3IN0A

Crystal structure of the f114p/m121q variant of pseudomonas aeruginosa azurin in the cu(ii) state
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
b'AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPPGHSALQKGTLTLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Rationally tuning the reduction potential of a single cupredoxin beyond the natural range.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3in0A00
1DYZA 4YSRA 4CSPA 4P5SA 2FT8A 1ETJA 1XB8A 3S8FB 4E9YA 2YAFA 3FU9A 3QJRB 3NJHA 4HZ1A 4AI7A 1KDJA 1PCSA 1SF3A 1VLXA 1FFTB 1XB6A 3AY2A 2XV2A 4N4YB 2H47C 3HB3B 2XX0A 1AZCA 3OQRA 2XLLA 5I5IA 2BZ7A 2LLNA 1E65A 1BQKA 1PZAA 4BDVA 3UACA 3S8GB 3S3BB 1QLEB 3T6XA 1PF3A 3FPXA 2PPEA 1NWOA 4F7KA 5TK2A 4RH4A 2GHZA 3AG1B 3WNIA 2HXAA 1PLAA 1IKOP 1KCBA 4YSSA 1X9RA 3GYRA 3U25A 3X1NA 2I7SA 2UX6A 1HFUA 2BW5A 5I6PA 1IUZA 1ZDQA 1BYPA 2W88A 4WTQA 1GR7A 3DKHA 2PP7A 2DY2A 2EILB 1KV7A 2E86A 4DPAX 2YAPA 3NP4A 4YSOA 4AZUA 3T71A 1ID2A 1AZRA 3EH4B 3TBCA 5I5MA 1OCOB 2DYSB 2X87A 1OF0A 3WNJA 5PAZA 2YAMA 5B1KA 1ASOA 2AANA 2XYBA 1KBWA 3OMNB 4BK5C 1JXFA 3AG4B 1WA1X 1NIAA 1JZIA 2VW7A 3CG8A 1NIEA 3N55A 2IDQA 4YVNA 3ABMB 2DWTA 1V55B 3FU8A 3QQXA 4G7RB 1PZBA 1JERA 3TU6A 3G5WA 1OE1A 2DWSA 2Q9OA 1PZCA 2VSKB 3WG7B 3AG2B 5B7EA 1OCCB 1MZYA 1IBYA 5E9NA 1FWXA 1JXGA 3CDZA 1SDDB 2VMJA 4DPBX 2VW6A 1A4AA 2FQGA 2IDTA 1XMEB 3UAEA 4E9RA 9PCYA 2IWKA 3QJVB 2IAAC 1AAJA 4GYBA 4DP5X 4F2EA 3ZX1A 4Q89A 4HCGA 1BQRA 1UATA 2CAKA 1JVOA 2R7EA 4JHVA 1ET5A 2BP0B 1CURA 2YXVA 2Y1AA 1KDIA 1CC3A 2H3XC 3FSWA 2HX9A 3IEAA 2GSMB 4KOCA 1OE2A 3X2QB 1RZQA 2PPDA 4DPCX 2HLEB 3NYKA 4EF3A 4TXVB 4E9TA 2WO2B 4BXSV 4YSUA 1A4BA 1GS8A 2HZHA 3ASOB 2AVFA 2NRDA 4FAAB 1L9OA 1ET7A 4AX3A 1NZRA 1KYAA 4KOBA 2BWDA 4E9QA 1AZNA 4A2HA 2I85A 5I28A 3BQVA 2YQBA 1OCRB 2GI0A 