3IMGA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.8 ang resolution in a ternary complex with fragment compounds 5-methoxyindole and 1-benzofuran-2-carboxylic acid
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
288
structure length
288
Chain Sequence
IPAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFGAGGDLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGPMPLNGSGRLLVAARLGTTRLLDNIAIEIGTF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligase
molecule keywords Pantothenate synthetase
publication title Application of fragment growing and fragment linking to the discovery of inhibitors of Mycobacterium tuberculosis pantothenate synthetase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
total genus 95
structure length 288
sequence length 288
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3imgA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3imgA01
4DDMA 2NSYA 1N2JA 3H05A 3COVA 1N2OA 5FO0A 3VRHA 4I6GA 5HUJA 3SEZA 1WKBA 4MUFA 1JECA 1Q77A 4R2LA 1PG0A 1NSYA 3DLAA 4YP6A 4ARCA 1ZH6A 4I6JA 1QU3A 1JZQA 2Z3VA 2RE8A 2X1MA 2E18A 1XNHA 2R5WA 2ZUFA 1F7UA 1IVSA 3UOWA 4YMIA 1F4LA 3UY4A 2QTRA 1T6YA 2QUIA 1D2RA 1WXHA 3CLSC 4XSVA 4CDMA 1NUTA 5LLTA 2PZBA 4R2MA 1Y42X 1KQNA 4KR7A 3SYTA 4JXXA 2EL7A 4E1AA 3RJZA 1XJQA 1A8HA 5K0SA 4JYZA 1LI5A 5KCMA 1H3FA 4RUKA 1GN8A 1NUUA 4NZPA 3VU8A 4K03A 1QRTA 3OTWA 3G6KA 3H9CA 1YIAA 4DJAA 4MW7A 1O94C 1OWPA 3IVCA 1QNFA 2A86A 1O0CA 1O5TA 3SZGA 3ZJVA 3L92A 3IVXA 3UC5A 2CT8A 3QTTA 4YP7A 3NV7A 4K0RA 4PBTA 3CLRC 3S3TA 2HZ7A 3NBKA 1PFVA 2A1TR 4EG1A 1U3DA 2PG3A 1VL2A 4CT0A 3D6VA 1TEZA 3PNBA 1H1TA 2O5RA 2Z08A 5AHWA 4A91A 5JBNA 3RK0A 1G8GA 4BWVA 1QU2A 2IJGX 4AQ7A 4MVYA 3IMGA 1N75A 3M5WA 1QJCA 3G59A 1MB9A 4HJRA 3UK2A 1EFPA 1Q11A 3FWKA 1OWMA 1O0BA 2OQ2A 3TNJA 4Q16A 3Q12A 3GLVA 3N9IA 5LM3A 3IUEA 4MUEA 4H3SA 2DETA 1EUQA 2YY5A 1KP3A 2A1TS 1YUNA 5TEWA 3H99A 5TEVA 2VTBA 2PFSA 2V0CA 1KR2A 2QJFA 3KT6A 1B6TA 2J09A 1NYLA 2QTNA 4MW4A 5IHXA 2JANA 1O96A 4UZEA 4MW5A 3X1KA 2J07A 3ZXSA 1WJGA 3ND7A 1H3NA 2QJOA 3FG9A 3MLBA 1PFUA 1J20A 1FYDA 4OUDA 1WQ4A 3IDFA 2A7XA 3TQIA 3L93A 2RD2A 1GTSA 3ILVA 5TGTA 2CV1A 4EG3A 1TYAE 4ZT2A 4U63A 1IQUA 3U1VA 1EFPB 4KR6A 1I6LA 1IFXA 3A4IA 4MWEA 2V0GA 2IP1A 3I05A 1GTRA 4MLPA 5KHAA 3KT0A 1I2DA 3COWA 1KKUA 2WSIA 3FHJA 1YULA 4MVWA 1IQ0A 3ZJTA 4EGAA 3CLRD 5LFAA 3COYA 1NUSA 2PXHA 4HK4A 2VTBB 5HUHA 4P2BA 4I6EA 4QREA 4ZT3A 1O96B 1NURA 1WXFA 1M8FA 5BNZA 2PIDA 2J4DA 4NAUA 3IOBA 4JXZA 3IOCA 1DNPA 1YUMA 4EFKA 1N2IA 3CLTC 1MJHA 3FNRA 1G8FA 2Z09A 4HPWA 3IOEA 1H3EA 1IHOA 4KPUA 4MW9A 3CVYA 3INNA 2H2AA 1TFUA 4ZT6A 4EG6A 3CVVA 3A04A 2D54A 3D6UA 4MW1A 1JGTA 4YBRA 1QRSA 1NUPA 1V47A 2CV0A 1MAUA 4PBSA 1TYBE 3CVUA 1OBCA 2PZ8A 1LW7A 1U7DA 3KT8A 2HGZA 5DEOA 3K9WA 1KORA 1ZUNA 3N2YA 1T6ZA 2I1LA 3P0HA 1HYBA 1MOPA 3PXUA 1BS2A 3COZA 3H97A 4MUIA 4XFJA 3ZIUA 1F9AA 1OBHA 2OV4A 3IUBA 4MUGA 4ND7A 2CV2A 2A4MA 4ZCRA 1N2EA 1PG2A 1ULHA 1QRUA 3AIIA 3SP1A 3DPIA 2AZXA 4KPUB 3ISJA 4QBTA 1K92A 1PFWA 3LOQA 2E0IA 3Q10A 3P0JA 3IODA 4FZJA 3FDXA 4L2IA 2DERA 1ILEA 4XFDA 1WXGA 4MWCA 2E21A 3CA8A 1CT9A 2ZP1A 1SURA 4YP5A 1OWLA 4EG5A 1EFVA 1G8HA 2QUHA 2NZ2A 4EG7A 1F7VA 1WZ2A 3CLTD 1O97D 2A84A 1I6MA 2QUKA 1MAWA 2E89A 2VXOA 3UMVA 1N3LA 4KR9A 1K4MA 2XRZA 1ZJWA 2DEUA 1UFVA 4EG4A 1ZH0A 1MRZA 1O6BA 3JXEA 5FNZA 5TS2A 3FY4A 4F3RA 4U7JA 5DB4A 4CDNA 1YIDA 3MUEA 3PNYA 2JA2A 1PFYA 4ZT5A 3ND5A 4L2IB 1KP2A 2WB2A 1WXEA 2X0KA 3ELBA 1J21A 3N8HA 5J59A 3P0IA 1MB2A 3MXTA 1I6KA 3ZXIA 1EFVB 1KH1A 5HG0A 3TZLA 1LI7A 4CQNA 1N78A 3RFFA 3VGJA 4JFAA 1K97A 4NX2A 3HFJA 2D13A 1IQRA 4MW6A 5DASA 1FFYA 1R6TA 1J1ZA 2O8VA 2ZUEA 4MUHA 2WQ7A 1S4MA 1VBKA 1J09A 3CLUD 3CVWA 3KFLA 4ZT4A 3LE8A 1WOYA 2AG6A 4OJMX 3ND6A 1M8GA 3AG5A 4ZCTA 1RQGA 1N2BA 4MULA 3HMQA 2G36A 4MWBA 5DK4A 3X1JA 3FOCA 3H9BA 1KAQA 4OUDB 1TYCA 1YI8A 1IRXA 4MW2A 1O97C 4DDKA 1T9GR 1NP7A 1O95C 3NBAA 4EG8A 2J08A 1U0BB 3X1MA 1N1DA 1OWNA 3TZEA 1WXIA 1KQOA 2DPLA 1JEEA 2QTMA 2TS1A 4RPIA 4X0EA 2BYTA 4PY2A 1JIIA 4DLPA 4QRDA 2XRYA 4MUJA 2DUMA 5KWVA 1NUQA 3AFHA 1GAXA 4ZCQA 1M1ZA 3FIUA 2GM3A 3ZGZA 1VBMA 1MBZA 2QUJA 1N2GA 4MAFA 1K4KA 3SDBA 2B7LA 1T9GS 4ZT7A 3FI0A 4WSOA 3IH5A 2YXNA 3KT3A 3HV0A 1N2HA 3HZRA 3PRHA 2X3FA 2C5SA 1KH2A 2CFOA 1GLNA 1IH8A 4NATA 4KKVA 3P52A 4DDHA 2HMAA 3A2KA 3DV2A 3E27A 4G6ZA 1X8XA 2QJTA 2IELA 4MUNA 2BTEA 3A05A 3SEQA 4GRIA 3GUZA 4S1OA 4G5FA 1NZJA 4JZYA 3Q4GA 3CLUC 3ZJUA 3AKZA 4ZCPA 1JILA 2DR2A 4G5YA 3IMEA 2D5BA 2GKSA 3RK1A 3G5AA 4UZFA 3HL4A 3FETA 3BL5A 5K0TA 2EJCA 1JIKA 4R0NA 2A88A 3RBAA 1P7PA 1JEDA 4MVCA 1JHDA 1MC1A 4MW0A 4ARIA 3MLAA 4U8HA 1WY5A 1GZUA 4MVXA 4Q93A 4NDAA 3IMCA 1QQTA 2YWBA 1OD6A 3CVXA 1O95D 4HJXA 5J5AA 3QE4A 5IJXA 3GMIA 3CR8A 4ND6A 4DNXA 1V8FA 3QTBA 1U7XA 2GOYA 4F4HA 2DXIA 3DO8A 4J75A 2DLCX 4DE5A 2WQ6A 1OWOA 1GPMA 1KAMA 2A1UA 2AKEA 1WQ3A 1JMVA 1M8JA 1M8KA 4WNYA 1JZSA 1JIJA 5H16A 1EE1A 1EXDA 3PNVA 1EJ2A 2CYAA 4MQ6A 2CUZA 2H29A 1COZA 3N05A 1EUYA 4EF6A 3AG6A 3LCJA 3OP1A 5EKDA 1Q15A 4AS1A 2CYBA 4NAHA 3TQOA 1VLHA 3CLSD 1NI5A 3FH0A 1N77A 2PZAA 1M8PA 4PBRA 1XNGA 3ZUGA 3RHSA 5J58A 1TQ8A 2JAXA 3MMXA 5FO1A 1QTQA 1R6UA 1R6XA 3F3MA 1X6VA 4MWDA 3IVGA 2YWCA 1Q19A 5F23A 3TS1A 3SZ3A 1KQPA 1J70A 2J5BA 3HGMA 1J1UA 1VBNA 2X1LA 1U3CA 3C8ZA 1XNJA 4MUKA 1M83A 1KH3A 2CYCA 5H7XA 2A1UB 4GU5A 1G59A 1TYDE 4TS1A 1O94D 3K32A 3AL0C 4ZCSA 2CSXA 1T6XA 4J76A
