3IN0A

Crystal structure of the f114p/m121q variant of pseudomonas aeruginosa azurin in the cu(ii) state
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPPGHSALQKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rationally tuning the reduction potential of a single cupredoxin beyond the natural range.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3in0A00
2HX8A 2FQDA 2FWLB 3NJIA 4EF3A 2AANA 2BW5A 4KOCA 1XB8A 4G72B 2QDVA 1JZGA 2A3TA 2PPDA 1AG6A 4KOBA 4YSUA 3NJNA 5I6NA 1R1CA 1ASPA 1BXVA 2OJ1A 2XU9A 4AX3A 4E9RA 3PPSA 4K9JA 1PZCA 1AS7A 1TEFA 4G71B 4DP1X 1UATA 1IKOP 4ZK8A 2MTAA 4P5SA 1OE1A 1ZV2A 2PPCA 2Q5BA 3NSYA 5IY5B 2BWIA 4AKQA 4YSSA 3GYRA 1ZDSA 3L45A 4YVNA 1W8EA 2ZXWB 1SF5A 2W88A 4F2EA 2CALA 4YSOA 3WNJA 2YAQA 3X1FA 3UAAA 1QNIA 2DWSA 2GHZA 4AKOA 3QJTB 4FA7B 1SDDA 1NDTA 4HAKA 3FT0A 2CBPA 1ET8A 1NINA 4PCYA 1KBWA 4E9SA 1JZJA 1TKWA 1JVOA 1SHWA 3GXUB 4YSQA 1PNDA 2ZONA 3SBQA 4AKPA 1IBZA 2IWEA 4AI7A 1KCBA 1ETJA 1BYPA 1NIDA 2IDQA 2MRYA 1IBYA 1BQKA 1OV8A 3AG3B 4GP5B 2TSBA 1L9PA 5LDUA 3NJFA 1YLBB 2Y69B 1BQ5A 1AZBA 3T6VA 2ZWNA 1RZQA 5F7BA 1BEXA 3SQRA 4BDVB 4A2HA 3DTUB 2B08A 3AY2A 5B7EA 1L9RA 2XV2A 3FPXA 4G7RB 1V55B 4E9TA 4JKNA 1SF3A 1ZPUA 4UAHA 2JXMA 4KNUA 3FSAA 1M9WA 2XX0A 3QJSB 2BHFA 1BXUA 1L9OA 3CVDA 4E9VA 1A4AA 1QLEB 1JXGA 4DP9X 2EILB 1DYZA 3HEIB 3AZUA 1KCWA 1KDJA 4P5RA 1RCYA 2QT6A 3V9EA 5A7EA 1N70A 3UADA 3TU6A 2UX6A 3H56A 2CCWA 2BP8B 1AANA 1VLXA 3IE9A 1AS6A 2H3XC 4Q89A 1E67A 1PF3A 2CUAA 4DP6X 2B3IA 1SJMA 4YSRA 3WG7B 1PAZA 3FU7B 1BYOA 3WNIA 5B7FA 3T6WA 3ABGA 3WKQA 2YQBA 3ASNB 6PAZA 1ILSA 3FU8A 3IBOA 2VSMB 2VW7A 1E5ZA 1PLBA 1JZHA 3DIVA 2VW4A 1OE2A 3UACA 1J5CA 4YSEA 3NJHA 3JTBA 2FNWA 1N68A 4N4YB 4DP2X 1SFDA 1NICA 4GYBA 4GP4B 2IWFA 4MFHA 2J5WA 2GBAA 2X88A 2UXFA 2HX9A 2J57A 5D4IA 3ABKB 2DV6A 2PP9A 2WO2B 3T9WA 1TU2A 2YAFA 3FU7A 2PLTA 3V9CA 2AVFA 6PCYA 3CDZB 3EH5B 3TASA 4BWTA 2FT8A 1W6WA 1AIZA 3EH4B 4HCGA 2IH9A 4AZUA 2QPEB 2YAOA 1F56A 4KO9A 3ZIYA 3S8GB 2BP8A 1PNCA 1OCOB 1XMEB 2N0MA 4KO6A 2XV0A 7PCYA 2BP0A 3ZX1A 2YAPA 5ANHA 5B3SB 2FQEA 1PLAA 3ERXA 1MG3C 2EIMB 1ID2A 1XB3A 3BQVA 3PCYA 3NSCA 3NP3A 1JXFA 5I6KA 4HALA 2IDSA 3AG1B 1J9TA 4TXVB 8PAZA 2VM3A 2HRGA 2HZHA 1ZIBA 1X9RA 3FQYA 4WKXA 1NPNA 2BZ7A 1WS7A 1L9TA 1EZLA 1PY0A 1T5KA 3PAZA 1NIAA 1AAJA 1DZ0A 2NRDA 1L9QA 4UANA 3S8FB 4NB7A 3NT0A 3BVDB 2I7SA 3CVCA 3CG8A 1GS7A 4KNTA 4F2FA 1GY1A 2PP7A 1IC0A 3T6XA 3X1NA 5E9NA 1J5DA 4BDVA 3S3BB 3OQRA 1SNRA 1CUOA 3NJMA 1ET5A 2Q9OA 4JHUA 5B7MA 4PAZA 1JZEA 4YSTA 1NIFA 2P80D 3CDZA 3HB3B 3PAUA 5I28A 3NJLA 4DP7X 3QJUB 2I7OA 4E9YA 4ENZA 3IEAA 5AKRA 3KW8A 2XXGA 2GI0A 3CVBA 3G5WA 5B1KA 4BXVA 1JOIA 1WA2X 1OCRB 3FPYA 2QDWA 5B1AB 1OCCB 1NWOA 3QJQB 2DWTA 4BWUA 4CSZA 2PCYA 4L0PB 3MX0B 4DPBX 2YARA 3FSWA 4QLWA 4G70B 2DYSB 1V10A 1A4CA 1AZUA 2HXAA 2R7EB 1CC3A 1JZFA 2TSAA 3GDCA 4N8UA 1HFUA 4KO7A 2PCFA 1KDIA 1KYAA 3X1BA 1E5YA 3TA4D 4DPCX 4BK5C 1GS6X 4E9XA 1AG0A 2YAMA 4A68A 3FU9A 3IN2A 2PP8A 2JKWA 3N55A 2R7EA 1FA4A 1L9SA 2YAHA 1AZRA 4HZ1A 1JXDA 3SBRA 3C75A 1AZNA 3UGEA 1CYXA 3QQXA 3X1EA 1OE3A 3WI9A 2XLLA 2FT7A 2OCCB 1QHQA 2DYRB 2W8CA 4M3HA 1BQRA 4M4RB 5F7AA 1M57B 3N2JA 3TBCA 4A2FA 4FAAB 5D4HA 4YVUA 5I26A 3OD3A 3QJVB 2E86A 3OMAB 3TBBA 2BO0A 4HHGA 2CJ3A 2XVBA 2ZOOA 4W9ZA 2HLEB 1M56B 2XV3A 4NERA 1AZCA 3IN0A 2GIMA 3ABLB 3ABMB 3ASOB 1AOZA 4G7SB 5I6PA 1BAWA 3ZDWA 3ZBMA 4KNSA 3QPKA 1PZBA 3CZUB 1RZPA 3D12B 4YSPA 1MZZA 1SHXA 1URIA 4YSAA 1SFHA 2YXWA 1KGYE 2BWDA 1MZYA 5TK4A 5B1BB 3WKPA 3MBWB 1HAWA 1CURA 1AS8A 2VMJA 3U25A 5PCYA 1SDDB 1NPJA 5I5MA 1PMYA 4F7KA 3OMIB 2VW6A 1GY2A 2HX7A 2PPAA 2UX7A 5AFAA 2GC7C 3AG4B 1ZDQA 5PAZA 2UXTA 3FSZA 4UF7C 5I6LA 2H5UA 5D4JA 2GC4C 4HCFA 2OV0A 3QJRB 1OCZB 3FSVA 4YSCA 2J56A 3EF4A 4W1TA 4HCIA 5I6OA 4X4KA 4Q8BA 1AQ8A 1WAEA 4DP5X 2J55A 4DP4X 1JVLA 3OM3B 2P80A 5AZUA 1FWXA 1NTDA 3T71A 1OOWA 1GR7A 5FC9A 2FQFA 2FT6A 1KV7A 2EINB 1NIBA 3AW5A 4A66A 3NJKA 3FYIB 1I53A 2XUWA 3PXLA 2FQGA 1KBVA 1GYCA 4DP0X 1NZRA 2HRHA 2XWZA 3RYMA 1CYWA 3UAEA 2WSDA 2LLNA 1MG2C 3FYEB 3X1GA 1AR1B 2JFCA 2UXVA 3EH3B 2AFNA 2IAAC 3EHBB 3X2QB 2I85A 4QKTA 4YSDA 2UXGA 3S3DB 4YL4A 3NJJA 1ILUA 1J9SA 3SBPA 4RH4A 1XB6A 1PCSA 3PAVA 2RACA 1A4BA 2CAKA 3S3CB 3FQ2A 1GSKA 1MDAA 2DY2A 4A2EA 1EHKB 2BW4A 2FJSA 1TEGA 2EIKB 1BXAA 3NSFA 1A8ZA 2AZAA 2AZUA 1A3ZA 4JHVA 1B3IA 4NAJA 5I6MA 1FFTB 1PZAA 3T6ZA 1ET7A 3WIAA 2XX1A 4DPAX 2XYBA 3OMNB 1WA1X 5I5JA 9PCYA 1A65A 2PPFA 2PPEA 2IDTA 1ASQA 2WO3B 4GXFA 1WA0X 1E65A 2VSKB 3DKHA 2X87A 2IH8A 1J9RA 1JZIA 3AG2B 3PLYA 1J9QA 4A67A 2BP0B 4GP8B 4HHWA 3NYKA 2IDFA 4DP8X 4GY4A 4E9WA 4KO5A 3NJGA 5EHFA 2EIJB 2YXVA 1PLCA 1W6LA 2XXFA 1X9UA 1GW0A 2YAEA 4A2DA 2VM4A 1ADWA 2FTAA 3H4FA 1IUZA 3NP4A 4WTQA 4HIPA 1OF0A 1AACA 3UABA 1ZIAA 2BZCA 2GB2A 1JERA 5B1JA 2H47C 1WS8A 2Y1AA 4CSPA 4E9QA 2GSMB 2IDUA 3NSDA 3FS9A 1NIEA 1V54B 1GS8A 2VN3A 1HAUA 2QPDB 2IWKA 3JT2A 3KW7A 3H4HA 4G7QB 5TK2A 7PAZA 4A2GA 5I5IA 3FQ1A 1E30A 1NWPA 4BXSV 1RKRA 5B1JC 1ASOA 4BWWA
chains in the Genus database with same CATH superfamily