3X1FA 5B7MA 3TA4D 1L9TA 1NTDA 2WO3B 3FSZA 1A65A 1PMYA 5D4HA 1HAWA 3PLYA 5I6LA 2CUAA 3ASNB 1E5ZA 1AS8A 4N8UA 3EF4A 1M57B 2DV6A 2GC4C 1AG6A 2HRGA 1MDAA 2OV0A 5I26A 3T6VA 5D4IA 2WSDA 1ILSA 3FU7B 2J57A 2GB2A 1OOWA 1BAWA 1MG2C 4GY4A 4E9VA 4UANA 2QPEB 3T6WA 1JZEA 1J9TA 2YAEA 3NJKA 3NSYA 2PPAA 3GXUB 3H4FA 8PAZA 3MX0B 5B7FA 2TSAA 4DP8X 1WS8A 2B3IA 4JHUA 5I6NA 3ABLB 4BWWA 1V10A 2Y69B 3AW5A 4E9WA 3NJGA 5B1JA 3UADA 1EHKB 1JZHA 1L9RA 1L9QA 4L0PB 7PCYA 3SQRA 2ZOOA 1AACA 2HX8A 1J9SA 4A2GA 3FYEB 3N2JA 3NJJA 4KNUA 2I7OA 3OMIB 3IBOA 1T5KA 1NINA 3NP3A 3EHBB 2JXMA 1J9QA 1QNIA 1AOZA 1GSKA 4BXVA 2TSBA 2BZCA 4K9JA 2GBAA 1NDTA 5ANHA 1IBZA 5FC9A 1EZLA 1J5CA 1N68A 1BEXA 3GDCA 3PXLA 3EH3B 3FYIB 2FJSA 3RYMA 4UAHA 3JTBA 1ASPA 2BP0A 4BWTA 4QKTA 2XV0A 1GS7A 2Q5BA 4DP4X 2PP9A 4KO9A 1DZ0A 2CCWA 2BW4A 1OV8A 3SBQA 3T6ZA 3UABA 3V9CA 2EIJB 2IWFA 2BHFA 2PLTA 2XVBA 3CVCA 4BDVB 2PP8A 1ILUA 3NSFA 4KO7A 1A8ZA 4YSQA 2XWZA 1PLBA 1HAUA 4GP5B 3OM3B 4A66A 3OMAB 2AFNA 2MRYA 3FQ1A 4KNTA 4ZK8A 1N70A 1ZIAA 2OCCB 1URIA 4P5RA 1AG0A 4HAKA 2XU9A 7PAZA 1A4CA 3X1BA 1KGYE 4YSEA 3IE9A 3DIVA 3SBRA 3BVDB 5AKRA 3AZUA 3FPYA 3NJNA 2AZAA 2PCYA 4M4RB 2FQDA 3TASA 1J5DA 1F56A 2IH9A 1AQ8A 2QDVA 3S3DB 2YAOA 1NICA 2XUWA 2PPFA 2FNWA 2HRHA 4MFHA 5EHFA 1M56B 3NJMA 4YSCA 2UXTA 4A2FA 3C75A 3H4HA 4HALA 2FT6A 1JXDA 1JZJA 3FSVA 3ZDWA 1NIFA 1SJMA 3OD3A 3JT2A 2ZWNA 4A68A 3PAUA 3QJSB 4DP0X 4YSAA 1TU2A 1TKWA 5PCYA 2CALA 1BXAA 4QLWA 2BO0A 4W1TA 4AKOA 1OE3A 4G7QB 4FA7B 3D12B 3NJFA 1J9RA 1ZPUA 3WIAA 2BP8B 3CVDA 2DYRB 2PPCA 2VM3A 3FQYA 2A3TA 4HHGA 3WKPA 3HEIB 3DTUB 4W9ZA 1E30A 1XB3A 3QJUB 1MZZA 1GY1A 2W8CA 1NPNA 1NPJA 1PLCA 2J55A 4G72B 1RCYA 4KNSA 2QDWA 2YXWA 5I6KA 1KCWA 4NAJA 1WA0X 2IH8A 1ASQA 1WS7A 3ERXA 1RZPA 4GP8B 4HIPA 5AFAA 2EINB 5LDUA 2FT7A 4A2EA 4WKXA 1BXUA 1PNCA 1AS7A 