chains in the Genus database with same CATH superfamily
5A4MS 1K5PA 2A59A 4AMVA 3BGWA 1D2AA 4TTAA 3AP1A 4LG1A 2E4AA 3ZCTA 4A1OA 3FDIA 3RWMB 1YMVA 2Y8EA 3SEAA 4URUR 3WMWA 3TRIA 5ALQA 4NU5A 1XIVA 1VFNA 2OWEA 4E5KA 4B82A 2GZ1A 2I9PA 2ZBPA 3W78A 2BGWA 2C8LA 3C70A 5HHTA 4B4WA 1I2ZA 2OG2A 1QGOA 1QKIA 2AQHA 2H9AA 3G13A 4I14A 4R6XA 2AOTB 5G4KB 1DELA 2Y66A 1ZAYA 4AIIA 1RYZA 5TIIA 1VHTA 5A2GA 2BFBB 1ZI8A 5IUNC 3JYPA 2RBGA 4WK6A 2EW1A 4S3MA 2J32A 3T1YB 3GPBA 1UM9A 3VDXA 1Y9EA 1WD5A 1J90A 1NBOA 2GZSA 2QV0A 3LYLA 4ZHSA 2C1XA 3MJ4A 1SGWA 2XUKA 3OJCA 1ICEA 2ZIAA 3NBZC 1DX6A 1PZGA 2QN1A 1GWNA 2IECA 4U2DA 5F77A 1II9A 3TZQA 3GC6A 1WMEA 5GWXA 3TRHA 1HKUA 4KBGA 2IV7A 3ILSA 5H4HA 1OYYA 3RC9A 4EJ0A 1DG3A 4IQ8A 5CT8A 3LBFA 4YJFB 1JDNA 1KYIA 5B37A 4ZQBA 3D64A 2X7JA 3IXMA 1CQWA 5C1PA 3K0SA 2ODQA 4K46A 1Q0QA 4LYAA 4PO8A 1NUAA 2NX2A 4XB6B 1YTLA 3TLEA 1PAUA 3N87A 3UAZA 4B6FA 4E2YA 3AVOA 1EP1B 4KFTA 3TPCA 5J47A 4ESVA 1RI5A 1QHEA 2EGUA 2IYAA 4NBKA 4E4RA 5IHPA 2I29A 1QC5B 5FTWA 1I3LA 4TGLA 4HV4A 3C5WP 2PBZA 2PJZA 3NKVA 3R8XA 3BA6A 3U44B 1TVCA 4CGYA 2YN2A 4I1SA 3REOA 1QFSA 2XH8A 1CETA 1IZ0A 1AUPA 1D0VA 2OBLA 3GJ3A 4LZPA 2ZSHA 3NZEA 1QAQA 2IKSA 4NPAA 3PUIA 3LYAA 2HTFA 4PIPA 4ASUA 4EY5A 3GFPA 5CHEA 5EVCA 5KPJA 3H9CA 1YIAA 2C00A 3UJPA 3V4VB 1RBYA 3ZVLA 10MHA 1GG5A 1MNAA 4CF6A 2FN9A 4RQTA 3S2UA 3GGOA 4RM2A 4E31A 4XX0B 3LQ2A 4QC2A 4QGSA 3QF4B 4XGQA 2EBUA 5HIJA 2EKZA 1K98A 2CT8A 2PKEA 4AP6A 4CMEC 3PDIA 4P81A 4KG7A 3A6LA 2DHQA 2OSBA 1TW2A 2JL1A 4PBTA 1YZNA 4QKQA 1US8B 2KBFA 1QHNA 4UM9D 4ZV9A 4YRKA 4EMTA 2H11A 2FK8A 4OEHA 3RS7A 2I2XB 1H2FA 4TLDA 1DC6A 1ZHHA 2X2FA 3QE2A 3FBTA 1ULZA 4RHEA 2XODA 1L0BA 4MWGA 1NX9A 4GHWA 3HRHA 3GJ7A 3X0DA 1CEQA 3A9CA 2HADA 2COUA 2HO5A 2AHOA 3L0IB 2X5KO 2OR3A 4A2WA 3GU3A 4FQ5A 1ONPA 4EUSA 1NLUA 2GZDA 2RGCA 5KMGA 4RA9A 3CEPB 2WINI 3BL6A 3QFRA 4TRNA 1R4AA 4RMNA 4KH0A 4Z86A 4ID3A 3ER9A 3TNJA 1NG1A 1CUVA 5FFFA 2WU0A 3DMHA 4I9FA 3FDJA 3Q85A 4Q1CA 2XCOA 3C6YA 3M83A 1DAMA 1ZW1A 3O82A 5JD5A 2F62A 1P5ZB 1VG1A 1F48A 1N5MA 1RKQA 2B35A 4YAKA 1BOFA 3CUYA 16PKA 1Q0LA 3K9BA 3IQWA 4PQRA 3ZY3A 4P2GA 3QV2A 1Z74A 3KT6A 3W79A 3G2NA 1U2EA 2G25A 2GTHA 3K7EA 1OX6A 4FB5A 2P91A 2IDJA 1Z45A 2X0IA 2X0JA 5HOEA 3AHDA 4UBKA 3ZVNA 1QAOA 3T1TA 2BIFA 1QGDA 3FG9A 5J2UA 5I5EA 4KDEA 5ALEA 3K15A 4ZVMA 1KERA 2BSXA 4DMHA 1K27A 4BFYA 4PQYA 4M8SA 3OAAD 1MA0A 1EDDA 2HQ1A 3KB6A 1JKFA 5CNIA 5JARA 2J3DA 3LO5A 5FPTA 4U3JA 1UC4B 5LDHA 1K7FB 4BB9A 1N5IA 1AOXA 1LWOA 2QNRA 3WL6A 2ZDHA 4JA2A 1FNSA 4HXGA 2BP7B 3JQ6A 4AXXA 3SICE 3FVTA 3HU5A 1WV1A 4MWEA 2V0GA 2IP1A 3BWYA 4FC6A 2G9VA 5GAJA 1RXSA 4QFBA 4RL4A 1MW9X 1XD2A 2H4HA 3EVBA 3EXG1 1F1BA 1ZA1A 3WMXA 1VECA 3GEIA 4DA4A 4HAYA 2PXHA 4A16A 1PYOA 2Q1XA 1J7KA 2KMLA 1Y5LA 3FFAA 3JAMA 3LXMA 3FMVA 4JLJA 1A77A 1YJCA 2WWGA 1MX3A 3GY0A 3O73A 1NURA 1G8PA 1P2VA 1ZVKA 5JLJA 2ZUVA 1M8FA 1G41A 3L0DA 4JI5B 4RH3A 1PQ4A 4P7KA 1IBKB 3BUSA 2OAQ1 1BE0A 1JMKC 1V5EA 1N3IA 2D59A 5AJXA 1M5UA 2R66A 1HE2A 1KNQA 2HU7A 4FLEA 2ISSD 5AKEA 1M0SA 2G80A 2J9FA 1FFBA 2YN4A 4NOLA 2PZEA 1EM8A 3NM5A 3PD7A 2V7QD 5EWJB 1G9XA 2PGIA 2OY0A 3HVKA 1UBTS 3O31A 3NIBA 3B9RA 3AZQA 1FUEA 2Q28A 5KI6A 3IHLA 5ANRB 4MO2A 2NXCA 2PPLA 3B12A 4YEDA 3VC1A 1KOJA 3MLEA 1G16A 4BTEA 3LM8A 2GPJA 4ZVSA 3M6WA 1EA5A 2ASVA 1FLVA 3I2HA 4RVGA 1ZL0A 2FXIA 3RT1A 1B2LA 2R2AA 4D80A 4N65A 1FNDA 1JGTA 2GA9A 1KJWA 1H5QA 2F1IA 5JYDA 2EJUA 1XL1A 5JHGB 3AUFA 3GFBA 4DRZA 1GGJA 1PBNA 4ZQGA 2TRSB 2MTBA 4GT1A 2QRKA 4ZOLB 3ASUA 5EHGA 4RD3A 4RTPA 5EE9A 1W47A 1Q1BA 5CLGA 3LU1A 1JH9A 1PSWA 4JHLA 5HIAA 1Y1TA 1SO8A 3VSCA 4HR7A 4BC0A 1ZUNA 4O6VA 3RYHA 4YCNA 4PLFA 2VPQA 1CTQA 3W5SA 3HXQA 5A6VA 3TDNA 5KTKA 1Q0UA 4CZ2A 1J8DA 1USUA 3M6AA 1SXIA 1XZEA 1BCSB 4DYVA 2HDNB 2YIDA 3BHMA 4DPKA 3USZA 3T3PB 1CEXA 3PT5A 4G01B 3GZTB 1UT6A 1U0RA 1HL3A 4FDMA 1N2EA 1PG2A 1ULHA 4FHGA 3MFQA 3QXCA 4I4IA 3ZWXA 3KQVA 3SP1A 1CFZA 1J9GA 4QBTA 1ZCJA 5TPZD 4CQLB 2IRWA 3WL3A 3DYVA 5TF4A 1L3BA 5JQGB 2D2EA 1QIJA 2GKGA 4RMHA 4M55A 1REQA 3PYXA 2VDVE 1XE3A 1MV5A 3V8PA 3WLKX 4X5OA 1KKLA 1QH8B 1K88A 2XUQA 1SUPA 3ZY2A 1BQ3A 4BB6A 4CLDA 2D1YA 3AM3A 4F72A 3DL7A 5AUQA 5DM4A 4DNPA 4EG5A 2IXEA 3ZDQA 2VC2B 3G7NA 4K9OA 4ZV7A 5JE8A 3H0CA 5H3CA 3GCDA 1I36A 4IM7A 4OLHA 5CK4A 4W5QA 2VP5A 4JELA 1RPNA 1ZGCA 1PVVA 5BNWA 1OZGA 3O92A 2C04A 4ZQHA 2WZQA 1NI4B 2OB2A 4RXMA 3U3KA 4QOGA 1E2DA 5IABA 1AGPA 2LD4A 2VXOA 3G1UA 2IZOA 4ND2A 5EJ2A 3N5KA 2AC4A 3RUFA 4HVCA 3NTOA 4EG4A 5K05A 2HMWA 4OK6A 1P80A 4F2HA 4I50A 2VP6A 5FNZA 4F21A 3L04A 4U7JA 4UDXX 2H59A 5AJVB 1GAWA 3PNMA 1XZAA 2PD6A 4Y2HA 1F0YA 1TVEA 2ODTX 3KKPA 4K6KA 4KAJA 1YJ5A 5HMLA 4C05A 4CLXA 3GWGA 4NDNE 5FFMA 3QVVA 1E61A 4PLGA 5JATA 1DLIA 1F5SA 1LDMA 3Q8KA 2BI4A 2LPMA 4HTFA 3EIXA 4H7PA 4RY9A 5TQ0B 2GR9A 2VN8A 3LQ1A 1RXIA 1C7JA 1RJEA 5THXA 1DQZA 4MUAA 5IJ9A 1Z18A 3A3OA 2Z1MA 3C3MA 3GJYA 4KLAA 3TMKA 5C8YB 4IIFA 4EELA 4M98A 1M5RA 3F2IA 3HUTA 3UB3A 3ZXIA 1Y4DE 1D2GA 1XBTA 