3IMGA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.8 ang resolution in a ternary complex with fragment compounds 5-methoxyindole and 1-benzofuran-2-carboxylic acid
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title Application of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 95
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3imgA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3imgA01
1YULA 3A2KA 1B6TA 1DNPA 4PBSA 3RBAA 1T6ZA 4HJRA 2CSXA 3IMGA 2A84A 1COZA 2WSIA 1WOYA 5J59A 2DETA 4PY2A 1N75A 2E18A 3H9CA 4G6ZA 3TZLA 4MQ6A 3U1VA 1OWMA 2O8VA 3HZRA 2CT8A 3IMCA 3IOEA 2QUJA 1KORA 4RUKA 2NZ2A 1KR2A 1V47A 1NYLA 1VL2A 2X1LA 3FIUA 3SDBA 4CQNA 4Q93A 1N1DA 1UFVA 1QRTA 4YBRA 4P2BA 3CA8A 1NZJA 2E0IA 3ISJA 5K0SA 4MW6A 3H9BA 3UOWA 1HYBA 4U63A 1ZUNA 4ND6A 1O97D 2A1TR 3HGMA 3KT8A 3TQIA 4KPUB 3IH5A 3Q10A 5KWVA 1JIIA 1JEEA 3P0IA 1M8KA 3H05A 4DJAA 1PFUA 1P7PA 2PZBA 3K32A 4NAUA 2A1UA 4F4HA 4JXZA 2A4MA 4I6EA 2HGZA 4CDNA 3MMXA 3CLUD 3G5AA 4MW2A 1O6BA 4GRIA 3CLUC 5FO0A 2WQ6A 4YMIA 4J75A 1G8FA 1QJCA 2A7XA 4NATA 3KT6A 3CVWA 1IH8A 1T6XA 1GPMA 3Q4GA 4EG1A 5F23A 1WJGA 2CFOA 3NBAA 3IUBA 2J5BA 5KCMA 3P0JA 5LM3A 1MJHA 1N78A 4KR9A 3N9IA 4ZT2A 4ZT4A 3GUZA 2QTMA 1VBMA 2XRYA 4UZEA 1JEDA 4MUHA 4QREA 3N05A 2PFSA 1G59A 1U7DA 5TGTA 4QBTA 3RK0A 1J1UA 4WSOA 3RFFA 4MWEA 3DO8A 1KH1A 3VGJA 1KP3A 1M8PA 2CYCA 3PNVA 3MLAA 4CDMA 1I6LA 1QU2A 3N2YA 4MLPA 3LCJA 3H99A 1VBKA 3I05A 1WXEA 2Z09A 4R2MA 4MWDA 2CYBA 1PFYA 4DDKA 3A05A 3HV0A 1VLHA 2C5SA 1NUTA 2H2AA 5J58A 1GAXA 4MW4A 2YY5A 3GMIA 2DR2A 3IDFA 2CYAA 3DPIA 2IJGX 2YXNA 3ZJVA 2E21A 4ZCPA 1MAWA 1OWPA 1IQ0A 2B7LA 2A1UB 1IFXA 4EG4A 4JYZA 4TS1A 2YWCA 5IJXA 4KPUA 2J08A 1MAUA 1Y42X 3TS1A 3CLSD 2X3FA 3HFJA 2BYTA 4MWCA 2QTNA 3UY4A 3IVXA 4WNYA 3CLSC 4XFDA 4X0EA 1T9GS 4U8HA 2EL7A 3X1KA 1ULHA 1LI5A 1I2DA 2DXIA 1KQNA 4NAHA 3AG5A 1O96A 1J21A 4ZT5A 1YIAA 1EFPA 3CVXA 5FO1A 2V0GA 5H16A 4EG7A 1ILEA 3TZEA 5TS2A 4J76A 1H3EA 3X1MA 3COVA 3LE8A 1G8GA 3CLRD 4I6JA 4MVXA 4DLPA 2J07A 3E27A 1O94D 3ILVA 3CLRC 3QTBA 4K03A 3D6VA 3SEZA 1N2OA 3FHJA 1PFVA 3INNA 1YI8A 1EJ2A 3VRHA 1BS2A 1YUNA 3PXUA 4MVWA 4MAFA 4MW1A 4ZCRA 3AKZA 4ND7A 3IOBA 4ZT7A 3ND7A 1TEZA 1N2HA 1TFUA 3UMVA 4JZYA 1H1TA 1MB2A 4HPWA 3COZA 1TYAE 1Q11A 3CVYA 1WXIA 5KHAA 3SZGA 1K4KA 4MVCA 2PZAA 3ND5A 3AG6A 2D13A 3TNJA 1O97C 3PRHA 2GM3A 5AHWA 1MB9A 3L92A 1YIDA 4NDAA 2JAXA 1FYDA 2GOYA 4XSVA 2EJCA 1IRXA 3M5WA 1J70A 1MOPA 5HG0A 1O96B 4F3RA 1EFPB 1KH3A 3HMQA 5HUHA 2E89A 4AQ7A 4MVYA 5J5AA 4MUKA 1EXDA 3IVCA 1EFVB 3RJZA 1LI7A 2O5RA 2Z3VA 1WQ3A 1QRSA 1A8HA 1U7XA 2JANA 1QNFA 1X6VA 2CV2A 2AZXA 2J09A 2DUMA 1V8FA 3HL4A 2NSYA 1IQRA 1H3FA 3H97A 4MUEA 2ZP1A 1PG2A 3ZGZA 3FH0A 3F3MA 3COWA 1GZUA 3X1JA 2PXHA 1QQTA 1SURA 1F7UA 4ZCTA 4MULA 2I1LA 1O0BA 3SZ3A 2AG6A 5DASA 1NURA 4KR7A 2DPLA 2TS1A 1F7VA 2CV1A 3CLTD 4OUDB 3SYTA 2QTRA 3FG9A 3CLTC 4KKVA 2YWBA 5HUJA 1OWLA 4E1AA 3ND6A 4XFJA 1GTSA 4L2IA 1JECA 3AFHA 1F9AA 2PG3A 2V0CA 3UC5A 2XRZA 1O0CA 1WZ2A 1JILA 3PNBA 1NUPA 1N3LA 4MUGA 3DLAA 4EFKA 1OWOA 2HZ7A 5H7XA 1KH2A 1VBNA 1O95D 4OJMX 1NP7A 1JZQA 3FOCA 2A88A 1N2GA 1WKBA 2AKEA 1K97A 1JMVA 2Z08A 1KP2A 1XJQA 3CR8A 1NSYA 4JXXA 5DB4A 3COYA 3FY4A 3A4IA 1N77A 5TEVA 1T9GR 1TYCA 1KQOA 2QUKA 3ZUGA 4R0NA 3IMEA 3DV2A 1EFVA 1T6YA 4MWBA 4EG8A 2IP1A 1IVSA 1U3CA 2BTEA 1S4MA 1OBCA 5TEWA 1IQUA 1O94C 5LFAA 2H29A 1EE1A 2RD2A 3FI0A 1WXHA 1JIKA 4ZCQA 2QJFA 2A86A 3LOQA 4L2IB 1J20A 2QJOA 3ZJTA 3Q12A 1XNHA 3OP1A 2PIDA 4OUDA 4ZCSA 3QE4A 1M8GA 3G6KA 2QJTA 3D6UA 3GLVA 3IVGA 4NZPA 3MXTA 2J4DA 4MW0A 4UZFA 4G5YA 4MW7A 4MUJA 3ZIUA 5K0TA 1KAMA 1R6UA 4AS1A 1RQGA 3FWKA 4EGAA 2ZUEA 3G59A 1X8XA 2X0KA 3P52A 4HK4A 4YP7A 5BNZA 1U3DA 4HJXA 4EF6A 1NUQA 1ZH6A 3ZJUA 1I6KA 1N2IA 3NV7A 4H3SA 1TYDE 3AL0C 3S3TA 3OTWA 1WQ4A 1KAQA 3FETA 2D54A 2WB2A 1EUYA 2A1TS 2PZ8A 3SP1A 5DK4A 1JGTA 1WY5A 4K0RA 1F4LA 3RK1A 1YUMA 3KT0A 4DNXA 4CT0A 4PBRA 3IUEA 5LLTA 3RHSA 1M1ZA 3UK2A 1MBZA 1GN8A 4YP6A 4ZT3A 1WXGA 1IHOA 1OBHA 4QRDA 1FFYA 1K4MA 1PG0A 1I6MA 2GKSA 3JXEA 2VTBB 4ARCA 1KKUA 2QUIA 2DEUA 1KQPA 4YP5A 4GU5A 3MLBA 1R6TA 4MUFA 2D5BA 3NBKA 2RE8A 3PNYA 3L93A 1TYBE 2OQ2A 4MUIA 1NUUA 1XNJA 3K9WA 3IODA 1H3NA 1J1ZA 4I6GA 1R6XA 1Q15A 3C8ZA 1GLNA 1WXFA 4EG3A 4ARIA 1J09A 3QTTA 1TQ8A 3P0HA 1GTRA 4ZT6A 3FDXA 4DDHA 1Q77A 3CVVA 1QRUA 5FNZA 4MW5A 3CVUA 1QU3A 1XNGA 1JHDA 1ZH0A 4PBTA 2OV4A 2CUZA 4FZJA 3KT3A 1M8FA 4S1OA 1N2JA 1JIJA 1O95C 3A04A 1U0BB 4EG5A 4MW9A 1NUSA 1MRZA 2IELA 1JZSA 1QTQA 1OD6A 4RPIA 2HMAA 3FNRA 3TQOA 1OWNA 4U7JA 2DERA 3VU8A 4DDMA 3ZXIA 4A91A 1M83A 5JBNA 1K92A 5IHXA 1N2BA 4NX2A 2VXOA 1CT9A 5DEOA 2ZUFA 1O5TA 4R2LA 2DLCX 1G8HA 2G36A 2CV0A 2X1MA 3N8HA 3BL5A 4JFAA 2WQ7A 4BWVA 1PFWA 3SEQA 1NI5A 4EG6A 3ZXSA 3AIIA 3KFLA 1M8JA 4Q16A 1MC1A 1N2EA 2QUHA 3MUEA 1LW7A 3ELBA 4KR6A 1D2RA 1Q19A 5EKDA 2R5WA 2VTBA 2JA2A 3IOCA 4MUNA 1ZJWA 4G5FA 4DE5A 1EUQA
chains in the Genus database with same CATH superfamily