3O11B 4P57A 1J0JA 1B0GA 3SKOB 1KEML 4YMPA 5I2IB 1D9KD 1D5IH 2WN2A 1W16A 1IC4H 3HPJB 3MXWH 3NJNA 4I0CC 4EXPX 1EO5A 3WIFA 3MRCA 1R5VA 4FTVD 1P1ZA 5M7QA 5DZPA 1LEGB 3E0GA 3VQLA 2FO1A 1XD1A 1L0QA 1RZFL 4NQCA 5BVJB 1TSRA 4RFNB 5E8NB 2X4QA 4KJWD 1IKOP 1NBZA 4Q6YA 3IMBA 4WY7L 4FA6A 5T1KB 3LQMA 2YGVA 2R69L 3EYSH 3FB6B 5CZRA 3QUML 1SDAB 2AMUA 1NKGA 2N01B 2W0LA 3QUHA 3ARTA 1QNIA 4AITA 1U3NA 5I6XB 4OIBA 5KYNA 2PW1B 3GHEL 4PJBB 5FV2A 1KN2L 2DB8A 3BQUC 3MNDA 4KMTH 5D96B 4E0RA 4JO4L 4KY1H 3EUUA 4PCYA 2ZUUA 1M71A 4YDNA 3KH3A 2XT1B 5MI0B 2EDWA 1TKWA 1XZ0A 3MV8A 3PDDA 4OF6A 4C56B 1AR1C 2OTUB 4MDJB 2ADJB 5HHMB 3IB4A 3CXHJ 5DEFA 4AENA 1T03L 3QG7H 3RGVC 3UTSA 1INEL 2EH7L 4F33B 4N3UA 2ENJA 4MNGB 2XN2A 2OX5B 1BQKA 4F92B 2ZNXA 3TJHD 1L9PA 2YUVA 1H3PL 2OPCA 4AYMC 5GGSB 3HI5L 3QDMD 4G3YL 2JV6A 1BEXA 4GSDL 4HUXB 4PJEB 3RWGA 3VO0A 4PV9B 2WB1A 2CHDA 3VD2A 1HH9B 1J1XL 1LO5A 5DUPH 3SJVA 3O3BB 2EDTA 5F8RC 3ALWA 2C9QA 3EYSL 3FCSA 1TQVA 1M9WA 2A38A 3OKEA 1WBXB 3BX7C 3KWVA 1OTTD 3I74A 3IVKB 2BRRL 1UWXK 1BXUA 3QZWA 5HTSA 2H0JA 3VG0H 1NFDA 4HKZA 5L9DH 4OZGB 3BZEA 3B4NA 3DARA 1J88A 4GRLA 4XPFL 3TYFB 3ZT6A 3GHEH 1BJMA 4IKLA 1IC7H 2HVKB 3VFTA 2FX8H 1AZZC 5D2NB 2N56A 3GLAA 4JFVA 3DUUA 4YXHL 3NCEB 3TPKA 1ED3B 1WQVT 4IS6B 1RIVL 3UC0H 2YEVB 5A7BA 3Q2LA 4NP4H 3CE1A 1FORH 5GSRB 2J3SA 5KSVB 5GIRB 3F5WB 3RIAF 4HV8B 3QQ3A 3H9SD 3EO1A 3HG1B 4QRTB 4PJ9D 4YN3A 5GGSY 1SVCP 4EVNA 5ENWA 1OAZL 2PMZA 5E5MA 1HXKA 4HU2A 4PJ9C 2ZYRA 4N0UA 4MD0B 5I30H 4EN2A 1HOCB 4JFYA 2GJZA 1OOAA 2J1YA 3R19A 1D5MB 4J3OH 3HE7A 4YXKL 1WE5A 3U2JA 1FVCA 1Z9SB 2BINA 1RJZA 1C08A 2UY6B 1TVBB 4GYBA 1NCHA 5K9JL 5DRWA 5F89B 5FYLE 3MNZA 2X88A 4J6RH 4OIAA 4WHYH 4L4VB 1LL1A 4NO5B 2X4NB 4UU9B 4ORGB 3V6FB 4N5UA 1GPOL 1BGXH 2WXOA 3FUHA 1AQKL 4H8QA 3TASA 4KKQA 4XB8A 1R3JA 5I18H 2P8LB 4QOKD 2YAOA 3CPLB 5HI4D 4YHZL 3U36A 4QJ3B 5ICZB 4UV4L 1IAIM 3BH4A 2R59A 4XPHL 1OCOB 1X6LA 2V2XA 2VUYA 1MJUH 5D1XB 2VDNL 2OJZL 1BZ7A 4LBEA 3LRKA 1T3FA 3V5HB 2OSLA 1Z0NA 3KBEA 4M6AA 4GXVL 4WW1B 5D6DC 4WV1C 5E7BA 3BQVA 4LQ1A 4Y19E 2BZDA 3GSVB 5D70L 4JLRB 5FB8A 5AD0A 3HOGA 1XF4A 1Q9OB 2HTLD 3OGCA 4YC2C 4H8VA 5DS8A 4F7CA 2ESVD 4Z3EA 2CIKB 4HPYH 3QIBC 4N0FA 2VM3A 4K5NA 3ZQWA 5DSCB 5MEOA 2UYLB 3UYOD 1Y18A 4DUXA 1T5KA 3PAZA 3UMNA 3FFCD 3RPKA 1MCNA 1DQJB 1NBQA 4JFEE 4W9HC 5K9KB 5SWSA 4R90L 1CVSC 2NX5A 1ZXKA 3MYJB 1T03H 4BRJA 3QG7L 1F58H 1VDGA 4JM2F 3HN3A 3IDYC 1T6BX 1PCXA 1MWAL 1KCUL 1KLGA 1SNRA 3K2IA 3MLZL 5KBLA 1FVDA 2Q9OA 4JHUA 2W92A 4H2CA 4PAZA 5CJBA 3SDYL 3UG4A 2WVSA 5F9WB 1KIRA 4AH2B 2OL3B 5LXGL 5EU4A 2FGWH 3ARXA 4NFBA 3HHMA 3TH3T 2IBZX 1MFMA 5C0AA 4J5VA 2BIMA 3JWOC 3ATBA 1IE5A 4D0DB 1QWNA 2Y1VA 3F7KA 5AYTA 2V2WA 4NENA 1SBBA 3WIIH 3ZRFC 3GLEA 5FLUA 3VWKB 1TZGH 2JWYA 3O2WL 1KXQE 1FFNB 1Y7VA 3QWOB 4BFEA 3PF2A 1EEYB 4OF8A 5GJSL 2JJWA 5DJDB 1KNOA 5GZNC 2VQTA 3L1OL 3LRSA 5CR1A 4EDXA 3QYNA 3QPQD 3QG6B 5LG6A 1CFQA 1T66D 5CZXD 3CZSA 4HBCL 4JL1A 4LOUD 4M7ZB 4PH8A 4OLVL 4G8GD 4PB9L 3RY4A 1EPFA 2QR0A 3NGBC 4LCIH 1QFOA 4WWNA 5I8EB 2WY3B 3ZRSA 2D7TH 3DI3B 4ZOCA 3TURA 1TUPA 3NDYE 4KO7A 1LE5A 2B4CL 3EH2A 5FYKL 1BPVA 1JZ8A 4PWKA 3J2PA 3EG9B 4I1NB 3HZMB 2QEJA 5IFAL 1M3JA 2CKBL 2YAMA 3AS3A 3TCLB 3D39B 3BAEL 5GS1A 2JKTM 4XCFL 4LOFA 3GJFK 4GRLD 3TZVC 3K7UA 1L9SA 2YAHA 3I2CH 2H0EA 2J88H 1KGIA 2CNZA 5KS9B 2IANA 4NC2B 5HYSB 3GKWH 2VDLH 4N0RA 3LNFA 2VISB 4NQDD 1CE6A 4LCCA 3ESUF 3VJ6A 2PWHA 5CN2A 2JI2A 5DDHA 4YO0A 2BC4B 3VGDA 1IFHL 5EU5B 3FUIA 4K7PH 3MREA 4IU3A 1N8ZB 4BK8A 2VDQB 3VX1A 3RFZC 4XH2A 5DA0B 4K7FB 5BZWB 3WMQA 1MHPL 1T7YA 3GSOA 3O6FC 1EAJA 2WVVA 2F5AL 3CSFA 1KCVL 4YL9A 2F1AA 4WU5A 2OLDA 3Q44A 3NPSB 2NDFA 3QCVL 1NAML 3UC2A 5IQ9B 1FNEB 1JTOA 4MTMA 1FHNA 5HVWA 3IRZA 3L9RB 3GSNA 5FDWB 3QZOA 1KCSL 3SOTA 3QUKB 1F00I 3BD4A 5IWLC 3B9DA 2YEQA 5FYJH 4KZEL 3JXAA 4B9KC 2H8PB 2WBWB 3T3MB 3IU3A 2F15A 3KJ4C 1YY8B 3R0MA 4QRPD 5G5DB 2YN5A 4Y9CA 1ACYL 4LEXH 2CK0L 4K2UH 4DGUA 2CRYA 2VRQA 1W0VA 4CBPA 4JQVA 3Q8EA 1MI5B 1Q0XL 3ARGB 5EB9A 1FL3B 3P9WB 3OB0K 1QQDA 4Y1AD 1HILA 3U0WL 3CLWA 3FSVA 1E27A 3I9AA 5CZVL 4Z7VA 5FA4B 5CSBA 4DHLA 1OANA 3THML 5I6OA 3CFUA 1W72A 4LNVA 3VRLF 4V2CB 3ARZA 3F8UB 3EXJA 3VNZA 1FL5A 2WQ8A 8FABB 3KVDD 2I07A 5FHAH 1GR7A 3HG5A 3WXVL 1AKJD 3OB8A 4LPTA 3O41A 2WINA 4NKOA 4C4BA 5C70A 2OJEB 3HZVB 2VLME 4TSCL 3NJKA 5CEXA 4RMUA 4P48A 3EGXA 4YUEH 4WHDA 1GYCA 4UDTB 5CJXA 5B39A 1NGYA 2HRHA 3MUZ1 1ZLEA 3QIWD 2JJUA 2Y36L 1A1MB 4FLRA 4XI5D 4YBLC 5J9PA 3BH9A 1E9OA 3UZVA 4KFMA 4BA0A 1WFOA 2DQFB 1AR1B 2EVHA 3KPNA 2LQRA 3MGOB 1NANI 4WWPA 3AADB 5TPWL 4W93A 3GT6A 3G9AB 4IMLA 3BKYL 1FFOA 1C16A 3L4TA 1HSBA 3U2IA 2YA1A 2VLJD 4MB3A 2UWEF 1J9SA 5D1QB 3X14B 2OR9H 2XFXB 5IREA 3JV5A 5DD3L 1A4BA 4OF0A 1AGDB 1JWSB 2C4XA 2XSKA 2QMJA 3O6KL 4I3SH 1CFSB 1WCBA 4M8QA 3BAKA 5HDBF 1BD2D 3BVVA 4QRSA 1ZHLB 1BP3B 4PJHE 4DQAA 2K9UA 2AZAA 4MAYA 3VH8A 3NCWA 3MXVH 1B3IA 1EUTA 3IDMA 2PWFA 4NAJA 4K8RC 4A04A 1PYWB 4NCC1 5ALCL 2DLFL 1QW9A 4CVUA 5I73B 3DHJA 2JKNA 1S8DA 4X99A 3NPZB 2ATPB 2C1PB 3JV0A 3NRPA 1XTLA 4K71C 3VXTB 5DRZA 3QFGA 5LNGA 1FZKA 2XQYG 4DGIL 3RJOA 1H15A 3DDFA 4LIQL 3DECA 3ZE2F 5F96L 3BMVA 3VH8B 3AMLA 3FNKA 2VN5A 4AYID 3VI3F 3PL6D 4IGBC 