2YAHA 4ENZA 2VM4A 1AIZA 1ZDSA 6PAZA 3S3CB 3NJLA 5B1BB 4DP2X 5I6OA 5IY5B 3ZIYA 4BWUA 3SBPA 4PCYA 4F2FA 3H56A 1AS6A 1PY0A 3T9WA 1GY2A 4AKQA 2XXFA 2EIMB 1SDDA 1NIDA 2IDSA 2P80D 5F7BA 2X88A 1RKRA 4CSZA 1W8EA 1PNDA 2CBPA 2J5WA 3ABGA 3V9EA 1E5YA 3NJIA 1CYWA 1GS6X 3CZUB 1SNRA 2QT6A 3FSAA 1BXVA 3EH5B 5D4JA 3FT0A 2VW4A 2XX1A 2ZONA 3NT0A 1CUOA 4JKNA 1L9PA 3PAVA 1BQ5A 4G7SB 2IDFA 1JOIA 3L45A 1I53A 1GW0A 1CYXA 1JVLA 2FWLB 2QPDB 3PCYA 4E9SA 1ADWA 2HX7A 6PCYA 2UXFA 4AKPA 3UGEA 2YARA 2UXGA 1QHQA 4HCIA 3ZBMA 3TBBA 4DP7X 1SHWA 3NSDA 3MBWB 4X4KA 4A2DA 1WA2X 3UAAA 1ZIBA 3ABKB 4GP4B 1NIBA 2OJ1A 3KW8A 2CJ3A 4G71B 4NERA 5I6MA 4YSPA 1V54B 4HHWA 1SHXA 2AZUA 3X1GA 2BWIA 2N0MA 2RACA 2BP8A 1AZUA 4Q8BA 1NWPA 4HCFA 4DP9X 1AANA 1E67A 3FQ2A 4DP6X 4UF7C 2JKWA 1M9WA 2UX7A 1A3ZA 4KO5A 2J56A 4PAZA 2YAQA 2UXVA 1YLBB 4A67A 3IN2A 3FU7A 3KW7A 5I5JA 2IDUA 2VSMB 5AZUA 5B1JC 5A7EA 5B3SB 1B3IA 2P80A 1JZFA 1BYOA 4YSTA 4E9XA 2VN3A 1ET8A 4NB7A 1R1CA 1SF5A 4G70B 1TEFA 1TEGA 3X1EA 4YL4A 5B1AB 4GXFA 1WAEA 1OCZB 2FQFA 4M3HA 2FTAA 2MTAA 1SFDA 1IC0A 1PAZA 1JZGA 3WI9A 1MG3C 3CVBA 2XXGA 1GYCA 2IWEA 5TK4A 1ZV2A 3QJQB 1W6WA 2EIKB 3IN0A 2H5UA 3CDZB 5F7AA 3AG3B 1AR1B 3PAZA 2GC7C 4KO6A 1FA4A 1W6LA 3QJTB 2B08A 1L9SA 3PPSA 4YSDA 2GIMA 4YVUA 1X9UA 2FQEA 2PCFA 1KBVA 1SFHA 2XV3A 4DP1X 2JFCA 2ZXWB 3QPKA 3WKQA 2R7EB 3NSCA 1AZBA 3FS9A
chains in the Genus database with same CATH superfamily
1DFBH 3NIGE 2CCLA 3WJLC 3AT0A 1KG0B 2Z6FA 4GAFB 3WXWL 1T6BX 3S8FB 3FFOA 4LCCB 5DTFA 3DSFL 2MNUA 4GBXD 2FR4B 1AGDA 1P7HL 3FFCD 1EJFA 1TJMA 4YR6B 3VA6A 4IOIA 2R2HB 4MDJB 3SZ6A 3LV3A 2YA0A 3O2WL 5A2IH 3S36H 1A7QL 1LILA 4HIIB 5DQ9B 2Q6WB 3RUGA 1FGVL 1NUGA 3KS0J 1KJ3L 4GUQA 5KYWA 2IQ9H 2ZAIA 5SX5K 1G9MH 3DX6B 3PIQB 5HDQH 4OGXL 1X4YA 1UUSA 3QDGD 4PUBH 4TQIA 1F3DH 4KROB 3T6QC 3JUYA 