1Y4ZA 2Q1XA 3CW9A 2BZ0A 3IJRA 3IE2A 3O03A 3A4TA 4KVAA 2C1ZA 3HLKA 3GAFA 4JOCA 4G67A 1DQNA 2VF8A 2JG3A 2IDMA 4TMKA 3D4PA 1IXRC 3SC6A 4QX6A 4IHKA 5LCXA 5LQJA 4RXMA 1PNOA 1O94A 4HFMA 3WYAA 2Y76A 4FDMA 3EX7C 1M0TA 3IP8A 2AN3A 3PHHA 3QGMA 4PQYA 4KVFA 4V3CA 5EKXA 3BJIC 3OHSX 3QLVA 2PUJA 1NC1A 4ZO4A 1SBHA 1P3JA 1AK2A 1FUYB 2FPXA 1NW3A 3I2IA 2AOTA 5DM4A 1XMXA 3IA7A 4GLLA 3VVLA 4A3SA 5F9MA 3GFFA 1RRPA 2XY4A 1KORA 2I65A 3G5MA 4C04A 1V1RA 5JFTA 3ZQ4A 2E82A 4IHQA 3NEJA 4PLWA 3SDBA 3TQTA 1DQZA 4C5CA 4DAEA 4GI3A 4LRWA 3V48A 2DPYA 4L8FA 4MKHA 1IXYA 3FTEA 3P9RA 1S2LA 2EYQA 2PUHA 1T3ZA 4OB8A 2ZRQA 3RC7A 3WA6A 5BSFA 1GL6A 5KSPA 5HUHA 3R6TA 3OT1B 3D3NA 2NO5A 1HYEA 2R7MA 2E0IA 3TTUA 4MW6A 1E69A 4G5GA 1ZI6A 4RMIA 1ZD4A 1VHTA 2D5IA 2Z2IA 1VSUA 2Z83A 4AKEA 1WHTB 5HIJA 1JMKC 2IE8A 4LWOA 2PH5A 3WWCA 3C1UA 3HJGA 5EWJA 4K9LA 5CNIA 1SUBA 2GLUA 3CINA 4IMJB 4OGWA 5EL0A 5MHTA 4JV5B 4F8YA 3TIGA 3BMCA 3P0IA 3E9NA 2L0XA 4JBGA 4DBVO 5BR8B 4BX8A 4BNGA 2QMHA 4WKBA 3KR9A 5IXYA 3OF2A 3K32A 4YACA 4F4HA 2JLBA 4RK6A 1M1NB 4ER5A 1P1IA 4MIEA 4ZAYA 4GXRA 1J49A 1C0IA 1Z63A 1IU9A 3M33A 2O2SA 5ESDA 3HNRA 4NENA 1NQXA 1ZAKA 2HA7A 1ODJA 1W5EA 2GGSA 1YR3A 2MMGA 3HCBA 5JATA 4M1WA 5AKYA 4RVOA 1O54A 1XFAA 1TT7A 2ZJ1A 4J75A 4KGVA 3O75A 1E9FA 1C1XA 1MVOA 1TA0A 1AGNA 1I94B 3V8QA 1GAEO 3LCUA 4EI7A 4MDEA 4AIRA 4XUDA 1PCXA 5B1IA 5ITZB 1DAEA 1UP6A 4EG1A 1WJGA 1JFFA 3KKKA 4QT0A 1ZEJA 2QLTA 2GD6A 1T5DX 3MAAC 3WL6A 2FPSA 2DFDA 3KL2A 4Q00A 1MDBA 2W6JD 3OEWA 4HMOA 2AJ8A 3RYIB 1O8BA 3MRXA 2QVYX 3CO0S 3KLMX 4NMMA 2R8XA 4L6IA 3K5PA 1KDYA 5DSXA 3JARA 4FK8A 5CXQA 2VK4A 1BKDR 3WGOA 2O7VA 2Q4OA 4IDBA 2DKOA 2X77A 2NT3A 3NTVA 1NMSA 1I0ZA 3WZLA 2EWMA 4QBTA 3AJ8A 3DXYA 4MWEA 2VZ8A 5KJFA 2GPWA 5BSWA 4MIOA 3BXGA 2MOKA 1RWMA 2GZDA 2BISA 2R47A 3LCJA 3O3MB 3EGEA 4CMKA 5AW7A 2FRXA 3I05A 5LSAA 5EJIA 2C97A 3CM0A 3WB2A 1E2HA 3ZZNA 1GITA 3ILXA 4IKOA 2WWHA 2J33A 1N0UA 2CXHA 4BTEA 4RVUA 3PL1A 1QHFA 3B3AA 5JVDF 2YY5A 2A59A 2WKQA 3HM2A 1O3YA 1P8JA 2O2YA 4AXXA 2HIGA 2PRSA 2WAOA 3N7UA 3EGWA 4KIUA 1Z36A 4XDGA 2D1SA 2GJ9A 1BX3A 1IFXA 2PD3A 3D0RA 2AOXA 2XQIA 3EY4A 3FPFA 4IQ8A 2MU1A 3V97A 2JZNA 5P21A 2C42A 5HNKA 1WHTA 1RPNA 2B7BA 5FOTA 3CUEF 3DO5A 1IEWA 2P0YA 4H0NA 1B7GO 4HG2A 4IWXA 4LHZA 3G1TA 1QGUB 4RV9A 2K87A 4XB1A 2OA0A 3SSOA 4CYMA 5B7PA 1UFRA 1U6JA 3E22A 3ZDXB 4DA0A 4CLOA 2B3TA 2AMLA 1EP3B 1QH9A 1LH0A 1BRMA 1TZCA 2QTNA 1QDUA 4PAGA 3DVQX 2O54A 1E2IA 2ZWIA 1VHQA 1M2FA 2IKSA 3EMVA 1M1NA 4O33A 2ZDHA 1TMOA 3ZWBA 4F72A 3LYLA 4MH0R 3UAVA 1HETA 4ZT5A 1TZ2A 2OPBA 5FHQA 4ZDKA 1NBAA 1J33A 1Y5NA 4OHRA 3HRHA 3H84A 4P7GA 5FLEX 4TLBA 2IHJA 4FOSA 4DMFA 4D9NA 1NRIA 3KVOA 4N65A 2PFKA 4WNCA 1GTZA 3QVUA 2BC9A 1K6XA 2CGEA 1NU8A 3DOHA 1HTTA 5JMPA 3ZEAA 3EYAA 5IULC 5ALTA 4B3CA 2PZJA 4DLWA 1EAYA 2E4XA 2FKAA 4QVGA 4LHEA 3RYIA 2XOXA 2CVQA 2Q7OE 2BZ1A 1DO2A 1DOZA 3BMNB 1S8FA 2DHQA 1XP5A 4MRAA 4PGFA 2CBZA 3INNA 2JEOA 3DMYA 2WG2A 1UWLA 1EKXA 3INGA 4N0DA 4F93B 2X42A 3D7NA 4KREA 4M9QA 1BS2A 4JLPA 1YUNA 4ZAZA 3L1KA 4EVSA 1TVKB 5LYJF 1GL9B 1OW3B 4MMZB 3I5XA 3KEMA 2PMKA 2GKGA 3D3WB 3AR2A 5BWMA 2GBLC 2JEYA 2K6GA 3FKSD 2WOJA 3KHSA 1G98A 4IH9A 3RASA 1PWEA 3IRUA 1RYDA 3S81A 3OKAA 3IALA 3RS4A 3S2EA 3TTXA 8ADHA 3UMJA 1XRLA 2IDZA 3SVZA 2N0SA 2FETA 3DR3A 3E58A 3M70A 2HMUA 4I4IA 4WNAA 2PKWA 2FSHA 2XE6A 1E0KA 5LNK6 1XX6A 4UXIA 4YUYA 3GLGE 3HS3A 2NSJA 3NXKA 1GA1A 4Q7QA 1HFJA 3Q11A 4PNPA 4EHIA 4W5OA 2RHTA 3LX4A 3MSCA 2KQUA 2MINA 2BE7A 2OT3B 1NPTO 1Z4NA 1U2SA 5E6RB 4DYDA 2AVNA 2C54A 3RRXA 4WZAA 3NVDA 1BN7A 1ZCAA 2JASA 5HS4A 1QX3A 1YQXA 4NBLA 2CHQA 3F5QA 4JI6B 4DB4A 5EIAA 5L3SB 1UDRA 1W75A 3N7TA 5J40A 1IQPA 1PYDA 1AKUA 4RY0A 1QGUA 3VOTA 5FFFA 1T5HX 2ZJYA 1YOVB 2ZWAA 1HG0A 2EP7A 2JFQA 1YNSA 2R751 2C0CA 1W44A 5ALGA 5ERYA 4H27A 3RO7A 4GDFA 4UE3S 3OECA 5ESXA 3MILA 4CQLB 3RSQA 3TLYA 3JVVA 3E5MA 1E3DA 4GPD1 3H11B 2A9KA 1IQRA 1QRRA 3KK0A 1Z39A 3TW8B 1HL3A 1XCGB 3BS4A 4E5PA 5EQTA 3MOGA 3LRXA 2ZP1A 4NZMA 1G9SA 4JI7B 3PU6A 4RPLA 3HXKA 4BFYA 5HF8A 3I61A 1HZZA 4KXVA 3ETNA 2ZRLA 3NHBA 3BE5A 4GGPA 3WLKX 4G4GA 3JCZA 4UUAA 4KR7A 2X4GA 1SCNE 2C29D 5L4NA 2CXRA 5DBIA 3QIAA 4TLMB 1HEUA 4HH0A 2A5YB 4MVJE 3VO8A 4D5EA 2FRDC 4M8NE 4XLZA 1RAAA 2XRFA 3WQRA 2PU7A 2XGSA 2C98A 4N5NA 2PYZA 2VS1A 1PU2A 3BMNA 3PWKA 4FQ8A 1I2CA 1NC3A 1P7CA 1A97A 4NPAA 1FVFA 2W6JA 3ZY2A 5HIAA 1JECA 5H5JA 2H51A 4LFAB 4LOJA 1D2EA 1ZEMA 4I50B 5GIOE 2XOKA 3ZHVA 4FINA 2ODQA 3PNBA 1C8KA 1EHCA 1KC1A 1UCFA 2X1HA 3D3WA 4XCXA 5IN5A 4F1KA 3U60B 4C2AA 1A50B 1BCRB 4X93A 4R8RA 4PG6A 5D8DA 2MDTA 2YVUA 5H3HA 3PFKA 1KSGA 2HCJB 4ABYA 4IXDA 4OYYA 1K7CA 3ML1A 1V71A 4NV1A 2OFPA 4I1PA 3RVOA 3FYUC 1WNTA 3G9QA 1JMVA 1PL7A 3HFSA 2RKBA 4JDPA 2WRZA 3B3QA 1HT3A 4JU9A 3D6FA 2GCEA 1RZRA 4YDQA 1TD1A 5E6RA 2IZZA 4LMAA 1OGYA 4E32A 4B6OA 4LGYA 3V4VB 2F1IA 1NIJA 3DYVA 1YC2A 2LRHA 3RRFA 3B1VA 5L3SA 2QZ9A 2VCYA 4TV8A 1RXWA 2Y77A 1UP4A 4RHXA 1C7ZA 3W5IA 5FAKA 4MLCA 2FPIB 4BGUA 3KJIA 2B34A 1CDEA 4HDOB 5AW2A 1G55A 3K92A 3V1NA 5KVAA 4EL5A 3HJCA 1TADA 3GFVA 4M8IA 3D1LA 1W93A 4MWBA 1PGPA 4BE9A 1NVKA 4UFOA 2IP4A 4CQLA 1L1QA 1H9AA 3W9UA 3H11A 5J2TF 4URYR 4A82A 1I2MA 2UYQA 1MN6A 1TU0A 1EBFA 4GS5A 3X1YA 1KRWA 4D45A 4ED9A 1E1DA 2VI5A 3HB0A 4LHVA 2FMFA 3JWEA 2NXNA 5U4XA 1P9NA 1SUPA 2UZIR 4Q9LA 