4AA 3L6OO 4DC1A 3UPDA 4HBZA 4B33A 5LCXA 1E1RA 3IUNA 4FYHA 5HOQA 4WXPA 1D09A 1N2CE 3CH7A 3KKMA 2V96A 1OT3A 1QUEA 2RGXA 4MQEA 2GH1A 4ZVUA 4ROTA 4HUQB 3VU1A 1IXSB 3GA0A 2O2JA 2QT0A 1EFVB 3BGIA 1QH0A 5MGBA 1HNZB 5C81A 3C8ZA 4NFLA 2Q7OE 1ZMXA 9LDTA 4JVOA 2GAFA 3ENQA 3P9CA 5ER6A 3BD6A 2IX9A 2O3SA 5JSHA 5IDXA 2J5BA 2WJJA 3E35A 3I3OA 2BYTA 1CSEE 4IEEA 4FEGA 2F64A 5GZ3A 1TJ4A 1NWHA 1SOVA 2ZIEA 5ELMA 4IS3A 2YJ4A 1L6RA 4FKBA 2IS4A 5ICMA 2O8BB 1ZH6A 1BROA 3AFNA 1KYXA 2XNDD 3R2JA 3HZZA 3F6BX 2BKVA 2G8NA 3D43A 1ZZEA 2JKYA 2WHRA 4MRVA 3SEFA 3HUTA 1NVVQ 2YVKA 3CEAA 3MQ4A 1DX4A 2INGX 4U6SA 3TZ6A 3DTNA 1C1XA 2O4CA 1UXIA 2GCNA 2X9QA 1ULTA 3MN1A 3AF0A 3N2KB 3USCS 4BO5A 1S2NA 4D43A 3CLVA 5A4IS 1M83A 4N3CA 2QE7D 1R9MA 4DLPA 4IJVA 5LKRA 1ZGJA 5DN9A 4II7A 4J0DA 4EG8A 3HJAA 4UBMA 3OQ1A 4LJ9A 1EVZA 3R74A 3F9RA 4L6AA 1ENPA 3HB4X 2W6JA 3S2EA 4A36A 3H9EO 2P2GA 3HUDA 1LDMA 3QW2A 4TWIA 2C83A 4YONB 2JGDB 3Q1LA 4CHTA 5A02A 4R2LA 1TEZA 5K8VA 3ANYB 2DT5A 2RB5A 1P6QA 3AB3A 1W29A 4L4RA 4B74A 1Q83A 3QTTA 1USKA 2Q5QA 3BSSA 1TIBA 3KZMA 4P5PA 4E2WA 4N54A 1PD0A 2WE8A 4EUHA 5KHLB 2FPUA 3HO1A 2OB1A 1Q1QA 2WAAA 4BMZA 2W2TA 3E58A 2BGGA 3ZWPA 1YS4A 5I01A 1AS2A 4ZYTA 1RI3A 2QENA 4ICIA 2O6HA 1BA2A 1CEYA 3DC7A 1ZD8A 2IW1A 4MEBA 1DE0A 1JU3A 2POCA 1GDHA 2YWRA 3KAJA 4JI6B 1EFDN 1GUAA 4YRZA 4ZEMA 5HJEA 5B3LA 4M1ZA 3ORRA 4U2EA 4LFBB 1SQGA 5CFLA 1ZESA 5EIBC 3ZHCA 4QU0A 4ZPJA 4NABA 2W11A 4RPCA 5IKOA 4QXQA 4BGUA 1KEZA 4KR9A 2RHLA 3H3FA 3FNQA 2BCJQ 2J41A 2R00A 4D96A 1FS6A 1F06A 1GITA 1X7WB 3OTOB 2NPOA 4NS4A 1R16A 3C3MA 1R4MA 2RH5A 2JCGA 1IE3A 1MDBA 2QV7A 4WWHA 4IDCA 3J80A 3DAYA 1NDHA 5A2GA 2GNPA 4HRAA 5G0TA 3UO8B 1RM4A 2IYEA 1DTSA 2BI7A 2OO5A 2NZ8A 2VDWB 2VN8A 3MCAA 1AVTA 4D4IA 1HSOA 2EZ4A 1KK3A 3CH4B 4JXXA 3C85A 2F4VB 1Y7IA 4EJ6A 4Y6RA 3ZU6A 1WB6A 1QO9A 5K3OA 2VPWA 2EOAA 2ZIFA 4A3SA 1C9JA 2AOWA 1H6BA 2FN7A 2VHUA 2ZIWB 2G1AA 1E9BA 3G2LA 5CT6A 5BR7A 1QIJA 4Q16A 4LWQA 5JMWA 4R0VA 5CMLA 1ENOA 2E4YA 4NKRA 3DO5A 1W4LA 3ZV6A 3ZYZA 1VKNA 5KDLA