1YEJH 3DVGA 3VQ1C 5MEPB 1LEIA 2QZ5A 2A77H 1IUZA 1TVDA 3FB6A 12E8L 4DF9A 3GKWL 2QPFA 3ZDYE 3SYPA 5JHBA 2FBJL 4X7SL 5DEZA 3IU3A 3QJXA 1KV7A 1BMWA 1SN0A 1Q1JH 3ISWA 4K8RL 2P5ED 3UH8A 5CD5C 1NC2D 2FE0A 2Y25A 3GB7B 3IXTB 3TBCA 2R0KL 4HIQA 1OGAD 1QD0A 4LQFL 3WNJA 5BOPA 4WHCA 1DVFA 4ZFOA 2XWTA 4O4YL 5AW8B 1YA5A 3AXLB 1IEBB 4J1UA 1S7XA 4G6ML 5CCHE 1CB4A 5H8DA 2YSSB 3VE0A 2ADJA 2X09A 3DTXA 1ZXQA 1R5IA 4E0RB 2A4EA 2CIIA 5C09B 4YE4L 3VW3L 1BZEA 4Z7IA 4TUKH 2WP3O 5KWYC 3IJHB 5EC1B 3TNMB 1CQKA 3MRIA 4PJIF 4PJEA 2DQCH 3A3YB 2PUQT 4XCCL 2X4NA 5F7DB 3EOAB 15C8H 5DI8B 1ZOXA 3G5WA 4OD1H 4FLQA 2I26N 1G1CA 3IFNH 3L9EA 2F1BA 2QBWA 2QR0B 5EBMA 4I3SH 1JXGA 2YD5A 4WGVB 4L29A 5ISZA 4ZOEA 5T1DH 2WOBA 3BSHA 5ACLA 4UT6L 5D1XE 5EZPA 4KUCF 5KZCD 4RRPG 4ZTOH 5HHMD 1S9YB 1XDTT 1Q0XL 1NKGA 4LRNH 4AW7A 4LSQL 4HIHB 1BZ9A 2W38A 2YXVA 2X4UA 2DPKA 3LPGA 5A2JH 3I6GA 2BSSB 3MXWH 4QAMB 2H3XC 3GMPA 2P3YA 1FVDA 4EIGB 4LLVA 4LCUB 3UIZA 2WVTA 4MAYA 2Z91B 2JKLA 3Q7JA 3HPJA 3RTQC 4BGDA 4LHUG 3OLEA 1KYAA 4QOKE 5E5RB 1SOKA 3VGAB 4NNYA 4BZ2A 1AZNA 1FNGA 1ITBB 3UJIH 2ARJA 5EZOH 3E3QE 3TIDB 3ZE1E 4XPHH 3L3KA 1MPAH 1YCSA 1AI1L 3QNXB 3HG1B 3S8WA 2CO6A 5GZOA 4QRQA 1RZFL 4F37K 4PJAB 2FATL 3MXVH 3MZTA 4FQHA 4HGWB 3KXFB 5E7BA 1LK2B 4H4NA 3T8VA 4UQ2A 1JNLL 4NYLB 5DZPA 5I2IA 4G2AA 3WDIA 4E42B 5D9SB 3F83A 5DHMC 4F8OA 5ACMA 5HVHB 4Y5VA 3SY6A 1E6OH 2D7TL 1BZ7A 5H2BA 1H19A 3CFKA 2EXYC 4AT6A 1PJ9A 4CVXA 3D9AH 3DX7A 5D96C 3VWKD 1OQXA 5FYKH 4AZ8B 5DMJB 2NR6D 2WTRB 4C56E 1VACA 4URTB 3UEQA 4OZGF 2E59A 1KWGA 4WF7A 4HS3A 5TF1H 4ISVA 4HPOL 5CGYD 2ADYA 3Q2WA 3IAGC 2WZ0A 4XP6L 5F1NA 2PPAA 3H4FA 4KHTL 3FKUS 1K6QL 4H0GA 2QSTA 1U8KA 3O41A 2PO6A 4XVJH 5EU7C 3VACA 3SKOA 3N9GL 1O7VA 1SBSL 3JTTB 4YDJA 3AAZB 4M03A 1VAHA 5BUPA 3ZZLA 5C08E 3Q2CA 1JNHA 4A2GA 1S7TA 3V0DA 1KFAL 5FCUL 