4ZU1X 4ZV4A 3QXXA 1JDPA 1U02A 2UVDA 3GLGA 1NVKA 4O2AA 4POAA 4EFNA 3VGJA 5CAEA 2I2BA 3T5DA 5FOUA 3Q3JB 4QQFA 4EQZA 1GSIA 1IQRA 5EMJA 4Y2PA 4Q00A 1VM6A 4KYVA 2HLDD 4N82A 3TQHA 2XWJI 1KDTA 3CLUD 3OU6A 1N9GB 2AW5A 2OCBA 3LE8A 1H85A 2C9DA 4I5DA 1M8GA 2C88A 4FE7A 4IKOA 4RMIA 3IUPA 1MHTA 2D0IA 4FFLA 2UXDB 3MB8A 4ND4A 1RQGA 1U7OA 3KBOA 2ZETA 2ZUSA 1NP6A 3LSTA 1E5TA 3M4XA 1KPGA 4HQRA 5L3RA 3PIIA 3ZDAA 1QX3A 2XKBA 4IY1A 4YJHA 4DJDC 5A6SB 5KQSA 4JXXA 2NU9B 3BGVA 3EUEA 2VYVD 1ZK0A 1UDRA 2AC7A 1W1WA 4FOLA 4EA7A 3S55A 3O9ZA 3VZSA 1IXSB 3AP3A 1JEQA 4TV9F 4RHFA 1JV2B 4FGLA 3VJLA 1HQKA 4LV6A 2PX0A 4A3SA 3CKKA 3SDSA 3WLAA 4ZYWA 5JJ5A 4DABA 2G5ZA 3I39X 3WVNA 2NYAA 4RZQA 3HDGA 2VRBA 3FFWA 5C3UA 3RSOA 4MYDA 3EQ6A 4OHUA 4CU2A 5JXIA 5KYTA 4DLUA 2BY4A 5AHOA 2Q3MA 5JCPA 3D3EA 1AC5A 2YV2A 5EZ5A 3UXEA 3KSAC 1NJ6A 1GAXA 1ACMA 1O8CA 2GGSA 1I2AA 2IC5A 1SCIA 2OK8A 3NTVA 3I2GA 2I80A 2QI9C 2GM3A 4FOTA 1YJQA 1ESCA 1BSVA 1Q2UA 3IGFA 1QFXA 2Q0XA 3NVDA 1A2BA 4K40A 4L5CA 4HFJA 5AKIA 5BSVA 1K4KA 4RHYA 2YVAA 5JEDA 3PYLA 2MSWA 5LP6F 4Z4GA 1WNTA 3MWLA 2JH8A 1Q17A 2JCBA 1FBTA 4YRBA 3ZBUA 1WW3A 3VTFA 3IH5A 3KT3A 3FCCA 4IJWA 4JL5A 2CFRA 2J9XB 4OQFA 4X6UA 3OE7D 1VIAA 2LNDA 5E6RA 2FR1A 2YOGA 4F7WA 1XMQB 4L16A 5BV1A 4E5VA 1AQYA 1K6JA 4PQFA 1BWPA 1HA3A 4G2TA 2IZZA 1PUXA 2ZJ2A 1GFIA 2Q5JA 1DB3A 4UKDA 1E89A 4WZAE 4G6ZA 5CEEA 1TUEA 2R48A 4W9MC 2JLYA 4BVEA 5A9SA 2X5JO 5AM5A 1NXTA 4FYYA 4MPTA 1PU2A 4H4CA 3BTVA 4DMUB 4W9NA 4ZZ3A 4Z1MD 2RK4A 5B64A 1E7SA 1FSGA 1NN3A 3MJHA 4B84A 4EGQA 3ILYA 1B8UA 4WH0A 2FG6C 1XHFA 2YXDA 4BWYA 3TVYA 1E98A 1Z5VA 2C57A 3NETA 3QH4A 4JI6B 2DWQA 2GKSA 4CLOA 1A1SA 1M3SA 4AJPA 4Q37A 3EUFA 3UO8B 4YT2A 4Z4CA 3UATA 5T4FA 2HPZA 4N48A 2W8BA 4P4SB 1GPDG 4E03A 2VUUA 3VKVA 4BXOA 3NUGA 2JIQA 4G8DA 2QN2A 1XVTA 2ZAIA 1Z88A 2AIRA 4OJYA 2QSUA 2JIOA 3F6EX 4FSDA 1HI9A 1V26A 2DPXA 2FZEA 4NZOA 1SIOA 4QWMA 2HK8A 2XHZA 4DDVA 4S0ZA 3IMCA 2G67A 3KJXA 5AUNB 5C35A 5ETJA 4MVJM 2E87A 1U2QA 3I9OA 1E1MA 5LZ8A 4TWJA 3CRVA 1ELOA 1JHOA 1E0SA 4M6WB 3SI7A 1DAPA 1PG5A 1FNMA 3ONEA 2XUDA 3CZ5A 3AR3A 4N5LA 3WMFA 3L7CA 4PHCA 3UWPA 3V2UA 4HGRA 5DWQA 2AKEA 1QRRA 4EB8A 2C99A 1U5BB 4MV6A 3TRKA 1NV9A 5FP0A 3RWOA 4L08A 5EHZA 2CHGA 2QL9A 2OLJA 2X13A 2OBNA 5BW6B 2J3HA 2AN4A 2VP0A 4US2R 2FOIA 1IEXA 3N2KB 3VTKA 4XDGA 2QX4A 1F06A 4PR0A 3R09A 5CVEA 2HREA 3RB8A 8ABPA 4YLGA 3ICPA 5FNVA 1E6WA 2AK2A 3TL2A 1N0IA 3NWEA 4FCTA 1J9ZA 1YQUA 2Y9MB 3JRNA 2PZAA 4Q5IA 4TKUA 5K1ZA 4BNDA 4EB3A 3KOOA 3EGDA 3EGCA 2X8AA 2OG1A 2DF8A 3UMYA 1EESA 4DKXA 1PJBA 2W22A 1JB1A 2JJYA 2XTNA 4QGFA 4UVGA 1THZA 2BI7A 4G89A 1EQAA 1NONA 1XTRA 4EECA 3ZJ5A 3WGVA 1YR3A 3AF6A 3U49A 1D2EA 4YJ2F 1F8XA 1WVMA 4NQRA 3PUVA 4DANA 3M6IA 3W2IA 1M1YE 1KY4A 2JFPA 2YWGA 3SMVA 1V0JA 2JH9A 3KEFA 1R5NA 2XUHA 1V6SA 2HNBA 4D97A 4I4TF 3UW1A 4X20B 4FLMA 3NHSA 2OOKA 5DISB 3CMCO 3HJRA 4IOKA 1HX7A 1JXQA 2PJDA 3ESBA 3VDQA 1RQPA 1F6DA 1OX4B 4A6XA 2HJSA 3PJFA 4GLBA 3QKIA 4ILKA 1LDGA 1MR3F 2V9PA 3O8LA 1BMTA 3IYLW 4Q3CA 4GVLA 3SLKA 1LQ2A 1GFWA 2X2OA 4BLWA 4W5RA 3AL0C 5LD2C 1O5IA 1XD8A 2XXJA 3EODA 1DTSA 1JVNA 4FW9A 1GDHA 4GUDA 4RKQA 3T3EA 4UCQA 2EFYA 1RPZA 5LMUB 4BMNA 4JI8B 2OFOA 3JWIA 3DGEC 3DBRB 5DP2A 4D44A 2PO7A 3OVMA 1TPYA 1FXWA 4PLTA 3ROFA 2QRLA 5HGXA 3GEHA 3ICWA 1TNDA 4U6SA 2I91A 4K6MA 2IBTA 3PVCA 1WMSA 5CT6A 2V7GA 1C81A 4GPIB 4XA8A 3DXZA 3OZGA 1KDYA 1K7CA 1OC2A 2J5RA 3JATA 2EIHA 1Q1EA 1KI9A 2FR8C 3LPNA 3UN1A 1Z8NA 4ICIA 1Q6ZA 3L0BA 2RIRA 1ONNA 1ZH6A 1BG6A 5DNYB 1EVQA 2ID8A 5REQB 4O59O 2R1TA 2WUDA 4P4UA 1JFRA 1B73A 5EZQA 5JPCA 4BQSA 4F3YA 1Y3FE 2JIMA 2YHUA 5I9SA 2DLDA 3V55A 3NASA 4FDLA 4BNZA 4AN0A 4C7BA 4CPDA 4DVGA 1M73E 4AMYA 2FPUA 5DNCA 2ENUA 1FMLA 1AHNA 1BOOA 3NGLA 2IOFA 2Q0QA 4K6FA 4P7JA 4QEZA 3R75A 3S5UA 4XGKA 1YCDA 1OPRA 3R0XA 4GI7A 4GAEA 1U3WA 1J97A 3R44A 3FTFA 4BBJA 4IGEA 2P79A 1B0ZA 2CXNA 2QNBA 2VIIA 4QBFA 1PLLA 1SXJA 3KPYA 2B92A 1E1CB 3FM9A 3IILA 5KBYA 2C9MA 5HM8A 3DMRA 3CEHA 1XMOB 4GR9A 3A1FA 5HRCA 4K9SA 3UAXA 3OJ0A 2XB9A 2XTZA 4UM7A 4CM5A 3BZUA 4Y9SA 3BMNB 2XT9A 2QZ9A 3CNOA 2Z6QA 2CJPA 2ZRKA 2VWGA 2XITA 3NBUA 4GI1A 2CJFA 1ULAA 2NYVA 2E48A 4PZDA 1FYVA 3RFUA 4CKCA 3OX3A 5K2OA 3DR3A 3D5QA 5ELLA 1FDRA 2B78A 2WIKA 2XF2A 2PD3A 3HUUA 1O94C 3MWFA 4YCJA 2O8CB 1S2DA 3NRCA 4HFRA 2GEJA 4YCAA 5L7YA 4IZOA 4W9NC 3W5BA 3ZJVA 2RKOA 1VE9A 3L92A 3R7NA 4BN0A 2OE2A 4J0KA 5MN4A 1JDVA 2IVZA 4JVSB 1MX1A 3NANA 4PS1A 5TVGA 3U5ZB 1OLXA 2VDQB 2VJYA 3OEHA 1RMQA 3DDUA 2OCDA 3WK9A 2XTMA 4C4ZA 2ZYUX 2K2WA 5KVQA 1G8MA 3NM6B 2GK4A 3D4LA 2D0DA 1L9XA 1IJBA 3CTMA 3E7PA 2YMLA 3B7PA 3IUMA 3VJKA 1ECBA 2P90A 5L9AA 3N2NA 3T35A 2QG6A 3UCEA 1CUZA 3QYAA 4J7XA 2BUBA 4DIOA 1UDWA 4OJQA 1DOAA 5FBWB 4MA0A 4B3SB 3OURA 1W85B 4G8CA 1V4BA 4Q39A 1VPTA 3WGGA 4DEXA 1N0WA 1AJEA 1UWLA 1ZRMA 4I8DA 5JMTA 2Y6UA 5A0FA 3MT9A 3KXPA 2WU1A 5F9MA 1MO5A 2VBGA 5HE9A 1WLSA 3CH5A 3IC5A 2FETA 4Z0PA 3PQ6A 4EW1A 2DHCA 3K0KA 5IEBA 1SEVA 1BHO1 2AE2A 2YXEA 3I73A 4EY7A 3LS2A 3WGIA 1E1LA 2FEXA 5JVDA 3TR0A 2V0CA 1N7GA 2BFOA 5LMCA 1CJVC 3H84A 2J09A 4LMBA 4TYNA 2AVNA 2Q9BA 1M34E 3KXLA 4LY3A 2JANA 3CXUA 1E96A 5TV2A 1EWQA 2QY6A 3BICA 4BV9A 2IEGA 3CGGA 3REFA 2CCJA 3WRYA 1XZNA 