3DUSA 1OM3L 1UHVA 2AF2A 4Y9BA 1T0NA 4LU5L 3BJ91 4KXAA 4U3XA 3TM6A 4OZIF 3FRUB 3QEQE 3QCVH 1HCZA 3ESOA 3CFCH 4K94H 4UM8B 1JGDA 1FC2D 1HHHB 1ADWA 4FTVA 3SY0B 1IUZA 3QI9C 2IG2H 5DLML 1JPEA 2GBVA 2XTLA 1IEHA 1A6ZA 5DEJA 3CCHB 3O9WB 3VE0B 5BUGA 1ADQH 1UTDA 4XCEA 4Z1PA 2F7RA 1CWVA 2XRAL 5GSVA 2APTA 1J11A 3EDKA 2G60H 3BESR 5IQLA 3IFLL 3UZVB 4BH7B 3VQ1C 2EKSA 2YBGA 1J9CT 5FCUH 1NGYB 1Q0XH 2YC1B 4Q56A 3T09A 5HHQB 1HNFA 1YNTB 4UDTA 1HCFX 2ZD0A 1ZS8A 2F7OA 4Y5YA 4BWWA 2BOBB 5CM1A 4Z77A 3ZQXA 1LEKB 2AEQL 2ZCLH 2F19L 3KD4A 1T21B 3ATDA 4TL5A 5FGRA 4MXWL 1TJIL 2PPDA 1NLDH 1BYNA 4NHUB 2EDJA 2NY3B 3CZJA 3V2AR 4QHMB 1FZJA 1FZOB 2XU9A 1SYVA 2I07B 3T1FB 4K9JA 3RWFA 1TEFA 2V7NA 2A2QT 5D1XC 5KN5B 4DP1X 5HGGS 3CWGA 3ZZSA 3ECVA 1I3GH 4OFYD 4ICXA 4KUZL 4Z7VB 5B21A 1YECH 3GTNA 4YXHH 5J7CC 4QJ4B 3TBYA 1XFPA 2AV1B 2X89D 1N26A 4UV7H 1EEZB 1U8PA 1I3VA 5IVNA 2EYRA 3V4VL 5FCUL 4N2AA 1ET8A 3ROOA 4JNXA 1RIHH 3N06B 1JZJA 3LNHA 3AFLA 5D2LB 4ZNEA 1IBZA 4JDEB 3Q5OA 3MRHB 3VXUA 3CIQA 3IGAA 1XCQA 4OU3A 5FF6B 3AS2A 3W57A 1KPVA 5EO1A 2IDQA 2Z1PA 5IQ9A 5F9WC 3QNYA 2D7NA 5FWQA 4Z7QE 2EEAA 4FMKA 3NJFA 4P2QB 2KDGA 1UJ3C 4KMTL 1P7QD 2V5RA 5ESVB 4HULB 3MRQA 1S9XA 4TVUA 2QADD 3GGWA 5GGVY 4UZGA 6CGTA 5FO9A 3EADA 1QSEB 1TXKA 4N6RB 2YD9A 1OHQA 5IMOA 3MLVH 4JRYD 2R2EA 2J44A 1NC4A 1ZT1B 5JO5B 4OD2B 1RIVH 2BC4A 2F8IA 4N2OA 5HGDB 2Z8WC 1GZPA 1WK0A 2E76C 1WHPA 3O8XA 1W80A 3CJJA 2Q2EB 3DMMC 4UNTA 5LGHH 4Z23A 3VJ6B 2YD2A 5EIIB 2F1BA 2PXYB 2A9BA 5TE6H 5AYUL 5CEZE 1OAKL 2J6WA 4Z5RB 1B4JL 2CPUA 2HJFB 4DP9X 4E5XG 1IBBA 4GRMA 5I71C 4D0CB 5IBLD 5BUPA 4ODTL 4Y4HD 1L9NA 3OJ2C 3DC0A 5GS1B 4XP6H 4MA8L 1BV8A 4LU5H 3BKCH 1V7MH 3VACA 3X13A 3RI5F 2OI9C 4J8RB 5J0BA 2WC7A 3LH8A 1IFRA 2H4EA 4K8RD 1EHLL 1HWWA 3GUTA 4HSCX 3B3BA 4HS3B 4NX0A 1E9PA 3D0VB 3L4WA 3W5NA 1R0AH 3BD3A 4AL8L 3V5KB 1A7OH 3SPHA 1E3XA 2VC2B 2VDOL 2EYSA 5EMYA 4ZXBA 5HPMB 1EZUA 2AJZB 4Y5VA 1IJ9A 1E5ZA 1JZHA 1DSWA 5FUCE 4L8SC 2RHEA 1KNOB 1PSKL 3GS0A 2H2SC 1UH2A 3QR2A 4XTRD 1XAUA 4ZS7H 3WO4B 4Z8FH 1QSFE 3STBA 4ANWA 1FFNA 4NUGL 1KEGL 4MJ6B 4IRJD 5FX3A 3OWEA 1HX0A 1UXWA 2ESVA 3ES6B 3TBTB 4Z76A 4FXGC 3MKKA 4XN5A 3PXJA 1NGQH 1MLBA 3NJXA 4XB3A 4OCWH 5K39B 1J8HE 1M2VB 2A74B 4OCSH 4P9MH 1U4EA 3CFJB 5DJ0A 3STLB 5SWZD 4AWJC 3F01A 4ATWA 1NDGA 1NFKA 4JW3A 1ADQA 1CDYA 4X6BA 3BOVA 1KIRB 4AH2A 1P5VA 2DLGA 4PWEA 2NYYC 4BWTA 4N87A 4WIQA 3N1FC 1T20A 2F8VA 4UBDC 1YMHA 2WVTA 1QFPA 1XD0A 2AEWA 4JL2A 4JFZH 1JZ7A 5IJKC 1AGFB 1TQUA 3JWNC 4JO2H 1I3GL 4QRPB 5DO2C 5I1AA 4YHNA 1XR8B 2WSPA 1MLCB 2XV0A 1CQKA 4P3CL 1AFVH 4M61A 1O6SA 2AP2A 4OZFG 5DO2D 3SE9H 4UQBA 3VU1A 2XKNB 2BPBA 3EYQC 4DTGL 2VR4A 4HS6A 3KPPA 4XCYB 3CHOA 5AD0B 5FB8B 3S3SA 4M1GL 4NJ9L 3ARQA 2OK0L 3EDEA 3RJDA 2W81C 2Z7YA 3WLWD 3CBKB 3V5HA 3GHPA 2DEWX 4H7VA 3RRQA 3EOBA 3SE6A 4I4WA 5JHDE 1GS7A 4MA7L 5DWPA 3DVGB 4HOWA 5E9NA 1MRCL 2MEJB 4JN2B 1TENA 2XXCB 2ICES 5BV7C 4Y1AE 3RL1A 3TBVB 2CDFA 1Q8MA 4CBZA 1H8SA 2JKRM 3QB7C 4WO0A 3HB3B 3PAUA 3CFEB 4JMXA 2XYCA 2X4NA 4FX5A 3FULA 1OD9A 2I7OA 1QI5A 3BP7B 4Y4KC 4E41B 4ENZA 4AV4A 5KOMC 3U30C 4GBXD 4J3OG 4U3SA 4L3AA 3QGVA 1BXXA 3G08A 3AY4A 4XP5H 1AC6A 2HFEB 1A4KB 1IGJA 3UBXA 2QDWA 5DK0A 1MUJB 4DKFH 3PJSA 4BWUA 3HMXH 2ITDB 2EVJA 3QDJE 2QQLL 4JY4A 2LAGB 4BV1A 2PCYA 5F7MC 3MMEA 4WEEA 3TEUA 4D9LL 4YAQA 5IFAH 3C8KB 4G2AA 4P4RB 4RAVA 1RK1B 1JK9A 5DD1L 4XP6L 4OGYL 4FJYA 2X70A 1OTSD 5E99L 1TZGL 5ICYB 1KYAA 1N59B 2FWSA 4DEUA 2PO6D 3CFDB 4P0DA 4Y89A 3QO0B 2R8SH 5AW8B 1EMTH 4B9IA 3NZ8A 3RHWF 4L1LA 1FLTX 4LSTH 4U7SA 5GIRA 3FOMA 4M9OA 2LR4A 4K2UL 5HDOA 2JJTA 3LZPA 3AT9A 4XMUA 2OMWA 2P44B 5C86A 4OKDA 2W80C 1NKRA 4IS6A 2CDEB 5F3HA 1ZHNB 3DUUB 3U0WH 5DR5L 2O5ZL 4MB5A 3T5WA 5I73C 2HP4A 4GIOA 4KH2A 2HVKA 5HDWA 4KQ0A 3DWTA 4X5XA 2BSTB 3CFNA 3TYFA 1EXGA 3GRWH 4M29A 5HDRA 5K93A 2IPKB 4EI5C 1T1XA 3SGDI 2G3XA 2FUQA 2XLLA 5E2WH 3ZE1F 4FQXB 5MHSD 4QXTB 5EZJA 4XAKD 4DH2A 4ZX6A 5F1SA 5JQ6L 4PHZA 3SE8L 4JRXA 4M4RB 3QSKB 5HHMD 1EO8H 4G7VH 2BP3A 4ADJA 1KCRL 3QRBA 2RB8A 3QJVB 4OGXL 5F2FA 3HAEA 2D3JA 5HJBA 2IADA 1MY7A 4YS4A 5A16B 2XV3A 3IM1A 3ZKXC 4I8DA 1SDYA 1GIGH 1YEKL 4KTEH 5TTRA 3ULUL 1QBAA 1MSPA 3HR5A 4TQEL 4P59L 1BG9A 4AENB 1U9KA 2VXQH 2F53E 3EGSA 3HAEB 2GBTA 5JHLH 1AKJA 1IVLA 4ABVA 2BWDA 5IHBA 4DTGH 2ICWI 1J8SA 3R06A 2QQNL 1JYVA 4E0RB 1WWAX 2E7BA 4N90D 2H2PD 5PCYA 4PJBA 2ODHA 4HD5A 2PW1A 4AMXA 2NXYC 5CFHA 4QXTA 3RWDB 5IUCA 2J8OA 3F04A 2OR9L 2IPKA 5HD8C 4FNPA 1AGCB 1N4XH 2ZXGA 4X5XB 1W91A 3KLSA 5IVXF 2K78A 3RKDC 1FUNA 4NQCD 5G4NA 4AGMA 3ARDD 2CBMA 3WFCH 4XMVA 3ULVD 3HC3H 2QKIB 1DFBL 3QUZB 1LYQA 3MLYL 5E2UL 4KDWA 1AQ8A 1WAEA 1T4KA 1TCRA 4LEXL 3FW6A 3CMOL 43CAB 4BZ1A 3LMJH 2FIRT 2AW2A 5GRUL 3HPJA 3EOAB 1E4XH 3E1ZA 4PVLA 4N2LA 1AYOA 5AENA 4X8GA 1F4XH 3LRGA 1FAKT 1T83C 3SGEH 4XNUH 1ZK9A 4HSAC 3KXFD 4N86A 4P4RA 5FFLA 3TL5A 5D72H 5EUKB 5FYJU 2EICA 2AEIT 4L4TA 4PJGA 1T80A 1VFBA 3D3VE 2FE0A 2ITDA 3RDJA 1DE4A 4DAGL 1MUJA 2OZNA 4WI7A 3AXLB 1B0WA 4NUPA 1KENL 4IOSA 1CBJA 4MNHA 5D9SB 2JK5A 3JVGA 2DWYA 3KS0H 4YDIH 5I75B 1F3JA 5FUZH 3CFEA 2HH0L 1T5XB 3QFDB 1ILUA 1H19A 1OCWH 4EO5A 3MLYH 