5HHVL 4AMKH 1T5KA 3VNZA 4K3JH 1JPSL 2CDGA 4JPWL 4R96A 5JHLL 5IJDC 4ZAKA 5F9JB 1ZSHA 5EEZA 1NFDF 1ECZA 2GBAA 4ZRGA 2WVVA 3NIDB 4TSAH 3CHRA 1N68A 1A6VH 2IOMA 1Z5YD 3E38A 3TJEL 3K8KA 3EH3B 3ZMEA 4NZTL 3HC3L 4DKDC 3HUJA 4TNVK 1MIEL 4QKTA 1AGDB 5JHDA 3GBDA 5CSGA 4KHXL 4DPRA 4AL8H 2RCSH 4IOIB 4RLDA 2A99A 1NGWA 2D7QA 2CBQA 4M6OL 4DP4X 2YRLA 5C97A 1OV8A 3SBQA 4B97A 5LJYH 1KTCA 1B0IA 2XN9D 1G6VK 4L4VD 3RUGB 1T1XB 2FBRA 3VI3F 3ECUA 1CBVL 1PLBA 4LLMA 5EOQH 5EU6A 1OARH 1XGRA 3QC6X 4FE9A 1A9BA 4HUMB 3UJJL 2E7LC 1NLDH 1X4XA 3ZTNL 3MAWA 3DVGB 1I9JL 1MCRA 1WIPA 3NA9H 1KJ2L 4AIXA 5I1DA 1KGYE 3FB6B 2B0SL 3U0TA 1T6VN 5AKRA 3ZDZB 2NCMA 3PFUA 4PYGA 2Z93A 2FQDA 3TASA 4E36A 2YZ1A 4KRNA 3UBXI 1P1ZA 2X6BA 4ZPVA 3WTTA 2ZCHL 1YDPA 3F6LA 3MZGB 2ZIDA 4PREA 2D3LA 1DQMH 5CLZA 4ZQKA 2OZNA 3L3OA 4FQIH 1Q72L 4M6NL 3L3IA 3C60D 3AQYA 4BZ2H 3QYNA 2HRHA 4J1UB 3BRGC 2HJFB 4ES8A 1YPZE 5J12B 3BN9C 5K59E 3LEYH 4UQCA 4L0YA 3H7LA 4U6YA 3L4CA 5GGTA 2NY5L 1SYSA 3ZOAA 1R5IB 1TTAA 2CIIB 2QL1A 4MA1B 4PWEA 2OTUA 4OFDA 2NX5D 3GXMA 3BFWA 3OB0H 1TQCC 2ZWNA 2J4WL 1WV7T 3ARZA 4FQJL 5ABDE 4QUOA 1L7IL 4HOMA 4LCWA 3DUHA 4KQ3L 1C5DA 4PJEB 5PCYA 4WO4D 3GPEA 5DUPH 4QLWA 3HRZC 3AS2A 1KB5L 4AKOA 4DKEL 1WJ3A 2ZXEB 3ZYOA 1I8LA 2H7WA 2JQMA 3DUSB 5EBMB 5JXEA 4L3AA 3JWNG 4L29B 4NHCH 2F6AA 2IAND 3DOSB 4XVUC 3HCVA 5ISZB 1B2WL 1KULA 2ED6A 1XB3A 1CGSH 5G4NA 1A22B 5EBLA 4A55A 3EYSL 4BE5A 3QZWB 2IO5A 2XQBL 2N7SA 3QG7H 1BZ9B 5FAAA 1JPGA 5IOPB 5GGVH 1N7ML 4PJBE 2D8KA 1TJGH 3TO4A 3TL5A 3I6GB 3WE6A 3GSNA 4Q9QL 2R0WL 1RHHA 1FVDB 1BQLH 3T3MF 3VXRD 3K7UA 3MLRL 4XPAL 4N5EC 1PJWA 3SODB 4MAYB 3SN6N 5DJ8A 3V6FA 3X3FH 3IS0X 5LDUA 2NNAB 2VDOH 3HFML 3HPJB 4I5BA 2HT4C 4UIKL 4POZD 3PQYA 3NBNA 3MRRA 5KVFH 1WQVT 2NXZC 3NJLA 4KPHL 4AXWA 5I6OA 1XR9B 1DVQA 4KGLA 1FNGB 3ZYZA 4XX1E 3DX2A 