3IN0A

Crystal structure of the f114p/m121q variant of pseudomonas aeruginosa azurin in the cu(ii) state
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPPGHSALQKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Rationally tuning the reduction potential of a single cupredoxin beyond the natural range.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3in0A00
1E65A 3FPXA 4WKXA 4A2HA 4MFHA 1EZLA 2GBAA 2WO3B 3S3BB 3NJFA 1IBYA 2W88A 4KNTA 5B7FA 2CJ3A 3GDCA 1JOIA 3EHBB 3ZDWA 4KO9A 4BDVA 3D12B 1AR1B 2CAKA 4DPBX 1KBVA 1L9QA 2ZXWB 4PCYA 2I85A 2GC4C 1AZUA 4KNSA 2PP9A 1B3IA 1N70A 1WA2X 4YSUA 3IN0A 3AY2A 3JT2A 3S8FB 2IWKA 4F2FA 4UF7C 1V10A 3PXLA 4HCGA 2IH8A 2EIMB 3FYEB 3FU7A 2AANA 4A67A 1NWOA 4YSSA 3AZUA 4UANA 3ABKB 2XV0A 1MG3C 1NWPA 8PAZA 4NAJA 4GP4B 2FQGA 1AZRA 1ASQA 4DP5X 1QLEB 2XU9A 2CUAA 3FQ2A 2H5UA 1JVOA 1ET7A 1PZAA 1PZCA 5D4HA 5FC9A 1JZJA 2EIJB 3KW7A 3OD3A 3FSVA 2UXGA 1GS6X 4E9WA 3S3CB 2QPEB 1MZYA 3FSWA 2HZHA 4DPCX 4N8UA 2CALA 5E9NA 2FWLB 1A4CA 1V54B 2IWFA 1BEXA 2XUWA 3N2JA 3QPKA 3V9CA 2QDWA 2YAPA 2AZUA 4BXSV 2WSDA 3NJGA 4DP1X 2YAFA 1E5YA 1GW0A 1SHXA 3PAVA 3S8GB 2YAEA 4BDVB 4M3HA 2EINB 3WNJA 1ILUA 1AZCA 2J56A 2HLEB 1AANA 1PLAA 3CZUB 1QNIA 1AG0A 4DP4X 3PCYA 3TBBA 1XMEB 3S3DB 1GR7A 1W6WA 2Y1AA 1CC3A 4NERA 3NP3A 1AS6A 2GHZA 3RYMA 5IY5B 3FSAA 1BQRA 5I28A 1WA1X 4DP6X 4KOBA 2PPCA 2TSAA 4AX3A 1KDIA 4E9TA 2UXFA 1UATA 3OMNB 1M57B 1SFDA 3OM3B 4HALA 5I5MA 4E9VA 1J5CA 2XV2A 4A68A 1PMYA 5B1JC 3WNIA 1M56B 4NB7A 1ET5A 1AG6A 1AS7A 1BYOA 1OCRB 2VW6A 3HEIB 1TU2A 4KO6A 4DP2X 3N55A 4G7QB 3NSDA 3FYIB 2QDVA 1BQ5A 2XXFA 3AG3B 1TKWA 4YSRA 2YAOA 2AVFA 4DP8X 1OOWA 2P80D 3FU8A 1JZGA 2IDQA 1XB8A 4W9ZA 2B08A 2J55A 1BYPA 1WS7A 2FQDA 3SQRA 2MRYA 3GXUB 1F56A 3ASOB 1ZPUA 5I6LA 1BXVA 2IWEA 3QJQB 4HCFA 1ASOA 1L9SA 4M4RB 4RH4A 3NJIA 4CSZA 4AI7A 4AZUA 2BP8B 2YXVA 3PAUA 1NIAA 1RZPA 2UXVA 6PCYA 1AACA 1I53A 1OE2A 4YSEA 2ZOOA 1OCOB 3IN2A 2XVBA 1PCSA 1ADWA 1DYZA 2BO0A 1ASPA 4YSPA 2QPDB 4YVNA 1MZZA 1PNCA 1DZ0A 4A2GA 3SBPA 5TK4A 4FA7B 4GY4A 4BWUA 4CSPA 2HX9A 4ENZA 3NJMA 1AQ8A 2J5WA 2HX8A 1J5DA 2BZ7A 2XWZA 3NJHA 3V9EA 1OE1A 2BP0B 4YSOA 1NIDA 1ZV2A 1KBWA 1N68A 4K9JA 3WKPA 1PAZA 1NIBA 2DV6A 1PLBA 4HIPA 1PLCA 4HAKA 4QKTA 2VW4A 4GP8B 2GI0A 3X1FA 4GP5B 1JERA 3ASNB 3QQXA 4PAZA 4GXFA 5PCYA 3IEAA 1JZEA 3AG2B 3BQVA 1BQKA 1E67A 3UACA 1ILSA 1IKOP 1IUZA 3CDZA 2BZCA 3QJRB 2BWIA 2XLLA 3FPYA 5I5IA 2FQEA 1A65A 2I7SA 6PAZA 1SF3A 1SJMA 1TEGA 3NT0A 5B1KA 3T6ZA 4YSCA 4AKPA 1FWXA 4DP7X 3BVDB 3T6VA 3AG4B 1NICA 2BHFA 5D4JA 3FT0A 1L9PA 4A66A 2XXGA 1GS7A 4F2EA 5I6MA 3ZBMA 2NRDA 2BW5A 4HZ1A 2FT7A 3PAZA 3NSYA 4FAAB 4BWWA 1KCBA 1X9RA 2YAMA 1SF5A 1W6LA 3TA4D 4HHWA 1ZDSA 3TASA 3FU7B 2PP7A 5B3SB 3T71A 3UAAA 4A2DA 4P5RA 3MX0B 1FA4A 3EH3B 1URIA 4X4KA 2HX7A 5B7MA 4AKOA 1L9TA 1NIFA 2XX0A 2DYRB 2A3TA 3NP4A 4BWTA 3C75A 1NIEA 2PPEA 1HFUA 2YARA 1GY1A 3X1GA 1J9RA 2FJSA 4DP9X 4YSAA 3ZX1A 1L9RA 4GYBA 4P5SA 4DPAX 1ZIAA 3NJKA 1IBZA 3PPSA 5ANHA 2IDSA 3OMIB 4JHVA 3DKHA 1WS8A 2R7EA 5B1JA 1ET8A 5TK2A 4JKNA 2BWDA 2IH9A 3JTBA 1XB6A 2FT6A 3TBCA 5B1BB 1AAJA 4G7SB 5I6PA 3ERXA 1GSKA 2GC7C 2PCYA 1E30A 1NDTA 1W8EA 1NTDA 2N0MA 2FNWA 4A2FA 2XX1A 5I6KA 1V55B 2OJ1A 4G70B 1PY0A 5AZUA 4BXVA 1JXDA 3QJVB 4E9SA 3T6WA 3FSZA 1AZNA 1GYCA 1J9QA 1OF0A 4WTQA 3NJLA 4YSQA 3QJSB 1KDJA 2X87A 4KO5A 1GY2A 2PPAA 2EILB 1A4BA 4AKQA 4KNUA 1JXGA 3UGEA 1OE3A 4G7RB 3FU9A 1R1CA 2OV0A 4F7KA 3QJTB 1OCZB 1PF3A 1NINA 2OCCB 3H4HA 5EHFA 4TXVB 3OQRA 3WKQA 2IDUA 9PCYA 1RKRA 3G5WA 3AG1B 2YXWA 3T6XA 2GB2A 3SBQA 2JXMA 4DP0X 3TU6A 3MBWB 2Q9OA 2XV3A 3CVCA 5B7EA 2HRHA 3ZIYA 2PCFA 1ETJA 1JZIA 3L45A 1KYAA 1J9SA 3H56A 2GSMB 4G71B 1MDAA 3QJUB 1OV8A 1JXFA 2YQBA 3AW5A 1PZBA 5F7AA 3WIAA 3UAEA 2X88A 2EIKB 2ZWNA 2UXTA 4E9YA 1EHKB 4BK5C 1CUOA 3UABA 4YSTA 5I5JA 2R7EB 3X1BA 4N4YB 2PLTA 2BW4A 1CURA 3OMAB 2CCWA 1BXAA 3DTUB 2UX7A 3X2QB 3PLYA 5A7EA 4QLWA 3CVDA 1HAUA 4Q89A 4YSDA 2JFCA 1BXUA 3CVBA 7PCYA 1SHWA 2DY2A 4UAHA 2E86A 2FQFA 3EF4A 3H4FA 5D4IA 1A4AA 3SBRA 4E9QA 1IC0A 1PNDA 3NSFA 1A8ZA 3X1EA 3IBOA 5I6NA 1VLXA 2XYBA 1RCYA 2W8CA 4E9XA 2ZONA 1CYWA 2IAAC 2VSKB 1SDDA 2DYSB 1JZFA 2MTAA 3WG7B 2WO2B 2H3XC 1TEFA 1JZHA 1L9OA 4W1TA 1X9UA 2IDTA 1J9TA 2FTAA 3HB3B 5PAZA 2PPFA 4A2EA 2FT8A 3KW8A 4L0PB 3ABMB 4ZK8A 2LLNA 3CG8A 4KOCA 4KO7A 1QHQA 2BP8A 2AFNA 3X1NA 2QT6A 1RZQA 3ABGA 2IDFA 3NYKA 2VSMB 4JHUA 1AZBA 2YAHA 2VN3A 3FQ1A 5AFAA 2GIMA 2P80A 3WI9A 1OCCB 2VMJA 1BAWA 3GYRA 1T5KA 4HCIA 1WA0X 1KCWA 4G72B 2HRGA 2CBPA 2B3IA 1HAWA 1A3ZA 1CYXA 1MG2C 2I7OA 1WAEA 1XB3A 1E5ZA 1AOZA 1AIZA 1M9WA 1NZRA 1SNRA 2VM3A 4E9RA 2DWTA 3FS9A 2BP0A 4HHGA 1JVLA 2VW7A 4YL4A 7PAZA 1SFHA 3ABLB 5LDUA 2RACA 2PP8A 5AKRA 3CDZB 3DIVA 2DWSA 5F7BA 3EH5B 1KGYE 4YVUA 2VM4A 4Q8BA 2YAQA 1YLBB 2J57A 2H47C 1NPNA 2TSBA 2Y69B 3EH4B 4EF3A 5I26A 2AZAA 3FQYA 3NJNA 3U25A 3UADA 2HXAA 1ZDQA 3NSCA 3IE9A 1NPJA 5B1AB 3NJJA 1SDDB 2UX6A 1FFTB 2Q5BA 1AS8A 3T9WA 1GS8A 5I6OA 1ZIBA 2PPDA 1ID2A 2JKWA 1KV7A
chains in the Genus database with same CATH superfamily