3SBPA 4IRZA 2Z91B 3PAVA 1IAOA 5LGYA 4GINA 4A63A 5ILTL 2P26A 4CU7A 1G7JA 3LMJL 3OF6D 5I0WA 43C9A 3H1ZA 4Z3TA 4NZRL 3DBXB 3SCMC 1ORSB 1WIPA 4JMNA 2F58H 4JFPA 5IIEA 1JJUA 2IH1A 1A6PA 2F19H 4G8FA 2IOIA 1J1XH 3T6ZA 3V0FA 1TJIH 1EAQA 2PXYC 2JCCB 3H9ZA 3OMNB 5F9AC 3UX9B 1NUDA 4Z7WB 2L04A 1G9NH 1WA0X 1KYOK 4N2GA 1M6UA 1F3DJ 2B39A 2B2XH 2YUWA 4KY2A 2MNUA 2R1XA 3BAYA 4E42A 3BE1H 5M95B 3K6SA 1J9QA 3GJFH 5DVKA 4ELKB 4XNXH 1RHFA 3NIDB 2Z3FA 1MPAH 4MXVF 5I1AB 4KO5A 2OAAA 4XVUC 3UC0L 2D73A 3EO0A 4LPYA 4ES8A 1MCWW 1T20B 2C8NA 3SPGA 1KELH 1PLCA 2JQZA 1XGTB 2XXFA 3BPOC 5J12B 1Q9LB 3CHQA 3QHZL 4M4PA 1JRHL 1JAEA 4A2DA 2RFXA 4JPVL 2GCYB 4X5RA 5CUSL 2D2CC 2Q6WB 2BZCA 4ILDA 3VXRB 4JRFA 4LHUD 1HHGB 2Y1AA 1M2VA 1K4DA 1F4YH 5BXFA 4LLUB 1X4XA 1SOSA 2ZAGA 4RX4A 1NLDL 3DJZA 3IGUA 4AG4L 5LAXB 5D7LB 4ZMTA 3Q48A 3B83A 1H8OA 2J8HA 3NVQA 3ISYA 4DOHE 3ULSB 1K2DB 3OKMB 4KPHL 3BPNC 4JO8A 1DJHA 3QARA 4JM2D 2YRZA 1E30A 3H7BA 2YD8A 3LDBC 4BXSV 4JFFA 3MUUA 3CZEA 2X1QA 3CHPA 3IMTA 3T6QC 5MEQA 3D4YA 1P84K 5CD5D 3ULAB 1QLEL 3NA9H 3HC3L 2D03L 2X4RA 1UJTA 1JZGA 1B9KA 1G5AA 3EBGA 2L7QA 4Y1SA 1CXFA 3R1GH 3L5WA 3VGHA 3DX3A 1DUYB 2IANE 2YMOA 2DQHL 2F9BT 1G6RH 4PJ5E 2N0KA 4C83A 3QH3B 1WZAA 5E23A 4APXA 2P5EE 3TT1L 5IJCC 3IGLA 5AL8A 1NQBA 5C97A 1KBKA 4G7YL 1VIWA 2C5DC 4K73A 3ZTNH 4JAMB 3LIUA 1X4ZA 2BWIA 5HHVL 2GIXA 4XNUL 1JWUB 4JRYB 4YVNA 1XCXA 5BW7A 1A3LH 4JDTL 1G0DA 1IEBB 1LD9A 4MASA 2KL6A 5JA8B 5ADPH 1OW0C 1A1OA 2XTJC 4PJIA 5EIIA 2FECI 1NC4D 1OF2B 2H3KA 4PG9B 2WWMD 1ITCA 1HEZB 3KWXA 4Y16C 1BPLB 3HHSA 1OSEA 3HUJA 1NDMA 4F8NA 3OAUH 1KJ2L 4QTFA 1B4LA 1QLRB 4OD2A 1T6WA 3FQWA 3M07A 2R2EB 4BUGA 2HVJA 4AL8H 2R29A 1JVOA 1YJDC 5IMOB 5ABZA 4JZJA 5GZOC 5FO9B 3QDHA 4R90H 1THCA 2Q6WA 1AD0A 1I7UB 5IK3A 1MFEH 1IARB 1KCUH 1H8LA 3II1A 3C5ZA 1Q9LA 5ELIA 4JUTA 3BSZH 3JTTB 1QI3A 4ACTA 4W9LC 4WENB 2Y5TA 1BQ5A 3N1PC 1RK0B 2F54E 3RVXD 3O3AA 1WBZA 4WWID 3FTXA 5DRXA 3ZE0B 5DC9B 1E6JL 2DQEH 2XNAA 3PFUA 4OTXL 5E7FA 4KQ4L 4E42B 4FZEL 1HHIB 1ZPUA 4IRSB 1QTPA 3MLRL 3V0VA 4HGKC 1BVLA 5IW6B 1EEZA 1U8PB 4S2SB 1OP5H 4KQ3L 1AJ7L 2AV1A 4Z7WA 1A4AA 3WHXA 3Q06A 2LVEA 3L1OH 2DBJA 3OAZH 3HEIB 1LWHA 1RVFH 1SYSB 2HLFC 4A7TA 1F1AA 4N5EC 4NGHH 3FHEA 4A55A 3EKCA 5ISZE 1CG9B 3QDJD 3M46A 2M83A 3PGFH 1YDPA 5E4AA 4CW1A 2V7NB 1ECYA 2D3VA 4F20A 1AH1A 2R0WH 2H3XC 5SX5K 1VFAB 3PQYE 3T1FA 3WKMH 4CGUB 3JWOL 4BH8A 4EKXA 2Z91A 4QHMA 5IMMB 3PFQA 3OHXC 1RSYA 2EDFA 1NCGA 1DQQB 3WG7B 4KKCC 1T5XA 3F58H 2Z31D 3DX7B 5B7FA 5I1GH 3K2MC 4HZLA 3OXSA 5T8IA 5F1NA 3NMEA 6PAZA 1ILSA 3FU8A 1TZIA 2VSMB 1ONQB 4F93B 4NZDA 3I2CL 2VW4A 2J88L 5HYJA 5A6IA 2DEXX 3NJHA 2ZXEB 4TLTA 4NQED 5JPMB 4S0HA 4WUUE 5DJ6A 5F9OH 4FMFA 5HVHB 1AJ7H 4A39A 3WOVA 3ARFD 5EUKA 5FM8A 3AQXA 4S1QL 5EG6C 2F7PA 2AKRA 4IBUA 2YD3A 3RUGF 5E2TL 1PZ2A 3SJVE 4BCYA 5IB1B 4KROC 5FIEA 3ATAA 3VRJA 4BHUI 2O72A 1I1YA 3MBEC 3UZEC 4DVRH 3FU7A 1FNSL 4XOBA 2FT8A 4UM8A 1L0XA 1Z6JT 1CFNB 1MCQA 1OM9A 3EGDB 3QQNA 1DVFA 2X9WA 3QEUB 1G0XA 3HMXL 2CUHA 3SY6A 3ZKMC 2BP8A 3ARSA 1P9MC 1U8CB 4G9DB 3DJTA 1WIOA 1PZSA 4PIRF 2J1ZA 4EOWL 3KHOA 5ANHA 1M1XB 4ORZC 3UJIH 5L7XH 1CD1A 2OR8A 5IJBC 5JNYB 3FQRB 3NIFF 4WJG3 1XGZA 3T0EE 2IDSA 2P43B 3ZDXB 1F02I 2C1PA 5I15L 2XPGB 2Y6SC 4X99B 3ZVVA 2HRGA 5HPOA 1SPDA 1WS7A 5GRZA 3ZKSD 3IDMB 2PCPA 4H8UA 1KY7A 1XF2B 3PL6B 4MAYB 3BVDB 1MREL 5JXAH 4BZ2H 4JY5H 5E1AB 3KLAA 2VAJA 3HNSH 3EGSB 4M8QB 3THMH 1J5DA 3D8MA 5EEYA 4TPRH 5FYKD 3VCLA 3RX5A 4TSAH 1QOKA 1G9MH 4JB9L 3F7QA 3G6JE 4Q4EA 1HN1A 3BGMB 1OGAA 4NQCE 5D1QA 3EFFA 1HKLL 4EMZA 5D71H 4Z7NB 2CD0A 2CXKA 3PNWA 4OUOA 1VPOH 3GI8L 5I17B 3V0DA 2WQVA 3BVWA 2R2CA 4NZUH 5E99H 2OYPA 3S35X 4BXVA 3Q8AA 4QY8A 5HYJE 1E9OB 3GM8A 1XZWA 2RCSH 3KYKH 4JRXB 3WGVB 4PP1C 1KMGA 3O4OB 1Q38A 4KK9C 1L3NA 1GYUA 3QZNA 3FTVA 5KWYC 4AC2A 4POYA 1N0LB 3C5SA 3C8HA 2EDQA 5D7JC 5D7LE 4BFOA 4DVBB 2BSTA 4PJHA 2V33A 5I75C 3HLAA 1UZ8B 4UIKL 3MGAA 2R7EB 5F3HB 4XGZA 1HCYA 2OJEA 5GGRY 4WV1A 3EFDH 2EP6A 1ZSDA 2OMWB 1YNKL 3O2DL 3BPCB 4FG0A 3KE0A 4GKLA 3P0YL 5IFJA 4MNQA 3H9HB 2FL5A 4PJEF 1N59A 1E0OB 1SGKA 3FH5A 2XZCL 2JKWA 5FGCE 2X70B 1GZQA 3D2UB 4CAGA 1HK6A 1KTLA 4OZHA 3WAKA 1OAUL 4URKA 3OJMB 1ZGLB 3UPCA 4Y2OB 4UQ2B 2LFGA 2FEDD 4L2LA 1EVUA 2OCCB 5AOLA 3SDCB 3O2WH 4DKTA 1ZWIB 5DK0B 3TJPA 1YUHB 2XWDA 3N2JA 3VI4F 2P4AB 2XQYA 3VDAA 1UEMA 3QEHB 4DKEL 3DTXA 1PKQB 4XI5C 4KKRA 1CTMA 1PAMA 5HGHB 5FDWA 4OLVH 4FXTA 2ZKWA 3WEXB 1LM8V 3AACA 4FZ8H 1HE8A 5FA3B 5FW8A 2MQ3A 4N2IA 3IJYB 5EOCH 4PS3A 1N4XL 3B56A 1SHXA 2P45B 4HC1H 1V3MA 4RSVA 2AJXH 2CLRA 3DROB 3CXDH 3MREB 4IU3B 2JF1A 1FIGL 2QGEA 2ZUVA 3GZKA 5L0QB 5CU9A 1AS8A 4YDLC 2XRAH 1SDDB 2J8UB 3QEGL 1GA2A 4JCLA 3HE6B 5F9DC 3T2OA 4LCCB 4PRHD 5HI3D 4TQEH 5K9OB 2IANB 3C6LC 4NM8L 5D4JA 5DQ9A 4KWUA 5E4EB 4MCZB 5FM5O 2WK2A 1IL1A 3RU8H 1OCZB 4TVSa 4R5TA 2VOTA 4YHKL 1IRAY 2G4GA 4M7LH 1IV8A 4PGZA 4JZNB 3A24A 1TQTA 3TCLA 3FONB 1MLCA 1A2YB 3FQ4A 4U1JB 5EULV 4K07A 5JW4R 3U2SB 1COBA 4HOZA 2VMCA 1JVKA 3KWWA 3DOIA 4L29A 1IZJA 2YQ3A 3DLQR 1XL6A 2P5WD 5D71L 3VI3E 4F9LC 3QI9D 1P5VB 2QLYA 1NGZB 1WUNT 1Z9NA 1XSOA 3MCLL 3I02B 3D87B 2H0PA 