4XE0A 4LCYA 3N1PC 3I3DA 4FFZL 5BRZD 3RWCB 4CBZA 1MWAA 3L3KB 3HZKA 4M5ZH 3QI9A 4G8FA 4JEGB 3M1BB 4WUKL 2CO6B 3N1GC 4Y7MA 2P8LB 4QRQB 3KPRE 2IDSA 1XD1A 4U4BA 4J27A 5D7KD 1IJ9A 3EO1A 2BIIA 5I2IB 2FECL 2VR8A 2Y6SD 5IB4A 3U1PA 4X7CC 3ZVVA 1XH0A 4Y5VB 3D4ZA 4LCCC 1SOSA 5D2NB 5CJOL 1BLIA 1BZ7B 1VCBC 5H2BB 5C2UB 3CFKB 4K5LA 5AW4B 1QFWI 3DX7B 1BAGA 4WFGE 4LBAA 3LKPA 4QTFA 4TULH 4Y5XA 5AVSB 3H9ZA 1VACB 5ESVA 4NN5B 4X50A 4ISVB 5F89A 3RL1A 1JRHI 5F1NB 4C54A 1B6UA 1HESA 3S88L 4PR5A 4P2QA 4KMTH 4N2NA 2E7CA 4C8XA 4WI9A 4KROC 3FUJA 2VLJE 5FGCE 5GGQL 1F18A 1U8KB 4APQA 3BVXA 4N25A 1RP8A 2VLRD 4X4ME 5DA4A 2MQCA 4JRXE 4HIJA 3SKOB 4EJ1C 5IESH 4YDNA 4WGKA 2CGYA 3N85H 3SKMA 3H2WA 5KVEE 5DVKA 4YDJB 3WELA 1Z9PA 2VDOB 1H3GA 1JNHB 3GXTA 1S7TB 4N0YH 5DS2A 1DANU 2Q7AA 3BE1H 4TVSa 2OJZH 2WMPB 2EEAA 1KIRA 2QSCH 3DJSA 2V9QA 3L54A 5JYLA 1S5IH 5GGTH 4EEEA 1NEPA 4ZAKB 3UAFA 1UUNA 4W9IC 4RGND 3WS3A 2WVVB 1E9PA 1HOEA 1MFCH 1NBCA 3WBDA 1Y6NR 1W15A 4X5LA 4Y2DA 3II3A 1I9RH 5A7EA 1QI4A 1JPEA 1RZKL 3HUJB 1R1CA 3P54A 5JHDB 2I9LB 1LO5B 4FDWA 1DQDH 2XCMC 4I3GA 3RWDA 4N8PA 3X1EA 4DH2A 1K85A 5B1AB 2CO2A 4X7FC 5FXCH 4GXFA 3O6FA 2VISA 3QIWA 2WLHA 1SFDA 4HWZB 4MCYA 1CL7I 3OKYA 2VL5A 4ZOAA 4R2GB 3QJQB 1W6WA 2ZP0T 5KUMA 3VFGL 3A6CL 4X4XA 5TE4H 3UPRA 2ID5A 4LLMB 5D7JD 5EU6B 1XGRB 5ACZB 5MHSD 2BC4A 2Z7ZA 5EEWA 4W4OA 5ADOH 1RZJL 3QJTB 2YEVB 4HFWB 1FH2A 3FCGA 4JO8A 4KKCD 4HH8A 3NG5A 2JJUA 1IAIL 3VFWB 3GSNH 1N67A 1LO4L 3U2SB 3U0TB 4YPGA 3FBQA 4D9LL 1YECH 1A6UH 3M46A 2B16A 2LU3A 2Z93B 4UUJA 3MRJB 4HKXA 1S9WA 1YY8B 2BY1A 3RDJA 1U58A 4ORZC 2FYYA 1P1ZB 4Y4KD 1YDPB 4PREB 1NPUA 1OZTG 4ZQKB 5IP4A 3BH8A 1R5VA 3PGDB 4G3YH 2R2EA 4JQVC 4HG4K 3TBYB 4LHUA 1VRSA 4LSVH 4OCSH 4AI7A 1KJMA 2CZNA 5IVXF 5J1AA 1QFHA 4MNHB 2ESVD 3TBSA 3VGAC 4D94A 5CFAA 3ZT5A 4KDWA 3NOIA 