3IYLW 2Y22A 4WKXA 2GBAA 1NAMH 2WWNA 1J87A 1EZVY 3T0WA 4Z8FL 5AD0A 1EHNA 4EO5A 2XTJD 3QA3A 2H26A 1MFEL 3W0WD 3WENA 2HVJB 1BZ7B 3NIFF 1AR1B 3R4DA 3G5ZB 4W9GC 1MHPH 3LH2L 3VFVB 3FUMA 1KWGA 3TT3L 2GC4C 1B3IA 1WA2X 2ITCA 5TQ0L 1MNUL 1OKEA 1QWHA 3F7YA 3MGOB 4XPHL 4FL4B 5DCCA 4X4ME 4UF7C 3ILQC 1V10A 4JDVB 1BG9A 3FO1A 1MN4A 3QNXA 4YSSA 5C9KA 3LZNA 4YWGH 1TZAA 3ABKB 3RVVC 5B3JF 1SJEB 1A7RH 1UG9A 1VRSA 2GT9A 2J5LB 2ESVD 4U1SA 3VFGH 4D9RE 3ZHFA 5EBLA 3F00A 4IBVA 3ZKSD 3BGFB 4L3CB 4AVJA 4PVNA 1Q9OA 1NSNH 4HCRL 3VD7A 2IOOA 2C7FA 3DJZA 4OQ1A 4KPHL 1T0PB 1KMGA 3KDPB 4K8RD 2ZIDA 1XHHA 3SBWC 3PWPA 3JWNE 4DKEL 4ZO8A 5LBSH 1X7QA 4AV4A 3DX7B 4TQEH 5MENE 2FR4A 5I8EB 4IKIA 3FO2B 1TQSA 4XWGH 1ZJAA 2FO4B 5DMYA 1TJHL 3FB8B 4YHLL 4PS4H 1Z6JT 3NFSH 2VLME 1OGTA 5EWIH 5JXAL 4Q52A 4V1DD 2WCPA 1OAJA 4YAQB 1FDLH 5D1XB 5EG6C 3LQZB 2JELH 3QDJA 5GJTL 4JMXA 1KCRH 4O2CA 4ZUTA 1YY8B 3BO8B 4FLQA 1YEHL 4H0LC 4FXTA 3LKSA 5EOQH 2YMTA 3EJSA 3BH8B 4AYFB 3QCUH 5E8PA 4M4RA 4FNTA 4FHKA 3ARUA 4RBPH 4HUNB 3RE0A 3S8GB 4HKZA 4OD3L 4XBPA 3PJSB 1L7IH 2EINB 4M3HA 3VFNA 3VW3L 3ARXA 2CGYA 3H9YA 4KROB 2OM5A 4KHTH 2YUZA 1G7LA 3BWUC 1CCZA 3QZWG 4LU5L 1G9EA 3RIFF 3BT2H 3L4ZA 1PD1A 4FNQA 2JJSA 1HILA 2I60L 2K70A 4A6YH 4TLUA 2RAMA 2YRBA 2JCCA 2QMKA 2VIRB 1AQKL 1N0LB 5J3HC 4ZQTA 2PXYD 3Q8EA 4NO2A 1HYSD 2CO1A 1KDIA 4NZUL 3OR6B 1HHIA 5BOPA 3QDMA 1A1MB 4OJEH 5KUKA 2VAJA 1L5GA 4MD0B 4HALA 3G04A 1P5UC 5DHVH 5E2JA 2YJQA 2CHNA 3S3JA 2Q1EA 2V5TA 3UTQA 3ZKNC 1PMYA 3HPLB 4EDXB 3MRKB 1EAPA 1RUMH 3DMMD 3PJNA 3PQYD 5BW7C 5BRZD 4BFIB 3OTTA 4DHLA 1BZEA 5SWQB 4UV4L 3TGXA 1KYDA 1S9VA 3QDGB 5D6DA 5EC2A 4Y9GA 3VH8B 5MEOB 2QDVA 4TPRL 3RUGB 2CHWA 4NZJA 4YSRA 4HWNA 1ML0A 4ETQB 2DBJA 4JREB 3HI1A 4HG4K 5CJXA 4RFOL 3MRBB 1GVIA 4G3YH 4HAFA 2Y3NA 4B9YA 1YECL 4CAGA 2J55A 2ICEC 4MNGB 4NRZA 4GAGL 4W9IC 2YC1A 3FAXA 1XAKA 5ALBL 5F1OB 2WQ8A 5BRPA 2FH6A 2Z31A 3ASOB 5J6HA 3QUXA 4G6AD 3C6SA 4GSUA 1WC7B 4F57H 2AV1B 2NMSA 4QHKJ 4WWKA 1QFWM 5SX4H 3P3SA 1FNAA 1U58A 3QNZB 4QJ4B 1Q8MA 3NJIA 5C0CA 2WWKO 2WYIA 4UQ3B 4K71B 4UTCA 5HI5C 4WJ5B 5EZIH 4ZMQA 3BWAA 5A2AA 4CMHC 4PB0L 1KULA 4X6CA 1AVAA 2ZOOA 3IDUA 4Z76B 1KEGH 1A3QA 1D5IL 1KCUH 3FRPB 2CLRB 3CH1A 1RERA 1NMBH 2WXPA 2HUEA 2L4OA 3NQIA 1VGKA 3QJFB 4GY4A 2W9DL 3QRBA 1H15B 5HGAA 5HJGA 1RZ8A 2V2TB 2X38A 3EYOA 3DURA 3ZTCC 2AK1L 2P28B 4YSOA 2XN1A 3OHXB 4JN2A 3OWRA 3LPPA 4CJ1A 3EADA 3SKOB 5I18L 2GTWB 1XSIA 2HSIA 5DC9B 1IM3A 5EZPA 4JN1H 2YEQA 4P23A 1U91A 3II1A 3FB5B 4G8IA 5PCYA 2LU7A 4G6ML 3LPGA 1BQHA 2JKJA 4Q6IB 5CS7A 1EFXB 4Y16C 4PJ5E 2F54D 2G4GA 1ILSA 1HCYA 2WTOA 5ERWA 2BSED 3TBVB 5HHQB 1FL3B 3KPNB 2A4ZA 4XXDB 3BP7B 4HU8A 2J8UB 2Q3XA 5ISZB 1SF3A 1WFMA 3MLWH 4GRLC 2D3VA 5I16B 3C5ZA 3QUZD 4HMDA 4FQLL 1NUFA 1KZQA 4Y4FB 4N0UA 3TPUB 3OKKA 2GJ6E 1F4WL 4LGRB 4TOYL 3TBTA 5D72H 1JV5A 3GI8H 1TENA 3AG4B 5HJDA 1JAEA 1NICA 4MTMA 3TL5A 1K72A 2UY6B 3ZJAA 3DO7B 4DW2H 1L9PA 1QI5A 4RA0C 1FZOA 3UJJL 3SO3B 4AZ8B 1MLBB 4QCIB 3RBGA 4AEHH 3GSRB 5IB5A 2NRDA 1AR1C 2EDNA 3O4LD 4XMKL 2D7PA 1JFQL 4Y9BA 4GAAA 3IRZA 5KVGL 7TAAA 1X9RA 5CILH 1DEEB 5LJYH 4P05A 3BH9A 4EIUA 5BPPA 2YOAA 3EO1B 3L6FA 3CFKA 3BAYA 4WUUB 2VERN 5F96H 2WB1A 2I9TA 1AGFB 1SMAA 4RZKA 4UINL 5ABDE 1ZMYA 3FTUA 2NX5D 4JFYB 3EH3B 3JSSA 2VDLL 3ZE1E 3LV3B 5F89A 1R3KA 2G9HA 2K1MA 1U92B 5C92A 1DQKA 1KCVL 1UQSB 2X9XA 5LBGA 3B7TA 3ZRFC 2BFVH 3MUGB 4A2MA 4RFEA 5FHBH 2QVKA 1PFCA 4AQAB 3A4EA 4GYBA 1ORSB 4OD2B 5D1QC 2IDSA 4JHWL 1MAKA 5IWLC 3HI6H 3EBHA 3LEXB 4D8PB 4JKNA 1NUDA 4A7TA 4KKAD 1Z7JA 3VM5A 3KGRA 3H85A 4HC1L 4LCCB 4RWYH 5IQOA 3VXMB 2DI9A 3P3TA 2D4FA 2MOGA 3MRNA 1CFTB 3GS0A 4NZFA 2IANA 1Z0MA 3LZPA 2AQSA 1IGTB 4JY6B 4ENED 3CFEB 1AZNA 5D1XC 4LGSB 4BELD 5B38G 5T3ZE 2HG0A 3KPMB 5C07D 1FIGL 1KDJA 4RRPM 4KO5A 2WXOA 4ALAL 3G6JF 4JFEA 2DTMH 1XH3A 3H9SA 3O2VH 2CA3A 4E0RB 1YYLL 5HVHC 1JS4A 1VIWA 2CIIB 2YQGA 5DMGC 1QKZH 3N43B 4OCLC 4QLRA 1RHHB 3QPQD 4LP4A 4QTFA 2AABL 3NUKA 1D6VH 3HE7D 1J1XL 1PX8A 4RGMC 5IVXE 1LO0L 3ARVA 3SOBL 4UWQB 2WOBA 3RKPA 4G7YL 3ARDA 3SBQA 5FB8A 3OF6D 5L88L 1GGBH 3DARA 1JZDC 1FZKB 4BV1A 2P5EE 3MU3A 3MKGA 2UVEA 3P02A 1DSYA 4GT0A 2B0SH 4P4KC 5DEFA 1AGDA 4YZFE 2YQBA 1P4BL 4OM1H 4PJGB 2K4WA 3SDAA 5DUBA 3OXRA 1S4IA 2Y36L 3UCRA 35C8H 3NFNB 2X2YA 4XC1H 1HK6A 2XQYG 5AVXB 1QI4A 3U7WL 4OGZA 4ZW8A 4N25A 1J8HA 2GY5A 4AM0Q 3VX0A 2H3NA 3IDJA 1CURA 1KJ3H 4D0DA 4HOMA 4ZPVA 2PTVA 5HJBA 3PLYA 3GTTA 4DAGH 3KDMA 4RMSA 4I1NB 3SGDI 3SY6A 2Q8BH 2Z7WA 4YIQB 1JNHB 1S3KL 1QWUA 1WZMA 4OJAA 1RU9H 2SODB 2H32H 3EO9L 3H3KA 3QIUB 4FE9A 4IS6A 4NYLA 5I1EH 3NSFA 1IQWH 1YZZA 4L29B 4YE4H 3T0VA 1QLFB 5F9DC 3X1EA 2P8PB 4PIBA 2WVUA 3QZBA 4FQHB 4PY7B 4YNYA 3OZKA 4NQSB 1T03H 2RJMA 5DJAB 3QP3A 5GXBB 2J6WA 3VMOA 4HJJL 2YPLB 2HLFD 4EN3B 1F97A 4DIXA 1TEFA 5TQ2L 3U1PA 4ZMPA 3IAQA 4I3RL 4K71C 4XX1E 1GZPA 3T4AB 2WYTA 3GBDA 3F05A 5IB2A 1UC6A 4EOWH 1V7NH 1E9QB 3IJ9A 3F7VB 2G75A 3K0YA 4L0PB 1Y1DA 1JZ3A 4XBGA 4YDZA 1JPSL 5SX5K 2BP8A 5DK2A 2WZ6A 4B9IA 2X1WL 1IKNC 2LE9A 3LD8B 2W81C 1GAFL 1VFAB 5GGSB 3WCYA 3QCVH 4LLDA 1IGJA 3EYSH 1WYJA 4MB5A 4BUGA 2A6JA 3IU3B 1CICB 1N18A 5BZWA 5I8KL 2OL3L 1BAWA 4MDRA 2Y25A 1WHPA 5D7JA 1Y18B 4PJXA 3DLQR 4MJ6B 4PJBA 