2X3BA 4RGOL 4NZUL 3QG6A 2XUWA 4PJ5D 5L2KB 5E2UH 3IMRA 3D39E 5K39A 2R15A 3MKGA 4XC3L 4EDXB 3FO2A 5F1OB 1F18A 2EXWD 4H2AA 2BCMA 1MG2C 4AVJA 2XI9A 1P4IH 2E7MA 2ZIDA 1CLZL 1MVFA 2ZCKL 1IC5H 3CDFA 4JG9A 3RTQC 4OLZH 4G42A 3RU8L 1HE7A 1DLFL 1QX1A 1WEJL 4OQTL 5HPMA 3V4PB 3EFDL 3T2NH 1Z9OA 3JV6B 2K6WA 4NZFA 5ABAA 4JPQA 3SE3C 3T77A 5BRZE 2G3NA 3I9IA 3V5KA 4Z3GA 1LK2A 5SWZB 1KY6A 3D0VA 3NAAH 4PW9A 2AJVH 4OJFL 1R5IA 3MGTA 4NBXB 1RP9A 3U2SA 2WXQA 1A2YA 4F8OA 1TO5A 4KXCA 3FONA 2FJSA 3S88L 1G94A 1UKSA 1ND0B 2JNZA 3KPSB 4YDIL 4NC1E 1DQJA 3O2VH 4GRMB 4V11A 2A4ZA 4JRWA 5AUMB 3WIAA 4FNRA 4MCZA 5KBMA 3GHBL 2F1EA 2JE8A 1ULVA 4N0FB 2AQ2A 4CKVX 2PXYA 1VFOA 2I25N 4P2RD 5F7KC 3DI2B 3OKOB 2IH8A 4Q6KA 3F83A 3K91A 3Q7JA 5HGDA 4DKEH 1XGRB 5CUSH 2ICEC 5IEKA 4ZTEA 4DK5A 4LBEB 2PW2A 5D1XA 1N10A 5E24E 4U1LA 4XPGH 1O5DT 5H37A 4DP8X 2VH5H 4OQTH 1DANU 2E4FA 2OCJA 1U8NB 3H55A 3MRQB 4J3WA 4NRZB 1R3JB 3W1ZA 3CFQA 1OARH 4P2QA 1G9NL 1WV7T 3UTSD 2YAEA 4ORGA 1OP4A 3QNYB 3O4LD 4P9HL 3V6FA 1XCQB 3NA4A 1AOHA 5HGHA 4JDEA 4NQEB 4ISVB 5CJQH 2MKWA 2NMSA 5EPMB 4E9QA 3DTXB 3MNZB 5K59E 5DK2A 3DHPA 1GS8A 3FQTA 2VDML 3QNZB 3MXVL 4NKMB 2OMYB 1YUHA 3I9GL 2ZSVA 5KEZA 4Z7UB 2BSSA 3CZLA 3PIQA 4O5LL 5AB0A 2Z6FA 1VZHA 1QACA 1BIIA 5IBLC 4DGIH 2FWLB 4RMVA 4EF3A 4KJPD 3HC2A 3Q5TA 1QASA 3FXIC 5E9AA 2UZXB 2AK1L 3F65A 1GGCH 2DQEL 5AVQB 3CSGA 2WNKA 1R1CA 5EBMA 1CFVL 3EO1B 4R7NB 2WVUA 3H9HA 3F5WA 1ORQA 1V27A 1K6QH 4X4MA 3T8VA 5D2NE 3LKQB 4G71B 4S1DC 3BPCA 1FZJB 1FZOA 2YFNA 4GNKB 1R46A 1ZSDB 2G4EA 3BEWA 1JHLL 1ED3A 3BUTA 4P3DB 3O9WD 4WCYH 1KLFA 1LMKA 3L45A 1UZ8A 1W8EA 3B43A 4M62L 2CHXA 2M8XA 3HN8A 1GZHC 3DXAD 3MDJA 4MJ5B 3SE4A 1JFHA 1DBBH 4GRLB 1Y6NR 2BOBA 3KR3H 4HKZB 1NFDB 3LZFH 4AJ0A 3V7AG 3WD5H 3B9AA 1E4KC 4X7FC 5GZOD 1CS6A 5FECB 3BSZL 1UG9A 3WKML 2PN5A 4G7YH 1YQ2A 5D7JD 1U8MB 4LQFL 2GJ6D 1KFAH 4NQQA 4E9SA 1XCTA 5HDQH 5CNHA 2R69A 2G9HB 1A3LL 4HUXA 5DVLA 3RWGB 3CCHA 4UQCA 2ZONA 3VGEA 5A2KH 1MCOL 2NY1D 2HUEA 4F5CE 4Z7NF 3MUY1 1HYSD 5GGSA 4DGWC 4BKLA 1GGCL 2G3MA 2VWEC 4FTVB 4OCXL 3SY0A 5MP6L 3ULUD 2CKBB 2WTRB 1KIQA 3VYNA 3BGFC 4RIRA 4M7LT 4PR5A 2PYFB 3BKJH 4GSUA 1TR7A 3D0LA 1AZBA 2C3XA 4L9LC 4XN9A 2DM2A 6FABH 4HKBA 4JRXD 4MDJA 2D7MA 1F8TH 1VKXA 1U41A 3MV8B 4XC1L 5IROA 3LQZA 4NGHL 3Q2CA 4B5ZA 3M1OA 2JXMA 3FSAA 4ZMOA 1YEDA 4J28A 3CU7A 3GO1L 1J5OL 5D4QA 3KNBA 2AEOA 3VDBA 1NCBL 1FNSH 1S5HA 1NCDH 1DL7H 1GJUA 2CBQA 4HLZG 3EH1A 4Y9FA 1UZGA 4PYGA 1KCWA 1JYNA 4K3JH 2XETA 4A38A 4P2OB 4CUCA 3V9EA 3DPBB 3L6FA 3W39A 5HDBB 5EO0A 2BP8B 2QQKH 4N0YL 1F86A 3NRFA 3QEUA 1KC5L 1P1ZB 2WLZA 3Q13A 4OM0H 4YK4B 1CFNA 1CXLA 1MY5A 1ZT4B 3VXNA 4G6FD 1SJMA 4NNPL 4I3GA 4IKKA 1SMAA 4HC1A 4LVHC 1I1YB 3SBWA 1HQRA 5DHVB 4IBLT 1U3YA 4ODBD 4ZX4A 1JFQL 2ZZUT 1KSRA 4P57B 2AKRB 2O5ZH 1CO1A 3HJEA 3MO1A 3S3PA 4P2RA 3F3HA 4KKAD 1MCRA 3TA3B 2RR3A 1X4YA 3BH9B 1FFPB 4LBAA 4PUBH 2IO5A 4KKLD 5H8DA 5HI5D 4BFBD 2AXGA 1M6OA 4JFWA 4QRRA 1TZIB 3MRMB 3GFUA 2W9EL 5FHBL 4FQJL 2DV6A 4XCNA 2WO2B 2A6IB 5L88L 3T9WA 1FYTD 4LSDA 2EUZA 1TU2A 2H26A 3GPEA 1G4MA 3EH5B 3K4ZA 1Z0MA 3TFKC 5DZAA 2ZWLT 3RA7H 5FV1L 3GXIA 5T3ZD 1ZS2A 4CVXA 5EU3A 3S3JA 3EYUL 5FYLD 3MRNA 4X6FB 1QP1A 3VYPA 3VFVB 4PYHA 4P59H 3FQUA 3II2A 4IKIA 1KIUB 2WTPA 3CZNA 3ILQD 2YAPA 1BBDH 2A7BA 4P2QE 4KVCH 4J4PD 4YDLB 3GIZL 3Q8FA 1J5IA 5LBSA 1R5WB 3V6OC 4ETQB 1OD7A 2JTDA 2VLLB 4JGNA 3GMNA 1HWGB 4IMKC 4R3SB 3ARGA 4J1UB 2WLJA 5I1KH 3S35L 4S2SA 3KPSE 1JUFA 1X9RA 3V0VB 1KEGH 4CC0A 2VXUL 4NQDA 4OV5A 1YY8A 2XWTA 4QTHB 4UANA 4NB7A 4GLRH 3LKSA 4MJ4A 4K23H 2XNAB 4LPCA 5J57B 1YPZF 3OSKA 3ZTJH 4K3EL 5JTWA 5F6IC 2AI0H 3GBNH 2AK4D 1R3IH 2NW3B 4QTIH 1IGTA 4M7JH 3AWGA 4F15B 3B9KC 4HWBL 4LRNH 1J48A 1GMIA 5IK3B 3MSPA 1P7QA 4U1HB 2IFFL 1JPFA 4D7PA 3KW8A 4DK6A 3D2UD 3FTGB 2E9JA 1DZBA 1WD8A 3GSUA 4KRPB 5I16A 1IZKA 3CN3A 5J6SA 3MFFB 5DHMC 3S97C 3REWB 3P4MA 3R4RA 1VACA 1OCCB 1NDMB 3QJQB 2DWTA 3MRJB 4JKPL 5DDHB 3T65A 5KUKA 5EORL 1QRNB 1HEZA 3FU6A 5EWIL 1D5BB 4DPBX 4RNRA 2MFNA 2X5PA 2X4OB 5HYSA 2XZAL 1TJGL 4X4YB 1CL7L 3EYOA 4FNQA 3L3IB 2B77A 1PG7W 4EUPH 3V8OA 3GDCA 2AQ1A 2MSPA 3CXDL 3KLHD 2DIAA 2PABA 4K3EH 4U0QB 4U6YA 4WWKA 2EO9A 1U8QA 1KGWA 3MJ9L 4TNVF 1KIPB 1MRDL 4G11A 3B8YA 3HA0A 3WFDH 1CK0L 4ZUUB 2CR6A 3KYOB 3PWUA 1THAA 1DUYA 3NCFB 2PNDA 2PP8A 5BZZA 1B88A 2G5UA 3KPOA 4NZ8A 4U1NA 4Z0XA 3EJSA 4XE0A 2HVBA 4OJDH 4YDKH 5J5EA 3VVWA 2AC0A 4RDQF 3MYZA 2ESVE 1JHTA 3MLTA 4JO5A 5I74B 2GI7A 1CYXA 2XQYK 3WV0A 3IFPA 3H7BB 4JPWH 4LL4A 4XMWA 3RP1A 1YHPA 4PUBL 4EEEA 1JK8A 1QEWA 1PJ9A 3NK4A 4PRHB 4I1RA 2VDLB 1XHHA 2QQLH 4XMZA 3U1QA 5IUSA 3ILDA 4QAMB 2H32H 5TQ2H 1DBAH 4B9ZA 3CAFA 4NENB 3RUGB 1E5CA 3D06A 1JNNL 5IJKA 1UOVA 3QVAA 4K94C 5CSZB 2X9XA 3VXRA 3IAPA 4W9ZA 4NNYB 3PU7A 1SJEA 1IGYA 5E70A 1F4WL 4OFPA 5I6PA 1BAWA 3QUYB 1FVDB 1KZQA 1QKZH 1TIUA 2VSDA 4PRIA 4NO2B 1JZ6A 1Q0YH 5SWSD 3PUUA 2NX5D 2NY5C 4PCSA 3NH7L 2WZ6A 1NCOA 1SFHA 2DQMA 1UENA 1ZJAA 3CH8A 4DGYH 4KVNH 1N6QL 5GJTH 3VM5A 3HG0A 3QUXC 2BDNH 1GVIA 4L3CB 5DR5H 2DWDB 2DH3A 3N43F 4R7DA 5B1BB 5K9KA 3UTSE 5DMJB 3GMPB 2E27H 4ZX5A 4EAEA 3SPCA 1JHKH 2HUHA 2YOCA 3Q43A 5GGTH 