The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
54
|
sequence length |
137
|
structure length |
137
|
Chain Sequence |
PAARRRARECAVQALYSWQLSQNDIADVEYQFLAEQDVKDVDVLYFRELLAGVATNTAYLDGLMKPYLSRLLEELGQVEKAVLRIALYELSKRSDVPYKVAINEAIELAKSFGAENSHKFVNGVLDKAAPVIRPNKK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
molecule tags |
Transcription regulator / ribosomal protein
|
molecule keywords |
N utilization substance protein B
|
publication title |
Fine tuning of the E. coli NusB:NusE complex affinity to BoxA RNA is required for processive antitermination.
pubmed doi rcsb |
source organism |
Escherichia coli k-12
|
total genus |
54
|
structure length |
137
|
sequence length |
137
|
chains with identical sequence |
B, C
|
ec nomenclature | |
pdb deposition date | 2009-08-11 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF01029 | NusB | NusB family |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Alpha | Orthogonal Bundle | N-utilizing Substance Protein B Homolog; Chain A | NusB-like |
#chains in the Genus database with same CATH superfamily 3D3B A; 3D3C A; 1TZW A; 5LM7 B; 1TZV A; 2JR0 A; 1TZX A; 1EY1 A; 1SQG A; 4EYA A; 1SQF A; 1TZU A; 3R2C A; 1EYV A; 2YXL A; 1TZT A; 3R2D A; 3IMQ A; 1Q8C A; #chains in the Genus database with same CATH topology 3D3B A; 3D3C A; 1TZW A; 5LM7 B; 1TZV A; 2JR0 A; 1TZX A; 1EY1 A; 1SQG A; 4EYA A; 1SQF A; 1TZU A; 3R2C A; 1EYV A; 2YXL A; 1TZT A; 3R2D A; 3IMQ A; 1Q8C A; #chains in the Genus database with same CATH homology 3D3B A; 3D3C A; 1TZW A; 5LM7 B; 1TZV A; 2JR0 A; 1TZX A; 1EY1 A; 1SQG A; 4EYA A; 1SQF A; 1TZU A; 3R2C A; 1EYV A; 2YXL A; 1TZT A; 3R2D A; 3IMQ A; 1Q8C A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...