2PUAA 3IUYA 4UZSA 1XK6A 3NHZA 4KKXB 2EX0A 4DV3B 1YF3A 4GEGA 2OM2A 4ZGWA 1CY6A 1E5XA 3TLGB 3ZIAA 4OUDA 3VMMA 4I46A 2JZNA 1DC4A 4PTLA 1Y1RA 1AH2A 5FFNA 4DWVA 1F0PA 2XDQA 2YUIA 1JUDA 2WM3A 3VVMA 2FHSA 4NCKA 8ADHA 3PA6A 3Q0IA 3THYB 2R84A 4J1SA 4DQXA 1YQDA 4NBNA 5KU7A 4WKNA 3JARA 3U62A 1W73A 5E9JA 4U0KA 2IH5A 4TTQA 4Q1FA 5U4QA 2BMAA 5IYZA 3QKSA 2LE0A 2BH2A 5KHAA 1YAJA 2O50A 2XA2A 3L8MA 4JNCA 2VPPA 1C7IA 1Z75A 1IYZA 3OC0A 2IYOA 1H2YA 3BSFA 2NU7B 2Z2KA 1MN6A 2MHCA 1K1EA 1XKTA 2WJ4A 3IIMA 3OT5A 3Q88A 1NUSA 4KGDA 1Z6XA 4O02B 4ZOBA 1I7QB 3THWA 1FS6A 1JNXX 4EYSA 2QBYB 4MS1B 4OM7A 2AFIE 1T9DA 2FJUA 2DPYA 4O4IF 2CK3D 1BZYA 1JH8A 4PC2A 2Z83A 5CYOA 1QO0A 3AVYA 4AG3A 2QE7A 2QT0A 3SC6A 1LBHA 3S1SA 1GA4A 4WLVA 3EZFA 3V7YA 1LRKA 3AEUB 2CLMB 1XLVA 4Y1RA 2DY1A 5DLPA 2JRCA 5FPQA 4F0JA 3BGIA 2ROQA 3ICCA 1T1GA 2XLCA 2F8SA 3OZUA 1W0JA 5KTSA 3WGNA 4ZC8A 4US1R 5LUAA 4M7PA 4V0SA 4JB3A 1Z6PA 3GGGA 4H7JA 4DIUA 5C46F 3FNRA 2WHQA 4BMPB 2W70A 3PX3A 3HA7A 3TX6A 4E5DA 1BVYF 1FFAA 2C9YA 2RAPA 1RMTA 3BL8A 3EQZA 3KB8A 4MW9A 4ZYLA 1GKIA 2GJ8A 4AJEA 2H2AA 3CFHL 1O7JA 1E8NA 1N7JA 3V2IA 4BQIA 4YAUA 1F4PA 3LC7O 5KNLA 1SIBE 3WRXA 3ZDFA 5CW2A 3R6GA 2DQZA 2X8WA 2KM1A 4XYEA 2NZJA 4XIJA 4G8JA 5HCNA 3WJ7A 3G79A 3DE5X 4X8LA 3VDNB 3WDSA 4C87A 1A7JA 5LJIA 1V47A 1EGAA 4MRMA 2JAPA 1CR2A 3PFKA 4HVAA 1NI3A 3CCBA 1ABFA 4ID9A 4N03A 3GLHE 3W9YA 1OBCA 3RTBA 1ULBA 2ZBEA 4U02A 1RAFA 3VV3A 1N5KA 5IANA 3K8ZA 1SXJC 3K1JA 3K9WA 2FPPB 1Q92A 2JGMA 1SQSA 3ST7A 1CS0B 3BULA 3NDIA 1VIDA 1NNUA 3D4IA 1ECGA 1KJJA 1D7AA 2JIZD 1JHZA 4GNRA 3GRAA 4QX6A 4Z7OB 5MFZA 1KI7A 1KMCA 4D8TA 2H1FA 5FBZA 3VDMA 4ND7A 1SUEA 3NHFA 1GL3A 2BR4A 5B7GA 1ZNYA 2PGJA 2PUHA 3WL5A 3ZX4A 1AKVA 1FJXA 2B5VA 3ZDRA 1TF7A 1H8HD 5FKJA 2E0IA 2V03A 4PC3A 3T4PA 4R1PA 1O9BA 4DUGD 5EN4A 3LG2A 4O63O 1WO8A 2CMGA 4AG6A 1ILEA 4KE9A 1QYIA 4CM8B 3ZV3A 4YFVA 4DUPA 4EUEA 1HBJA 2J4CA 3PEFA 4MWCA 1KQFA 4CQMB 5LIRA 4FMCB 4ZI3A 5C80A 1SVIA 1MMFB 5KJ1A 2O8DB 1RPAA 1SB9A 1ZH2A 1TU0A 1YFKA 3JQCA 4IXMA 4NIMA 1B16A 2BM0A 1I0ZA 1SURA 2QQGA 4IV8A 1ODKA 2Z8ZA 3I5MA 3WP1B 1G8HA 4TRJA 3F67A 5K03A 1SVNA 1XTUA 2X4DA 5IT0A 1WZ2A 4QU0A 3JZAA 4ACBA 4RYLA 1CUIA 4J3FA 4WEQA 1O97D 5EZYF 4EDHA 2QSZA 6LDHA 3EZ2A 2DHDA 1AS0A 2I4MA 1I6MA 2ZU6A 3B8HA 4LMPA 1Z5NA 3GRCA 3OOWA 4WA7A 4FR2A 1KAEA 4BLUA 4DJTA 2EDAA 1WBJB 1UJCA 2QMZA 3H1GA 4G1BA 1GSOA 2NM0A 3DE3X 2WD7A 4HEHA 1EWVA 1Q74A 2C61A 2PN1A 2FZWA 4KP7A 3PXDA 1S3GA 1DHRA 4WINA 2FPIB 4HDRB 4YRPA 1PCXA 4CQJA 1Z9BA 1CF9A 1Z33A 1PT6A 4BQRA 3MMNA 5BORA 1FP1D 2NU8A 4D99A 2R6JA 4UE6A 1KI3A 1UWKA 2W2QA 3VTAA 3FVRA 3ZHUA 2GD0A 2GZRA 1MB4A 2ZIVB 3HI4A 3IAUA 3PWZA 3V1MA 4M7RA 5AW9A 2EQ5A 3JY6A 4HGPA 4ZODA 4L9RA 1PV1A 4LNHA 3W6NA 2FG5A 3IALA 1I10A 3AEKA 3UJ7A 1IXRC 2HPAA 4M8NE 3ZVKA 3IUNA 5DT9A 2ODNA 1DQRA 2R7AA 3GVHA 3V1NA 1Q2XA 2GJAA 2VCEA 1C8KA 4TX1A 1TT7A 4NF2A 3BIJA 2RJOA 2XUZA 3VISA 5EJ8A 2LCIA 2BE9A 1BXRA 3EXAA 4AIRA 2CLOB 5JADA 3LRXA 1CNMA 2ZAYA 4N9WA 5THQA 3KD3A 3QLUA 3V1KA 4CF5A 3VYSB 1TQ4A 4IMJB 3QWIA 3IEXA 1TVKA 1DTEA 4DG8A 1JFFA 1ZESA 1WXWA 1H9AA 4DBVO 3MMSA 1FP7A 1KMIY 4C6SA 2Z1DA 4CG1A 4ENVA 2OHVA 1EK6A 1NVGA 3BK7A 3P94A 4B0PA 5IJZA 1BWRA 2BEVB 2O3UA 3H9BA 1X1RA 2DBVO 5CFNA 5I7UA 4CVNA 2CL0X 4HH1A 3OA0A 4EI8A 2C9OA 1TUGA 4DDKA 1T9GR 3H9UA 1W88B 1NP7A 4UHDA 4AZVA 4TKVA 4NC9A 4DRYA 2R47A 4DA6A 3CX7A 3OICA 1BX3A 4PZ0A 4BGIA 1Y3BE 1UBLS 1UUFA 1KQOA 2J6BA 2QTMA 2XWQA 4UDOA 3A27A 4B85A 3G2PA 4K9LA 2H1HA 2QVGA 5FULA 5G0UA 3E81A 4YMVA 5GY7A 1OR8A 2DUMA 3KQOA 1T3GA 3EWSA 4R5HA 1OXSC 4RJIA 2IYZA 5JRDS 5HTOA 5JCOA 1Q0RA 2WV7A 2PU7A 4R2KA 3LLUA 1FVOA 3MQ4A 3WRXC 1MBZA 4GPEA 2OEPA 3N6XA 5DBOA 4KTVE 3E15A 4BIIA 4ER5A 5KNCA 5LU9A 2JLCA 4RK1A 1T5IA 1GZ3A 1IBRA 3T1QA 2G04A 1RXUA 3ECSA 4DQDA 1ZM7A 3AU8A 5IDWA 4IUBS 2M98A 3F7TA 4WNAB 2HJRA 5AVJA 3GLIE 3F7MA 3RAGA 1ZR4A 2FPWA 2CFOA 3MS7A 2O2DA 5D3ZA 4DLLA 4NATA 2QUBA 2CXXA 1C7FA 4JUDX 1GPUA 4BIMA 1L4LA 2FKNA 1PWEA 2M1ZA 4AW9A 3V00A 1OBOA 3FPCA 3SR0A 3OI7A 4FI3C 1YD7A 2G1JA 2J33A 3LHIA 1BXGA 1FS4A 1BX0A 4G25A 4LAFA 2Y4OA 4N0MA 3FPBA 2BWJA 4OBXA 1NVDA 2VK1A 2YCBA 5C51B 2GCGA 3Q4GA 1T9ZA 5CVTA 1J07A 1K5GA 1ZOSA 3R0QA 3CUVA 4XFKA 5DYTA 4HYEA 4G5YA 2HFKA 4WESA 5HFNA 2FDRA 4KXFB 4UAJA 3OCWA 2H06A 4UU7A 1BRMA 2AFHB 1R0SA 2OKCA 3E82A 4LZZA 4BX2A 2XKAA 5FF9A 2ODWA 3PI7A 5TF0A 1UJNA 3PWSA 2ZSJA 1YWGO 3UQZA 3MLAA 4RTJA 2V55B 2ZJZA 2JGIA 2Q4EA 2WTNA 3VU9B 3C48A 1SXHA 2FX3A 1TIPA 4AN4A 3A9WA 1Y1LA 3W2FA 1UPFA 3QNUA 3P2YA 3T8YA 1HSZA 4RWEA 3WO1A 3E5RA 5CDFE 4EPTA 1P60A 4AY5A 1EB8A 1N6RA 2ZRGA 3QE4A 4YRQA 5IJXA 4DV5B 1PJ2A 2DXIA 4HH4A 1YKSA 4R3WA 2IPLA 3K96A 4YAGA 5K0EA 1PQPA 1EFCA 5TARA 2WUFA 3W6OA 1GPMA 1W75A 1C1HA 4KMMA 5HIKA 2R68A 3G2KA 4BU1A 4IS3A 4ZDIA 4R98A 4D4KA 4CGZA 2A35A 4WNYA 1VGQA 1IZ7A 5H16A 4X45A 5EESA 4GMFA 3TBKA 4AECA 4CTJA 2J0UA 2NAFA 1COZA 2FFJA 1UDAA 4JC0A 4R81A 3AG6A 3BHJA 4NR0A 4JQOA 4YV7A 1E9DA 3HFGA 4MGKR 4O0LA 3WYDA 4BL5A 4NV0A 5F73A 6PFKA 3CLSD 5I45A 1GPYA 3GRFA 4B3DA 4CMBA 4TUYA 1X7GA 3QUTA 3RD5A 4H4DA 4I7EA 1DV1A 2HJHA 3LCUA 4B2LA 1YDEA 3Q3IA 1Y3IA 3ROXA 4ZARA 1C8BA 4JI7B 3Q5GA 1UXJA 2CDNA 2OMKA 4FWBA 5B3JA 4NU6A 5J4VA 