4JPSA 4ELMF 4IOFD 5AFAA 4UUJA 1DSFL 1F41A 3AG4B 4N26A 1RZJH 3QIBA 1XTMA 4N2NA 4PJ9A 4Z95L 2VDKL 1R33A 3QCTH 1DBAL 3HS9A 2NR6D 3D7PA 4JFPB 4KDTC 4ZDHB 5IIEB 5D7IA 1QFHA 1ORSA 4RAUB 3R1GL 1G7IA 4DP5X 1N5YH 3I50H 5DS2A 5DTFA 1E50A 5LBSH 3SCMA 2ARJQ 1MCKA 1FWXA 3APCA 1ZVSA 4K7PX 1DQIA 1EZSA 3QJFB 5E9DB 1MFDH 1AQMA 4FJ6A 3K5RA 3QFDA 1P4IL 4NO5A 2JSFA 2X4PA 2IQ9H 5F7DA 2LHAA 4L4VA 4QWWD 5CHNA 5C0ND 3E8UH 5I19L 5DRWB 4GIAA 3K6FA 4E5XB 2WYZA 3IJSB 2G0LA 2UY6A 3BQUB 3UTZB 4M3KB 1C08B 2VO5A 3UTQA 4D3CH 3DOSB 3Q2VA 1SHMA 2A6JA 1OARL 2VN6A 3TV8A 2VLMD 3OAUL 4L4TB 2FWUA 4LDOB 3KCPA 1TJGH 4QCIB 4DO4A 2I85A 4EZJA 3FCGA 4DW2H 3TIDB 4NI6A 1G4RA 1XH3A 3QUZD 4UTBA 1OPOA 3X11A 1XSIA 3B9KA 4QRTA 3DJSA 2X44D 5GGRA 1ZA3A 2ZCKH 1TCRB 4YXLH 5F7FA 5JOPE 5E94B 2JQAA 4JHAL 4AM0A 4LVOC 4ZW8A 3ZU8A 2VR8A 4JKWA 3DHUA 1TYJA 5HYFA 1BEYH 1DVZA 1RD6A 3CQPA 1KGCE 5AALA 4NHCL 2NW2A 3SPIA 3FO9A 4M6MH 1MHCA 2GKIA 4NQXB 2E6PA 2DOCA 5EIQA 5FO7A 1EFQA 5FO7B 2C9VA 3HS0B 4NQXA 5CN3A 2NNFA 3AGVA 2VSKB 3NZHL 2UWEE 3FCSB 5T1LA 1LO5B 3WIHA 5D6CB 2B9AA 4FNLH 2NY4D 2KERA 3SO3B 4AM0B 4EN3A 2BH0A 4R97B 4GQZA 4U6VL 5J3HD 1CI5A 2V37A 5INCA 2ORBH 4I0PB 5GGRB 3UP6A 3WY3A 1Q1PA 2WPGA 1ES0A 3OL2A 5FCSH 4FXLA 2WZ0A 3JWOH 4MNGA 4LOEA 3ZZLA 3QORC 5CU5A 4AYDC 5A16A 3F58L 1A7RH 2YOAA 4G5ZH 1ZXQA 5IW3A 1EXHA 3CVIH 2ADJA 4Y5XA 4EZKA 1VAHA 2R29H 1PIGA 3NSDA 3D9AL 4Z7QB 4OFDA 4YR6B 2AK1H 3TA3C 4W9EC 2TRHA 2GW5A 2IWKA 3V0WL 4NZJA 4NPJA 3IJEA 1JNHB 2CLVA 3NIGF 5DXWA 3GMOA 3W9DB 4KJPC 3DXAA 2MTPA 3CVHL 4E5XA 3HHRB 4ERSH 4NCDA 5A6LA 3BXNA 4G43B 2FQDA 5GS2D 4HISA 4OZIE 2Z7ZA 4OVUA 4ZQKA 4OFIA 4ZS6D 5EBWB 1ZVHA 1ZHNA 4YSUA 4FYSA 4GRWB 1LGVA 2CDEA 1NBZB 2VSCA 4HIEA 3QJFA 3O6FD 3QXAB 1JGVL 5E8NA 3DGDA 4LGSB 2GT9A 1MCEA 2D0HA 2W5PA 3FOMB 5HYSG 4Z7VE 3NZ8B 1WAAA 4F9PC 3ZZQA 1T22B 4XWOD 3HVDA 5IG7B 2XOTA 1WP6A 5ICYA 1UATA 3BWAA 5D7IB 4ZK8A 2GBUA 4AKQA 1CLYL 5K69A 5TH2B 1XMWA 1ZANH 4RAVB 3WNJA 2VDPL 3QIBB 1HZHH 4FL4C 3FB8A 1CFMA 4JRLA 4MA8H 3X1FA 4UUJB 4ZUWB 2ZXBA 3RQ3A 1BZDA 4LFHG 3WYRA 4JFHE 4ZUSB 4FA7B 5EZOL 3FT0A 4KK8D 4Y2LA 2EUVA 5B8CC 4L3CA 2E7HA 2FJHA 4XNQB 1AMXA 4YBQC 1KV3A 1AHWB 1ZE3H 3C60B 3N1MC 3REVB 4E41A 4AKPA 4QKXB 4XPTH 3RWHA 5KVDE 4B9CA 3KR3L 2X38A 2CHNA 1G6RA 1QO3B 4PS4H 4YNYA 3X12B 3WD5L 1KCBA 2MRYA 3AG3B 4NN7C 1V3JA 1LNUB 1VHPA 2X1XR 3TJEH 2QLVB 4FGMA 2JB5H 2WP3T 4G6FB 3IXAA 4H1LA 4JANA 4UT7L 5DJYB 5KVEH 2IFGA 5CP7A 4FLHA 5CGBA 3TIEA 4S1RL 4I4WB 4A2HA 1XF5A 4ELDA 5CCKL 3MLPA 2NY2B 3AY2A 1X5KA 1L9RA 2J21A 4ESKA 3D1MC 5A40E 4MLIA 4G80A 4IHOA 4OCLC 1JK8B 1QEWB 4PJXA 4OFVA 1UT1A 3KJ6L 4XCYA 5D7KE 2A77H 3CVDA 1QLEB 3KPPB 4TM9A 4B7IA 1AXSA 2F0CA 5D8JL 1MN4A 1RQ5A 2J25A 1C12B 4U1NB 5B4MD 2BVYA 2J12B 4P46B 3KYOA 5E1QA 1GGIL 1XR8A 3MODH 1EZVY 3L81A 2CCWA 3QQDB 3SD2A 1AS6A 4XP1H 3GB7B 4BINA 4PJ8A 4LHQB 4NQSB 3JZYA 3L13A 5IOKA 3GBML 4MD4B 2NY5L 5DFAA 1PAZA 1VGEH 3D4ZA 3EOTH 1LP9A 5KBKA 1P4LA 1RZKH 3LZRA 3K2KA 3L3HA 5DD0H 4ZMNA 3EJZC 5DJ0B 3ASNB 4WEUD 3STLA 3O81A 3JVGC 1LILA 4K23L 2WQXA 4UTAA 1D5BA 4YSEA 4JZJC 3V0IA 2LFEA 1N68A 3P77B 4HFUH 4MJ6A 4N4YB 4AVIA 5EEVA 4ZW3A 3MOBH 1FGVH 3P4MB 2XWBA 3Q2WA 5TF1H 4C59B 3ECBB 4JM2A 4OV6F 5ICUA 5F0LB 5I16B 4PRDB 4HEPG 2BVPA 1NC2D 1YNTF 1ZVYA 1UJ3A 3NJVA 3LNEA 2Q3XA 4D8OA 3GIZH 2EYSB 4N1EA 3WSQL 3UAJD 1NANH 2J20A 3MOAL 5D5MF 4EQ3A 1FNGA 2YPVA 4P2YA 4QO1B 4LAJH 1P7HL 1CVRA 1E9PB 4UOQA 1ZLSH 3LRHA 4HS3A 1IGTB 2AGJH 3CBJB 5FGSA 3PHQB 1BMZA 5E1GA 1FPTL 4PJ8C 3ULUF 3SGJA 5IHLB 1I1RA 1G43A 1F11B 2OMNA 4ODXA 4J8RA 1HHKB 1ZTXL 2VXUH 4N2EA 4HLJA 3QUXB 3QJHA 2BP0A 3AWEA 4ELMB 1OQOA 5AAMA 3ERXA 3K8KA 1WRFA 5B3SB 4RWHA 2AJXL 1BVKA 3II3A 4OV5B 4ONGL 5JORA 4YHIA 3LCYA 3FCBA 4Z5RA 5I82A 1G1YA 4D8PB 2DMGA 3HMWH 4GQ9L 1YY9D 2XN1A 3P4NB 2VLKD 4AEFA 2JCCF 1EH9A 2VLLA 2PKDA 3LNDA 4W70A 5C2BL 2JLPA 1R5WA 1KPUA 1NIAA 1QA9B 3KVQA 4RQQA 5F9OL 3ZZ1A 1RZJC 5IR1B 3S8FB 4M5SA 1IGMH 3GPSA 4KAQL 5C0AE 3CVCA 2OMZB 4Y1AB 1Q9WA 2ZICA 4WTXA 3RVUD 1VESA 1QSEA 5IROC 5BNXD 4WW2C 4JVWA 4NWUL 5G55A 1S9XB 1UB5B 3IU4L 4UB0L 1BREA 1T1ZB 3TVMB 4L9LA 3RGVB 5JIDA 4PBVC 4H44C 1NIFA 1BVOA 4AV5A 3E6HA 2YPLE 3W11C 2B1HL 2OW6A 3B2XA 1D3CA 5CFAA 5FF6A 5EFIB 3ZGHA 4YPGB 1I9JL 5KVDH 5C71A 3GMMA 1KULA 1JP5A 3HIZA 1J8RA 4F1SA 4LHUB 4MD5B 3UXFA 4JFOA 1CGTA 4FHKA 5KVFH 1G7PB 1KB3A 3Q3GB 2EDYA 1AIFA 2X6AA 3L5IA 3GINA 1PBYA 1DEEB 3ZLQC 1QFWI 2OSXA 5DFTA 3WFDL 4KHXH 1F90L 1SXSA 3DX8B 3EYFA 3GKZA 4U1MA 2HLAB 4ZFOL 2MQCA 3PP4L 1F6AA 1S7WA 4P99A 1GZHA 1QAWA 1AZUA 2XWEA 4U6XA 3SE4C 1IGML 3HMXA 1A6UH 4KAQH 2FJGB 1SUJA 2TAAA 2VABB 4NJAL 2BSED 3FUFA 3UO1H 1CJYA 4YOKA 3T2NL 1HIML 1IQDB 2PCFA 3F12B 3FZUC 3O3UN 4LVNB 5AVRB 3G5YA 4N68A 5F1IA 5D2LF 2OL3L 5DMIH 5AVVB 1YMMD 4PPTA 2IGTA 2Q8AL 2Y2YA 1SYVB 2XWRA 3WFBH 4E9XA 1AG0A 3E9TA 2IEPA 2X09A 4OM1H 5AAWC 1I3RB 3HRPA 4NBZB 5EA0L 1E8XA 3W39B 3DPBA 4NHUA 4ALAC 1ZT7B 2YXFA 3B6SA 4LASH 4Z95H 2WAQA 4GBXB 1GTFA 1T21A 1VPOL 3GI8H 4XP4L 4LEOB 5T3XE 4QHNB 1AO7E 3VW3L 2IQAA 1NGXB 4O58L 2K6ZA 1NM4A 4P8QA 3Q6FA 3MUGB 1KB5L 3OMZA 1VF5C 4S11A 4XN2A 4UMSA 4M3HA 1NGPL 1MCJA 