4U6VH 2GJZB 1KB5H 3O2WH 5DTFB 1IX2A 1U2CA 4HIIB 3IB4A 5BOJA 2DWTA 5C6TL 3OZ9H 4KV5E 4HHGA 5JIPA 2MPVA 4N90E 3FUNA 4NC0B 3ROLB 4YEFA 1OSPH 5L8KB 3UAJC 3DIVA 4Q6IC 3TCXA 3R18A 4NRXB 2JB5H 2VDRL 4PW4A 4CBPA 3KPSD 4Q8BA 1A14L 3ARYA 3WSQH 5AWNH 3RPBA 2MTPA 1NCOA 4LVHC 4LARH 4PJ6A 3ZYIA 4AMWA 5M7QA 2QQNH 5LWYL 2GHWB 1ZDQA 4LCIL 2RALA 1BFTA 1RI8A 4WSJA 2P5WE 3KEHA 3SIKA 5D2NC 1TZOA 4N2LA 5B8CB 2BSRB 3CHQA 1BP3B 1FFTB 2F61A 3J27A 2CJUH 4PJ8C 1T3FA 4GUCA 1EAQA 1RZIA 1JUFB 4K9EC 4WU7B 4YX2L 4A2HA 4AC4A 4OCNC 2ZCHH 4X99A 4MMYB 5AVRB 1OTUD 5JYMA 2H6OA 2QGDA 4HGMA 4R97B 2RFXA 3WFDL 4ZFOB 3VGAB 2BSSB 3T71A 4GKZA 5E24E 4YHML 2VTFA 2BNRB 5DFAA 5EBMB 2CRMA 1X6LA 4YO0A 2NQ3A 4XNXL 3V6FA 4KKCC 4RGOH 2AW2A 2IGFL 4LLVB 4LLWB 3RBSA 2GAZB 3S8FB 4F7EB 5DQDL 5T1LD 5C2BL 4UT6H 3ZZSA 4N2AA 1S78C 3VMPA 1XF3A 1HNGA 4L05A 4QUOA 3AZUA 1MCEA 1OLZA 3RVUC 1E4KA 2H2PD 2V8LA 2VITB 4OZIE 2NTFB 2P8MA 3GKWL 4HAGA 1A6TA 3P0VL 1UYWL 3IRPX 1G7HB 1MWOA 3HBPA 1Z3GL 4GFXA 4F20A 2ZJSL 5KSUA 4B6ZA 4J3UA 1WCBB 1I9JL 3WKMH 3T0DA 2LAGB 1EMTH 4R0LA 3ULVC 4NP4L 3FQ2A 3SQOL 3O6FD 3P9WB 4NUGH 4YH6A 5EUOA 4YDMA 1JK8B 1PZCA 2PCXA 5D4HA 1XGZA 1D5MB 1T0OA 1TT6A 1U8CA 3B2PA 1JZJA 3N42F 4I0PB 4KBPA 1ES0A 5AW4B 3UO1H 3WNNA 1BVNP 1AMXA 4NNYB 4QXVA 5FUZL 3ECQA 5LXVA 1ZVNA 4UILL 3PHAA 4FF9A 2E7DA 3CHRA 5CJ5A 3J2PA 4KTYA 1G7MB 43CAA 1KLFB 5HYSG 4E9WA 1INQB 4AITA 5L0QB 5HP5A 4Y1AD 1JGUL 1A1NB 1ZEAH 4PS8A 4XPBH 3ZR6A 4MWFB 1A4CA 1UA6L 1FV1B 4TL4A 4J3XA 5I75B 1BBJB 1M2OA 3QARA 3N50A 5GSRA 3ARGA 3MQIA 5AD0B 4PWGA 2F08A 2H26B 4XP4L 2D03L 3K5RA 3ZGIA 4KK8D 1U8JB 1VERA 4XXWA 4AH2A 1RZGB 4L8SA 3QNYA 3V0IA 3BMVA 2DQGL 5IJBC 2X4NB 3MACH 1LO3H 1P4LA 2ITCB 2OSXA 2VKXA 4GO6B 3T3MB 4X4MA 3FT4A 3JXAA 4X0KA 4LE8A 3BX7C 5HDLA 2VDMB 2CQVA 1I9IH 3QUML 5E2TH 1J5IA 2D7TH 1HL9A 4Z7WB 3VWKA 3FTZA 4ELKA 5EBLB 5EUKA 2YD7A 5L2JA 3S37L 1Q9OB 1T4KA 3CQFA 3PWVB 1H3UA 2LAAA 5JLZA 4UZGA 1NFDE 4FG0A 1OB0A 5F0JB 4B27A 3ZQ9A 4ZMAT 3EHBD 3SKNA 3PWPB 4B96A 1D9KB 4Q4IA 2VXVL 1BQSA 2X89A 1X7QB 2GBVA 5ICYA 3PGFL 2BK8A 3ELQA 3LKQA 3IAGC 2FR4B 3HE6C 5MENA 4DN3H 4I0KA 1IBGH 1ZTMA 5KSAD 4WGVB 3CFIC 1FC1A 3C8KB 5HHNA 4QJ5B 3EOTL 5AVVB 3BIKA 1JMXA 5DD5L 3RWFA 4ZAKC 2AVFA 2D73A 3ARBA 3SPCA 2ZTBA 1GGYA 1PFOA 1XWVA 1DBAH 1M7UA 4M43L 1MLCA 2IDQA 3AADB 3ATBA 4W9ZA 3W9DB 2DIBA 4BA8A 2UUDH 2NY1D 3SQRA 2HRPH 1PZ5A 3QDJB 1QSZA 4WO4B 4B9PA 1FFNB 3AABA 1EGJH 1UWXK 4H8VA 4JG0L 4MNHB 4ZUTB 1DQVA 3CFQA 2AI0L 2W07B 4FZ8L 3BDYH 3PUCA 1P2CA 5GS1C 3KD4A 2YEZA 4HCFA 5JR1L 5E8PB 5F0PB 1FVCA 4M4RB 5D8JH 2JIXD 2A4CA 2NY6B 4PWIA 1F4HA 5FO7B 2BC4A 3BCDA 4U4BA 1PSKL 2YD5A 3VFNB 4OGYL 3V0FA 1JPEA 2XYCA 5TFSL 2K9FB 5D7KE 1HOCA 1KIRB 1RZPA 3RWHA 1PU0A 1E7VA 3DDGA 4YC2B 1WIUA 3NIGB 4UB0L 4HJEA 3VG9B 3MV8B 4JPSA 3IDNB 1LEIA 2JNZA 1HILB 2Y5QA 2XVBA 3L4TA 2YMXL 4P2OC 1HJCA 2JCCB 1OZTG 1IGIH 2X09A 5GZND 1INDH 3VI4F 4J3BA 1VFOA 1DZ0A 4A2GA 3QIWC 4FA7B 4Z0XA 4NO2B 4WWNA 3JWOH 2V7NA 4G9DA 1OARL 1VFBA 4OLEA 4G9FD 3CN2A 4FNLL 4ENZA 4DUXA 3D0LB 1HHIB 5CGTA 5IEKA 4ILDA 1LWHA 1O7SA 1UB6A 4GRWF 4Z0BL 2XWXA 4Y2DC 5BO0D 3NGBC 1JTTA 1N68A 3R1GH 4S1DC 1CE1H 4Y89A 3ESUF 4TVPD 5C86A 2V2XB 3UTQB 5BOZG 1LDSA 1EAPB 4TNVF 4YLBA 3B2UC 5EIVA 1E42A 2X4QA 4XO8A 1FYHB 1GOHA 1E8ZA 2DWYA 2OA9A 3M8OH 2Z7UA 4MD4A 5EC2B 1QX1A 4Z7VF 1KELH 3U9PH 5KVDH 3BVNA 2XTJE 3W0WE 2LLLA 1FAIL 4LNVA 1K6QH 4OGXH 1IUZA 3HI1B 4CDHA 5CM1A 1RAMA 1BEYL 3RDTC 3RGBA 2FK9A 2ILLA 2DMCA 1DQML 2I07B 2R29H 2R56L 3MV9D 4BINA 4NRZB 4G42B 2YC1B 4FXKB 1A3LH 1TEGA 5B1KA 4ZI8A 4ONGH 1DANU 3CN3A 3NOIA 5C2UB 4AKPA 3N91A 1GOGA 3BFWA 4WWKB 2Q87A 2OXHB 5D6CA 4W68A 4D0BB 3ARZA 3JQOB 4OIBA 4OD1H 4WNQB 1U58B 2EXSA 2WYZA 2ESVE 3O6LL 3UDWC 5I6MA 1A2YB 3QEGH 4R97C 1VPOL 4NQXA 2W9EH 2YFNA 4QRTA 5HYIA 3BWAB 1RFDL 1UXWA 2CU9A 3L5WA 1R0AL 4X6CB 4HQQH 3IF1A 2R4RH 1HSAB 1OD9A 4HHWA 1SXSA 4ODHH 2FX7L 1CXLA 3D18B 2V3FA 4A2DA 2P47B 1KBGH 3HNSL 3CMOL 3QQ4A 1FA4A 3BE1H 5DRNA 4KUZH 3SE3C 5JW4R 1RHFA 1ACYL 3L7EA 5C0RH 4M8VA 5GGQL 4JN2B 4Z3TA 4V1DE 4ZFGH 4D94A 1IM3B 3G5VA 5E1GA 1DZBA 4K3JH 1EEQA 1I1CA 4XN7A 1U91B 4S11A 3ZR5A 4WUKH 3MJ9A 4G8IB 1R6VA 4JVUA 4FHJA 1TLMA 2Q20A 1CFBA 3RY5A 1T21A 1ZXKA 3B2XA 1FFOA 3JTBA 3STZA 4I0PC 4NNXA 4GUQA 4OQTH 2F1AA 1Q4NX 2M8XA 2PMZA 2WLHA 5ID0A 2XZAL 1NCAL 2O93L 1XDTT 5I6PA 3Q6FB 4X5WA 4FP8L 3G08A 1EJOL 3PHOA 4AXWA 1V55B 1CTNA 4M48L 5EF2A 1MFDL 4JGMA 2CDFA 5DZPA 4QRFA 5FF6A 3WN5B 1SOXA 3P4OA 1KY7A 2FH8A 1J1PH 2WBJD 3AREA 3CDGB 2GJ6A 2UZIL 4KUCF 1QR1B 5E2VH 4W4OA 4MNQD 2JWYA 3BPLC 5BMFH 3MTRA 1OO2A 4G80B 1ZAGA 3FU9A 4OFYA 1F45A 4OAWB 4Z7AA 3GRWL 4KRPD 5IB5B 5L2KA 3MCYA 4NM4L 2OCCB 2EDOA 3P73B 2HN7B 1A7PL 5C08D 2BNUA 5HHOD 3FF8A 5C6WH 3BH9B 4FQQA 5KN5A 1IC1A 3BZ4B 3PQYE 3CFKB 1D6EA 5BRZE 2QLVB 3IPEA 1HL8A 4FFVD 3NABH 1ZLVK 2XFXA 1U8HB 2C1PA 5CGYC 4DO5A 1G9MH 1FG2A 1JWUA 3SHSA 1U33A 3UYRL 4AVKA 1DN0A 5F89B 3QE5A 1GPOL 2G9HB 2CM5A 3LHPH 3X3GL 1SXBA 2HFGH 3IGAA 2AEWA 2A74A 4J2XA 4MJIB 1NGQH 4OZGF 5C0ND 2D9QB 3UAEA 1JRHL 2QADB 3UL4A 2D31A 1EDQA 1IAKA 5DFVC 4HEME 2C34A 2WXKA 5I82A 2OAAA 3ZE0E 1HWGB 3MCG1 