4E5NA 5FLKA 3UVEA 2GRUA 5JD6A 2GXSA 1SKYB 1C9NA 3LOQA 3WG9A 1H6DA 1PL6A 3ZU6A 2IVZA 4C0XA 1GQFA 4E94A 4MHSA 2YWJA 2OGTA 4LJ8A 3OCYA 1PIWA 3OT4A 4MQEB 1EVLA 3ORFA 4UMFA 2OZVA 4G0QA 5DTMA 4ZCSA 1WW2A 4BFTA 1PQYA 4JIGA 3SGLA 3KP1A 3TLMA 3LL7A 1URPA 3UPDA 2PGJA 2VAVA 1MJGM 2H3HA 1TCUA 2IYQA 2ZIAA 4MOWA 1GUAA 5MGBA 2RKWA 2FQQA 4ZTUB 3EUWA 4P9NA 1C3VA 3OKCA 2H4YA 2XT0A 5K0TA 3NXSA 5BQ5A 3E48A 4RSHA 3VJLA 4KBFA 3ENVA 2FK8A 3L06A 5FF9A 4A8PA 2Q5HA 2PUCA 4MQMA 2VSNA 2ZK7A 3AP1A 3FOAA 3GEMA 4M55A 2QUBA 5TB5A 3SDSA 2BD0A 3BD7A 3FPEA 3O8RA 3ESAA 3GMDA 1BCRA 4I5DA 4FEGA 3QQ5A 1PQUA 3VSAA 1N2IA 1P2FA 4GBJA 5HBGA 4E11A 1QYRA 1R0KA 3FHTA 3AIKA 2F3SA 2CNLA 3BXOA 1UT5A 1KO1A 4Z9XA 4C1BA 1IN5A 1Z0DA 1SCUB 2E6KA 1QP4A 5EXTA 3RSHA 3SWWA 1U65A 3HJNA 4S1TA 2FK7A 2HU2A 4TZKA 3R44A 3TSWA 1C7QA 4FN5A 3ZHSA 4EFNA 1WPXA 3TLGB 1RMYA 5DHAA 3KT0A 3H3JA 4CT0A 3CONA 3RUCA 4QHSA 1XZCA 1JN0A 1CQIA 2RDMA 2VLIA 1TF2A 5CH8A 5DNWA 5HGJA 1C9DB 4UMVA 5EHZA 3ADDA 1TZJA 3OY2A 3V8PA 1BA3A 2BSAA 4GHWA 3ZLTA 2G71A 1LTHR 1C9JA 2ERYA 3HCCA 4KPGA 1JV2B 5FI5A 4DW8A 2F55A 2G3YA 4KVZA 4JX9A 4FFSA 1MFZA 1JHUA 3D6JA 4O29A 2FPIA 4P7BA 2JA1A 1LTQA 2WM3A 3IR5A 4KWTA 1U2GA 1U2RA 3WV5A 5F5NA 3HXOA 1VMKA 4YP5A 1CYEA 1PJZA 1N5LA 3HEMA 4IDOA 3RGWS 1Z4LA 1KDTA 1K86A 2ECKA 3EGIA 3ELDA 3ZDFA 3O94A 5L51A 2CB9A 1OI2A 2OQ2A 3JQBC 3K9WA 4Q4JB 4HV4A 4EJ2A 5F21A 3BWBA 3D8SA 1OH6A 4KPFC 1AUXA 1WVIA 4YXFA 4IH1A 1J1ZA 4DHEA 1FFAA 2ZI5A 1C0PA 3GJ8A 4I6GA 1XPRA 1M5RA 2G76A 4OMFG 2QOEA 4DDVA 3EUEA 3DEAA 1ONBA 2ONJA 1PTJC 4OREX 2EBFX 2CF6A 4I5FA 4X45A 4XTRA 1S9HA 3NOQA 1YB7A 4WT7A 1AK9A 2IT1A 2YMLA 3WQHA 1BEEA 1EBUA 4MR7B 4DDHA 3NHFA 4MUXA 4EB6A 3FFAA 3I1YA 2RHWA 2XXBA 1YZHA 3PDJA 4JKYA 1IDN1 4MQEA 5FBQB 3B52X 4CMJA 3DOIA 4PBTA 4EJMA 2E7ZA 1RU3A 3RVNA 1Z8NA 2ZE7A 5A4KA 1SBCA 3BE4A 2NYUA 1HDGO 3EVTA 4FZJA 5CNJA 4BDTA 1J2TA 2QY6A 2NO0A 2HLNA 4IV8A 1JIJA 3P0FA 1W47A 3MXOA 1R0SA 4N3NA 1Z68A 3QY0A 3R5HA 1X94A 2G1AA 7MHTA 1PT7A 1HTWA 2QM3A 1SU4A 2ZSEA 3IT3A 4YIKA 3HCFA 1ZGBA 5DNAA 4EH1A 3SS7X 3RVKA 4X7RA 3TTTA 1MDFA 2PIAA 1ZHFA 1JBQA 1XFDA 3O91A 2KM1A 4OQQA 4DEYA 3MJDA 1IN6A 2QN7A 1EDEA 1GNRA 1SCUA 1YQTA 1X1SA 3ENZA 4JLOA 3T54A 1ZQ1A 3F3YA 3VU8A 4A91A 4CMEA 3AF6A 1P5FA 3EW7A 3FROA 2GB4A 4Q01A 3WIDA 3CEJA 1VXOA 5CDHA 2P6PA 1YHNA 1FF9A 1K92A 3DZGA 1XA4A 4KE7A 5IMBA 1AIPA 4DOMA 1YU6A 4ESHA 1CT9A 4GMGA 3JRXA 4R4JA 1VHWA 2D0OB 4QRHA 4JVSB 4DUPA 1DU4A 1H8HA 4BWVA 1ILWA 3SEQA 1XZEA 1DVRA 2ZXEA 1Q20A 4MB2A 5IAJA 5DX0A 3P2OA 2PUTA 4V1CI 1RJDA 1U6IA 2IITA 4J1SA 4PRLA 1R8XA 4ARSA 1RJ9A 4XR9A 5A3JA 1UEJA 3OCZA 4HN4B 1D7OA 4WXRA 5JCJD 3K0FB 1IBLB 3AM3A 1Y6GA 4PHFA 3KQWA 3VO1A 3MAJA 1LUAA 4RK4A 4BWYA 2GQ0A 2IZ6A 4BBZA 4HJRA 4JLSA 4DV5B 1KZ9A 4AF8A 3UBTA 4ER7A 2Q28A 1JDJA 4ZFNA 4UTXA 3ESCA 2C4WA 1NN1A 4EGCB 4GMDA 4TV9A 4MQ6A 1NMQA 4RSGA 3OPQA 1Q44A 2Q6LA 3KJGA 3VPCA 1Y8AA 4DLTA 2DECA 1UZAA 2ZJ2A 5HA5A 2CT8A 5IYZB 3PFBA 2R0QC 3G8YA 1MKYA 4F92B 1U2DA 3FUTA 3FFWA 4DNPA 2E4UA 4JODA 5G4KA 2JEZA 1VL2A 3R0IA 2B2XA 4LX8A 4AYWA 3ZV3A 3BH6A 3NYIA 3KPJA 4D96A 3D64A 5L7YA 4R41A 1QZTA 2VKTA 4PAWA 3OAAD 4EUSA 1CUYA 1UKZA 1M0EA 3RDPA 2Z3ZA 4EHBA 1XMOB 1KZHA 3X1WA 3BSSA 1WCWA 4YI5A 4P3KA 3QF4B 5AKZA 2C78A 2XE4A 4I1SA 5E2AA 3RRMA 3F6RA 2BM1A 1TCVA 2F1HA 2C04A 2M98A 2VJAA 4U63A 5DOVA 1L5FA 2CFTA 3T9EA 3HGMA 2PA3A 1BE0A 1R8JA 4OLBA 1SHZA 4ZZ2A 2ZROA 3M6XA 1ADYA 1J23A 1I1NA 1LJUA 3NU1A 2H1IA 5HK8A 2R4UA 4PG5A 4G41A 2BBTA 4LG1A 1K5GA 5K8JB 1TO6A 4HI0E 3FWPA 4Q4LA 1WAMA 1NKSA 1IIRA 1OXSC 1TO1E 3VMFA 3HL0A 3FJYA 4HLCA 3SS9X 1D9XA 1VA4A 2PJUA 3CR7A 4IEIA 4MVJH 4PSDA 4F11A 3VNUA 1Q7TA 2ZRPA 4L28A 1Z56C 4OY3A 2KS6A 2ZG6A 3G5AA 4BU1A 1O6BA 2Y1FA 4K6FA 4TTAA 2ZB3A 3A6ZA 4CR7A 4AJ1A 1LDGA 4HXGA 1GVNB 2GW4A 2NUBA 1F20A 4R84A 4M9RA 5CLLA 2JAOA 2VH5R 1SRQA 5DBOA 5LA6F 1FS5A 4D3YA 4PLYA 2WAYA 1T6XA 1QE3A 2XCQA 3L8GA 4Q3KA 1FZQA 5CHYA 4O4HB 1UBNA 5FXMA 3V1KA 4BCDA 4MEAA 3PNOA 2ZJ4A 2BZSA 3I9KA 5K3CA 3ROFA 3T52A 4D7AA 1NVGA 1E1LA 4BVBA 3L7KA 4JYCA 1DIAA 4CG1A 1V11B 1KARA 2BOVA 3K0FA 1T8WA 1XRPA 3PC8C 2QD4A 1UBJS 4DG9A 4JJIA 1CYDA 2VDJA 4KZKA 4TKZA 5ETJA 3ICCA 4KV7A 4NEQA 3JPYA 4TQUS 4KR9A 1ZK3A 1L7AA 3LJKA 2YN2A 2IF0A 1AKTA 2ATEA 3D6NB 3QG1A 1ZUWA 2DT8A 3GUZA 3NORA 4I1RA 3HWWA 3S8MA 4L27A 5HR5A 2PUFA 4AURA 4J0HA 1YTLA 2VNSA 1DAGA 2CVZA 4IKPA 1J1UA 3D2LA 1C7RA 4IGFA 3RK0A 1LBEA 3HZOA 2HK8A 3Q7QA 3PNVA 5KINB 4UUQA 2ZVDA 4IKEA 3H99A 2C3UA 3L79A 5IYZA 1Y1QA 4MAAA 1ZH8A 1HFWA 1W49A 4MS3B 2PNJA 2C5SA 3NLLA 4OQFA 3FUUA 4I1VA 1QYDA 2X4LA 3FMFA 4YRPA 5ADWA 3CNBA 1O9GA 3A10A 5CK5A 1M6EX 1D4FA 3H0EA 3GD7A 1K6EA 1PO7A 1PP4A 3B6ZA 1PDOA 3A8TA 2YQ4A 3DPIA 1MAWA 3AH8A 3FYCA 3R4CA 4AP6A 4FM9A 4CPDA 1B73A 3PDIB 5JD3A 3QI2A 3T15A 4CLRB 1AV7A 3C6XA 1DX4A 1U7OA 1KHHA 3V1YA 2CKDA 4HFNA 4LRXA 3V7NA 4DMLA 1DIHA 4DZRA 4IUCS 3CH5A 2WU4A 4OKIA 4X90A 1RXCA 4ND3A 4RLFA 1MB0A 1N57A 5TMPA 5JCOC 3MSXA 1F12A 1W5BA 3X2FA 4ZYWA 3AY7A 2F8MA 3TOSA 4HD8A 3S5UA 3JVEA 3DHEA 4DIKA 3EF1A 5CH5A 4AZWA 4B81A 3NAMA 1NU6A 1LI5A 1JVBA 3DKIA 3P9IA 3WL3A 5CA1A 1ISHA 2ZM6B 5MN5A 3TZQA 