1MF2L 3BUIA 3MBWA 2AAVA 3SO3C 5GSVB 1RLBA 2ZCHL 4RMQA 4Q9RL 1IILE 3KGSA 3G6JA 4KFZC 2WXFA 3O9WA 1J12A 3L5XH 4C4KO 5SV3A 3TEWA 4ZMAT 4YEFA 4YWGL 2YBRA 2MNJB 1A0QL 3T1WA 3P2TA 1KIQB 4FQ1L 1YNKH 3O2DH 4PTUA 1DO6A 2ZF8A 4IOSD 5HHME 4Z0BL 1MNUL 3SCMD 3FRUA 3ZDWA 5EF2A 1UXSB 2NT1A 2NY7L 4OGQC 1RZPA 3MV8D 5AWNL 3QP3A 4H88L 5IEHB 4U7KA 1MZZA 2DQJL 3G6JB 3BISA 1XR9B 3CSYA 3PWPD 4V1DD 3ZE1E 1WJ3A 4LSQL 3FHAA 4D2NA 3MBWB 1U8MA 3BD5A 4BQBA 5H94A 1K72A 3U25A 2YKKA 1RZKC 3VW3H 5FECA 4P23C 1FZKB 3VAEA 3FTUA 4X7DC 4O2CA 2BRQA 2J4WL 2BNUB 2C3VB 3CFIC 1ZLDA 2W60B 3EOYG 4H1LG 4IBZA 1AGEB 2OA9A 4AYBA 1R75A 4GBXA 4X6DB 2YK1L 5E8OB 3W37A 3PUCA 5I19H 4NWUH 5IM7B 4ZQTA 4JG0H 3M1CA 1K85A 4O9HH 1NTDA 1ORQB 3ML8A 2XY2A 3ARDC 3MV7D 4GAAA 5BJTB 3W2DL 4N2HA 5IKCB 4X6EB 4FERA 4GS7C 4DT2A 5DJCA 4L8CB 2FQFA 2X40A 3X14A 1YY9C 2YD1A 3WNOA 1D5XB 2B2XL 1ZA6A 4DUVA 2FEDC 4XVTH 3RHWK 5LQBH 4JY6B 1F6AB 3LKPA 1C16B 1I53A 3HFML 5D7JA 3RY6C 3DX8A 4KZCA 5CILL 2CGYA 2WQAA 1RUAH 5JIQA 1DEEA 1MAJA 3MGOA 5IVXE 4XAKE 5EZPA 2DQFA 2O6EA 2Y2TA 3HE6D 3CGTA 2Y7MA 1HXMB 4FFVC 2VRAA 5IW1B 1G7PA 5J9PB 2BIOA 3VXRE 3CX5J 2OMYA 3VGGA 2Y1YA 5K59F 4Q2ZB 4LHUA 4MD5A 5EF0A 4QLRA 2QSTA 1PX8A 1WDAA 2AFNA 4XCCH 3TWCL 4JHAH 2UXGA 4Q6IC 5EFIA 4RFEA 2GTQA 2R4RL 4B50A 4TTDD 3FN9A 1DQML 1OP3H 5E03A 2ZWSA 2QVIA 3LXAA 1WFJA 3ZTCC 3B9EA 1PCSA 3L4YA 4F2MA 4NRZA 3BHBB 4MAUL 1JGLH 1FL5B 3FQ2A 8FABA 1ZSHA 2HKHL 3V4UL 3BPLB 3ARBC 1HQ4B 1SOXA 4FJZA 3WFHB 3ZHDA 4KTGA 2PW2B 2R2BA 3JZ7A 5BMFL 1A8ZA 2GVYA 1A3ZA 3MRGB 2HYMA 2FLBT 3OKOA 1L7IL 2W1NA 4AVHA 3TZVB 1T89A 1YA5A 1UFGA 3V79C 4K55A 2XYBA 3LPFA 2MOQA 3RAJL 5K33A 5CD3B 9PCYA 4KVPA 4IEFB 4D8PA 4GXFA 4S1SH 4UOW0 5AUMA 2ZCHH 3AG2B 5IB5B 5A3ID 1YMMA 1H5BC 3PLYA 4HUCA 4AXWA 3EO9L 1MNNA 1ND0A 2BP0B 1X5LA 4P5KA 5DFVC 3JWDC 1BCIA 3QWRA 4B27A 2FZ3A 4ZMWA 4GY4A 5ID0A 3LD8B 2KZKA 1I7RB 2PWEA 3B7RL 3GSNB 1AHKA 4NKIL 2B59A 2FH6A 1NPUA 2DQTH 1NOFA 4WU5B 3GDBA 4AYFB 3T77B 1G7QA 3BW9A 2XN9E 3GTVA 3V4LA 2H1PL 3NP4A 2OP4L 1JGLL 4JGJA 3V95A 1CI3M 5BZWA 4PTTA 2H47C 4JPKL 4YHOH 2EEDA 1OWRM 1MW0A 2ADFL 2FD6L 3UTTB 4PJIE 2V7HB 4ZZFA 3KJ4B 3P77A 1P6WA 3SKNA 1U21A 1D9KC 2UUDH 4PJAE 5EOTA 5L2KE 4HUUB 5CJXC 4MRBA 4IQHA 1IGIH 3M1BB 3RL2A 3FO2B 2ZOLB 2ZWZA 4B0MM 3F7LA 5B1JC 1D6EB 4ZOEA 5KVEL 1IBHA 2OFQA 2VJ0A 3Q9QA 4QOKB 2D9QB 1MFNA 1NGZA 5KTEH 1UWEL 1D7CA 3QR0A 4HUVA 5M94B 4XO9A 2VMFA 1HZHL 3D09A 4IKNA 4O9HL 4PJ8B 4XP9H 5CD5C 2KZ1B 3QQDA 3EG9A 5CR8A 1REIA 2PTVA 3AU0A 4CC1A 5IF0A 2BFVH 4QRBA 3VG9B 5SWZE 1DN0A 4P46A 4MKTA 3MAWA 5T5NF 2X2YA 3OTTA 1C12A 2QR0B 2ED8A 1IGFL 1LO4H 1CFQB 2A9NH 5DQDH 3KGTA 2D2OA 3ZE2E 5K9OA 2BERA 3LRSB 2H6OA 2Y4SA 1ZD6A 5DJDA 1JMZA 2VITA 3TPUB 4HUUA 1EEYA 1T1YA 1FF5A 1GC1L 4PJXB 3LHPH 1SDDA 2J8UA 1JNLH 4HMCA 4CILA 4HAKA 4G80B 4I77L 1QSVA 4YBLB 1KBWA 3UBXI 1O0VA 3BVNA 3JV4A 4TRPL 3ZYIA 2V2WB 3BUYB 4PY7A 3AXIA 1XF5B 2CLRB 2WWMC 4Y16D 25C8L 4D0DA 4HWEH 1XBDA 3TVMC 4XPBL 3WUZA 2EE6A 4MWFA 3ATEA 1BAFL 1FLRH 1ETJA 3TFKD 4PJGE 3HB3C 3BW9B 3LSOA 3C87A 4Y2NA 4GP5B 1E3ZA 4DIXA 5J6HA 3MLUL 1QWHA 1A6TA 2K7QA 4OLUL 4YNYB 4UDUB 1I75A 4XMKH 1I9RH 2HCZX 3RWHB 3U30B 5SWQB 5F7BA 1RZ8A 1AR2A 1I8UA 4A7UA 2WXMA 1U3HA 4AE1A 1FP5A 2NX5B 4OQ1A 1H6TA 3BSZA 2PO6C 1IAIH 2EIDA 2OTWA 1OGTB 4G7RB 3BAWA 3JUYA 3ZY7A 2Q87A 2NSMA 2E9IA 2BNRE 4TUKL 3SDCA 5EF1A 4F7MA 3GEWB 4JVPA 5MEOB 1GOGA 2Y0SA 5LXVA 1MIML 2HMID 2DKMA 3CDYA 3OGCB 3S9DB 4R7XA 3GS7A 1SLWA 2EILB 4JLRA 5JLZA 4K71B 3AZUA 4WUKL 2XZAH 3A21A 3I6GB 3L5JA 4B9GA 4LVNC 1T3FB 2Y06L 2C3HA 4HK3J 2R2BB 3BWAB 3KS0J 2ZP9A 4KXBA 4QXGL 3I9PA 5IG7A 1HQ4A 4FA8A 3L7FA 2LLLA 4DGVH 2P5ED 5IFJB 4TNWF 1AANA 3ZGIA 3EJYC 3CPLA 4R4FH 4C54A 2AQRA 2P8LA 1KN2H 1E67A 5T33H 4G6KH 4UYQA 4F2MB 3QXAA 4JO4H 4DCQB 1NUGA 2EYTB 3A0OA 3WMSA 1EHAA 1SJVA 4KX7A 4UU9A 3UG3A 5EBWA 1FGNL 3V0EA 4I0KA 4H4NA 3RIFK 1DVYA 4PJHB 4HMEA 4ZTPH 1QFUH 1PLBA 1RK7A 4JY5L 4G9FD 4FQXC 1CD8A 3C5SB 2VWEE 3CH1B 3U6XS 4B7LA 4OGAC 1XSKA 3K80A 5ACZB 3VTMA 2VXSH 2DH2A 5IW1A 4TUKH 1BLIA 1FVCB 5L4IA 3HE7B 3GMQB 3VFSB 3T8MA 5AW1B 3UCRA 1E4WL 4Z7QF 1ROCA 3E2HC 1UA6H 2CXGA 1BQLH 4Y1TA 3B1UA 2X2HA 5SX4H 3EFFB 1C1EH 1D5XA 3GNML 4HFUL 1B2WL 1ES0B 3ALXA 5DJCB 4N8VA 3VG0L 5C0GB 1V3LA 2YKLL 4R4ND 1NSNL 2FO8A 2APSA 1QUPA 1F56A 4M02A 4TKWA 5KSVA 4I0PA 2VLRA 4X80H 3C8DA 4EN3B 3RKPA 2WQSA 2NXZD 4MNQD 3VXME 2Y2WA 1YEEH 1CLOL 1XF2A 4P23B 4YBHA 4PLKD 4BQ8A 1MEXH 2DDQL 3NSCA 4X8CA 3VFTB 3JVFC 1AGBA 5C1MB 3OXRA 5DZ9A 3ULVF 1HIMH 1JHKL 2F53D 4JO3H 2HZHA 2ZKHH 3RUGE 4C56E 4FHJA 3OB0H 4WKXA 3FO9B 3FQRA 4M6NH 1IT9L 2Q8AH 5H94B 1DZ0A 1NMBH 1YEIH 4Q9CA 4JHZA 3W3BA 2UV3A 4PRAB 5MEND 4XO4A 1ML0A 4JHWL 2Y6SD 5J89A 1HEHC 1XR9A 1F3DH 5I0VA 1T0PB 1FYTB 2PP7A 5TF0A 2NPLX 4LSVL 4PJEA 5HHNA 4HCRH 1W9XA 3T08A 3RTLA 3BYTA 5KSAA 3EGDA 4EDWL 1ET5A 4ODSH 4KMLB 1JZEA 4YSTA 4PTUB 3BVXA 1FH2A 1PLGL 3ESNA 2WQUA 4OQTA 1FNFA 2OX5A 3UYPA 2YBRB 5IVXB 1BQUA 1TTAA 4DP7X 5IB1A 4KV5F 3UTSB 3ABZA 1VB9A 4GAFB 5DEFB 1RHHA 1B9ZA 1MFCL 3WNNA 2WJ5A 1TQCC 3OZ9L 4AIZB 3NFSL 5B1KA 1NOAA 2H9GA 3MCG1 2BK8A 2NNAB 1SY6H 4IBWA 5C0EB 5DF0A 