4AE1A 4J6RH 1KIPB 1SY6H 5J9PB 2X4OA 1F6FB 3MKKA 3ZL4H 3HLAA 2FHBA 3QRGL 5AL8A 3CIQA 5DJ2B 5GS2D 2CCWA 5A7EA 5I73B 3ZGHA 1A7NL 1SEQL 3TA3A 5LBVA 3NIDF 1HI6A 2W0FB 3KPQA 2APXA 5D96B 1W16A 4HIXL 1JI2A 4XP1L 2FJUB 4X80L 3ZDYB 4I9XA 3ULUF 4AW7A 1IZJA 2HVBA 1PNDA 4K94H 5EPMB 1VDGA 4FQXB 2IGTA 4QR7A 3TFBA 1GOFA 3RILA 1TJGH 1MJ8L 2G3NA 2LU3A 1OXYA 4FULA 2CKBA 1CPUA 4Z95H 5I19L 4JPVH 1ZE3C 2ZNXA 3LS5H 1XH3B 2EO1A 2K6YA 3AAZA 3H9SB 3Q44A 1P84J 2H3XC 2NY6C 3L9RA 4DUWA 4YN3A 1MF2H 5GRVL 1QFWI 3ZL1A 1UM4H 3POHA 2D3LA 3K8LA 1XO8A 4QRRD 4YS4A 4PRPD 4QY8A 5IVXA 2XPZA 4NSKB 2Z6FA 4WI7A 2JJSC 3TH2T 2YMOA 4I2XE 1KBPA 3ZDXB 3E8UH 4ZBJA 4EI5B 4JM2B 5H37G 2P5EA 2F54E 2VZ1A 5DEFB 1AGDB 5HD8C 1D2OA 2A9BA 3FJTA 4GINA 2Y7SA 5EORL 3SDDA 3T5WA 3T77A 4JZOB 4NZTL 3SDAB 3X3FL 4OFQA 1WZKA 3Q5OA 5DA0B 3U0WL 5IFAL 3LJ3A 4OW6A 2C7UA 2DB8A 2E46A 4ZG1A 2J12B 5HHME 4OTXL 3D08A 1M9WA 1U8PA 1YYML 2O5XL 3V5HA 3WHXB 2H3NB 1F5WA 4D0DB 4I18A 1S7UB 5KTEH 2G0LA 3AS2A 5L9DL 1KTLA 3T04D 1DSFH 3KDMB 4RA3A 2X5PA 3JYBA 2IAMB 3FCUB 3O4LE 5C3IA 5CJXC 3EH4B 3L95A 3MJ7B 4RISL 2AZAA 1NLDH 3JTSB 5GHWH 4U0RB 4NYLB 1R24A 4IS6B 4KVCL 5D2LB 2O5YH 3PAYA 4O51A 4Y4HB 1KYUA 4RGNB 1I1RA 4JDEB 3B3IA 1R5WA 4X9BA 5HBBA 4FQIH 1QBBA 2NX5E 2Z31C 2IOIA 1NPJA 3MLXH 1D5BA 3QUXC 2XQYK 5KVMC 3FRPG 4WWKC 3PWJA 5F1IB 3D9AH 4HWBL 5KS9E 2D7MA 2BS8A 2FEEI 4N28A 2EIMB 1S5IL 1ANUA 1YNLL 1GZPB 3F83A 4NXKA 4UV7L 5JW5A 5TTRA 1PEZA 1HYRC 1IBYA 4KNTA 4LDCA 4NQTA 4N2HA 4V2CB 4XT1C 5F9AC 5K1JA 5B7FA 4EIBA 5IB2B 5L6YH 1NH6A 3I50H 4TLTA 2R1XA 2ZUVA 1X7TA 4QAWA 3MR9A 1PQZA 2IBGA 2B5IC 2GUOA 2VXUH 5ACLA 5DK2B 4KK5D 3FRUA 3KM1A 3JV0A 2E6JA 3JWDH 3N41F 3BEWA 4F2FA 1OPOA 2A6JB 3JUZA 3FYEB 3UJTH 1ZGLB 2AQQA 3S9DB 1RL1A 3NTCH 1P7BA 4KITB 5DC2A 4WK2B 2YZ8A 3T3PB 4BFOA 4W9DC 1OGAD 3FQUA 1OQXA 3FQNA 3NQKA 3MO1B 5C07E 2WLKA 2OK0L 2XICA 4J3OF 4P23C 4GO9A 1TSHA 2HFFA 1Y6MR 2FQGA 4XVTH 1GZQA 2IXQA 5FS5A 1FBIH 5AW5B 1XAUA 1G1OA 2F5AL 4JFVA 2A0LD 1IAMA 3UZVB 4PJHF 3EBIA 4KXZH 3D0VA 4TLKA 2GSGA 4LVEA 3QG7H 5IB4A 5KEZA 1FAKT 4TNEA 4YDNA 1T66D 5FC9A 3ULUL 1HKLH 4HD5A 1NCBL 3D69A 3RTQA 1LK3H 1WLHA 1J5OH 1EVTC 5FGBC 3BP6A 4QF1B 3FSVA 4GUPB 3C5ZC 5AZEL 1C5CL 1IBBA 4IRJB 1HX0A 1UKQA 4C56B 2J44A 5IKCA 3QYMA 1IGFH 2QGBA 3GBNH 5A2KH 2F58H 2Q7YB 3LS4L 1DFBH 2VL5B 2R0KH 1T3FB 3B9KA 3QZOA 2AHIA 4MCNA 1QSED 1HZKA 1DR9A 1S8DA 4RETB 4XVOA 4OIIH 1AXTH 3NZ8B 4Y8AA 5GRZA 2EH8H 1XD1A 4PLJD 1BBDL 4TVUA 4XNBA 2HVKA 2FECL 1C1EH 5DJCA 1N12A 3ZDZB 2YAEA 4GKZB 3WFCH 4PGZA 2R2EB 5T33L 4RSVA 4JPWH 4JFSA 4H88L 1BF8A 5HDQH 5DWPA 1U36A 4EZLA 5LGJB 4HK3N 3G3LA 4NN6B 3S3SA 1CF1A 2DBLH 1AS6A 2Y7QA 1IGML 3MRMA 1RUPL 5I28A 1LD9A 4G6JL 1Q9LA 5IUSA 3F8UB 4KOBA 1FFPB 3SCMD 3RFZB 2E9WA 3EJJX 4CNIA 4OZIA 3AXLB 2QADC 3MLVH 3V7MA 2V5RA 4TTDD 4OT1L 2VLKD 4JFPA 3RWDA 5CD5C 4CDGC 1Q0YH 4KXDA 3DROA 2DAVA 4L5FL 2E56A 3HZ3A 4JO1L 4NUJB 2K7QA 1JPFB 3RIAK 1AG6A 2X2IA 4P4RA 4O02A 1U8CB 2QHLA 1TU2A 2XWTB 5LG6A 4OGAD 4DK6A 2Z1KA 4P9HH 4NWUL 2YIHA 4LXFA 1BQ5A 1MFBL 2XBZA 4MJJA 2YAOA 5CZXD 2B9AA 3W39B 5GS0C 4ZUVA 2IG2L 3ENEA 4UM9A 2ROXA 1ZTXL 3P54A 1XB8A 3AWFA 5EEZA 2ZOLA 1B0RA 3GXUB 2WW8A 4XNAA 5LO7A 1F56A 5C0BD 4AENA 3G7TA 3C8DA 1BA9A 3NZSA 1OAYH 5GSRB 5FM5O 4HHAA 4K3DH 3ARGB 5DD0H 1FYTD 1WDAA 2JTYA 2QPSA 4XI5C 4HS3A 2XZCH 3NCFB 4IIQB 4IRZH 1BOYA 2YRZA 3BPNB 4AH2B 4Q9BA 4L8SB 3MV7A 3QNYB 3KPRA 2ID5A 3ARDC 4TLSA 4YSEA 4X5RA 4MGXA 1X4ZA 4XOBA 2G5RA 3WTTA 4QHLA 4KJQC 3L1OH 3OKNB 4GRMA 4CC1A 3KPSE 2E9IA 5D1ZA 3QAZC 3RGVD 4OZHF 5C3TA 3WLWC 1ZLWK 3TV8A 3L1EA 1HKFA 2J88H 4DFHA 4XCYA 2VQ4A 1AGBA 1BLNA 3PIQB 3OAUL 3VWKB 5IB3B 3SKMA 2QV4A 4H40A 1A22B 4G1EA 5L2JB 1F6AB 5AB9A 2KPNA 2V9RA 1PDKA 5JLZB 1MJ7H 2CK0H 4U1IB 1CWVA 4GQQA 1NFDA 2L8AA 1B4JL 1PLCA 4UQAA 3K8MA 2Z0BA 3QUYB 4WHTA 2O5NA 3SKNB 2EIZA 3MRDA 4I48A 1DBML 5BV7L 4UTAH 1EXGA 3LKQB 3UBXB 1FQ9C 5MENB 4AL8L 2VDOL 2PTUA 4QWWD 3KZ8A 4XCFL 5HHNB 4BZ1H 1EO8H 2X05A 3RWFB 5FCUH 4MJ5A 5I1KH 4HJUA 3F58H 3ARBB 4ZOAA 4U0RC 1RH8A 1S5HB 1F00I 3FPYA 1G7JA 4HUWB 4DGYH 5CN3A 5I9QB 1ZV9A 4ZUSB 1RK1A 1LMKA 3VRJA 4YSCA 5GRJL 3V4UH 2AK4B 4I77H 2YEZB 1LLAA 3EFDL 4R4BB 1A6PA 2JF1A 1FVCB 3U4EB 4JPQA 5F7YC 3KCWA 4U3SA 2BC4B 1Y7VA 3AQXA 3Q8CA 1FSKB 4XAKE 5CR1A 1IM9D 3IWVA 3FOLA 1JF1B 2R1WA 1KCBA 4LHUB 2YUWA 1LEIB 2ZQKA 2WXLA 4U3CA 1RIHH 1YEGH 4PJDE 1J7VR 2WZPA 4FLHA 4NJ9H 2ZWYA 3OV6A 3RPIA 4YQXH 3AS1A 4U7SA 3TBWB 5SV3A 4XMUA 5EMYA 2B59A 4IW4C 5T5FL 4OVVA 4G9DB 1VFBB 4OKVB 1L9TA 2VXTL 4KTEH 2WAQA 4YGAB 1UB6B 1V3KA 5D7JC 1YPZF 4BWTA 4ELDA 1NBQA 2YSSA 1TQWA 2G2NA 4JFHD 1MW2A 2IPTH 5DUPL 3HFML 5L7XL 4Y1AE 3TEZA 1NA8A 1CXFA 1U8LA 2Z9TA 5TDPA 1KFAH 3REWB 3SDXE 5F6IB 5E4EB 4Z8FH 4RX4D 4L37A 4JHVA 4XHQA 5IT2L 1MFEH 1OTTD 2Q6WB 5DD3L 3QQ3A 1U21A 4NC2B 5D7IE 4Y5VC 5F7DA 3KPPB 4YFDB 1KJ2H 3GMPB 3INUH 1DJSA 5I1LA 25C8H 1TO4A 4YDIL 1LL1A 2IPKB 1E8YA 1JGVL 1PY0A 4PRBA 2EKSA 1LYQA 4FKHA 5F3BA 3F6IA 4FLOA 2XQ0A 3AMKA 4X9GA 3UMNA 5DJDB 2R39A 1UFUA 2P49B 4YSQA 5HYJA 3KLHC 1TJIL 3AGVA 1A4BA 2MQ0A 1N5YL 4HCRH 2ESVA 5K39B 4I0CC 5C0JB 3RZCD 3SDCD 3NBNA 1GMIA 1TPXC 