3TJRA 3AHGA 1N6LA 1XLVA 3AMVA 1T9CA 1N4AA 3OBBA 3CVXA 1OHHD 3RBXA 1FJHA 1XDUA 5AYVA 9LDBA 5E7IA 5IJAA 3WLEA 4EG7A 1QO9A 5DULA 1ILEA 3BFPA 1L3CA 2OG2A 3O82A 2I7XA 3K0EA 3COVA 3QVKA 1P0QA 2IRWA 3CLRD 4GGMX 2K2QB 1YZQA 1Y48E 1Y8CA 4DQDA 4DLPA 2EEZA 1NT2A 2TMDA 2ZW9A 3I34X 5AIAA 4US1R 3WLRA 3C7AA 3OLZA 1N3IA 5EEHA 3QVOA 3OVMA 4LYHA 3WAKA 2WM9B 2QX4A 3OP4A 3PFGA 1JA1A 1EFTA 5KYGA 4N0EA 4WKGA 1TC1A 1NVDA 4XR4A 5JCJA 4YC7A 1XDWA 4B4KA 5A5DA 3ABRB 1PL8A 3T1HB 5DSTA 4XCVA 1JBKA 1K0UA 1Y1KE 3QHAA 1KWGA 4IVNA 1PD0A 3TINA 4FU0A 4K9QA 4QYIB 2FP3A 4II7A 4MW1A 2CXOA 2WG1A 3R20A 4N54A 5I8WA 4LC1A 1SIWA 1U6KA 5FA8A 5GAJA 1BDMA 2D4HA 2W6ZA 1KWKA 1NG9A 3MJFA 4D97A 3GVPA 4J2TA 1XF1A 1CUXA 1I36A 1DC4A 1ODIA 1XMIA 1Z5ZA 4JI8B 4FYJA 2WZDA 5ICSA 4MS3A 3NIDB 3QLJA 4KHPB 1WR8A 5A5EA 2OVBA 3WLHA 4MP3A 1X87A 2WD9A 4UCFA 1PK8A 2RHRA 1CLUA 4RAOA 3C1OA 3WLPA 1FQWA 4NDAA 1AV6A 2OR3A 5FJJA 4DQUA 1T8UA 2FFQA 2LCIA 3T5MA 3NIWA 3PDIA 3UT5B 3OAAA 1FX0B 1JJBA 1FU8A 1W73A 2VSYA 4LPKA 2VHJA 5CM8B 4CLRA 4YWJA 2G2SA 1BKYA 5JQGB 7ADHA 1A98A 3EZ2A 3SK0A 4BNTA 5H8WA 3IAEA 3ERCA 2Q6IA 1UBKS 3AEZA 5HILA 3HXPA 2H5LA 1LI7A 4R2HA 2Z3VA 5AW4A 1WQ3A 2NZUG 5KYKA 3THXB 1BGWA 4PRYA 3JQEA 1L7MA 4IIBA 1LBHA 2EX4A 2DUMA 3PC2A 1GIAA 1ADFA 4IOKA 1RLJA 3M81A 2GZRA 5CCXA 1ZONA 1V25A 2KB0A 4UU0A 1JHYA 2Z30A 4UEJA 4C7OB 1H65A 1ZGAA 2FN4A 1VC2A 2VR1A 1CR4A 1TM4E 5AJWA 1J97A 2R1TA 2RGCA 2VATA 2GESA 4CQMD 3QYFA 4N5LA 1LK0A 3RUIA 3WLAA 2WE7A 2GETA 1TCAA 4U4AA 4EHHA 2R1VB 3L1IA 3PNLA 3I2YX 4BTVA 1ZAYA 1E3JA 5EE1A 3VM6A 4KUHA 3GPIA 2XZLA 2Q1YA 4OGFA 4L3VA 4AROA 2QTRA 2AK2A 4AWXA 2QSJA 4GOLD 3C8HA 4EYOA 5JEEA 2G77B 4MHTA 2R5NA 1ICEA 3C4QA 5JZVA 4DSUA 4KWIA 3FTFA 2BWJA 3B1FA 1KYWA 4ASUD 1R5OA 2CC2A 2VP6A 4LRSB 4JGGA 2PS3A 3BE6A 3STWA 5AM3A 4QYIA 3V7UA 3W2IA 1WPGA 4MIYA 1F1JA 4OPMA 3KYDB 2OCXA 4W4TA 4XVUA 4FCVA 3DOOA 1POWA 1YRYE 3H2ZA 1EUDB 4MUAA 5HFAA 3VOBA 3IQHX 3AINA 3N74A 3ZNOA 2PEYA 1OWOA 1T1RA 2HLHA 4Y6OA 2VYCA 3M5PA 1YDHA 4H6VA 4DCVA 1RDFA 4JU8A 2R8RA 4F9GA 4X7PA 4W5RA 4X5OA 2OAQ1 4E6EA 1B8VA 1JZQA 1N2GA 1WKBA 2RI1A 3KHUA 1HR0B 4MAMA 4EPRA 2QI9C 4NI5A 1L5MA 2XEXA 3I04A 1A4UA 4GF5A 2D06A 2C9MA 2HN9A 3C5VA 2W58A 3RANA 2C7PA 1FW6A 2GPYA 1T8TA 1SFRA 3THYB 3WJAA 1YL7A 2I2DA 4F4FA 2J5KA 3N6VA 4HDCA 4C07A 3NIFB 3EMKA 3UT5A 1I3MA 1FX0A 1P2TA 2IIPA 2L18A 5HQTA 4TWJA 3SC4A 2AT1A 2WE8A 1T9GR 1HFKA 3C3YA 3IAAA 1TYCA 3OIWA 4XGRA 5ALYA 3ZWXA 4BBAA 5JQGA 2Z8ZA 4INJA 1MT0A 4UUBA 4EEKA 1BDIA 1IG3A 4NP6A 4YJDA 4A6DA 1P5JA 4BLUA 3N70A 1JHXA 1WXWA 1DRUA 3PGMA 4LYFA 1HDEA 1QORA 2OYCA 3THXA 3W5VA 1SUEA 1NAIA 5DNDA 5AMXA 1QLHA 1DAMA 3DZBA 3BIOA 1I4DD 3R0JA 4MYRA 4AMYA 4BLWA 1ZL0A 3D3EA 1WUYA 1XZPA 3BULA 3D54D 3KXDA 2ADMA 3INTA 4NZZA 4C7OA 2B4RO 3KQHA 4Y6RA 2OBXA 1EFKA 3LMKA 5FP0A 4OYHA 2G5GX 5I7AA 2OO5C 1XF9A 1HDZA 1JHOA 1Q1ZA 3MJSA 4Z9FA 5EE9A 4D4HA 1E94E 3VPDA 3OQ6A 1Z6QA 5LMZA 1OHHA 1QG0A 1X7GA 1CW2B 2JBHA 4MTCA 3DE4X 2R1VA 2WMOB 4CQMB 1SOUA 5EMJA 4F96A 2ZYSA 3ENKA 1A96A 4UVDA 2J3QA 3BMQB 1T4DA 3WNVA 3IUSA 1PT8A 1H85A 1G3IA 1OFTA 2BPOA 3DOJA 4CNQA 1R66A 3FCYA 4X7MA 1K3FA 1PDWA 3Q2OA 4LDZA 1NN3A 1UZNA 4CKBB 4PICA 3MXTA 5IUKC 4ERXA 1XNQB 4JROA 4DSZA 1YBMA 1OZGA 5CGZA 3ON5A 5JANA 3B3JA 1JKFA 1NXXA 3VR4D 5F7ZA 2I1VB 1OI3A 2W2NA 1G8PA 2BI4A 4UNNA 1U81A 2ZUEA 3K9HA 2OGUA 2GN2A 2ZRBA 4PX9A 1J8QA 1EUDA 4RAQA 4AG5A 2VAXA 1X80B 3I2KA 3LKZA 1PR6A 4ITUA 1J2EA 1KEWA 3PQ3A 3HMKA 3MGGA 5JYCA 2W8ZA 3NI2A 2GPJA 1DRKA 1GUZA 1V8OA 3MWLA 2Z8YM 3UUFA 4I5GA 1R64A 2NO9A 3BRSA 1F0KA 1UANA 4A8TA 5J23A 5HMMA 5TT1A 4F3TA 5FD8A 1JXOA 3G6WA 4OX9B 2WHPB 4DSNA 4JI2B 1RC0A 2UXBB 1QHHB 3A3KA 4HOYA 2HM7A 4I99A 1KGDA 1DXQA 4OHOA 4TL6A 5JC8A 1UBHS 5FORA 5JFOA 4DCGA 2YWDA 3KCQA 4YCLA 1U28C 3L0CA 2IEYA 5JAMA 5KNDH 4OFBA 4LVNA 2FW0A 1MX9A 1RPAA 2XE8A 1KQPA 1U8EA 2IEIA 3F8TA 1JTEA 3GPLA 3FLBA 3AZQA 5HTKA 3JWIA 3RUAA 4ENTA 1G2PA 2EFCB 3A1NA 4O4JB 3VDQA 1ZITA 2IXGA 2MSKA 2X8WA 3F90A 3L93A 2A78A 3MW8A 4JSTA 4HDSB 3BJZA 5EKSA 4MI6A 3QE0A 1YO6A 4Q1EA 1YCGA 4YT8A 1XTUA 2OBYA 2NNLD 4FZ3A 5BWCA 2XXAB 5AUNB 4NFSA 1DAHA 4EG3A 2HU8A 1WXFA 2Z98A 1XBTA 2PVCA 1J8VA 3N8IA 3OEED 4YNBA 1XZJA 2VQDA 3IT1A 4JB3A 1Z4IA 3CRZA 4EPYA 3W5DA 4Y2VA 4ZMRA 4CQMA 4KNYA 1NW6A 1DAIA 1JDSA 2GJKA 1U2PA 3B60A 1JPNA 3DHYA 4GEGA 1RP1A 1XJCA 1E9EA 1KZ1A 3L0BA 3P2IA 5A7HA 1XEAA 2PSFA 1HDXA 4KYIB 4CKBA 2B20A 3KU1A 3RK4A 1AU9A 4KXLA 5JS7A 3T5AA 1F8GA 4S1OA 3ZXUB 4FZ5A 4QPNA 1I33A 1HDYA 4ASUA 3AU9A 3OD5A 4TMZA 4GX1A 5EESA 1E3LA 1WU8A 2QSUA 3RFXA 4JVOA 4D9HA 1M1XB 3BFVA 3OWOA 1JZSA 1XA0A 4FT2A 1IPFA 4FMDF 3W9BA 4IJMA 1X80A 1AO3A 1E7WA 4KE8A 1JQAA 1FEZA 2HU5A 1XJ5A 4KODA 4JWTA 4GP9A 5GVRA 1UWKA 3TQOA 2G4VA 2W90A 3VTKA 3JZDA 3M6IA 3UWPA 3OPNA 4ZGGA 1CCWA 3LI2A 5DCUA 1M83A 4HUTA 5T8KA 3KKOA 1GFSA 4JT2A 2HMSA 2WHPA 2FEAA 1DQSA 2ZI9A 3PL5A 2NAFA 2XGGA 3QVSA 4M1YA 3VNQA 1VYUA 3WXMA 1M1YB 2QAGB 1JG7A 2FSFA 3NJ4A 4GH5A 1YK1A 1QHHA 4PPFA 3UTCA 1XKTA 4YRGA 5B36A 5SZKB 5EYPB 2A3RA 1A72A 1XRJA 1DG3A 5DWVA 2K7ZA 1ISJA 1TEVA 2IQIA 2J59A 3GEBA 2JC3A 2VWPA 3NBMA 4O59O 4OH1A 1N2EA 3TVYA 3MUEA 