5A62A 2WIDA 4M9ZA 4MDYA 1OFHA 3UF0A 5JAUA 3K8OE 3IAXA 4CEIA 4EKYA 3B7WA 8LDHA 2WG2A 4KVZA 3SZUA 3I34X 3UFXA 3UICA 4FHZA 4RLSA 3SZ3A 5SYNA 4PX3A 2H7XA 1HSOA 1SBNE 3ETCA 2JLUA 1Z2PX 3DOJA 3QFCA 1PR5A 3T5PA 1K5HA 1E1YA 3HKEB 3VR0A 2B4AA 2AV6A 3WWDA 3RAPR 2P5UA 3UKJA 5MN5A 4MRVA 5AIBA 2FG7C 1NQWA 1PZMA 1D8AA 3H13A 4HBGA 4RJKA 3RW9A 1TYDE 4BV2A 2O0HA 5AT1A 2KI5A 4CM9D 3M3DA 2HUPA 3BM5A 3NVAA 4IAOA 3NIWA 5AM0A 5HS6A 1IN4A 4D9JA 3N2ZB 2C9BA 3N8DA 3VR5D 4CIYA 1N57A 5JWOA 4ETIA 1FRNA 1Y4ZA 4IHAA 2CVQA 2YJ5A 4JC5A 2H00A 3CVOA 3DMGA 1MENA 3GOHA 1W5SA 3B3QA 5F4BA 5F35A 3MILA 3QYJA 5H81A 1RJDA 3HY3A 2ZGVA 1R7RA 1OPXA 1XVIA 1CW2B 2DH5A 2WJAA 3CJQA 1J8FA 1P7ZA 1UBHS 2UZ0A 3Q41A 4UJ3A 3SHTA 3FGNA 3DKRA 4EAQA 1LRJA 2HJ9A 2DT5A 4UNNA 4B9AA 3U4CA 3BWXA 1J5PA 3MTDA 4OB6A 3JQGB 4EHJA 4F8YA 5LNK1 1VLMA 2GSDA 4BNJA 2CLHB 3H1EA 4IOLA 5BUQA 2OD7A 1YKFA 2OT3B 2GZ3A 1NDUA 2R5WA 2XGGA 1BDMA 4I55B 2WFLA 2ERYA 2R5FA 2VSYA 1ORIA 1Q7BA 1UEIA 3T9BA 1WDWB 3WKAA 3HJBA 1XA4A 4M9RA 1A7KA 1I3CA 2QUIA 4PYOA 4LTDA 4RJ2A 4CM7A 3MYYA 4KQKA 3WKBA 1A27A 3EEIA 3CVJA 4KUGA 4KFSA 3FLBA 3HGQA 2IW1A 3ZWBA 2BVNA 4YQEA 3AB7A 3IQFA 3AWDA 4DCVA 4GP7A 4HGYA 1JSRA 1U2DA 4R01A 4NJEA 4PG8A 1MG5A 3V33A 3Q0TA 1E3JA 4PLYA 1NNI1 3IJEB 1QF6A 1CXZA 3NWBA 3ZHRA 3EFOA 5KVCA 5FUBA 1ZGJA 2O7NA 1R15A 2QX6A 4NZPA 5LZ5A 1T5TA 2ZIGA 2ZYRA 2I3GA 3QVKA 1H6BA 3R7WB 4E08A 2PT6A 4XWYA 3PUJA 2G16A 2Z30A 3N8IA 1RZRA 4YPOA 3O75A 1N6LA 2ZREA 4TWAA 1OWPA 5LZ2A 2YVKA 4QNMA 3K9HA 4O4HA 1T4GA 2GCEA 5KS2A 4A27A 1X7XB 1TU3A 4TMTA 1VPLA 3D6NB 3KP1A 2AD5A 2CNLA 2C5BA 2DECA 3A6ZA 2JGDB 3A1EA 4L8WB 1H2WA 2R8XA 3NHKA 1W44A 2MR6A 1X3SA 2JD2A 3W8NA 3UHFA 4EKDA 4EG1A 1J8MF 4RJTA 3J81k 1DRWA 3AQIA 3PNBA 3E3NA 4UHFA 1ULSA 4JBYA 2A56A 2Z4TA 1QE0A 3Q6NA 4QOEA 4Y9TA 4TT3D 4ZAVA 4AJ1A 1TJNA 4MJ7A 2XDWA 5EVJA 5EMNA 3NLLA 1IM8A 4QTUB 5ALYA 1WLYA 4J6FA 4BFXA 3EGWA 4KQ2A 1CUDA 2IH2A 2W7TA 1GNLA 4KN8A 4R8VA 4O2BB 2ONYA 2QPLA 3UK2A 1CQZA 1EIZA 1BTOA 1V9SA 3AEXA 3Q1LA 4UHHA 1YBFA 3R6WA 3PZBA 5IZ4A 2P9HA 3DLCA 4KMSA 4JLUA 5LM3A 1CDZA 3RVSA 1DQPA 3LWBA 3VAAA 3DYIA 4IRMA 3GJZA 2GUWA 4PFSA 2IYPA 5HX7A 3MB5A 4RE6A 1KP3A 3B3JA 2X15A 4X64B 4YN3A 4YV1A 3L0OA 3TTSA 4MQ5A 2LCQA 2VZ8A 4H2DA 1GQSA 1KIMA 4F85A 4HDAA 1PFKA 3ZWWA 3FJOA 4G0NA 4KB5A 5J2UF 1NYLA 1XHEA 3NEJA 3ONWA 1NXXA 2VEDA 4MPRA 4UZEA 3TB4A 3UBTA 1EX9A 2G06A 2P9JA 3G2IA 2ZIZA 2W4IA 4KAAA 4N8EA 2FW7A 1EYZA 1UPBA 2GBIA 5KJ6A 1HM5A 1YH3A 1QH1B 4Q01A 3P9QA 5EHNA 3U3DA 3SQMA 1PL7A 5JT1A 2WVGA 1I3NA 3RV4A 1PJCA 5A0VA 1Z68A 3S2GA 5JY1A 3IDFA 5C9ZA 2VNHA 1ZG3A 1VCOA 1UK7A 2ZR7A 4MA4A 3FSEA 3STUA 1L4NA 2RHJA 4CWAA 2AJ8A 3D02A 3EWIA 5H4GA 4AQDA 1E5DA 5JYEA 1N7HA 2ORED 4Z3KA 3ZWCA 4MS3A 1JDUA 2YINC 3F97A 2OLEA 4WKBA 4V0KA 3SQNA 4PSAA 4IF6A 2HX1A 2X6TA 1JHMA 1MEEA 1ZGGA 5DWVA 1CP2A 5I8WA 1AO3A 2D2VA 3DHWC 4NFYA 1J1IA 1QTIA 3H5WA 3KHUA 1BN6A 2AEMA 2ZRPA 3FHJA 1O6GA 5ITSA 3TF5A 4FZ5A 3UJAA 2XX3A 2UDPA 5H5JA 2R0QC 3H3XA 1S6YA 3F4LA 2Z6AA 4D9KA 3EN0A 1ZIPA 3UHJA 4XPIA 1DGQA 4HDQB 1RYNA 3MTBA 2ZVJA 1E1NA 4XWGA 2VYNA 1DAHA 1WHTB 1HT1E 4LY0A 2A0KA 3OKPA 1WXFA 4HAVA 3ZWVA 3QBJA 1U7UA 4TL7A 2ZDQA 3HP4A 4FZRA 3H2GA 4YP9A 1SHKA 1MPXA 4JQYA 3NC4A 4BJHB 5HKKD 4EYQA 1N33B 3EWNA 4PZYA 2N9UA 2BDUA 1B8OA 3W34A 2QI9F 3NOOA 3UHPA 1ZOIA 2FWBA 4XUDA 2VYQA 4OYHA 5KB3A 4MQFA 1L7MA 3IKLA 4YTEA 5KINB 1VTKA 4RZUA 1DEAA 1R0XA 1VKJA 3W9UA 4ITRC 1U8AA 3SXJA 4B4OA 3C1UA 4EVSA 1ZI6A 4FPXA 1L5HB 3TOCA 1RLTA 2NVUB 4AWXA 4YMUA 2PUFA 1POWA 4RFSB 3CISA 1SHUX 2DR3A 1CLEA 3CB2A 5TMEA 1W96A 2I8CA 1DG1G 2V1UA 2I2FA 4IIJA 4UU8A 1MAUA 5JZSA 1OTYA 4LHVA 4QLAA 5CIYA 3A6EA 4WNCA 1LEHA 2DFNA 1Z4QA 2OVBA 1ZHOA 1J2JA 1VJ1A 3KT8A 1JLKA 1YVPA 1R10A 4ZYTA 1EDEA 1J42A 3CZ9A 5FTMA 3TVDA 4R16A 2BMWA 3T9CA 3ANXA 2BFEA 3BCHA 2GB4A 4UVIA 1A71A 3P0HA 2VT6A 3M1LA 4HQOA 1Y8ZA 2NZUG 3NEYA 4IMRA 3KCQA 1GQ2A 3OCCA 3AFMA 1U0EA 1NVMB 5DMXA 4C2TA 3LDAA 2VJMA 2VNKA 4MUGA 3NX4A 2CLLB 4HB3A 1DV2A 3LPAA 1XVLA 3S44A 5SZJA 4A0GA 2ZIXA 3K30A 1GKYA 1SMKA 5CD1A 2NXWA 1IHXA 4RY0A 4HQ6A 2CWDA 2TMKA 4JIGA 4K6HA 4UCFA 1P33A 3DUFA 3FDXA 2OAEA 5EKSA 3ONFA 4OTZA 4IGFA 4B4UA 1ZYUA 2K7ZA 4JA0A 3QVLA 3UV7A 1KEEB 1A8QA 1AKWA 2VAMA 2VKTA 4G5XA 5F7ZA 5J2TF 1DXYA 3FNHA 2ZE6A 4UDNA 2IYXA 3KSBC 2Q62A 3TZ6A 2WFAA 4INZA 1ISGA 1ECPA 4KRXA 3BC1A 1E32A 4KO3S 4EHDA 1AKRA 3E4DA 1PJ3A 3TLYA 2ZIEA 4B45A 2Q50A 1KSHA 2JLVA 3R3UA 4BNGA 2F43A 4MVJA 5DX0A 2Q07A 3T15A 2WSYB 1M2VB 5BT8A 4RZIA 3W7VA 4DT1A 1AK1A 2GA8A 1W5TA 1EJ0A 2A84A 2HF8A 1KK0A 2ISQA 1C30B 4X1YA 1NVAA 4BZPA 2ZAMA 3ZBPA 3HXPA 4HNAB 2PKWA 3ESRA 3IIKA 3RABA 3V1LA 4CIXA 4QDZA 5AQEA 3QE0A 1FDVA 2DULA 2R00A 2VH5R 3ASYA 5A7HA 4KNWA 4ML3A 1KPHA 4JUAA 3R74A 4P31A 5B4UA 3S1AA 5CB4A 821PA 1K6EA 2RCNA 2PKYX 3S4YA 1BDBA 1OAKA 1B74A 3HPQA 5EXEA 5BSTA 1J2TA 5HF6A 1HNWB 2QMQA 3N8GA 1FYEA 3GZNA 4MR9A 5KCZA 2WW8A 4JVMA 1NKSA 3I30X 2VQ6A 1SKMA 4F8JA 1JAZA 3TLZA 1Z35A 3C8HA 3M5PA 1LRLA 2VOEA 4JB8A 4C30A 4BE7B 1ZI9A 2B25A 3ZKWB 4C5CA 4QDTA 4MR8B 4ISBA 1P77A 2HI0A 1D2MA 5THKA 5D3KA 4AO8A 3TTUA 2PX8A 2HF7A 1GSHA 1T4DA 4NBVA 3VUFA 4AS3A 2OZKA 5FI3A 2ZJ7A 4BLSA 4B7AA 4FIZA 1LB1B 1OAAA 3GLFB 