1FN4B 1QEXA 1MCPL 4KPHH 4NQXB 3RVXC 1S7VB 5J7CC 1JI1A 4TQ8A 3H6JA 3VXSD 4RAVB 2Y2WA 4DKEH 3OLEA 3IF1B 4W9HC 5B39A 2NZIA 3WS6A 2QSCL 2E7CA 4ETQA 5FM5M 2JKTM 3QEHA 4CU6A 3VD0A 1BX2B 1TJHH 4H8UA 4HK3J 3UPCA 3ZKXB 4XCEA 2ICWI 4GQPH 5AW6B 1U9KA 2VQTA 3D06A 4N20A 5DHXB 5AB0A 1NCDL 4LFHG 3NA9H 4CSTA 4G8GD 1ZVSB 1WBYA 4IDJH 5GJTH 2QTVA 2AMUA 1MH5B 2EIKB 2XQBH 4V1DA 5D70L 2ORBL 3SGDH 4TMPA 2X2HA 3G5VB 3UABA 3CN0A 3ZXAC 4YXKL 3HG2A 3IDYC 1URZA 3LEVL 4LOVA 3VFWA 4R0LC 4X9HA 2WB7A 2QGEA 3IGLA 3D3VE 2EE9A 2J4WL 2NY4B 2VN5A 4OD3H 2R4SH 2A7BA 2PYED 3VW3H 1V7ML 5KJRL 2PLTA 3FQTB 3KPOB 4PJ5B 4NNXB 2VAAA 5F71A 3STZB 1DQDL 1FNFA 4X5WB 4YSDA 2JFCA 2I60H 2EUXA 3G08B 4OFPA 3ZE2F 1NAMB 1FI8C 2KZBA 1HIML 3HG1A 3QORC 4NFBA 4AXWB 3WY2A 2VUOA 2YLKA 3H4FA 4FFZL 4JHZA 5D4IA 1XR8A 4NWTH 5FF6B 2XHNA 2XC8A 3P4OB 4GB9A 3AREB 3TC9A 2GJ6B 3LNEA 4NZUH 2PXYA 1SMDA 2XDHA 2XYBA 4ODSL 1EXUB 1VFMA 1CYWA 1X5FA 2EICA 1FZMA 3KNBA 4G9FE 5JUEL 5E00A 1OP5K 1JN6A 2EDMA 3Q9QA 3ARGC 4RMRA 5LVEA 3WG7B 2YKKA 3DHUA 4EZJA 1U30A 5TGBA 4TVPE 1IBDA 1PX4A 1J9TA 4YGVA 2OULB 4LEXL 2AC0A 3BPNC 3FONB 4FQQB 5KN5B 1SJHA 2PPFA 3PQYA 1E6OL 3DMMA 4LDLB 5EIQA 5ICUA 5BRZA 5JHLL 4JQVC 2NXZC 4TPRH 4WHDA 3RKDD 4M1CD 4U2YA 4U6YB 3BP4A 3Q6GL 4AG4L 3NCBB 1SHSA 1DN0B 2K3HA 4QXTB 3ZE1B 4ZODA 4WK4B 5M94B 1SYSB 3TJEL 3OAZK 1YECH 4N2DA 4ODBD 1AP2A 5FK9A 3H9HA 5TH2A 2VN3A 5EH1A 3IGAB 4PHZA 5F72S 2OQJA 3EJQA 2X9WA 2IC2A 4GAGH 2VMJA 3MV9E 5F7FA 2D31B 1T5KA 3VGBA 2W5PA 2JKLA 2HRGA 2B3IA 1GTNA 1NDGA 4YHZH 3FTVA 1SQ2N 1UH3A 3NEEA 4PMEA 1NZRA 4YLQT 2AF2A 2L7UA 3JWNC 5F7LB 5LDUA 4FYQA 4L1LA 2Y6SC 1BLIA 3SN6N 3VI3F 1IAOA 2QHRL 4PB0H 4YVUA 1FZJA 4ZX3A 1J48A 1HI6B 3C87A 3CZSA 2TSBA 2BIMA 2BDNL 4YXLL 3TESA 2WVSA 5J57B 5HDBE 5FGSA 5I9QC 1HS6A 1CK0L 4HMCA 4PY8I 3B8SA 3FT9A 4S1RL 5L8JB 3FHAA 3TBSA 2CKBB 1HH6B 4XNYL 4OLWL 4AYID 3AAZB 2DQCL 3KGUA 4K55A 5GGTL 4A6YB 3N0AA 1YAZA 3L9RB 1M4KA 4F8NA 1R3IL 5I1CL 1E65A 3OKOB 1FSKC 4PJIE 4R5VA 3RB7A 2ATKB 4GKNA 4WI4A 4AE0A 1T7ZA 4WCYL 3GDCA 1EIBA 4LVOC 1CMOA 4EAEA 4QY8B 2ZF8A 3WOVA 2XKNA 5IVXB 5E8OA 4I2XA 1FH5L 1B6UA 4ODVL 4AJYV 2P5EB 5CFHA 3JZ7A 2F54A 4AYBA 1UADC 2BSEA 2IWKA 4CC4A 4TQIA 2DLEA 1UA7A 2KC0A 3V4LA 3T77B 3L5JA 1CG9A 3FU7A 3SDDB 4A67A 5KYXA 5DURB 1JTPA 2C9UA 4ZMLA 5FR3A 2ENPA 2HA1A 2A73A 2WBXA 4N2IA 1USZA 2C7UB 3QUZA 5F1KC 1U4EA 3BRFA 3CSYB 1U8PB 5FYKH 3V5HB 2HKFH 4MSWA 2IBZX 4MNQE 1QSVA 4P5KA 4GG8A 4DP5X 3EW3B 4I18B 1NCIA 3RZWA 1MHHA 1KTLB 3QFGA 1LP9F 1G6RA 2CUAA 3GTNA 4N3UA 4Z7NF 5KVGH 1TJXA 4RRPA 1N67A 1I8KA 3O4LA 3L95B 1WT5A 2CO7B 5E4IA 5HHOE 4PWFA 3LH8A 3KW7A 5IVZB 1W72A 2L7QA 4UINH 1R24B 4QXUL 3GSUB 3VG0L 2L0DA 5K1NA 2VDLH 1R5WB 3EYQC 1I3RA 4LL1A 1H8NA 1AE6L 1BVKA 2NR6C 2NX5A 2VE6A 5CXPA 3ZUNC 5FO8A 1DFXA 1KCVH 3FSWA 4KXBA 1XGTA 3JYCA 3DHJA 3FTYA 3HAEH 5F6HJ 2EC9U 2FWLB 5ALCL 2PWGA 2XUWA 5JW5B 2QVIA 5K59E 5CZKA 2YXMA 3CDCA 3TO4D 3NFPB 3NJGA 4QMEA 1OAXL 2JXMB 3ARTA 3UO8B 5IW1A 3ME0A 2C9XA 2R1XB 3U1QA 4UZSA 2IPUG 2WGNB 3MR9B 4BSWA 1MCDA 2E47A 4ZDHA 3TNNA 1AANA 3BQUD 2MQ3A 4PV1C 1D5XB 4OCRL 2X3CA 1AXIB 3QDGD 2AJZA 3GQFA 2EDBA 4MYPA 4PG2A 1XMEB 3STBA 3UTPD 1XF5B 1AHMA 3ZKXC 3RYMA 2BJML 3B7YA 1QRND 3ECBA 5LGHH 3E6FB 1P5VB 1MVFA 2YZ1A 2VZUA 4B9ZA 1DJIA 3KWXA 5BVPH 1A6AB 1JPTL 2DQTL 1FIGH 4OQTA 2O6PA 1WAAE 5KBMA 3QYNA 1CF8L 2BS9A 5DQJA 2VXQL 4X6EA 5C07A 2EXWD 3BGAA 1T2QL 4DTGH 4LEOA 4HDIB 2HFFB 5I5MA 2IXQB 4BCZA 1YYLH 4FG6D 3O0RL 3GRGA 1H0DA 4CKQA 1KGIA 4N1EA 2AABH 5DJYA 2VRAA 2GSGB 1Q94A 3KYKL 4G6FB 3EJZD 2Y2YA 4DP2X 1LO0H 2QFRA 5FGRA 2XWBB 1CB4A 3D69B 1NFIB 1MW0A 3L48A 4QRRE 3HE7A 3VVVA 3NRQA 4PRPE 3RNQA 3Q48A 4QHKI 3K2KA 4LEEA 1CI5A 2OP4H 2HH0L 2Q7NA 2P5WB 2FL5A 2VXSH 4PJFF 4MHHG 3MREA 4ETYA 3MRRA 4WZ9A 1WS7A 2Z93A 3B9KB 4W4OC 4FS0A 4DGUA 1NAKL 1S8DB 4M6ML 5CINH 1SHMA 2Y36H 4KZ0A 2IOMA 1RPKA 3U6XA 4GXUN 3BWUF 3UC0H 4BSVB 4CGTA 1L9SA 5DJXA 1EDYA 3OKYA 4P57B 3WYRA 4X98A 1N7ML 1NJ9A 5EU5B 4D2NA 4D8OA 2DQJL 2YPVA 1NIAA 2ED7A 4U1KB 3L4UA 3MRIA 3RI5K 4XR8C 4LBEA 4F8QA 4CSSA 3P4MA 1ORQA 3VXTB 3TOPA 3IN2A 4EQ2A 5FFLA 2K78A 1T2JA 4HFUL 1UGNA 5A6LA 4S0SD 1YUHB 4Z78A 1S3KH 2Y7QB 2QPDB 5E0QA 5HVFB 3MRMB 3A24A 3V95A 4FKKA 1ZXQA 1SY6A 1LD9B 4K4KA 1Q9LB 2A74C 4O9HL 1KLUB 4KRNA 4CSPA 2VDNH 2VRKA 5FYLL 4R2GD 2ARJA 2HX8A 2ZX8A 4HP5A 4OZIB 3TP4A 1RURH 1BM3L 4NQCD 2BVTA 4JFPB 2YSTA 4K9JA 3VD3A 3DROB 3GMMA 4Y4FD 3T8XA 4KVNL 3WEXB 5TQ2H 5CLXA 4A55A 5B3JE 2AXJA 1BD2D 4I3RH 3VXOB 1U95A 4GP5B 3X1FA 3WNPA 1ADQA 4P4RB 4O02B 4WW2A 4UOJA 4PAZA 4L8CA 1TU2B 3VWJB 3TA3C 4DKFL 3VNZA 1QHPA 3WY3A 4GQZA 3FKUS 4LPVA 2B1HH 3FAWA 4AT6B 3VXRD 2D0FA 4L9DA 1GAFH 1FL6A 1PTZA 1JHLL 1D7FA 2RHEA 2ZOLB 4F3FB 1B0RB 1WFTA 4NS0A 1JF5A 4LCYB 3S88L 4AENB 3DJ9A 5I8KH 1M9SA 1QASA 1ZA6A 2ED9A 4CKVX 2WMPB 1KN4L 4OU3A 5KSBF 3T6VA 4HHAB 5D7HA 4FXGC 4JRXA 4AK1A 4HS3B 1DUYA 2J6EA 5C6TH 5I17A 1R5IB 1WTGT 3AY4A 1GS7A 3RL1A 3BN9D 3DX0A 1CFVH 5BS0E 1NCNA 3NZHH 2A38A 2BPBA 3LRLA 3R7QA 3MROA 2FT7A 4MA8H 4CU8A 2VDRH 1E28A 4KDTA 4PJEB 4LNRB 6TAAA 2CA4A 1ZDSA 4MA3A 4QJ3B 4F15C 3CBKB 5D1ZB 3KPSA 4EXPX 2BWQA 3FK3A 1T89A 