4AJHA 4D4MA 6AT1A 1M6VB 3BEOA 4FHZA 4D9MA 3PUKA 1G3UA 4MI9A 3D8RA 4FP9A 2QU7A 3A7EA 4YMGA 3U7FB 4R1TA 3PG5A 2R1ZA 1LSJA 2Q9BA 5I5EA 3T3NA 1EUQA 2YYYA 4M1ZA 1B6TA 4ZA2A 1UIMA 3OHMA 5CG1A 3SIPA 5JUWA 4WBSA 1XTTA 2ZBDA 3MWJA 1SHTX 2B94A 2ETVA 3DEFA 3FDJA 4HDSA 4ND4A 4QEZA 4XD7D 5LL6P 2HCTA 4IXTA 4ALLA 2EDAA 3KFVA 1UFOA 2CXSA 4PY2A 4G6ZA 1L5WA 3E9ZA 1DWOA 5HWSA 3T0IA 1W8DA 3SR4A 3MCVA 5DNYB 4QTUB 1DO0A 4MPRA 3RVJA 3U1VA 2WJGA 5JS2A 1TF7A 2Y1OA 2G40A 3UJAA 3HU3A 3PIDA 1G9TA 4ZEWA 2CZQA 2ODTX 4XWAA 4N6NA 2A33A 1OZ0A 2Q50A 3WL7A 1XDZA 2VA9A 3AHFA 3W34A 3QX9A 5C81A 4AO7A 2X76A 1GHTA 3DLIA 4F1WA 4OMUA 3RROA 4YBRA 4P2BA 1ZW6A 1H2ZA 2Q5IA 3P26A 3NO4A 3VBEA 3SAJA 3U61B 2AZMA 4ALIA 4Z4GA 2CSUA 3HADA 3NHMA 1NUAA 4BFXA 2CLMB 2JIOA 4LFBB 1PSZA 3DE1X 4G8JA 4IZHA 2OHJA 4MQUA 4DBZA 1GPDG 2KX7A 4LW8A 5EE5B 1SUWA 1YE5A 5LKAA 1LB1B 1RWNA 2DUNA 4YUWA 2ZR9A 1CJUC 3H1FA 3I9V6 1KOLA 2YCBA 4BKRA 1C3LA 1XYYA 2J3IA 2AL7A 1GO2A 3O8LA 1V8BA 3E35A 3P8ZA 3VR4A 3R8CA 2BVNA 2DHDA 1PR5A 4ZO7A 2D1TA 4MGIR 4Z9AA 4QGGA 4IDFA 4Y9DA 1SGWA 5FV7A 1P62B 1SQ6A 3EF3A 4XQGA 5BUQA 5LIPA 1SOVA 2VHVA 2VF4X 3HCOA 5LZ8A 4X8OA 4YRCA 1KYVA 1M2VB 4F5ZA 3OEHD 5DOZA 3PCTA 4JT9A 3OBIA 5EIBC 4BPBA 1USWA 3GNTA 3HNOA 3FYDA 4CKXA 5JXJA 2IYTA 3QMVA 2QNIA 2KLHA 4YHHB 2H0AA 3WMFA 2QAGA 1ZK1A 1G291 2MYUA 4A92A 3TGPA 1R4MA 3AR6A 2CXUA 5EYPA 4P4GA 3LYUA 1CUWA 4RETA 3ZW7A 4JKOA 1VECA 4PG7A 1M6VA 3LWZA 4FPXA 4EKIA 5AW8A 1X2BA 4QAQA 1U3FA 2GN1A 4JP3A 2DE0X 2QI9F 3OCXA 1K89A 4ND8B 1KY3A 4OQXA 4D8YA 3ZE1B 5TNXA 4P5DA 5HCUA 3B2EA 4Z7NB 4N3BA 5KYUB 2R7LA 1F14A 4HZUB 3KTFA 1A2QA 2LWIA 2IUSA 4HB3A 4TOIA 3R7SA 3LUHA 3KAPA 3PQ2A 4G5QA 4F3CA 4DV3B 4W7HA 2C5GA 3UUGA 4HGRA 1DXYA 1YV9A 2OGWA 3IP6A 4JJ8A 3QUCA 4UZEA 2V58A 2COUA 2JIQA 1AUVA 2GAAA 2VNJA 4F9EA 3Q8KA 4BAUA 2D0PB 3BYZA 5GMOA 1CDZA 1N2CB 3SJUA 1GAQA 4YCAA 5EOVA 3MLAA 2Z1DA 4J0DA 1LY1A 4RV5A 3RVSA 2FFBA 4ECEA 1D2MA 2VBCA 2WILA 1P29A 3H2HA 2IK8A 1IHDA 1JKIA 2P9YA 3OEEA 2DT5A 2P75A 5FA5A 3D7SA 1VLHA 2IZ0A 3B85A 2FUKA 2K4MA 2JIBA 5SICE 5J58A 1K75A 4HVTA 1GAXA 4K9NA 4CMBA 3IIKA 3BHNA 1M3SA 2C7VA 5KYXB 2XMDA 1EYZA 1XLTA 2D2EA 4PYRA 3EG9B 1RYEA 5KQMA 1ZHOA 2NO4A 5CD1A 2A1UB 1R0LA 2GBPA 2CMGA 3KUXA 4EB8A 5AW0A 5GP1A 4BXOB 2G63A 3QWBA 4JJ4A 4LY3A 2MTBA 1P2VA 1GN9A 5I3CA 3J81k 2WIDA 1NMEA 4TPKA 5A0FA 4U0JA 3AL3A 3VFDA 3ESYA 4UU7A 3TS1A 3BPSA 3KRTA 3Q7IA 1Q0RA 3JSAA 2AI3A 4K87A 4MWCA 4UMDA 4CLDA 1P72A 5ADHA 4WNYA 4XFDA 5C7LO 5E2BA 1S0UA 5SYMA 6CHYA 1DKPA 1M2VA 5TIIA 2O7QA 5B3JC 2DGDA 4CLEA 4L7VA 4QTTB 2VBIA 1VG0B 8MHTA 3KQMA 2OE2A 4OIFA 4X61A 2QTHA 4XYLA 2PGOA 1Y7HA 3IIEA 3FF4A 3PZBA 2PV0A 2RHHA 3AILA 3ILHA 3EVDA 4I2VA 4QL3A 4NZOA 1EAMA 1NLMA 2I3GA 2O2GA 3IJ5A 1BMFD 2E4YA 3BF8A 3KVNA 3H42B 5I51A 3ACDA 3D59A 4ZCLA 1W87A 1KIMA 3ILVA 3RWMB 1I14A 3KKZA 9MHTA 1TQ6A 5J2UF 3BIXA 2CXXA 3M4NA 4J9VA 5F3RA 1CJCA 2Q2OA 3RGGA 4EHNA 5JZOA 5KYUA 4HYYA 3SEZA 2I4OA 1I24A 4XRRA 5G53C 4HVCA 4IZOA 5KNLA 3ZXYA 5DJ5A 4Y2JA 2FPUA 4YAGA 2C3MA 4KAAA 1EVJA 5DM60 5HK9A 2X0EA 2XVZA 1FRNA 3OPYA 1G21B 1NTRA 4M0CA 3H2JA 1JF8A 1NFRA 4XD7A 4C4YA 1SD5A 1N2HA 1N2CA 3IUPA 4MLDA 2HWUA 3AR8A 1DC3A 5D7NA 1RWXA 3LX5A 3TDMA 1KBZA 2II6A 3DWFA 4TMYA 4FMCF 3U1BA 3STYA 1QHEA 4ETNA 1FFBA 1VB5A 2GVDC 4QOJA 4B9EA 1Q11A 3P9CA 4D9BA 5JDIA 5CFLA 4E5YA 2IXBA 1YBFA 2PZAA 2BDUA 2HZBA 2G7ZA 2J85A 1AZWA 1ZOSA 3PV0A 1XZDA 3TRFA 5FTMA 1O97C 1P45A 2GZMA 2FVYA 4XEUA 5EWMB 3RRZA 5B6JA 2XUIA 4ZOCA 1P4SA 1VPVA 1CU1A 4YRTA 3EG9A 4FGZA 1U02A 1CUHA 4XSVA 3X1DA 1U99A 3R6DA 5D84A 3SHWA 3AUAA 4M9CA 2B1JA 2GA8A 3F9IA 1E6LA 4BXOA 4N5HX 3BL6A 2HDOA 5JYEA 2EZTA 4N8DA 1D0SA 1E3WA 2GARA 4RF4A 1CR6A 3ZV5A 4X6LA 1TM2A 4PZ9A 3CKMA 5DIFA 1YDFA 1K7YA 4LJSA 5FFNA 4OQLA 5B5SA 4AQ7A 1Z0UA 4NZ9A 4R8LA 5FEUA 3QKRB 3ECSA 4GOJA 2IPMA 2UV8A 3OEYA 2UXDB 4LVOA 3BWXA 2L42A 2O07A 3BD6A 3EIEA 4DMGA 1ZUD1 2UYYA 3HL4A 4ACBA 1NSTA 4LZPA 2B2CA 1VDMA 4AW9A 4KI0A 1NW8A 2YASA 3OEHA 4R1OA 2ZT7A 1H94A 3T34A 2F1OA 3P9XA 1YDWA 1OC4A 5ECWA 3TRJA 1ZA2A 1ZR4A 3UFBA 2H7CA 5AOBA 1SZCA 5AESA 1NJ1A 3LBNA 3R0QA 3NBFA 2IU3A 1JA0A 2CV1A 1SAYA 2E9SA 2I7CA 2VNAA 3WGJA 4JQYA 2QVZX 2VSFA 3DW3X 4DM7A 4HLUA 3NHSA 4NOKA 5C5EA 1XPOA 5B12A 1GFZA 4CF6A 1F4PA 2UUAB 4OU5A 2QP9X 1XZNA 2O9JA 3FTDA 2G67A 1KFKB 2WK1A 3TZBA 4YYEA 5LJLA 2CN1A 1J4AA 3H4MA 1ECGA 3LZCA 3MIIA 3H6HA 1RPTA 3F4LA 3FBWA 4FHGA 3LT1A 4JP1A 5DTIA 1IEVA 3A3NA 3T4UA 3UWOA 5J43A 5KU1A 3A6JA 4V0NA 3HGTA 2V4MA 1BGVA 2XRZA 1OAOA 4C7XA 3O4HA 2JZCA 5JS6A 1U2ZA 5K3EA 4JITA 4O2LA 1H2AS 1T9ZA 1HO3A 3MPUA 1Z35A 4PLFA 1X7ZA 4PFKA 1ZX1A 2P27A 4CDRA 1LDBA 4GE0A 2V3CC 1NWHA 2QP4A 4IXJA 3C43A 4MSUA 5FKJA 4OJMX 2OXRA 2OFFA 5JDIC 2YKGA 3KB8A 2OQVA 4Z0TA 1VPWA 2XR1A 3H5IA 4DIOA 1K08A 3P2KA 1PF7E 4FVTA 4E14A 2WAMA 3USES 1ZM7A 3KOWA 4I4LA 2HA3A 3KOXA 2FEXA 1A9SA 2ODPA 2ZTUA 4LY0A 4NXMB 1OV4A 2CJPA 3DPSA 2OFOA 5EWMA 3A70A 2IGTA 4I14A 3ABZA 3THSA 3DDOA 2OSBA 1K7EB 3PC7A 1ORIA 4RIHA 1OU0A 1E8DA 2BGGA 1O57A 2FR0A 5KNDD 3VDRA 1TOAA 2OCGA 1LF0A 1V3VA 2QDKA 2CVOA 3PFCA 2VBGA 5CJ2A 2RHCA 2WJ4A 3AEUB 3ZE6A 2I9KA 3GRYA 5J63A 