1VMDA 1A9XA 3A4NA 4G5SA 2RI0A 3T7RA 2BFBA 2FQYA 1YDGA 1RZRD 4HD8A 3H6KA 4YRRA 4ASUD 1KRXA 2FW1A 2O7RA 4UMDA 2ZBFA 3U7FB 4A8PA 2HT6A 1JRLA 2BM8A 4DV4B 3RS8A 4NV1A 1FVXA 2Y0PA 4GG1A 1V8PA 2Z57A 4ZRNA 2WDZA 4C0SA 2CJWA 5EI5A 3OWXA 5KYXA 5F12A 1P4AA 4K28A 1IY2A 2V58A 3FPAA 3KFLA 1LS1A 3IEMA 1TUBB 2Y1FA 4QJ5A 3KV1A 4Q3DA 3O1IC 2AWOA 4YJFA 4ZCTA 3KZ1E 3FVVA 3DO6A 3VJMA 4G5QA 1SOAA 2W2LD 3OUTA 4LS3A 4PEVA 4D92A 5BR7A 1WETA 3NO4A 3VPSA 2PKCA 1RU3A 1W6RA 5F3WB 1Y7HA 1Z0SA 1XMIA 1ZSNA 1AN9A 2SHKA 1KEKA 2BOVA 4MPDA 3ETLA 4Q6WA 5HE8A 2XCUA 4DVJA 5JAZA 4BUCA 2EZ4A 2DCUA 3SJBA 5BOSA 5JNLA 4B17A 2FFHA 3CU5A 1T0IA 3F74A 3Q7PA 3TG2A 1U0BB 1IN5A 3A4LA 4HTAA 1N1DA 2D5CA 4KQ1A 4RTQA 1WXIA 4IPTA 3PCRB 2BYTA 2ATVA 3A1TA 4HFMA 1DFGA 4JJKA 1XMPA 1CVIA 2WJPA 4K88A 2R97A 3GLRA 4FOOA 3X1WA 1B1AA 2JBAA 4E3ZA 5K8TA 3AFHA 4FHEA 4QJBA 1YVEI 3ADBA 2XUAA 2AT1A 4DDWA 4XX0A 3O8RA 1TB4A 1OBVA 4JDUA 3P0RA 4NULA 3K0FB 3EMDA 4HQKA 4JI1B 4AP5A 3DWGA 1LV7A 4XWAA 1N9KA 3CNBA 2CDCA 1ULUA 1VC2A 1OFUX 1Y98A 4ND3A 1SUWA 3SDBA 3UAVA 1KI6B 2CMKA 2PT7A 4BFVA 4ER6A 1KO8A 1NU8A 5CLHA 5P8WA 3H2SA 2RSLA 1YK0A 3MMZA 1RQRA 1GLNA 3F6BX 3NOXA 4H6VA 4W7SA 3NRBA 4DSNA 5CGZA 4ZO6A 3HJFA 4WXHA 1XMVA 2EHDA 3PPIA 4UUBA 5E4YA 4CM3A 3HBAA 3HWSA 2XD4A 1H93A 1KVSA 2V7VA 1U3GA 1GAQA 2XB4A 3QPUA 1WU8A 1X8XA 2SNIE 3QWBA 5HA5A 5KYYA 3K3PA 2PXAA 2RMKA 3H2BA 3HKDB 3RRXA 1YS2X 4R6WA 1AZLA 3O8QA 1X15A 4Y8VA 2BLLA 3SK0A 5JASA 1AIPA 3E5NA 1XR3A 4KFCA 2OHIA 5J43A 3SBEA 3IMEA 4F3NA 5JJLA 5BWBA 3AI3A 2C5GA 3A3PA 3FOZA 2DWCA 4WFKA 1EK1A 1V3UA 4GKVA 5BSGA 5HS4A 2FDCA 1XRSB 3AP2A 3STXA 4QYIB 1ZO8A 1GDTA 4M4SA 3QITA 3EFEA 4H17A 1K0FA 4DQVA 5GVSA 3TNLA 4AN1A 1O4VA 3EVFA 2QX7A 3E03A 4HDSB 1KZ4A 3WRVA 2QE6A 3ETDA 4MJ3A 2UU9B 3O0TA 5ICMA 3CVXA 5LKAA 2R1VA 5KNCD 2XCLA 4CV3A 4MYHA 2HIGA 4U7FA 1O4WA 1XQWA 3T3DA 5IARA 3DO5A 1V8DA 4KXWA 2DHEA 4ERXA 4W5JA 4DE5A 2LIVA 4GD3Q 1RT9A 5D87A 1XTTA 3DAHA 3C0KA 1NL3A 2A1UA 2DP4E 1A95A 3NV9A 2H2WA 5JLAA 5AK3A 2YIJA 2QYSA 3P2KA 5BQXA 4KXLA 4JYBA 1RR6A 1U0FA 4MGHA 3RNOA 4Z53A 2YOFA 2ZYSA 5A9RA 1EU1A 1W2GA 3G68A 3MJDA 4K9DA 4MEAA 3TD2A 3TSOA 3WC4A 3N05A 4R8KA 2WKRA 4DCCA 1V1RA 3Q3HA 1G2QA 3L8FA 2X58A 1NR1A 2GTIA 2RFLA 3R40A 1RYMA 1CS4C 1VLHA 2IYYA 4IFBA 5EINA 4OAQA 1SUAA 5LC1A 1R0BA 2RHGB 3UUFA 2H54A 3WFIA 3WAGA 2RGXA 5I7FA 5C4IA 2HM7A 4RJJA 3U61B 4AICA 1XNGA 2HO4A 4Q3BA 2JAXA 4M0CA 1G21E 4Q3OA 1HDGO 2ESRA 2XWSA 5JAQA 3TSWA 4TZ6A 2P6UA 3PXBA 1GAJA 4IJKA 4EMSA 3V4OA 1ETUA 1R6XA 3M89A 3V4LA 3GHYA 5BPFA 2ZI9A 2CLFB 3JQRA 4FYKA 4BHRA 4MWDA 1SZCA 5TT1A 3SOPA 4K86A 2H1VA 4L74A 3NYIA 3TPFA 3C6MA 1P5RA 3VSEA 3BA1A 3G0HA 5EWJA 4NENB 4E11A 3BWCA 3W77A 2A5GA 3DFIA 1T91A 1UBKS 1KH3A 3AJEA 2O0JA 3I9LA 4WA8A 2VQSA 2Y1KA 2XQVA 3S7ZA 3ZHSA 4E5UA 1HNZB 1PL0A 1DCTA 2ZWMA 4M0PA 4TS1A 3THXB 4NXMB 4A36A 2PUWA 3PNSA 2GBCA 3HDQA 4TLLB 3O8OB 4O29A 3UKDA 3CZCA 5ADVA 2AR7A 2J46A 4EPRA 1N2JA 3DPSA 3LPCA 4JITA 4HOYA 4CHTA 4F46A 4EEXA 5I9LA 2V98A 3AERB 2P27A 2ZSUA 4H6WA 2ZAGA 2F8TA 4BS9A 1V11A 4YRTA 2O57A 4LNUB 1RQLA 4H7FA 3B6ZA 2PCJA 4IJ5A 5CH8A 2PL9A 5KNBA 1ESNA 4Y67A 2CXSA 1VI6A 2A92A 2ZRNA 3QNMA 2YNMA 2OWDA 3R2JA 4ZXPA 3M8KA 3FWNA 4MUFA 2HWXA 2C4VA 1XYVA 1A04A 2EP5A 4GLLA 4UE3S 4YI5A 1C0LA 1Y1SA 3F90A 5I47A 5EMMA 2K5UA 1F4VA 2XDAA 3PYMA 5FBVB 4TYYA 3UJ6A 4AS1A 3SVLA 1PZFA 4YMLA 3ACCA 4PIVA 2VPYA 1F7UA 2WUEA 3GVIA 2CLKB 2C96A 3Q3EA 2NUPB 5B55A 4HLNA 1I80A 1XEFA 2EATA 2QTRA 1JKJB 4NICA 4WCDA 3FPSA 5FTNA 3WBJA 2JLSA 5IBQA 1KYXA 4ADSG 4EMBA 9ATCA 1JMYA 1ODTC 3HJAA 3IUQA 4G4JA 3WAKA 4AZSA 2IYUA 5BV2P 3PV0A 1IQPA 1Y42X 4I4TB 3TCXB 4PYNA 4U39A 3ZNQA 1JE1A 4AKSA 4CG2A 2Z2ZA 4EX6A 1PEDA 1XN1A 1K2WA 2FMTA 3A1VA 5TQVA 2VUHB 4Q9JA 4K6GA 1DU4A 1V3QE 3SNHA 1AQ6A 1SD2A 2Y1EA 3D7NA 2C4HA 3B6EA 3ORFA 2BR5A 4BECA 3RUAA 2WJWA 4XM0A 4RUKA 1YRAA 1FZQA 2PRKA 1SBIA 2VHWA 3LRTA 3R0ZA 3IR6A 4RKYA 4KIFA 3OD5A 3RYTC 2MINA 5D5PA 4JVNA 4EW2A 4O8ZA 4F6RB 4ARUA 4O5AA 3QLTA 4HAUA 3KM0A 4CTMA 2AFRA 2ILTA 1DAGA 3EVAA 3R5FA 4Y2RA 3B3FA 5EXXA 4JSYA 4X60A 3GUYA 4GP9A 3SHWA 1IWPB 2BKLA 1EUCA 1PNQA 1GZDA 1R9NA 3AGPA 3OWHA 4OQ4A 4C4TA 4ETNA 3RYCA 3P9RA 3WIEA 3OOHA 2IK8A 1P91A 4X6LA 3ZWPA 1JFLA 1KBZA 5HGJA 3L49A 1WB4A 2VP4A 2PDAA 2HZ7A 2Y1LA 3CO0S 1I1QB 1PFVA 1YC2A 2R7NA 4JBGA 4QOFA 3ZK8A 4EFLA 2W6IA 5KTPA 3ABIA 1SK8A 3F5SA 1UEXC 3JQQA 3GLSA 4LXQA 3VGPA 4MV1A 1G8GA 5HILA 3PXGA 1YMUA 1MAVA 1NJ5A 1V6CA 1QJCA 1P9NA 1XX6A 2GBLA 4JJFA 4N0DA 3NDBB 4YXFA 4MYCA 4A6DA 4CKXA 5C8YA 1P9WA 1THTA 5ECDA 2OQ2A 4HVTA 4B6JA 3PXCX 1RM0A 3L1HA 4MZXA 5JCJA 5C5DA 5JVDF 4BBAA 3T7AA 2EFHB 1GITA 3NDJA 4PO3X 5K8UA 1NJ2A 4UVEA 5ENVA 2K2QB 1UDXA 1EUZA 5KSWB 1HOXA 5CPBA 1KBQA 5I8PA 1TO2E 2GASA 2P7HA 2PIAA 2X9VA 1PTKA 1N9GA 4QPDA 1LPAB 3ESCA 3O4JA 4X65B 3K1TA 4ZDWA 5JZMA 2QWXA 1VIVA 2C97A 2J07A 1MXHA 3QBEA 3PUXA 1M1XB 5CBPA 4I19A 1FNNA 5A5VA 1XFAA 1X7HA 2CDAA 1RACA 4FNGA 3A6GA 4LMRA 1XPJA 3OG9A 5B53A 1K8RA 1WQ4A 2OPBA 2WTBA 4US0R 3RQSA 4HWRA 4DJEC 1AU9A 2B20A 3EZXA 1EUDA 5B5SA 2PEZA 1AV6A 2EWWA 3ILVA 3U7JA 4C7XA 3HB9A 1R9MA 4QGHA 2QVXX 3GZ4A 4D1YA 4F4DA 3RUEA 1NC1A 3A1SA 1F2TA 1A88A 4HSEA 5CFZA 1UBRS 5B1EA 1I6LA 7AT1A 