5LWYH 4XO3A 1DJXA 1R34A 4FQ2L 4JHBA 3KE0A 5AEAA 2DQHH 1M42A 5HGBB 4HLZH 3SKMB 2A3TA 3NN8A 2XN9D 5KVGE 2CO4A 4HF5H 5F3HA 4R8WL 4XMPL 1NIEA 3X13B 1BZOA 3INOA 1NFDB 3V4PA 4YX2H 3GLAA 1ROCA 4PBVC 4WHTB 5JW4N 2H7WA 1P9MA 1QSEE 4LVNB 3NSJA 5J56B 1UB5B 4XMZA 3DKHA 4LHJB 3WFDH 2XA3A 3EDFA 1AIFA 1D5ZA 2VZ3A 4YHMH 1XB6A 4MJ5B 3VFTB 4M6OH 1EZVX 2XETA 2E7MA 1O5DT 3QS2A 1GSKA 2QVFB 1QLEH 2N0MA 4LP5A 5CU5A 2XG5A 3DGGB 4JPIB 1G5GA 3VRJB 5DGQA 4O00A 4JJ5A 5T1LA 3L5XL 5J6GA 2XPYA 3NJLA 2CMRH 2X1PA 3GKWH 3P0VH 4PCSA 1LK2A 1SLXA 2ICWA 1TZIA 1Z3GH 4P5TA 3CQQA 1E4HA 2A9AA 4G7RB 1ACZA 1RZJC 2DWDA 3QJTB 4AC2A 2VLKE 3D1MC 1PZDA 4OH2A 3DPBB 1CD0A 4IU3A 2NUTA 4TXVB 2VLJE 1EAJA 4NP4H 3SQOH 2DQUL 3PL6A 2BMKA 2Z7YA 3VXQA 3WDJA 4NN5C 3AQZA 3O6FA 2V2WA 4PJDA 2AEIT 5FUZH 3NPZB 3UJIL 3RPIB 3KJ6L 1JK9A 2VDQB 4UILH 5IMKA 2W60A 1S7RA 2P8LB 3ESMA 1XXFC 1HSBA 3GS7A 5KSVA 1TG8A 5BO1H 1PIGA 1MWAA 3VGDA 3K71A 5C09D 3BUTA 2WP3T 3ULUD 2ZG2A 4G71B 4JR9L 4UQ2B 3MBXL 2D7QA 3QIUD 3THML 3AW5A 4ABQA 1JGUH 1RPQA 1YQ2A 5JDJA 2YKLL 3IGUA 4YBQD 3CIAA 2JTDA 1OY3B 4Y1AA 1U8LB 3ILEA 3OBAA 5TDPB 3SDXA 1SVBA 1XZ0B 1QUNA 2OMTB 4OUUA 2H6UA 4YSTA 3HBGA 4WJG3 4L37B 5HI3C 2YPLD 2D03H 2HRLA 4JFUA 3QQ3B 1FYTE 5H4ZA 3FXIC 5HPOA 5IEHA 3ZK0A 2HWZH 4HSAC 1W0VA 3W0WB 2AAAA 1A8JH 4DKDC 5D7IA 5DWUH 3OVUB 3RTQC 1CLZL 1HWWA 5I1LB 3V8CA 4IIZA 2R69L 4JFOB 4MMZA 4PRBB 1J0ZA 2EKSB 4YHNA 5F3BB 3MRPA 2OMXB 4MXQD 1IC0A 4NHUB 3SBRA 2EEAA 3QUMH 4AQOA 2EYRA 3B9KC 4P48A 3KYNA 5C70A 4RLDA 3S37H 3GBLA 1T1YA 5DJ6B 5ES4B 2BVOA 4XE0A 2IDTA 5IMMB 4OSUL 3MRLA 2VXVH 2BCMA 4X8JA 1W9XA 3PGFH 5CO1A 4AGQA 5B39B 1EO5A 2X0UA 4Y7MA 5BZDA 2NYZA 5F88A 3QEHB 1TVHB 3EOTH 5EU4A 1QHQA 2VDKL 4FI8A 5DD5H 3TT1H 5KSAA 2WXNA 5JW3H 3HOGA 3U0TA 1ICTA 3ABGA 2WN2A 1LHZA 3DVNB 4XCEB 2Q76A 3Q43A 4GOSA 4P46B 4FFWC 4MMXA 1ONQA 3MXVH 3GO1H 1WBYB 5J1SC 4I9WD 2D9CA 1AZVA 4V1DB 4JG0H 3DDFA 4H1LA 4ONOA 3CVHL 1KCWA 4S0HA 4FZ8H 4Z3FA 1U2HA 4JL1A 3VFWB 5GQBA 1E5ZA 1YMME 3Q2NA 2VDPL 2ZX7A 2R0ZH 1NCCH 1NOLA 1JVLA 1CGYA 3KLAA 1Q38A 2JIXA 1FNLA 5ILTL 5JQ6H 3KL5A 2PP8A 2VAAB 4APQB 3G5YB 4GW5A 1ITBB 3QUGA 3VD4A 3EH5B 2XWCA 2H47C 3H42H 2O72A 1TTCA 2YD1A 4M7LT 5F7NC 1KV3A 1BCIA 3NJNA 1JHTB 2QTEA 4X0NA 3MRQB 3I74A 1BF5A 2X1OA 5GZNA 3L1GA 2IDCA 3I75B 3DC0A 3ROOA 5C0DB 3F65A 3SGJA 2HLAA 5J5EA 1FZMB 3KNBB 2EEDA 4N2NA 3IFNL 4G9FA 5FUOH 5G4NA 2G3ZA 2PPDA 3IMWA 3X12A 4IGBB 4RDBA 1XH0A 2C1OB 2N56A 2XXMB 4JFHE 4PREA 4YGVB 1SJHB 4O4YL 1ZWIA 4X7TA 2ADYA 3G6JE 1CFQA 5BRZB 2OR7A 4KK9C 3ULSA 4F8PA 2CAKA 4JO5A 2ADGA 3B2MA 3BP4B 3FZUC 2I85A 5CP3H 3RVWD 4KNSA 5D1ZC 4J3SA 1BEYH 4IHOA 1E5AA 2FWOB 4LFHD 1CD1B 5TH2B 3DV4B 3HJ0A 2R56H 3UBXG 2J20A 4ODWA 4OBRA 4UTAA 1QLRB 2VR8A 2X6VA 2Q8AL 4XPTL 43C9A 2KPWA 1NWOA 3MV9A 5IB1A 3SDYH 2EVJA 1MG3C 1SBSL 2DQDL 3MLZL 4IEFB 3C2SA 3CX5K 1R9FA 2C8NA 2I9LA 1F02I 4LVNC 5TE7L 1JCVA 3RJOA 5I15L 5I71B 2A9NH 1RFDH 5LCVL 1IAOB 1R0AH 3L3HB 3UP6A 1NAML 4P3WA 5TE4H 3B43A 3VXSE 1LWRA 2EIJB 3BSZA 4NIYE 2FX7H 4ZTPH 1E3XA 4JCMA 3HZMB 3O4OB 1IKFL 4N0FA 3HNSH 1QRKA 3CMOH 1JHKH 3SQBA 3ZMRA 1MFCH 2IALA 3LXUX 1UGKA 3TCTA 2VMCA 3GTVA 4FQCL 1I7TA 4LCWA 4PRNB 1EXHA 1ACYH 2ZOKB 4PFEA 4ES9A 4LHUG 1BMGA 3DXAD 2E74C 2GY7B 4BH7A 1CBVL 2PO6D 2HZHA 2D7OA 4POZC 5CAYB 5E9NA 1EUUA 3WFZA 3VFUB 1BEXA 5I8CA 4PJIA 4YFLI 4YWGL 3BUQA 4ZX4A 1TXKA 1A7RL 3IMRA 3E9TA 5I1GH 1PEWA 2RH0A 2XKNB 3ISWA 4U1HB 2MCG1 1NSNL 1SLUA 3KH3A 4I2XB 4R84A 4XZUA 3MLRH 1D9KD 1PLAA 1OSEA 3HJEA 4HJ1A 2F54B 1NCAH 4FP8H 2FATL 1G7QA 1OP9A 3P69A 4LB8A 5LBSL 2D8KA 2GITB 2ZCLH 2WZAA 1CC3A 4XGZB 4TQEL 3IGKA 4M48H 4M56A 1VHPA 3KWUA 1CG9B 5KYXB 3CE1A 4XWGL 4B95C 3HZKB 4KJWD 1T4WA 2BIPA 4AX3A 2UZIH 1O7DC 1RUQL 2WQWA 4PJAF 1NEPA 4PRID 4QPEA 5J1AB 3QC6X 5HHMB 5EWIL 3ULVF 3EGSB 4WO4D 2ENYA 4Y19D 4OV6F 1MRFL 4MNQA 4P5KB 2JELL 3CBRA 1MHHB 5EZOL 4KXAA 4UOZA 2GABA 3K3QA 2XTJC 1A7PH 1WD9A 5EOQL 4CC0A 4GBXD 4MB4A 3PWLA 3QCUL 1CYGA 5C08A 1OSZB 3N55A 4ABWA 2DN7A 5HHOA 3UG5A 4FQJH 3ZO0A 1W72B 1WJ3A 3ZOAA 4K7PX 4BEIA 2GG1A 4AIOA 4HCRA 1CTMA 4GRWH 4KHTL 1KTDB 2J71A 2JJWA 4PWJA 4FRWA 5K1VA 5E70A 5DMKA 4GLRI 2E9JA 3S3PA 3ASWA 4QRAA 4A6YL 1FL5A 1OD7A 1XGTB 2FQDA 2HAZA 2ARJQ 3MI6A 5KS9B 3TYFA 1JRHH 4NZDA 3FUJA 4XRCA 2LTQB 3CDFA 4HPHA 1CTOA 4G8FA 2GJPA 1DBJL 3ME0B 2IGLA 2CCLA 2EZ0D 3QFJB 1CL7I 3QRGH 3TURA 4X5LA 4Z7UF 5K9OA 5FHAL 1L7TH 3ALPA 1OE2A 1U8QB 2CJSA 1HE7A 1R3JA 1RUML 3MRFB 3R8QA 3FT2A 5IHZA 3JV5A 4TSBL 4Z3IA 5HGGS 1ADWA 3IFOA 3U1SL 2OYKA 1YNTA 1PNCA 3ECBB 5CEYA 2GBUA 5K9KB 3GSWB 4GFTB 1MJ8H 5I19H 2ZXCA 3V9EA 3VA6A 4BFKA 2AKRA 1S7XA 4LPTA 4XP6L 5JZ7D 1EEZA 3AUVA 5C07B 2HP4A 4LEOB 4YDVB 1Q1JL 2IPUK 3RHWF 4FGMA 4POYA 3DX2A 5JHDD 3IFLH 2YWZA 3B9AA 1JERA 5DJYB 4PP1D 4ODXA 1Q94B 1MJUL 3ZIMA 4WTWA 1X44A 4W9FC 5L4JA 2ZUQC 1HEJC 4S1QH 4QRRA 3UFIA 4J4PC 1WFIA 1TVBA 2HTKD 4K9EL 4MRBA 4PRPA 2NY3B 5EZIL 3RNQB 4ZFFA 5IFJB 1KTRL 3M1OA 3FBQA 5ANME 1MNNA 6PAZA 1JWMB 3E0GA 2BOCA 3MRRB 4W9LC 1KCUL 2PXYC 4L1BA 1KEGL 4AMXA 3WTVA 1X5YA 1RVFH 1HYSC 3GMNB 3EGXB 2NY5C 3UCQA 5IFAH 4WEEA 3U0WH 4DP7X 2CXGA 3DGDA 5DJXB 4X98B 1NJ9B 