4TVSA 5I7EA 1YRBA 5FBZA 1F8YA 2GJ4A 4GM1A 1KS2A 1L8QA 1ZDMA 4OP3A 3FVTA 5FL7D 3RR2A 2DVMA 2IP1A 4EVQA 2V7EA 4X97A 3HU1A 3R24A 4YCDA 3I6MA 2QIOA 3HFGA 4J0QA 2REBA 4FLEA 4QARA 4GQIA 4Y2YA 2BE9A 1K2VN 1UKBA 1FQOA 2VKQA 5ALXA 3VSBA 3O0TA 1QQ7A 1WPQA 5CURA 3FI0A 3QKIA 1E66A 1ZIPA 2JPDA 5EXXA 4C6HA 1RRGA 1S2DA 3MT9A 4C4PA 4EBFA 4L2IB 1HE5A 4B82A 2FEMA 2QJOA 1O7JA 5KOIA 4C0QC 4TL9A 2AMJA 4AN1A 3ELWA 1AC5A 3ID6C 1BMFA 1YR7A 4OXRA 4MRVA 3Q2KA 2PMCA 5JOQA 2CXNA 4OJKA 1UJ4A 2HQ1A 5GINE 2Y1LA 3CPEA 2C94A 3K8YA 1T1GA 5A5VA 1UPCA 4UXJA 4Q9AA 5AI9A 2AZDA 4Q3CA 4TKVB 4E33A 5C35A 1A0OA 3F7TA 4WLUA 3ZLBA 1R6UA 1O1YA 2H1CA 5HJ2A 3VR6H 4N7RA 5I01A 3H83A 3O4RA 3K1ZA 1SBQA 3P52A 2JGKA 1M34B 3ZC3A 4U9UA 3H2IA 3NVMB 2XNDA 3ZJUA 1I3KA 5EHNA 4FZRA 4MGHA 3U4GA 2QQ0A 5E6UA 3ZW9A 2WJ6A 4W1PA 5IEBA 4DANA 4CN8A 2R7NA 3L0DA 2A1TS 2PZ8A 3EXAA 4GYYA 1G9XA 1G2OA 1F4LA 1QVAA 2HIMA 3RK1A 4EG0A 5EIWA 3A9CA 1KOGA 3CEHA 4IMPA 4OB6A 1G63A 3ZOZA 2A5LA 3OJXA 4LPSA 1SQ5A 2QZ4A 2ID9A 2R5FA 2WFMA 3KTOA 4GM4A 4JBXA 4UTOA 3S28A 1ODSA 3U3DA 2BH2A 1M5TA 3DT8A 1CG6A 4Q9IA 1H4VB 5KJEA 3V2UA 4ENWA 2OBLA 5BQFA 4UC0A 4HB2A 4KJXA 4RTOA 2GHRA 1DE0A 1P9WA 5K6TA 3BX1A 1RI2A 4JCOA 2BT4A 2XODA 4R40A 3IC5A 4D74A 4JVNA 1BU5A 1JQKA 3PD0A 4MRRA 4R2JA 3DHNA 1PNRA 3MVEA 5IABA 4PC6A 4FS8A 3DTYA 3IODA 2R4QA 2O2HA 3UB3A 3H18A 2J9ZB 4IIYA 4Q0MA 4J7UA 4ZVPA 3SPXA 5AK5A 2ZWVA 5KNCA 3RLFA 2HA2A 3SNHA 1SOWA 2GKOA 1QB8A 3U3ZA 1KMHB 4B6QA 2G09A 3TB4A 5EJ8A 2NW6A 2YZKA 4Z1MD 3GLIA 6YASA 3MT7A 3WTBA 5IM5A 2AI2A 2XMGA 3PNQA 1XQ1A 3D3KA 3NPAA 4JB8A 3CVVA 4B3IA 3VQTA 5TMEA 2QT9A 3CIFA 1G6HA 5BPFA 2KSQA 4PS0A 1B23P 1ZRHA 2GWRA 3LCCA 4ZOLB 1BOFA 2QUAA 5DTJA 2WT8A 1CY6A 1MC4A 3QUQA 4MGZR 3U3JA 4ZK6A 4Z4IA 2WIFA 4C06A 3K6JA 2W7TA 4TKVA 2W6MA 1NVXQ 1ZMTA 4LZLA 2IZOA 4E2WA 1PQPA 2DFKB 3U6KA 1CF2O 2QD5A 2WSMA 4PG4A 2XTNA 5DFAA 1T2UA 5JW6A 4CUJA 1UOQA 4RPIA 2JKZA 1P6QA 2AJCA 3FHCB 1SN7A 3G0DA 5I9NA 1QAQA 4KQEA 4P38A 3REQB 3T8YA 4HAOA 4Z6KA 4MKGA 4UZSA 2J0UB 1TZKA 5HZGA 2BAGA 3L7AA 1F6DA 4RD3A 4FNGA 3QHQA 1KMIY 4RTLA 2QPAA 4PSKA 5JBNA 1LJ8A 4BNWA 5I9BA 2HIHA 1ESCA 1QHGA 3B2NA 4K6CA 4BJ3A 2JFYA 2PQ0A 2VEOA 3TIIA 1O5TA 1JIQA 2V6MA 3OUZA 5ER6A 3P45A 4L5CA 3V2HA 1LC0A 4R6WA 2B8TA 2X1MA 4B6SA 1CJVC 4UEKA 5KDOA 1NI5A 1DAOA 4INAA 4Q16A 4HLDA 3W2FA 2W5UA 5H1YA 1D2RA 3KQYA 1EESA 3L7CA 5K1ZA 3WYEA 4QOSA 3TMAA 5LP6C 3MUOA 1KI8A 4G0PA 4F5YA 2PX2A 2QD3A 4RY9A 1RKBA 4BGDA 3QVTA 3C2QA 1WZCA 2QPTA 1YULA 2QTGA 1A9YA 2P77A 3GD5A 4AP9A 4BKUA 1TO2E 1SVKA 3OQJA 3IDZA 4P22A 4QEDA 4MUBA 5FL7A 3GN2A 1SVLA 5CH3A 1ZLYA 4NCAA 3GFGA 1V3TA 3IMFA 3L18A 4MPDA 4A2QA 1YE8A 5I9SA 1WB9A 5IN4A 3F96A 5A9TA 1V0JA 1TJYA 2X9QA 3OHPA 1DBWA 5BSKA 1KMHA 2JLAA 1OWMA 2ZBRA 4LJ7A 4KSCA 3TD2A 1ZCJA 4PIVA 1E2QA 1ZKDA 5AW1A 5GTDA 4AY4A 3IOEA 5JC1A 1GV0A 1UBLS 4FEYA 5HKLA 2PGLA 5FOQA 2HY7A 5JPDA 3PSAA 5IC6A 3MS2A 3A6EA 3WO1A 1J2YA 2Q4RA 2HA4A 4B32A 1N5MA 2JGEA 1VE7A 3TI9A 2X5KO 4F6LA 1X86B 4MWZA 5BYBA 2DBRA 2ZWPA 4FKBA 3FNGA 4O63O 3R3SA 1M7GA 3I0MA 1F17A 3N0VA 1SJ9A 3ORRA 3IQDB 4UBJA 3RYCA 3GG2A 4ZAGA 2NZVG 1B0UA 2Q2QA 1Q6YA 2H2WA 1I2AA 1V5IA 1OH8A 4LQDA 1G1AA 2XLBA 5LQRA 3M49A 1S3FA 1B0AA 1JLSA 4RGBA 3ZHBA 1ECCA 3H4TA 2VXBA 3HR4A 4YRJA 5K4GA 1YFJA 1MZPA 3REQA 1CF4A 1JEEA 4Y67A 5IJ9B 1VLJA 1FDOA 4E2FA 2J0UA 1V37A 4G84A 5KNBD 2W4QA 4RY2A 2AEEA 4EGJA 2H7VA 1BZYA 2J5QA 3AHCA 1A5TA 4RZSA 4Q9DA 3KZMA 5HIMA 1ZNZA 4YLGA 1ENOA 3IKMB 1P81A 3AIMA 3TBHA 2LE0A 3KSDO 2Q1WA 2QRNA 1QOZA 2ZOSA 3UHFA 1OOEA 5L95A 4IFEA 1YFKA 1WUHS 2QL9A 4P2GA 5IKOA 3W77A 4OHMA 2PUGA 2HJHA 4HVLA 2VZLA 4B46A 4KE9A 5A3VA 5KTSA 5JJKA 1ORTA 2C2OA 4I9GA 2E5WA 2HB6A 3MTAA 4JT8A 4IIDA 1CUAA 1V43A 3H65A 3RTDA 5ALWA 1N1EA 3K30A 3CIOA 4HNSA 1PVOA 2J5BA 3AW9A 5AKLA 4H08A 1SU7A 2C8KA 4DL9A 5E8RA 4LYYA 1BH6A 2H9YA 2FFRA 3NETA 1QC5B 1NP6A 1Y3FE 4ERNA 5HJ5A 1PI3A 5L4LA 2Q1SA 2C99A 6REQB 2QTMA 4A16A 4I36A 1DCFA 4M7PA 4X8MA 2PBLA 4LMRA 1II0A 4CKWB 4RL4A 3IHLA 4YROA 5BXYA 3VGJA 4XPIB 1EWRA 1LWOA 1KP3A 2H4JA 2PR2A 2WA2A 3F3SA 3STVA 4CDMA 1T0IA 4WZBE 1IPHA 3W4JA 2IEBA 2FR8A 1OVGA 3KFXA 4RS3A 3A1CA 1DWPA 2QF7A 1YS7A 1TLFA 4Z1MA 3ORQA 2EF0A 3O9ZA 2ZUUA 1NLFA 4XJVA 5DVZA 3BXHA 5LPNA 3EZLA 5EY5B 2XUKA 4RKQA 4UTZA 2BBWA 1CY8A 2AR9A 2PL3A 1DHTA 4A4DA 3C4VA 3CE9A 4JJ7A 4EYSA 4BNYA 3HXMA 3C3BA 1XXHB 1JFTA 1GQYA 1Y7TA 3R3ZA 2A0YA 1IQ0A 2G8NA 5EXPA 5CB4A 4ZJPA 5IZCA 1U5AA 4M0LA 1O95A 3CNHA 3EGOA 4ZI7B 1XTRA 4DC1A 1ODKA 3FDZB 1RHKA 1A7KA 1SM4A 5CLFA 4GLOA 4XXHA 1QGAA 3LQKA 5LDHA 4MHOA 6LDHA 2OQIA 1QCDA 3H13A 4RO0A 5HOQA 1Y4AE 3PE3A 4A0RA 1MAUA 1V8DA 3H3XA 2G70A 2X2PA 4OQ4A 4D8VA 1ZVMA 4YUZA 5IJ9A 3HFJA 5GADl 4AIIA 1P1BA 5HTOA 2Z9DA 1XR3A 4P5PA 2H63A 1RQXA 2WOOA 2WZCA 4GO1A 1JLRA 5CIWA 1G6OA 4EHKA 1JH9A 3DDCA 5TSDA 1D8TA 4BTLA 3O47A 4B75A 3EZXA 5CITA 1X77A 2WFZA 2LDBA 4DV6B 4QUHA 2A2ZA 4TTQA 4CM8B 5HHTA 2WR8A 3BH0A 2OL4A 4ABTA 3ZX5A 1T9KA 3NTUA 1C2TA 1CZLA 2R2AA 2VPYA 3LFHA 1QFYA 3F6EX 2XTAA 5CFPA 3U3OA 5BV2P 3MS4A 1U5CA 3KE9A 3T0GA 5FLYA 2ZT8A 3ZWNA 4HQNA 4HWGA 2WMDA 1GU1A 5JCZA 2G9UA 4DT1B 5T4EA 5CPFA 5JI2E 2RMKA 