5LQRA 4G86A 1JYFA 3A3KA 1GPKA 4BO8A 2H7CA 4ZYXA 3R0IA 1WIWA 2FOLA 4KHPB 4MVWA 1UL1X 4IUDS 2F64A 3B8EA 1QHXA 1UMCA 4FP9A 3KXKA 1QQAA 1I0LA 1ETHA 4HN9A 2V97A 1UC5B 5CITA 4CIAA 2E5LB 4ABYA 1RPJA 2WVAA 5EE1A 1RAGA 1O96B 3GARA 3T34A 3M6MD 4XUEA 2ZSAA 2GF9A 2PH1A 4R51A 2OV1A 4AAYA 5JIBA 4EEZA 1YOVB 3IOBA 1YA4A 2HMSA 3LT0A 2BF4A 4INOA 3ZI0A 1HDRA 2E3JA 4Q7KA 1G38A 1WSDA 3R3ZA 1KXJA 4HGNA 3D1VA 2LDBA 1X1BA 3QPDA 1YZHA 3B48A 1WZIA 5JC8A 1ZQ1A 3PGXA 4LF6B 4LV5B 3UQYS 3EZ9A 3OKAA 3B78A 3FMGA 4I08A 4LZWA 4EFMA 3NGMA 1YHYA 1NW9B 2FN3A 4FGZA 3F3KA 2CFTA 2JD0A 2P6RA 1RLUA 1OTHA 3QFSA 4JT4A 1NVWQ 1DIRA 1OLSA 4UUPA 4X54A 5AKJA 5IX8A 1J4AA 3M6VA 5JAIA 3M81A 1ZSVA 1MU0A 2W71A 3WGZA 1BRTA 1P1HA 5KC8A 1CX9B 4F5ZA 3WICA 1VYVA 1ZLXA 1UKBA 3UA3A 4E5NA 1NUPA 1XD9A 1HR0B 2F7SA 3ORHA 4TTTS 3I53A 4BZXA 1PSZA 1TRKA 1BMFD 1BW9A 4ZCMA 2EFDB 3DWEX 1WHSA 4FI3F 4D0NA 5ESRA 5I7OA 3CJRA 1ECJA 2WILA 2L0XA 1JJIA 1TZMA 1OI7A 3EDOA 3KKOA 3OZTA 2J1LA 1CUXA 4IYJA 3NTXA 1XZDA 5AVKA 4OIMA 5FWYB 5A3SA 4UVDA 5JSUA 3IBTA 3KPUA 1F20A 1P7WA 4DIDA 2QY9A 4LJAA 4O4IB 1MOPA 3TW0A 4U2FA 3QXGA 4OGKA 5GQSA 3ONNA 4V38A 1SC4A 3B3AA 4NCNA 1MW8X 1F9AA 3VVBA 3IUBA 3WLJA 3ZY4A 3TQTA 1Z6ZA 3I6BA 3ZHZA 1TM2A 4JJAA 4L8FA 1YMQA 3PUKA 5ADWA 1INLA 5ITZB 3DTVB 5AKGA 2HBYA 4H31A 1FYWA 1L7EA 4Q1VA 1N34B 1KOFA 4LWPA 3V4FA 2OHJA 3EPKA 1PJTA 2IUSA 5FBRB 3JZMA 4J1NA 4XFDA 5KTRA 4K0KB 4RTKA 3ND9A 1Z82A 2FMFA 2IYRA 3OLZA 4G5OA 4C5BA 3EGEA 4KZKA 2HHHB 4LDJA 4DR1B 3HBNA 1PS8A 4LRXA 4MS4A 2ZE7A 3HA2A 5LA6A 5AI5A 1QLWA 2B0JA 4PSCA 4RHXA 4ZO9A 5DHPA 3LK6A 1ZXLA 3WTBA 2NZ2A 421PA 1CEEA 2PZMA 3DEYX 2P3OA 3UH1A 1X74A 2BJHA 1KJYA 2YRFA 3SJAA 3T0IA 1LI4A 3UV6A 5CFOA 2GBLC 2IIPA 1H1DA 1DFIA 2HEIA 3H1PA 4LZLA 2C7VA 5F2NA 3L7IA 3G9ZA 3PKJA 1U8EA 4PAQA 3V3KA 1XP8A 1L4HA 1SPBS 1UT5A 2OP1A 2DQYA 4DSUA 4EJSB 3L6CA 4QM6A 3UTDA 3O95A 4GL4A 3VH4A 1XMJA 2QLBA 2QMHA 3ADOA 2L18A 4YCBA 2PV0A 3UWSA 3WWPA 4F1JA 1Z22A 1U8TA 2OHXA 5AHKA 2GVZC 5EL0A 2BFPA 3HU2A 2XMRA 2AN5A 3A10A 1YIDA 1QE3A 3RT7A 4NJMA 1R4MB 1RVV1 3DEHA 4L76A 4L2IB 1SBHA 2PU5A 3I76A 2Q7XA 4WCVA 3TTVA 1DKPA 2KJQA 3E3AA 1KHHA 1KO1A 2R6DA 3EGXB 4GMGA 1NF8A 3GFGA 3GCWA 4P8RA 5FADA 4BHTA 8OHMA 3RNLA 3WYFA 3PFWO 5BRAA 4PRYA 2GN8A 3DBRA 4L27A 2V96A 3WBKA 4ENUA 1SXJD 4L07A 2YS7A 2O2GA 2AQ8A 2GN0A 3QVXA 4Y2TA 1ZJWA 3STTA 2ORWA 1R6DA 2J3MA 4EWLA 3I09A 2PQ2A 2V3CC 5ABPA 4UAVA 4URYR 1PR4A 2HWKA 3GP8A 4HYTA 5K3EA 4JVLA 4CQNA 3IVRA 3HYSA 5DW0A 2R25B 4O3MA 4OQNA 4LBYA 4PAGA 5REQA 4EA9A 4KOAA 2NQTA 1N2CA 3R5XA 3EXFA 3LT1A 3TR5A 2DBYA 2NPIA 3QX3A 1J99A 1NFFA 3EDRA 2ZJ5A 1NMYA 1ST3A 2I34A 4L6AA 1SD1A 3VNSA 3FHTA 4J07A 1W0CA 4UMFA 1DC7A 1RLMA 2C0PA 2FY8A 2J7PA 3CF6R 2XZLA 2D2IA 4UARA 3ABRB 3S5JA 1UJ4A 4F5YA 1BHJA 1G17A 2O3QA 2BH9A 1R0LA 2ST1A 2W6MA 1CB0A 2WP0A 3KZXA 1HUQA 1GPAA 2BKUA 3HMQA 2MDTA 3JQBA 1MFPA 3KYBA 3QPVA 5CT4A 4A03A 3FOCA 2V7TA 5E38A 5BSRA 3RFXA 5H9VA 1H42A 2CMDA 3ZHCA 3IUSA 3OZCA 4RGBA 1E1CA 3OCZA 2XMPA 1JBEA 3QFHA 1IRXA 4MLDA 4YO7A 2IBMA 3T5GA 4D43A 4TYPA 4NE7A 3KUXA 4NFHA 4EG0A 4V0ME 2QXTA 2JKYA 4QIHA 3V8MA 5LLTA 3BMNA 1N6PA 4HBZA 2E7ZA 3VYUB 3J80A 4TTRA 1IXYA 5BMVF 4MHTA 2G8NA 2Q7DA 3ISTA 3UWDA 4ZVPA 1Z2CA 2CMHA 4C6RA 3SWWA 4QRDA 2WI8A 4ZZ2A 1XZ8A 2XRYA 5J40A 2V5VA 4TL9A 4EEKA 2C2HA 4U7TB 5AVZA 3BXEA 2Q7OE 1JLLA 4FMPA 4FWIB 3SVTA 2V6JA 3Q0EA 2CUKA 1LFDB 4HRXA 3HDJA 1KMHA 3FZYA 4YCLA 5DN6A 1YR6A 5AW0A 5EJ6A 5KUTA 4F8EA 3ZGZA 3F5QA 3SU8A 2JZOA 2FVYA 3EXG2 3HCWA 4KCGA 2ZTHA 1XA3A 3QLJA 3T61A 4IP0A 2XECA 3BIWA 2CJYA 3EEQA 1RWKA 3RS3A 3DHVA 3FDFA 1JR4A 1E4EA 3GN1A 1OVMA 2C58A 3DEFA 2XGMA 1N8SA 2WD8A 3TQCA 3AVWA 4H1HA 1I51A 1H69A 2RC6A 1DTWB 5D6NA 3BB4A 2RBKA 3B89A 4CV2A 3ZIAD 1JF8A 1Y9DA 2RHHA 4FWTA 1UCFA 4HRAA 4GH5A 5KYVA 3NCTA 4BV8A 1QV6A 1W85A 1AK9A 1NX6A 4B3IA 1WR8A 2SECE 4MCIA 1Q95A 4G5FA 5KX5A 4ZAYA 3PU6A 2R2GA 4ZXFA 5IKXA 1KYQA 4EUKA 1H94A 2DTXA 3ORRA 3U37A 4JLMA 1XJ5A 4GOMD 1H2HA 2DRIA 4Z9YA 2NUTB 3HNRA 1GRNA 2CBGA 2XTAA 3CYFA 3OQJA 4DB4A 4UAGA 2EJCA 3J7AC 1K7YA 3MA0A 3OQMA 3N2GA 5AK0A 4KHZA 2YASA 3LUJA 4E6EA 5IULC 2VAVA 2FSUA 1FX0A 4JLDA 2QG9A 1WDMA 3RF6A 1E3LA 2Q2OA 4NDAA 1QO0D 1U0HC 4C7MA 2QE7D 3SOZA 3CFFL 3WWCA 2C2ZA 2GDZA 1QV7A 4HJXA 1NYQA 3E9NA 1XVVA 2WSLA 3LOUA 1IY9A 1TCUA 5KQLA 4WPGA 1W0JD 4W8GA 4ZO4A 4X8MA 3UT6A 4EGJA 4Y3UA 2VRNA 1R50A 1Z0FA 2FQXA 4YCMA 4UTPA 2PK3A 2WJVA 3DT8A 3ZE9A 1XCGB 3CKYA 3NI2A 5K6AA 1CQPA 2V6BA 3O7MA 1IJEA 1PTJA 4AF6A 7REQA 4XKJA 1TK3A 5DIFA 5TGTA 1Z6AA 1IPEA 4WN9B 1T5BA 3PNVA 4L4RA 1EJ2A 1C8VB 2CYAA 2H29A 2YZNA 5L4NA 3WFJA 1NP3A 4PN7A 4D9MA 1J06A 1D0SA 4E2WA 3SS7X 1PZHA 1GL6A 2MSDB 2OKGA 3AF2A 1HFWA 3ZZMA 2R7KA 3HYLA 1YO6A 3RVNA 3UCFA 5GOTA 1NI5A 4YAIA 3RCBA 3RREA 2RGNA 2HK6A 4MS1A 3VHRA 5HPYB 4KIGA 2VF2A 1HLDA 3P2OA 2BCJQ 1ZNZA 2JJMA 3HP1A 3KYDA 5G0WA 5LBIA 4AZTA 3JVIA 1UPTA 3HU3A 3Q87B 3LBYA 3FXAA 3NTLA 4MVJI 3OIGA 3R5HA 2X8BA 4Y9RA 1I1OA 3ER8A 4MKIA 1VB3A 4FXPA 2OGUA 1Z2OX 4NBSA 4TXLA 1LNSA 1YZYA 4GNKA 3MINA 2JCXA 1VBNA 1SHJA 1JKIA 1AQIA 1M7HA 1XC7A 1Z0JA 2IYWA 4XR9A 3VO8A 2ZRMA 3NKLA 4AVYA 4J9UE 1UH5A 4B09A 3WISA 4B3CA 3U7QB 1ONBA 1ODCA 3DF9A 3EY4A 1E3WA 1EDBA 