2FIKA 5IHLB 1TQTA 1WUNT 3DMMC 3D4GA 3MRIB 3PHQA 4NP9A 5L9DH 4F27A 4G59C 4JN1L 1LE5B 3KM2A 3H53A 5CJOH 2C9PA 2VR3A 4RISH 1KACB 1RJZA 4ABVA 2AJSH 4KVCH 4HETA 1UEYA 2SEBB 3NRFA 1NLBL 3C2AL 3RTLA 5B38A 2EVFA 2WBWB 2YA2A 3RJDA 1RD6A 3OQ3B 4EDWL 3O41A 3AQYA 4H8WH 3GMMB 3T8XB 4G6AC 4PGCA 4PU2A 3X1GA 1S5IH 3PV6A 3UZQA 1HCVA 5C6PB 4UV7H 4P99A 1CQYA 4HK0A 4DQAA 5HYJD 4PSPA 4LZKA 4I5BA 3GI8L 4QHUA 4L8CB 1X5MA 3PNWA 4ZUSA 4JDTL 1E40A 4MZIA 2HJFB 5HHPB 5EU7C 2BWDA 2IH9A 3WEOA 2E6QA 3GXIA 1V3JA 2WM0A 4F91B 3O4OC 3Q1SL 5B1BB 2ODIA 3QXTA 5FYJU 5K9JH 5CILL 5GS3A 1UWFA 2NQCA 4Z7OB 3DETD 4R26L 5AZUA 1JNJA 2W0KA 3UTPE 4NQED 4PS3A 1ZA6B 4ZO7A 3MNVB 1NCWH 5GISL 3ZZQA 1QRNE 2ADIA 3GHEH 1UT1A 3LPFA 5ICXA 4MJID 3TM6A 2XQYA 1BZ8A 2ZCKL 4YDJB 4KNUA 1OGAA 4Y5YB 2R83A 3VU2A 5I17B 5EOTA 3A6CH 3RL1B 1Z9OA 1PG7H 1VACA 1M2VB 2X70A 3MROB 3SOTA 5EHFA 5FHBL 3UEQA 1NDMA 3NACH 3G5WA 2H1XA 3NCJH 3AG1B 4HFWA 2B77A 4Y2NA 4MA3B 3ULUH 3BAEH 4FEMA 4L48A 4XODA 1HQRA 1NCBH 4QOKA 4FA6A 2R1YA 1G6VK 3BWZA 2OSWA 3WELA 4CC4C 2O4EA 1XR9A 3K74B 1FCCA 2H2SD 5EU6D 4WHYH 5EO1A 1RY7B 2AQ1A 3IFPA 1E5UI 3QUZC 5F3HB 1YYCA 3VI4E 3BFQG 1LTXA 3VXNA 3HLKA 3LKRA 1VGEL 2EQDA 3V4PB 2D4DA 2OMWB 1F86A 5DJZB 3I6LD 3MV11 3GSNA 4IRSB 1QSEA 4GRWE 2VLRD 3KBFA 1QZNA 2W65B 2QKIA 1D5ZB 3X1BA 4F33A 1XCQA 3I3EA 4I4WB 5DFWH 2DTML 5T33H 3W82A 1O5PA 2JQMA 4HBQA 4N24A 3K4DA 4TUOB 1WT5C 2QMJA 4H88H 2WINA 1XF2B 2J25A 2EIEA 4PLKD 1YG9A 4EMZA 2A83A 1QKZL 4XX1G 4EKXA 2K3TA 3RAJH 2FJHA 3FO0H 2CIKB 2VISA 4EI5D 3GHBH 1IGMH 4JM2D 1RUPH 1A7QH 4JJ5B 2CNYA 3KXFA 4G6JH 4OCWL 1HXYB 1NBZB 2YOCA 5DO2D 4M1GH 1XIWD 2CRYA 4O2EA 1TETL 4HC1A 2J8UE 3SCMA 4OT1H 1TZIB 2B0SL 1YHPA 2LTQC 2YD4A 3EZ8A 4BD4A 3UX9B 4ESKA 2DWDB 4OM1L 1JZHA 3PREA 1DN2A 4L5FH 1A3RL 2VLKA 1E4XI 4NQCE 4JO1H 4IU3B 1UKSA 5E5RB 1QO3B 3DIDA 1EVUA 35C8L 3N1PC 4XC1L 4NJAH 4ZOEA 2BVYA 1N10A 1BD2E 4XTRD 4NX0A 4NWUH 4PG2C 1MFBH 1JK9B 2AQRA 2KZKA 2W60B 4F37F 4MB3A 2IAMD 3X1NA 4WKZA 5KSVB 2IDFA 3K71B 4XC3H 3U83A 2YHGA 1ZTXH 1KZYA 3FNKA 3HCVA 3VXRE 2APTA 5DVOA 4LIQL 3CSTA 3S34L 4EIGB 3WI9A 1Z32X 1L0YA 2Y1YA 4ENEC 5BZZA 4RGND 5I1EL 1YRKA 3SDXB 5IJDC 5C0BA 3U4BL 3QJHB 2IJ0C 4RDQG 4D9LL 1SNRA 3GK8H 1T03L 4UIMA 4XXCA 4Q9CA 1FYTA 3ABLB 4AWJC 1OZUA 2OXGA 3QK0A 1W0VB 5AKRA 4WV1A 2DL9A 2DWSA 4PWEA 4OLYL 5F7BA 5HI4D 3HE7C 2WLIA 3D39D 5D93B 3P4NB 2VERA 5FUCE 4YDKH 2WWMD 5I0DA 3WXWH 4YHNB 3LOWA 1KXVA 1N3NA 1S9XA 2HXAA 3D85D 3MRPB 4HJSA 3RGVA 2EYRB 2WCGA 4J3OH 1OP3K 4RSYA 1WWBX 4CILA 4ANUA 5H2BB 4HWEH 2LU4A 3EYSL 4B9GA 2XN9E 3CDYA 4JHAH 3FBKA 3QCTL 5F8QC 2BVOB 3GPSA 1KFGA 1B4JH 5FYLD 3RP1A 3MRLB 5BV7H 1DBMH 4X8JB 4U6VL 3UZEA 5C0EA 3QULB 1JOIA 4C8XA 3EHBB 5FOBA 4IM8A 3U79A 1KB5L 3O2WL 3GMRA 3V0JA 4AL8H 2XZZA 1K4CA 3W11D 1OK0A 5F88B 1J10A 3OZ9L 1L9QA 4C54A 5EU4B 1R75A 1RSFA 3WEAA 4M62H 3U0TB 2X6MA 4HKXA 1OSPL 5EF0A 4HXBH 2H3KA 1THCA 3IN0A 5HYSA 1PKQE 2Q76B 2VMDA 5IFHH 2YN5A 4MMXB 3U30C 5AWNL 4LARL 2QQNL 2NY1B 4IRJD 3DYPA 5GRJH 1M6OA 4JMNA 1MCJA 2A9MH 2LLGA 3DTXA 1ZSDA 3P77A 3D3VB 1AO7D 3EZJB 4NKMB 4OZGE 4WW2C 5E08L 1KGJA 1KOAA 2JIXB 32C2A 5MI0B 2CJUL 4ZXBC 4BK4A 4ZW5A 3DHPA 2Z8SA 1IM9A 12E8H 2OL3A 4C4UA 2F8VA 1E9PB 1IFGA 3IVKA 4QXWA 4JS7A 1MREL 1G87A 1KGCD 4GKOA 2F9BT 4M93C 1SZNA 1ZGLM 3Q0HA 4O5LL 4Y4KB 4HMEA 1HDMA 1JPGA 5T5FH 3WTUA 3NIDE 3QQ9D 2VXTH 2P46B 2X4SB 4RGOL 3GMOB 2HLAB 3WN6A 1IMHC 3UBGA 1UA3A 2WLYA 2J1KA 5AW8B 5C09E 3QEQB 3VFPA 1IAIH 4N8UA 5DUPH 4F7CB 3ULUE 3X12B 4X6CF 1MFAH 3AY4C 3BUBA 1XTMA 2F74A 4Y2OA 5BXFA 4GI9A 1N6VA 2ZG1A 4WIQA 4Z7IA 2VC2L 5HSFA 5DD3H 4CVXA 3BJLA 3MJWA 3ULSB 3T0XA 3WNJA 3FFCD 4KDTC 2Y5TA 2B3RA 4RX4A 2YPLE 4QRQB 1B88A 2PR9A 4LLYB 3ILDA 5H4YA 1IO4C 5HHXH 2G4EA 2VCOA 3LN4A 1R5VA 3PCYA 5CZVL 3Q1EA 1RV6X 1T89C 2WXGA 4NUGL 1RUKH 2OR9L 3L3DA 2NSQA 4ODWB 4GIAA 1MRDL 4YDIH 1JGVH 5H35B 2X6BA 1H5BB 5FECB 2LHAA 3MV9B 4H8WC 4X9FA 4PB9H 5IB1B 1C12A 2DIAA 2XOTA 2CRZA 4ELME 4HVBA 5DVLA 1TJIH 4GI8A 2J8HA 2UWEA 3EOAA 3C5SB 1N5YH 1P9MC 5AVSB 3SYOA 4H2CA 4E9VA 1MCPH 1AKPA 4P2QD 1ZEAL 3OJVC 1OTUC 3HS0A 3ULAB 3RZCA 3SPGA 1ECZA 3SDCA 1JGLL 1S7QA 4GW1A 2GI7A 2YK1H 1GJWA 3HEIB 2ADJA 1ZRUA 4KO6A 4BHUI 3VXSA 2YBRA 2VR9A 5GRUL 1X5GA 1MDTA 4ODUA 5HDBB 1TKWA 4CVZA 2XT1B 4PUBH 4WW1A 5IV2A 2JB6A 4GXUM 4GG6F 4L5FE 4X2UA 3BAXA 3GJEA 2P80D 2H8PA 3KLKA 4FI6A 5IQ9A 4FLSA 2UYLA 3AGWA 2NXYB 1RZKH 2H2PC 5CF3A 5IW6A 5D70H 4WSKA 1NM4A 2ORBH 1ZPUA 4P5TC 5I8CB 4G8GA 1ZHNB 4AOFA 1GTFA 1I9IL 4I9WE 5E2TL 2D7TL 3UGUA 3LEVH 4ZW6A 4AQ1B 1XGUB 2J4WH 2ICCA 1B90A 2OI9B 1AD9A 1Y0LA 1ZTXE 3PL6C 4BFBD 2YFOA 4KHXL 2BLFA 3QUYD 1BJ1H 3A4FA 4G5AA 3O6FC 6PCYA 2NNXA 2IFGA 5DD1H 4X8CA 1I1FB 3WIFA 5J8OA 2PYEA 3IMBA 3E38A 1WSST 1C16A 4ZX6A 4X6FA 3JVGA 3X14A 4JRLA 3P4LA 1HIMH 1FVEB 5DK3A 3K0WA 4DN3L 1HNFA 2ZUTA 1IBGL 4M02A 1WFNA 3SBPA 3G9AB 1ZLVH 1EQWA 4WI6A 4LDEB 3RY4A 4L2LA 1O6SA 2WBJB 3FT3A 1KJ2B 5JUEH 1DBAL 2FBRA 4M9OA 4ODTH 1PAZA 5HI5D 3FB6A 4MNQB 4ZMTA 5B22A 3OWEA 2AK4D 2FLRT 4J3TA 4KRMB 1EGJL 4KAQH 3U0PB 3V4VA 3WFBL 4GXVL 2VW4A 2CWRA 4PRDA 1LVEA 1YDPA 4PGBB 4NO3A 5FYJL 4KRPB 4L0ZA 3TVMA 