3PHLA 3JATB 1E63A 1XT6A 5F2EA 3CEPB 3ELUA 4PSUA 4DBLC 2XBMA 5FUQA 3AVQA 1PFVA 2HBRA 3C3JA 4J94A 1Y5RA 1QC5A 2CB0A 3M89A 4TXNA 1W2GA 2YWFA 3SDZA 1GNSA 3DNMA 3E70C 1N0WA 2OCYC 2VF7A 3KVYA 1G5PA 4WBXC 4AUEA 4M1TA 3AF1A 4OK5A 2JD2A 2X0JA 2FSVA 2WAXA 3MD9A 4QGFA 4XPIA 3WDKA 5CB8A 1MO2A 1ETUA 1VGQA 1HOXA 2WU8A 4WKOA 3F6YA 3UW1A 1DKUA 2FCRA 4IOJA 4LJAA 3V8BA 4EPTA 1LPAB 3R77A 2W2KB 1D0VA 5DWQA 1XXLA 2VTDA 3D81A 3K9LA 1ECLA 5AK0A 3SZGA 4E5VA 1K4KA 4MVCA 3PHCA 2AC7A 5HDQA 2QTBA 5AM2A 3BWEA 1BCSA 2BONA 1NXQA 1O58A 4IJ6A 4AZ0B 1NBME 1QHNA 3NKFA 4L7QA 1NY6A 1XXHA 2ANCA 5BXQC 5CFNA 1JUDA 2FHSA 3WGZA 1A4IA 1PWHA 1EK2A 1KFBB 3AETB 3EA0A 1FDSA 2NPFA 1VJ0A 4NIMA 4CM5A 1F6WA 3H5AA 1QO0D 1D1TA 1AKQA 2FPMA 3ESBA 4NEHB 1RJFA 2PN1A 1GQSA 3FDZA 4ZI7A 2SBTA 3GPBA 5LZ7A 4F3RA 1OJLA 4ZCIA 5IHPA 1SUFA 3ESZA 3GAZA 3F46A 2J45A 1UBMS 4MUMA 3WIVA 2IH2A 1DADA 3TN7A 4MVYA 4A6EA 1P39A 2QRVB 4M9XA 3L6RA 1EFVB 4LK2A 4W9NC 4F1JA 5LQNA 2DRIA 5EQDA 1A9OA 4NE7A 1QX4A 4PHGA 1KJWA 1QNFA 5LMCA 1Z7YA 3CFFL 5CDFA 2NVOA 4EX7A 5DCYA 1G16A 2Q5OA 4L5YA 4JKIA 1T2CA 5KNBA 3NT2A 1WF3A 5BR7A 1TTQB 1KQ3A 1Z4OA 4BVEA 1CNEA 4M0MA 4CM8A 2A5DA 3TLEA 4MWGA 4O2RA 2QL6A 4ONEA 4EEZA 4I81A 2WKWA 1XPJA 1J0AA 4B0PA 4FYHA 3G0BA 3TJMA 1WKCA 2BY4A 4U2BA 1W85A 4K86A 1A76A 2YR0A 3WL4A 1NURA 2KLBA 4G56A 1VG1A 4OQZA 4PN3A 4IIXA 4QUAA 4Y6SA 3ZV6A 1DEXA 4OUDB 4KWHA 3SYTA 4LI3X 4OI1A 4DT1A 5HQJA 4C7VA 1L7NA 4OO3A 3UOGA 3K09A 2HQBA 3JATA 1DBIA 3ESDA 3LAWA 2ZVJA 1V16B 3TLZA 4GEKA 1L5ZA 2AFHB 2DWOA 2C5AA 1Q50A 2F3TA 4PYOA 4C7JA 5J4HA 3UHJA 5ITSA 4KXWA 4WV3A 1CE8B 4BLVA 4ZU6X 1MJNA 1USUA 4OSPA 3PITA 1PJSA 1WWKA 1UADA 5IFKA 1PZMA 4N0PA 5DV9A 2ZBQA 3BCHA 4KWEA 4BYMA 1XK7A 2OORC 3RS2A 5LP6F 1XQWA 2FF7A 4B2YA 5HQ3B 5GGXA 3HO1A 5IDQA 1Y63A 2GWHA 1OX4B 1WX1A 2ZR0A 3BHMA 4N6OA 1CY4A 3ONWA 3V1LA 2I33A 5L6MB 1NP7A 2W2KA 1Y33E 3WGUA 3MINA 1YKGA 2X19A 1I7QB 1DWUA 2JVJA 2L82A 3E53A 3K20A 4MRPA 1GY8A 1T9AA 2I78A 2QY9A 1KPGA 3LTNC 5C52B 3L5KA 3DLHA 1W25A 3NC4A 3GUCA 1IOVA 2ZSFA 3UMFA 3OLXA 3PICA 4AZ0A 4BZZA 3M3PA 1G60A 1UM8A 2ZRJA 3FUWA 1YBHA 4HP8A 5DT9A 1EUZA 3V7FA 2A7QA 4CF4A 1GZ4A 2PD6A 2XX3A 3BA6A 3I42A 5BY2A 4M1MA 1X42A 3LSYA 3A9RA 3AETA 3SHFA 4Y6LA 4JL6A 5FEMA 3A37A 3N1UA 2BSQA 3EAQA 4H7PA 1IXZA 1S2NA 2PCLA 5JTTA 2OV8A 4I50F 2ZANA 4DM3A 5FUYA 5IKMA 1CUIA 2OKGA 4DMHA 2BMAA 3LHDA 3CZAA 2QRVA 1EFVA 5AVJA 2ZU6A 3QY9A 4HMPA 3B7PA 2WJPA 4GOOD 2DHRA 1U3CA 1JXAA 1K9SA 2Y68A 5CHEA 1V3QE 4LSWA 1QP0A 1UBTS 4RDXA 1YSCA 4V24A 3G5TA 4UREA 3CRQA 3NPMA 1CHNA 1YK0A 4C03A 4YRRA 2RD2A 3TPZA 4M8LA 5H4HA 3L8DA 1O77A 4KYTA 1OBVA 4J6FA 2VFAA 2G08A 1RRFA 1U04A 2OHXA 3U4IA 1GG5A 4E4TA 1U8CB 1J20A 3CZ4A 3QFSA 2GAOA 2V3VA 2IEGA 3M4JA 2PLRA 1W4RA 1C1DB 3L02A 3EB9A 3GEEA 4OLHA 1OXXK 4OUDA 4EKEA 5EMKA 4CM3A 2EGUA 3LP5A 5L9AA 1JDBC 2FA9A 4PS1A 3TSOA 2LKDA 1H0HA 5JLJA 2I1QA 5D1NA 1N6RA 4EAAA 5BW6B 4BAZA 2WJYA 1V16A 2AFHA 1FQKA 2ZYAA 2Y71A 3AB8A 4WFKA 4YP9A 4MW7A 2FPKA 4DA8A 2GT1A 4UHHA 1BXZA 3KEFA 3NAZA 1ACLA 4R54A 3KLPX 1LVUA 4RYLA 5AK6A 4K6MA 2EF1A 3G59A 5I9TA 1HKHA 3NHAA 4KIFA 4LYAA 5T3YA 5BNZA 5C80A 4AY6A 5HQ3A 1FLAA 3ZBUA 1Q0SA 2X2OA 1K7FB 2BHNA 2J0VA 4LBVA 4M7RA 1KI1A 3RODA 4CL3A 1OX4A 3A6FA 1TYDE 3AKDA 2AW5A 3HR7A 1H0SA 5FNVF 4JUFA 3ZHZA 3ZK9A 2PTGA 1ZMXA 2FZVA 4C0WA 5JXIA 1HQDA 1NF3A 4FOTA 1UXKA 2VP3A 3ZHXA 3QNWA 3N0XA 1E4EB 3DV0B 3L3BA 5DK4A 2Y1WA 2VK1A 3EIXA 1FP6A 1XZMA 3EUFA 4A10A 4FUQA 1UMCB 1B15A 1G20B 1QIJA 2WWWA 3U2QA 3U3XA 1YCHA 2BR5A 2H17A 3OD1A 4QXPA 2WTXA 3IHTA 4YFYA 2PX6A 2IZ1A 2JBWA 2WFAA 3DG9A 2RB4A 1Q0HA 5HVNA 1Z8HA 3ZWCA 4DUGA 1QFJA 2ZJ8A 4KQGA 4IS2A 4CMHA 4N9WA 3GUVA 4FX5A 3I8OA 1KKUA 1N2ZA 1U8UA 3D3JA 5DWDA 4B3XA 1OIVA 4DCUA 3SF8B 4KL8S 2O5EA 1PBTA 3QA9A 3DFUA 1EP2B 2QHXA 4FFOA 4WJKB 4CT5A 5U1PA 3VYSB 2FX2A 3GDOA 1QZXA 2Y0BA 4IJ5A 2JAQA 4PEVA 1RQLA 4BS9A 2LTAA 2INGX 2ABWA 3TGLA 1AHIA 3P5BA 5FUVA 1Q15A 5FT9A 5JVDB 4I1IA 1REQA 2FB9A 3OZTA 3EODA 1O6CA 3QXSA 4GNKA 4QJ5A 4TL7A 5K51A 3TE7A 1UIRA 4GYJA 4RVHA 3IYLW 3EVAA 5KDLA 3T4EA 3W4IA 4FBGA 5TQJA 4B3BA 4Z7OB 1LKZA 1UXGA 3HVKA 3FW1A 4PSVA 2HV8A 4UHCA 1C1DA 2N1MA 4ZC1A 2C4HA 4XZ3A 2IXEA 2YNMC 1N6NA 3PS9A 3C7DB 1AJEA 1P31A 1X1QA 5F77A 1NGSA 4I46A 1OXBB 2CDBA 4CCYB 5E1OA 1QVZA 3A2NA 1MZVA 1IMJA 2FMHA 2JGIA 2Z9CA 3EMDA 1M8FA 2YY6A 3OTIA 3NG1A 3A04A 3IQXA 4YJ3B 1XMQB 4PFJA 1KZ4A 5EZYF 3RS3A 2B0CA 4KDCA 4NY1A 4OTZA 2RGUA 4QDTA 3CX8A 1NW4A 1ZUNB 4UUPA 5K45A 2JAWA 2H1FA 2QR2A 4OAOA 1QOPB 4BMVA 5KVVA 2XT9A 2FQ1A 2LP4Y 4L8VA 3SQWA 3HBNA 2DPGA 3GA0A 4IWNA 4XYEA 2CL0X 4D0RA 1OWNA 4XGIA 5LU9A 3AVTA 2C61A 2X15A 2ZRDA 1VCIA 5DYYA 5AXDA 2A9FA 4JXKA 4IEFB 5CM9C 2XYPA 3CUTA 3BJEA 3BXEA 3GCGA 4X41A 2VEDA 1E4EA 2D1RA 3DV0A 4K3UA 1XQYA 3HVJA 2PRZA 3QEOA 4CMIB 3PGLA 1UMCA 3AF4A 1V1JA 4LE2A 5CIYA 2V5UA 5GVSA 3BGWA 1TJ5A 3E18A 3T3IA 2IPAB 4KUEA 2VPPA 4AJJA 1ZA1A 4V0ME 5IAOA 2WTBA 5B2EA 3QVGB 5FI3A 2GXQA 2DWQA 2ZUCA 3HP1A 4CUZA 5LYJB 3ZD9A 2EJVA 3CCFA 1P9RA 2DR3A 3DBIA 2PXCA 2BEJA 2FCAA 4PVCA 3OQMA 4L6AA 1QCCA 4ZRMA 3SZMA 4UQPA 3T5DA 2C2HA 3SF8A 1XWIA 4RMGA 4S05A 4ER0A 3L49A 