1S5IH 1J1OL 4N2BA 2VLJB 4FQ1H 5D1XE 2YSSB 3U4KA 4G70B 5EA0H 5F7NC 4BE6A 2P52A 3ARPA 4TSBL 1A3RL 5T1KA 3FOLB 1ZT7A 3B6SB 3N40P 5FOBA 2VDQL 1DQQA 3CXHK 4TUOA 5BRQA 2NTSP 5CXPA 3T04D 4FCHA 2V9UA 2ADIA 1ZVSB 2X2IA 4KJQC 4YLQT 1MW1A 4J4PC 2BNQD 4EDWH 2VDNB 4ODSL 5FGCB 4PRPA 5LBGA 5DTFB 3SCMB 4CW1B 4RMSA 4RAUA 1CG9A 2V17H 1DBKH 2XZQL 4WWKC 2KT6A 3AMKA 2YUXA 4WFED 3LH2H 1FH5H 1SYSA 2TRYA 1MWAH 4HZ1A 1GOFA 4MRCA 3O11A 5JW4M 1OE3A 4R0LC 4A1RA 3OAZK 1BM3H 2BY2A 3MX0A 4L8SB 3QFJD 5GZNA 3WO4C 1A7BA 1X9QA 2ZUWA 3LPWA 1T2QH 3GMPA 1J1OH 2W8CA 3MLWH 2L7UA 4MMXC 5IBTH 4LASL 3RZCC 1X5AA 1UT9A 1RERA 3OMAB 1IBGL 3Q2NA 5GGVH 1WBZB 4PJ7E 4L23A 3QZWG 3TO4A 5I1DA 4TLUA 1ZLWK 5DZJA 3JTTA 2YKLH 2X9YA 3C5ZB 3ABMB 1Q1JH 3ASOB 2MHAB 5ID1B 4UM9B 4APQB 3HKFA 1T1ZA 1MRDH 3MPCA 4N24A 3ZYOA 2ENSA 4JVUA 2DTMH 2HRPL 4LCWB 2YXWA 3NTCH 3BMWA 5CEYB 1NH6A 3DV6A 3KM2A 4NT6B 2D7TL 2ICWA 3P30L 3K81A 3LH2L 4PREA 5H35B 1HAWA 5J6GA 4N8VG 5IR1A 1WEJH 3P0VH 4Q52A 3FKUS 3ZHKA 4PGBA 5DQJA 3BCDA 3HHSB 1G6VK 2DKSA 3HUJB 3ORJA 3V0WH 4WQOA 3MQIA 4GUCA 1LD9B 2D4FA 3MLXH 1F3RB 3WS6A 5JORB 4JRYA 2XC8A 2IBGA 3F64A 2Q7YB 4IJ3C 4U31A 4XXWC 3EJCA 3L3JB 3PWUB 4ELMA 1JSYA 4JN1H 2P46B 2Z9TA 3DUHA 3QUXA 2VXTH 3K5SA 1F11A 4ODXB 4ZO9A 1ETZA 1BW8A 4NQVB 1KIPA 2C34A 4C83B 5LKNA 3LVEA 4YDZA 1LK3L 4P4KB 1E4JA 3ZO9A 3A67H 3GSNL 3IDXH 4N9GB 2YGQA 2NUTA 2QADC 4K7PL 3L5WB 4NDMA 1DJZA 2WLKA 4A66A 2P28B 4H0LC 5DVNA 4AUUA 3N41B 4CMMA 3AVEA 2BVPB 1OT2A 5L4JA 2BDNL 4NSKA 3FB7A 1CPUA 3B37A 3L7EA 2XWBB 5BO1H 1TTGA 2EVIA 5CJ5A 5D7LA 4IK6A 4LLUA 3COOA 3KYAA 2HKHH 3V4UH 3N85H 3FTGA 3X2QB 5AVSB 2WYTA 3T3ME 2QVMA 1FZMA 1KZYA 3L3HB 1FCGA 4JJOA 2FSEA 2C9XA 2IBZY 1P7QB 1K9TA 4N28A 3QNXA 5DYFA 1ACYH 1UD2A 4NDMB 3CSPA 1DJWA 3SZKC 1JZ4A 4L4VD 1XGTA 2NOYA 4JFTA 2MPVA 4PWHA 4ETYA 1ETZB 4GRWH 2HFFA 4UT7H 4XCCL 2BVQB 4O00A 4YEEA 1E40A 2BW4A 3ECWA 1J86A 3NIDF 4U1KA 4EJ1C 4PJCB 4NKQB 3QBTB 3SGKC 2YRLA 3L1GA 3VFRB 4IRSC 4NQDB 5KVGH 2GHWB 5E8PB 1FFTB 2AXJA 1CXKA 2VQ1A 2I27N 3PYCA 3SDAA 1XDTT 2XA8H 4V33A 1B4TA 1HSAB 2EC9T 4R26L 1SN2A 2JCCA 4K5PA 3P11L 4RWYL 4FKHA 5DQJB 3BAXA 4MMYA 4RDQG 4EUPB 3RWJB 3NSXA 1K3ZA 1UWXH 2IH1B 4B0MB 1XH2A 3KBHE 1R24A 4FFWC 1WT5C 3U9UB 3FQUB 4HHWA 4M5YH 2EO1A 4NT6A 4CVWA 1L7IH 2IDFA 3VFVA 2IOOA 3DYPA 5CEYA 3RGVD 3HFFA 4E9WA 5EHFA 2EDNA 1E6OH 2DKUA 4CVXB 3R8BB 4EIGB 2ZP0T 2YXVA 2ZUQC 4MDIA 3IJ8A 2MHAA 5ID1A 4F7PA 3NQKA 1PX3A 3H85A 3R18A 2W91A 1F3JB 5MEPB 2OMTB 1MKFA 3SZ6A 1OF0A 4PG2A 2B1AL 2A6IA 5CINH 5BS0E 1N19A 3C60A 4NO0D 4R2GD 5D9SA 4O2EB 1AHWA 1SMOA 5F21B 3WJJC 3HE7D 2CMRH 5JPMC 2IAMA 1TEYA 1MJ8L 2WHVA 4XP9L 4ZUSA 4A2GA 2X7LB 1F2XK 4FQLH 4K3DH 4P2RB 1JF1A 3GF8A 4CJ1A 5JIIA 1XF1A 5KAQF 2PTTA 5JOEA 5AZEL 3FB8B 2OM5A 2N1TE 3D51A 5BRZD 1XB8A 4PEEA 4AQZA 2QDVA 1QBMH 1S7XA 2I60H 4KOBA 4LDCA 4LARL 2D9CA 4P5TC 4BJLA 3SKMB 1R3LB 1IAIL 1ZT4A 2ORBL 2VDRH 3IJ7A 4TTGA 3HI5H 4MBOA 43CAA 1AS7A 3MV11 2QSQA 1WT5A 1WPCA 3O3EB 1KT2A 1DBML 1YC7A 4HIEB 1KJMA 1NBVL 4O51B 3TH2T 1GGUA 5HHPA 1WFMA 4MYWB 1CDGA 2LE9A 1G7LA 2HWZL 4GUOA 4F80A 4R83A 1PPIA 1QATA 3DGGB 4FG6C 2YAQA 4XPBH 3BXNB 4G43A 4ZBJA 2WLHA 3RWDA 1QUNB 4LCYA 4AKOA 4BUHA 4HJJH 1MJ8H 4Y8AA 3FT3B 4LLYA 3GMOB 4MXVE 5C0EA 4B9PA 1S7UB 3HNVL 1I7ZB 5AAMC 2NNAA 2DMHA 2GEQA 2YUZA 3R06B 3S2AA 5EV7A 5GS0H 4YR6A 1T0MB 4AIZA 4G6AC 3DO7A 1RHHB 5F3BA 3EDDA 1ZTMA 4B5EA 1AI1H 3D0LB 3BT2L 2NYKA 4UTAH 2ZQKA 5JHAA 2TSBA 1JGVH 2VIRA 4LNRB 4C57C 5MENE 3RVTC 1JD7A 1YO4A 2FB4H 1ANUA 2GJ6E 4QRRD 2ID5A 1H3TA 3KYNA 5KSAB 2WBXA 4N2KA 3K6OA 3MV9E 4NKDA 4WLCA 2G9HA 1FYTA 3V9FA 5FYKE 1T5WB 4TVPD 5E1IA 5B7EA 3DTDA 5AVWB 5D6CA 5I1IL 2I5YH 3ULUE 4M4RA 4E9TA 5HXMA 2CK2A 4AIXA 2FWOB 3GUFA 5EZJB 5JUEL 4PJBF 1X5MA 4DGVL 1OLZA 3JWDH 2BHFA 1BJ1H 5IZ7A 4FTDA 5FO2A 1T1XB 5HY9B 2M26A 2D0FA 4XN7A 3APDA 3OXRB 3G5VB 4V1DA 3CN1A 1UKTA 4ANKA 1KLUB 2B15A 3NCCB 4P5RA 1N2RB 4PN6A 1S46A 2OW7A 5E6UB 1NCIA 3UEQA 1BECA 1MCBA 1P1VA 4AK1A 3SSGA 3QEQB 1YEGL 1AQKH 5E94A 2VQ4A 1DQDL 3FJTA 5AZ2H 5KYXA 1ZA3B 4PS4L 1R9FA 1ZGLM 9CGTA 1L9MA 2CUAA 4R7NA 2WXLA 3V52L 4K8RL 4R4BA 4XWOC 3VFMB 5J4MA 3CDGA 4OM1L 1UM4L 4LAQL 5J1TC 1HHJA 3FQNB 1XEDA 3T6WA 1YEIL 2ZNWA 4F58L 5C08E 5ISZA 3GD1C 4P23D 3DIVA 4WO4C 4QCIA 4YFDB 4QRUB 2FX9H 5DJ2A 4HPOL 4L1BA 3WY2A 4Y2DA 5FK9B 1RULL 4JY4B 2X0UA 1TJMA 3MRDB 1IGJB 5FS5A 3WUWG 5I8OL 1I4FB 4QMEA 2B1OA 3TN0C 3NCMA 4HUMB 5C8JA 5ACLA 5J56B 3SDDD 3KPLB 1DCEA 3BAIA 4RMRA 2HFGH 5EPMA 3LDBB 1D5IL 4A7QA 2F7IA 2XQ0A 2QSCL 3BP7A 4BHUA 5AAPA 4PWJA 1MIEH 1MFVA 1RI8A 1U42A 2F5BL 2X4PB 3QPXH 3V0AC 3QAQA 1XX9C 3C5ZC 3OG4B 1WCQA 2ZSWA 3RWIB 5E9DA 5FR3A 2GK0B 4FQ2H 2JELH 5CKGA 5KBPA 2BVEA 2G2RB 2Q0ZX 5CZXC 2IH9A 1MJ7L 1L7TH 1PKOA 2GJ6A 3MR9A 1ZEAH 3HTLX 4HEMA 4NYLA 5FW6A 2R56L 2FLRT 2KDYA 5EWIH 2DI9A 4AYSA 4PCKA 1IU1A 1X7TA 1BG1A 4ZW6A 2DQJH 4BSWA 3TF4A 2WTOA 1K8DA 2C1OA 4B53A 1JXFA 5C0FB 4BBWA 3NDZE 3HBPA 4HALA 2Z8VC 4YE4L 1J9TA 3C6LB 4HJJL 3GSWB 1RPQA 4I2XB 2UUDK 2JLLA 1ZIBA 5BW7C 4OKVB 4FI8A 1VCBC 4X42A 1XGPB 2NRDA 1DQLH 5JPNB 1CK0H 2CGRH 4Z7AA 5JW4Q 1B6UA 1CGSH 1YEEL 2BWQA 2ZXAA 3VSUA 1LWRA