3PWLB 3DA0A 4L4TB 2H9GA 4U1LB 4WFHE 5JHLH 1NMCB 3BQVA 2JQAA 4ZO9A 5HHOB 4KK6D 1GYUA 1ECYA 2DD8L 4MMZC 1F4AA 4N9GA 4LHUD 5DHYA 4AG4H 4C4KT 4PJHE 3CAFA 5E0FA 3D6GA 1BWWA 1PW3A 5DMKB 3TJEH 2IMNA 3OGCB 1KXQE 1NGWA 4XPFH 2QQQA 5B39G 3F6JA 3QR0A 4W6YB 3D48R 3FF7A 2OYMA 4XVSL 3TYFB 5EO0A 3CGTA 3BKJH 2EXYD 4G6KL 4XRCB 3LXAA 4UUJB 4MA7H 3GBEA 3I3BA 3SPVA 4F24A 4XBMA 3R1GL 1X6NA 3SJVD 2DQFA 4ZPTB 3CCHA 3T2NL 1XGPB 2VUYA 3U4AA 3VACA 3VB9A 5F1NB 3NJVA 5IHZB 1RIUL 5TDOA 5KSAC 1SF5A 4BQ6A 1FHGA 3VSTA 3IFOB 3BP5B 4MLSA 2BDNH 3ORJA 5KYUA 3CZFA 5C0FA 2HVJA 5KVDL 4P9MH 5JORA 3G5ZA 4QAMB 1MOEA 3FB7A 4MMXC 3IETA 5D4QA 5CEYB 3WO3B 5I30H 1K6QL 2GK0A 4OGXL 1WD8A 4S1RH 4PGDB 2DYRB 1RLBA 4XX5A 4XNYH 3UPAA 1MRCL 2BSDA 2LQRA 1EEZB 1CBJA 2DQCH 2R29L 5GGTH 3JTTA 4JDVA 3QDHA 4H44C 3DXAE 3OC8A 3B2VL 1G4MA 4ZMXA 2PABA 5E6RB 4YSAA 1L9RA 5KAQF 4HH9A 2AERT 5MI0C 4Z7WE 1H6TA 2ZUUA 4WCYH 1G9HA 4WWPA 1WS8A 2XRAH 4OD1L 1IB5A 1I75A 3GIZH 4L3CA 1E3FA 4QRRB 1FH5H 1TVBB 4PRPB 3QEGL 4ODVH 3B37A 1E8WA 3CPLB 4KKLD 1FLRH 1I7ZA 5ANMA 2B4CC 4BRJA 1LJMA 5GZNC 2R4RL 1FNEB 3DX7A 3FUIA 3HMWL 3FTGA 1NC2D 4WDIA 3V10A 5JPMA 3CHXA 2E9BA 3WTSA 3BE1L 4KUZL 4MAUH 3QJSB 5D1QD 5FLUA 4IOFD 5CCKH 5HPMA 3CU7A 3L4CA 4HWUA 2F15A 4Y8DC 3K6OA 1DVXA 2FIKB 2P5PA 4PRIE 4WI0A 2Y0SA 4BQ9A 4YAQA 3OKMB 4LQFL 3LQZA 2DIEA 4FMFA 2P45B 2EE3A 1SOQA 5FA4A 4ZFGL 4Y19E 4M6AA 3ZT6A 3WKQA 4JO8A 3BO8A 4IYKA 4K3JL 3MBED 3WUWG 3N1FC 2WNKA 2NY4D 4M7LH 4WUKL 1JNNL 1I1AC 2GB2A 1F0LA 3IDXH 2B15A 4PJXF 4QXUH 4PJBF 2NLJB 1HVXA 5AYUL 1C9SA 5CMAA 4ZMWA 1OV8A 4OZHE 2OX5A 4P06A 3VSVA 1N0LA 3PV6B 4M5TA 2VWEE 3UZQB 5DMGD 1CUOA 5GS0L 1QW9A 3ALWA 1OQOA 4HK0B 4QHUB 3OR6A 3JBG7 1OAXH 3LIZA 4MDJB 3AT0A 1A1MA 5BMFL 3TO4A 2OCJA 1EJFA 1JCKA 1GC1H 3KWVA 3GDBA 3ZU8A 4OCRH 3CVDA 3HPLA 1MCOH 3MRKA 1HZHL 3K2MC 4F2MB 4BFIA 4P4KD 3L3GB 3TEUA 4K07A 2NY7L 2RB8A 5CD3B 3EF4A 3QDGA 2BJMH 2Y07L 3VH8A 1S7TB 3NABL 2CDGA 1FUNA 4XB3A 3VTAA 5AG8A 3QI9D 4UU9B 1M3IA 2DRUA 1G9ML 2ADIB 1QRNA 1JPTH 3MRBA 2LVCA 1WGVA 2XWEA 1SDDA 3O9WB 1JZFA 2VXQH 3LHPL 4FTVD 1T2QH 3U9UB 4LSSH 4WFED 3VX1A 4YE0A 4MNGA 2VT0A 3P30L 2X70B 2G60L 5TF1H 1HEZB 1M1SA 5BS0B 3K72A 3O0RH 5T8IA 4FXLA 1I31A 3ARQA 3BVUA 1XEUA 1UHVA 4HFWB 4HKJB 5JHDE 4V33A 4BE6A 3OLDA 1HQRB 5AOKA 1HH9B 1TYRA 2R1YB 4HV8A 4X7FC 3ZL4L 1DVQA 3ESNA 4LPXA 1MCKA 4WJ5A 4Z7QF 1KBKA 2TRHA 3MYZA 4JHUA 3GRWA 5DUJA 2AJXL 5EO1B 4Z76A 3IFPB 3VI4A 4YK4B 2ERJB 5DRZA 4CJ0A 3WY1A 2E0PA 2K45A 3LKRB 1NAKH 1QA9B 3GYRA 1A1OB 5DD6B 5EUOF 4K94L 4XNUL 1GKOA 3VB8A 1H15A 2I7OA 1YPZE 2VDLB 4Z95L 1N7MH 1K8IA 4CN4A 2QKIB 4H25A 1XCQB 3CXFA 4JPVL 3LB6D 4KRPC 3OHXA 2C3GA 3CSFA 1NMCC 2WNXA 2WINB 4LKCB 4AGPA 4K3EH 5GSVA 2GTWA 3V0EA 4EKJA 2A83B 3WGVB 1UM4L 5F9WC 1IEBB 3NCCB 1EBPA 1XMWA 2FJHB 4IOSD 2VISB 3BT0A 4M1DL 4HIJA 1JTOA 4B53A 1FIEA 4X6DF 3E8UL 4OJDH 4A7VA 4HIEB 4MKTA 3Q2LA 1FL3A 4O2EB 1ERNA 2O26U 2R0LH 4XXDA 2O5ZL 3SCMB 2J8UA 5JPMC 1B9ZA 2W91A 4X7CC 5C0NC 1MELA 4XAWL 5DURD 3PFQA 2C3HA 3CZJA 3VSUA 4N2FA 3HA0A 4KVNH 2K8MA 1BOGB 2VLKB 4NQCA 5K5YA 3PDGA 5EFIA 2VLJB 4Y4FA 4AYMC 4YXHL 2W88A 3IJ8A 1IC7L 2C9QA 1BD2A 5E6IB 3QEUB 4DKFH 5GZOD 1UD2A 2BS71 5TF0A 2KUTA 5HYJE 3L9YA 3K8KA 3G6DL 4AZ8A 1MLBA 3EGDA 4QCIA 3L17A 2LGNA 3GSRA 1Z9LA 4OF8A 3CQPA 1FO0H 4LMQE 3Q9PA 2IWGA 1YEFH 3OJDB 1UWEH 3X11B 1JHLH 3VXRA 1OAQH 2AQ2A 4LPWA 4HISA 4B9JA 5T5NG 1KXHA 5GHWL 3C6LB 4NDMA 1FJ1B 1ZLWH 2O5YL 1XH2A 4Z6AT 4NQEE 2FJFA 4YPJA 3MOQA 3LV3A 4FQIL 2PWEA 3WS3B 2J72A 5CSZB 4UIMB 1VESA 2CH8A 4C58B 1FYTB 2C3VB 2DZEA 2OXGB 3HB3D 4MJIE 1H3TA 4KDVA 4WV1B 5CIPH 3ARWA 2NW2A 4RMVA 3SODB 1B3JA 4OD2A 1K85A 1IE4A 2IF7A 4Q4EA 2R8SL 1S78D 2X6CA 5L6YL 5EB9A 4D8PA 1S9XB 4UIKH 4E41D 1MCFA 4N85A 3RVUD 4LCCA 2E59A 3US1A 4HPYL 3ZE2E 3OB8A 5DYOA 5E4OA 4IU2B 3TN0D 2QSVA 4R8WH 3N85L 5EU6E 2XN9A 1FFRA 1AD0B 2AJUL 2X12A 4HXAH 1SEBA 5DS2A 4TULL 2OZ4A 3T6QC 1U0QA 3CFEA 2HFTA 3TH3T 2AZUA 4RMBA 2F53D 4B0MM 2QPFA 3KPMA 3OB0H 2VDNB 2A4EA 2DTSA 3GMRB 3I6LE 1K4CB 4DEPB 2VLRE 1AZCA 4XVTL 4E0RA 2YN3A 4HWBA 1FBIL 1M05A 3BVTA 5DVKA 4GPVA 2CIIA 3P9MB 1PPIA 2H1PL 1RHHA 1PKQA 4PMFA 3WNMA 1XEDA 1HKLL 1MJJB 3LRMA 4JE4B 4BHUA 4V2BA 3ZDXE 4DP6X 3A4DA 2P5WD 1LK3L 5DT1H 3VFSA 1J5OL 1M6OB 1WWCA 2YLHA 1KWKA 4QKXB 1YMMB 3U6RA 3DTXB 1ZSDB 3FULA 4EVNA 1IGFL 3GBNL 3BYYA 3U2JA 1T0MB 3FQRB 3ZSSA 32C2B 2XV2A 4AGNA 3WIIL 4XP5H 4B9CA 4P59H 4ZZKA 1VAHA 4MHHI 1AS7A 1AXTL 3MJ8A 3WFEL 3K4AA 2ZNWA 4MA1B 3W5NA 5DS1A 2MOVA 1W0YT 2ZWLT 1NANI 2XXFA 3NRPA 4KK5C 3D7PA 5I74B 3WFCL 5EF1A 3VI3E 1JPGB 2VMEA 4JPWL 1ZHBB 2C3XA 2BSTB 4UT9H 4OJYA 2CHDA 1OVZA 4N5ED 2KLRA 3U2IA 4JR9H 2JJVA 2VDRB 5E23A 3GMLA 1KY6A 4Z9KB 3OZLA 1JNHA 2DBLL 4O58L 3HN8A 3W56A 4KKBD 3QIUA 2IWEA 3GLEA 2HT4D 3H8NA 3GF8A 3C09C 4L29A 4PVLA 4Y2OB 3WHE1 3HC4L 4RGNE 1QLFA 2YJLA 1NFKA 1UEMA 5GPRA 1TOXA 3G6JB 3GLZA 3MLVL 2E5EA 3F84A 4NQSA 3TLRA 4CVXB 5A2IH 5DJAA 4JM4L 3DK2A 3FHEA 2YPLA 3HFFA 1Q0YL 1E5CA 3WDHA 4HU2A 1D3CA 1SVCP 3RL2A 3D34A 1R5VB 2WBKA 2H0EA 1F3DH 4ONHA 3VWJD 3T4AA 1ODUA 1WUZA 3OKDA 2BO0A 1ASPA 2GK2A 4FFTA 3D39E 3FQWA 2N0KA 3F7VA 3ZLQC 1UJ3B