4J2OA 1RAAA 3EGOA 3FPLA 4X7RA 2VSQA 3SSAA 3AI2A 1T3TA 4IKPA 2AZTA 3Q9UA 3RVPA 4TTPA 3TCNA 1QK4A 1D04A 3DLPX 1K6MA 3FPKA 2XQGA 3KTAB 3M5CA 4F4CA 3HK2A 4JJ6A 2PKRA 1SN7A 3HKBA 3M4JA 3OLXA 1UPCA 2XMSA 3DEIA 3FHLA 4B6OA 2Y71A 1DBVO 2V7EA 3SBOA 3NTRA 1KS9A 2NZYA 1A4XA 1QV9A 3JQBC 4DMFA 2OCIA 3HUDA 1XWIA 1ZA2A 4A8TA 1XI2A 5IZCA 2IU0A 1F38A 5LXTA 2QAGA 4NOKA 3PB3A 3IPCA 3CE9A 2FPPA 3D8UA 1XHLA 1SKYB 1J24A 3OX4A 4F9TA 4DIEA 1QP7A 3NWJA 4MOWA 2EW8A 3WNQA 4CEHB 1BYUA 4MUYA 1IEWA 3M49A 3ROQA 1U8YA 1IY8A 2J3QA 5GJCA 1B6SA 1JQBA 2AK3A 5JU6A 3QEJA 3AIKA 1M54A 2CEKA 1ESDA 4HX9A 4YMIA 3ZE0B 3MWKA 2AW3A 4JYPA 4G8BA 1CPYA 3K53A 1FFHA 4CCWA 1KTVA 4AK9A 4E2ZA 5KJFA 4YQFA 1UBEA 1PR0A 2HU8A 4UMEA 3ZJYA 2IHVA 4IXJA 1B41A 1FF9A 5LJLA 4KLRA 3CW8X 4N01A 5E8RA 1KQNA 5BN3A 1NLZA 1TO6A 3FW1A 1CJUC 2Z9CA 3NHUA 4FFDA 4NAVA 1GYPA 2WG1A 4D56A 4E1AA 1NASA 2EL9A 1D1TA 3KEGA 3MXOA 4ZI7A 1H4SA 1ULTA 2XV1A 1ZD4A 2AMFA 3N70A 4RTNA 2WT8A 4OO3A 1FMTA 4R7TA 4RLHA 3K72B 3NHBA 3Q9LA 2AG8A 2VTVA 3C4JA 4Y6LA 4ZAFA 4A0FA 1SU4A 5BW8A 1YFLA 1NBAA 2D1FA 3R24A 2OV8A 4IUCS 1MV8A 3SQWA 1RP1A 5L95A 1N2ZA 2COEA 3ZN2A 1V3VA 1D9ZA 5E6UB 4EHLA 5KWEA 3OTWA 4L3OA 4O4HF 1RS0A 3PGMA 3RVMA 3WAJA 1BD3A 3WLMA 3AR8A 4HUJA 4KGZA 1ABEA 3IURA 1Y3CE 3W5JA 4XR4A 4JS0A 4XYMA 5E9QA 4EGSA 2PYIA 5ERGB 4GDMA 3TW6A 2P2NA 4FYPA 1MT3A 3JX9A 2HCJB 1V5WA 2FH5B 3DZGA 3PP8A 3SZGA 3T0GA 2IXAA 2ZUWA 4HX2A 4DEYA 4FKBA 2FLKA 3K70C 4HUQA 4KN6A 2QRPA 2CHVA 1X7ZB 2B4TO 3M70A 3TTTA 5CFQA 1P7YA 2BGRA 2OQRA 2B83A 2WAMA 3CLRC 1YRYE 2O2JA 3EXEB 4FD2A 4FYVA 4MLZA 1GYQA 5FORA 3NBKA 2V9CA 2EX4A 3W5DA 4A5OA 4R2JA 1KHTA 2Q6VA 4CT0A 3TSYA 1B76A 4CNQA 1P8AA 1XRRA 1XU9A 2Y27A 4NG4A 5J4LA 3OCUA 1XZGA 3SE0A 1TCBA 3IDAA 2C29D 3RK0A 4LYHA 4BWVA 4C22A 4V1CA 5KNDA 4JU8A 4TMYA 4P4LA 2MOKA 3F6CA 5HF5A 4N4AA 1RP7A 3C45A 1XDSA 2WJ3A 3OPMA 4FBMA 4IIGA 2ZR0A 1C7EA 3SHFA 1C0IA 2QGFA 2PUJA 5UKDA 2R4TA 4BKRA 3A31A 1Z7WA 3E2IA 3FZGA 1ONOA 2Y0BA 3OU7A 4N3GA 4B7CA 3TM4A 1JEYA 5LDGA 1F60A 3ZWYA 3ZW9A 1JEJA 2FPLA 2C42A 3ANYB 3DNPA 3GG2A 1KJZA 4W8OA 5IP5A 4OLJA 5U1PA 1GADO 2I7CA 2GM5A 3NBYC 4YRIA 3U09A 2C5FA 2J0SA 1Y81A 2YJTD 1FDIA 5I5GA 5K6AC 3PFFA 3AR4A 1PTJC 3S1LA 2OZVA 4LCEA 2QJFA 1ZWLA 1N0VC 1HE4A 3K0AA 4MW4A 2Y2VA 4I3HA 3PDIB 1K89A 4W5OA 4TN5A 5E0OA 2XIJA 5C5CA 5I7AA 1PVOA 2PT5A 4DYHA 2N47A 2EP7A 1W36D 4NRDA 4CLEA 3O4VA 3R4CA 2IXGA 4Q4HB 5K2MA 2YJNA 2NXJA 3PGJA 2W5UA 1QFJA 4IX1A 2J6IA 1RWVA 3E5MA 1UXHA 3GVXA 3UMCA 4FHDA 1GTSA 3GBSA 3L8DA 2F3UA 1KI1A 4LC9A 2GTPA 1ZCBA 3AR6A 3MOSA 3D7KA 4OXNA 4RA9B 3VZQA 1NVEA 2AQIA 4QSMA 2Q0SA 2HHCA 1ZM9A 1DUSA 5A2QA 2OZLA 3PR2B 3L0SA 4N18A 4KREA 3PGLA 2IIQA 2Y1XA 4NH4A 5HJ2A 1RRMA 1TM5E 3GV0A 3GJ4A 4LSMA 3VNQA 1GVNB 2ZZNA 4IOMA 5LB4A 1KFCB 4E7PA 4P3YA 3HB4X 3PXEA 5KKCA 1ZMBA 4Q3AA 3VV2A 3W2GA 3SQOA 3KYIB 4LY9A 3COYA 1OI3A 1U80A 1XTJA 4IV0A 3TL3A 4TKLA 3CT4A 4GM1A 1HEIA 4X41A 3WNZA 3W9SA 3DB1A 2JCVA 4WNAA 5D3MB 3SSOA 2DJIA 1P61B 4D25A 3ITDA 1WTCA 3LKBA 3P9PA 1I32A 2HKIA 2JFUA 4REMA 4UBNA 5J2UB 2VPZA 4KTTE 1PIWA 2YFHA 3B82A 3OJWA 4A8HA 1V2GA 2IEAA 2QAGC 3F3SA 3GWZA 4L5JA 2ZYGA 1RWOA 3SD7A 2ATCA 3Q11A 4HPWA 3O6VA 1Y5MA 1HFKA 4X7PA 5AP9A 1TU4A 3PFHA 4U3JB 5EKXA 5HKBA 1IHOA 1G7CA 3L8GA 4IGIA 3UJDA 4C89A 5SYAA 1DVRA 3ZE2B 3KU4A 2QU8A 5JANA 3ORYA 4GS5A 4R0VA 1SVSA 1KMMA 4IHQA 4QPNA 3E05A 4GKAA 3A04A 4X24A 2B2NA 4RORA 3PD1A 4P5PA 4B6GA 1TVMA 5TXGA 1IBLB 1AK2A 1EFRA 1Z17A 4RNCA 3RS2A 3MBKA 2B5WA 1V9LA 3QPCA 1XD2B 3U4AA 2ONKA 4EA6A 3GUCA 3GRYA 2XUFA 3TJRA 2LUOA 3C3WA 4F84A 5AXCA 3CMMA 3JSAA 4YRGA 2W43A 3PHBE 3KVVA 1N4DA 4I1YA 5IWAB 3HCCA 3WYGA 4Z4IA 2FOXA 2I6GA 5ELXA 3BVPA 1KJNA 3QBVA 2XE7A 3KSRA 1NBME 4RETA 4R9SA 1T6ZA 1FUKA 2IPAB 1PDVA 4HNGA 1VYHA 4PRKA 1Z12A 1OMOA 1I7LA 1HYBA 3GD7A 2BJWA 2H63A 2PRZA 5BP7A 5J5VA 5FWXA 3D6JA 3OUUA 4QJ4A 3GEGA 2W2KA 2NTYC 2WD9A 1QCDA 2QTCA 3GJ5A 3HXKA 1EM8B 3O1LA 3D8BA 3GLGE 2PLFA 1E63A 2ZRJA 3C7DB 4UUAA 1U0SY 2TYSB 3H11B 3RIXA 2GAIA 1Z5OA 3U4HA 2WT4A 2XQJA 3O74A 5AVTA 2W6CX 2DFTA 4NP6A 3IDOA 1P62B 2WAYA 4EOGA 1RTTA 4H9GA 1Y6RA 3WJ1A 1DAIA 2LKDA 3FKSA 1TC1A 4CUKA 5IU6A 1ABBA 1QVWA 3DVRX 3HYNA 4FFMA 5KREA 1PNRA 4ZPJA 4MVJF 2NZVG 1Z0DA 3O26A 4ZYUA 2ZE8A 4IILA 4MPJA 2EKDA 4ER3A 4MV7A 3C15C 4LX0A 3UJNA 3Q3CA 1F6WA 2V5UA 3LIIA 1ZUNB 1L7PA 3QBTA 3JZFA 1V7PC 3KV3O 1BHQ1 1E3EA 2JAOA 3QEKA 1LK5A 3RYHB 4ATNA 5CDSA 3M4ZA 5E4JA 3HUFA 3K09C 3LX5A 2QMEA 1H9BA 1KPIA 3ZGOA 1VYUA 1NW8A 1E2LA 4DLRA 2QVLA 2VJOA 3OKCA 4BCBA 1C8LA 1RLOA 4EQ6B 2NZ8A 3QU2A 5EIHA 3FY4A 4U2BA 4F3RA 3EARA 3SM9A 4Y9UA 4OBEA 2IZ0A 3OTGA 1Q0HA 1O57A 2ID7A 4U2GA 4BNYA 3U4DA 3M2TA 4DV7B 1SVWA 4MR7A 4C6TA 1U1DA 2I4RA 2PQ6A 3PENA 3HWRA 4YP1A 3DKVA 5EG5A 1REQB 3PC8A 3SXUB 2H0QA 3RG2A 4X1IA 1FSPA 3IR7A 3ZGNA 1U98A 2X7HA 4F6CA 3FN4A 2IZ7A 3IQZA 3OOJA 2MT9A 2P2LA 3KK0A 1M6HA 3BSSA 4L0QA 4NYMQ 5IXYA 1AB5A 3DMTA 4I9NA 5EPEA 3W4KA 4YECA 2HA6A 4KNYA 1J39A 3VPDA 9LDBA 1EHYA 3M34A 4C3UA 1DIBA 1II0A 3EOAI 1MT0A 1W9MA 1TKRA 3ZK9A 2E4ZA 4BO4A 2ZBQA 2JHFA 3HCFA 4C14A 2JI7A 1ZCFA 2GJ9A 5SY9A 3RRMA 3L02A 1H0HA 1EFUA 2IXFA 1MC5A 3VYWA 6YASA 4I55A 5E0KB 1KJIA 2C5HA 2C83A 1ZKMA 2DJ5A 2XIQA 1G8AA