1UXHA 1XJWA 4YXWA 2P9CA 1DNPA 1TRHA 4KQXA 2QXTA 4HXYA 3RBAA 2ADOA 1T6ZA 4BIMA 2JLUA 3KXPA 4XVRA 4ENQA 4W1QA 2BIFA 4FJ1A 1YI1A 5AVSA 2W6ID 4OQDA 4QA9A 4U02A 4XD2A 5JVDA 2VJCA 4EELA 2QGFA 4FDVA 1FRVA 3KWFA 5EJGA 2ZATA 3WLLA 1S89A 4D82A 1JPUA 2X0FA 4QGSA 3T0FA 4OG2A 5FFMA 1DUSA 1AS2A 2AZTA 2MCFA 4BUZA 3WYFA 1T25A 5GOZA 2BFMA 1GGHA 3GZNB 2C03A 3SX0A 1AQNA 2HT6A 4LV5B 4DA9A 1WW8A 2ZVQX 2QX7A 3VKUA 2XMSA 4O2BF 2HIAA 3GXBA 4A0QA 4IQ0A 4CQNA 5DEIA 1W9HA 5JSHA 1YJAA 2Q5FA 4IIVA 2O3SA 4HLNA 3K8ZA 3I30X 4FONA 3FCXA 4PRZA 5AQ1A 3C8UA 2XZOA 3SFVA 3CA8A 1BXRA 4G81A 1BTOA 1ODTC 2WSYB 3R5FA 4WI1A 1R6AA 3T3PB 3B7GA 2PLAA 3OU7A 3O1HB 4X3CA 1Y9EA 2JHPA 2A4KA 4G0MA 2SCUB 2V4UA 4G1VA 4I8IA 3S5JA 4GLBA 1FPMA 1ZUNA 1Q2XA 2VRWA 3MELA 4IRUB 3W2HA 4F5EA 2IY7A 3IXMA 1OZAA 3M3HA 4HDAA 3GGCA 4K28A 5G4LA 5GJWC 3TCKA 1KEEA 3WAJA 4JUAA 5TARA 1IRIA 1E9VA 1I8TA 3H05A 4I9FA 2ZE8A 3CLHA 1Y1PA 3B78A 1ZFNA 3QOYA 1TW3A 5DI3B 5A2QA 1D4OA 4HEJA 3ROEA 2HKIA 4O3MA 4JXZA 2CJFA 4KV9A 4QHYA 2HGZA 5E4YA 1JHRA 1V96A 2WD7B 1U11A 2OBFA 1WB5A 3BDIA 4CG3A 1TUIA 2YMMA 3GDGA 5EHXA 5DBHX 1HL7A 3MTEA 4YUVA 1G5RA 4CKEB 3EFEA 3CLUC 1FSFA 3WWPA 1KY2A 4QGBA 1ADJA 2NAPA 3HVIA 3R23A 5DGCA 3VDXA 4A7PA 4DIMA 2ZE6A 2W93A 2K5UA 3H2KA 1ULZA 4NATA 3DXXA 5LYJA 1WMAA 2BI7A 1IJFA 2O2IA 4GPZA 3LQFA 1DTWA 5FWYB 5A9SB 1D2HA 1OBFO 4K5QA 3LS2A 2UYOA 4CE6A 3DKRA 2DF8A 3MCTA 4JL8A 3FTPA 1BRTA 3P0JA 3AOEA 1FMJA 4CW7A 2YYAA 3AIOA 4F8JA 3I73A 5IEJA 3T9AA 1IONA 3WGNA 5C9ZA 3G2NA 4PFQA 4ZT2A 1BQ3A 4GC5A 4QNNA 3RS7A 6GPBA 1K7SN 1QG2A 1K27A 3E8SA 3KBBA 4LRUA 4RS4A 5JZMA 4RVCA 3VPXA 2C7BA 1C7JA 2M6RA 2PFSA 2O2ZA 4P0QB 4MS4B 2P62A 4DLVA 3O74A 3PUZA 2TMYA 1ID8A 1Q74A 5IARA 5EIEA 2KE5A 4G0NA 3J81A 4BOYA 1SPBS 4MUYA 4H7KA 1JAIA 3AYZB 2Q45A 2ST1A 4OHXA 4JOSA 5CEFA 3E0XA 1SD2A 4D44A 1SZDA 3ORYA 3QVLA 4PO1A 1FIUA 3GZNA 4KZPA 4TYWA 4AUNA 5KDDA 4DDKA 1EWKA 5ALEA 5CB6A 3REGA 4ZHQF 1W0JD 2R66A 4KOAA 4O4HF 2XAAA 1ZQ9A 3EVFA 3P0EA 4ZV4A 4EUFA 1A69A 3B9RA 4X44A 2HK7A 5EVCA 1AF4A 1P1HA 2BSXA 2YXNA 5T67A 3AC0A 5TC4A 3NQ41 2BF4A 2PO7A 3AFIA 3M4XA 4C0KA 1J2UA 2OD9A 3LKBA 4ZCMA 4QYWA 4RTPA 3WRXC 3QYPA 4WXMA 2SCUA 1DQRA 3P5SA 3KKMA 4YI3A 3PQDA 2WNIA 5FBLB 3DM5A 3TIXB 1E1CB 1OXMA 3TBKA 2LGJA 1I13A 3E1KA 3U16A 3RJ5A 3DF7A 3C7TA 3A3PA 4UU8A 2CW5A 1Y42X 2AA3A 3FYTA 3HACA 1SO8A 3RYHB 1C2YA 1KJIA 4UBLA 4DR1B 2RHOA 3GROA 5DI3A 4Q47A 3T5CA 1EQ2A 3X1KA 1VGVA 4D8WA 2YCLA 1AGXA 2WD7A 4N7BA 5HP4A 4M46A 2E37A 5JDCC 5HZKA 1ZC4A 4ZMBA 1ABEA 4OF4A 5IU6A 2ZZKA 1R0YA 4X84A 3E03A 3Q3IA 4CI9A 1E3IA 1OX5A 1QQAA 1XYGA 1EZ1A 2BLLA 1C8BA 1AZLA 4RF5A 4QYMA 1NQAO 4HS4A 5LQMA 2W9XA 4EECA 1PR2A 4KYVA 2GZ2A 1LBQA 4DLZA 2YJ5A 5C7OO 4PC7A 3LY5A 5FWYA 5A9SA 1OZFA 1U1EA 3E27A 3E3AA 2ODAA 2NGRA 2GM5A 1BNCA 2W00A 3DYIA 2P9FA 4BQNA 3K70D 1W30A 1Z4QA 2Q99A 3N76A 4NE2A 5HE9A 5IF3A 3MTDA 1NW5A 3PQ5A 3QE9Y 2OV1A 5FQNA 2ROQA 3ZHQA 1JI0A 3HEAA 5TXGA 2DPMA 3AOGA 1B8PA 1NR1A 4Y2PA 4D9KA 4ESEA 1ZOIA 3VRHA 4C87A 2QQ5A 2GR9A 2JGJA 2X7HA 1D2NA 3OIUA 2H8GA 4M6WB 1HDIA 4WCVA 5E1MA 4ZO8A 3STXA 3U7QB 3ZVRA 1ZD2P 3ND7A 2GO1A 2IIQA 5HDBB 4MS4A 5JRZA 1P1FA 5CLJA 1Q1GA 1ZXXA 2W6IA 1EM6A 1NVEA 1Y34E 4NDZA 2AQ8A 2PZEA 2FEWB 2WG0A 4EL0A 4JZYA 2B8WA 1XQ6A 4R2IA 3W2EA 3ZW8A 1GCAA 3FCCA 3SKYA 3K1JA 1DRWA 5DNEA 4U2KA 5E7QA 5A1JA 3W04A 1J5PA 2EFYA 4RD2A 2D13A 5KOYA 1KPIA 4K6HA 1A04A 3ER9A 4C43A 4B74A 1WTCA 2ZI6A 5J5VA 2AZ4A 2H07A 3DE3X 1KYTA 2A9PA 4PWZA 4DV1B 1MHPA 3U48A 2C7GA 2PGAA 4LYDA 1X7DA 3WJ1A 3FPHA 4DEXA 2H1VA 4RADA 4JLAA 5HJ7A 1OXKB 3DMGA 4S24A 3UH1A 1ESNA 1FUKA 1E1CA 5K0CA 1GGJA 1UH5A 2OPHA 3RS8A 3W1VA 4C0HA 4EGSA 2PSEA 5ITWA 1JJ7A 1I3LA 1VZ2A 2GFHA 2XUDA 3F7OA 1CVRA 2ZDGA 5CDTA 1Y1TA 3SY8A 2XKJE 1L5LA 1EXDA 4BEJA 5FUWA 2LCFA 3RYHA 4WXYB 5DT2A 3VSEA 1X6VA 2C88A 4HSGA 2YV2A 4LVCA 3WZMA 1RYHA 3QNUA 1ODCA 3QVXA 1ENYA 1T9BA 1JRLA 2P2YA 3DDSA 3NRCA 5EP1A 1JG1A 4RH3A 1H0KA 1JSXA 1WB4A 3ZGZA 4EIWA 4QZVA 4A1OA 4RU1A 4N6GA 3FSGA 1J1IA 3F7MA 1T24A 2C20A 2ZBGA 3C5EA 4BQOA 3EIOA 2XB4A 5LVAA 2Q8PA 2AF4C 2QZJA 2ZULA 1SQSA 4KK4A 2ZGVA 4Q12A 1KYIA 4FOPA 4Q39A 5GJVC 2ZJ3A 3JZAA 4GQAA 3C6QA 3V1TC 3HRIA 4TZ0A 2EU8A 4BX0A 1NNLA 4B71A 3DBOB 2Z04A 1UJ5A 2AEJA 2NZWA 4KOEC 1X38A 2GF9A 2H1WA 1MLDA 1DIGA 2PUWA 3RLIA 4Q9NA 1IBKB 2AEFA 4ZD6A 5TEWA 3UGJA 2XZDA 1TMKA 3RB8A 1J07A 2X40A 3KO8A 4ZZ1A 2O8DB 5K3SA 3KJHA 1HG1A 2G25A 3OCUA 4U9HS 5CG2A 1KK0A 1Z07A 3U7QA 1ZD3A 3GGOA 3PP8A 1JEOA 3PFIA 2G1KA 3Q3EA 5K4AA 5KVQA 1JL3A 1PDVA 3ROGA 4LF4B 1NX9A 2V97A 1ZGCA 3IIMA 3Q72A 1NVVQ 3TCXB 3VPSA 2G16A 2V7UA 3CH6A 2QNBA 3ILSA 3L7DA 2X3YA 4RD6A 1C7FA 2EJUA 4EOGA 3P2MA 1CIVA 4HRVA 3VOAA 3KHTA 4UVGA 4OV6B 4OHYA 4HH4A 1Q0ZA 4OIMA 3CJQA 3GL9A 3EPKA 8AT1A 5JS8A 2CMFA 1GU7A 1T8SA 1N5DA 2LPMA 1NSYA 2Q3CA 3FZNA 4LXHA 1RCFA 3WGVA 1GZ5A 3PTZA 4OBWA 2BHLA 3LG2A 3WSVA 4JXXA 5ALQA 1QYIA 3PPVA 4OMDA 1FJ2A 4RKRA 5E0OA 5EI5A 1PQWA 5KREA 3NYRA 3HA5A 1J90A 2RK6A 4LKOA 2Q5JA 3RIGA 2JLRA 4DQVA 1T9HA 4O4IB 2FPPB 3DAGA 1YU9A 4YR9A 2O2EA 4ACAA 4HN9A 1WV1A 4EATA 1AHPA 5K09A 1GTJ1 5EJFA 3KIPA 4DTCA 2GEBA 2G72A 1M2JA 3OZIA 4FTWA 3TIVA