2FEDC 3GTNA 4P9ML 3LKSA 1CDJA 1SYSB 2A9MH 4XCFH 2XXCB 1ECYA 3VYNA 5IR1A 1YVLA 2OK0L 2DN7A 4H1LG 1FBIL 1FRGH 4XWGH 5E1AA 3S8GB 3S3BB 3HI5L 5TE7H 4HPYL 2O6EA 3CNKA 4PJCE 4WUUA 5HVHC 2F18A 1S8DA 3NRQA 3Q8AA 1IKOP 2APFA 3Q8FA 4YSSA 1IGCH 3F12B 4OI9A 3H6JA 2WNKA 3ULUE 1CK0H 4GEIA 5FFLA 2ZYHA 2UYLB 4X6BA 5EH1A 3HCVB 4P3WA 3A23A 1WBXB 4XZUB 5EBLB 4DPAX 5J06A 4G82A 1UZ6E 2EVIA 2FZ3A 2WYZA 4H8WH 5K9JH 1AP2B 2YAMA 3X3GH 3DMMA 4JN1H 3TO4B 1OQOA 3P2TA 5E00A 3OMNB 3WE6B 3GSNB 1HILA 4IKKA 3M7OA 3ZK0A 3Q13A 4OFYA 4BQBA 4NPYA 2OPCA 5EIIG 5EUKB 4ZFZA 3UBXG 3MV01 3B5HA 4JVWA 4K3DL 4ZMVA 4GKSA 4WJ5A 2WXQA 4AVKA 3CXDH 4L1HA 4APXA 1FNSH 4X6CA 4Q2ZA 4D8OA 3RJOA 5I71B 1JN6A 4U7KA 4BH8A 5SX5H 5IEHB 1NFIB 4MQXD 4LCYB 1NCCL 2OXGB 4GBXA 4LIQL 4ADJA 1CTNA 3B2UC 1AHKA 1NDMB 2IGTA 5KEZA 3O2DA 3I9PA 2XBTA 5F8RC 4G8FB 4YBQC 5EF3A 2R9HC 4HK0A 1CI3M 1OSZB 2BY2A 1AO7D 5C0DA 5T1KB 3EO1B 4LVOB 2IDTA 4YZWA 4I4WA 1BIHA 3I02B 2NYKA 4PS4L 3WKNA 4HSCX 1F58H 3TN0D 3QPQC 4KV5F 4DP5X 3CFDB 3QRFM 4OD3H 4HCGA 1BQRA 1UATA 2VXQL 1GGCH 3J2PA 4JHVA 3RIAK 3S37L 4F7PA 2AJZA 4Y5XB 5JOPE 3QZNA 5ESVB 3GMQB 3LH2L 5EWIH 2JI1A 3EG9B 5FR3A 1LO3L 2DYPA 3QQNA 1IBGL 3QZLA 5F89B 3NAAL 5DFVD 4ONGH 1ANUA 1P4BL 2JB5H 2P5EA 4P2QB 5JZ7D 1UCBL 5E4OA 3FQ4A 1OGAA 4QXWA 1IKFL 4LAJH 5K1VA 4APQB 5D2LE 2E6QA 4RIRB 1TITA 2ENQA 5ELIA 1FGNL 4L3ED 4XH2A 3V52H 2N59A 2YRBA 1PZ5A 1NANH 3SKMB 1WFJA 2HTLD 2X4RB 3Q2NA 4EI5B 2BRRH 4JPQA 5DQDL 1CR9L 3AMLA 3ZTJG 2BS71 4WIQA 1WHOA 1KIRB 3LZRA 4P23D 1FC2D 2JIXD 4RDQG 1ETZA 4UV4H 5J12C 1DZBA 4BZ1A 3WS3B 4ORGA 4HLEA 4PVMA 3VGEA 3PWLA 4HETA 4LSPL 4MA1C 1ZWIA 1JHKH 2AKRB 4RVBA 4Y2DB 3B9EA 3SDAD 1CS6A 1X5XA 3L5XL 4AOFA 3E8UH 5LKNA 4X7DC 3SE3C 4ABWA 4CAGA 4NIYE 4TNEA 1IO4C 1MJUH 4KZDL 1MVUB 5B7FA 3O6FB 2VISB 4AL8C 4NDMA 4JHUA 4E9WA 3E2HB 1T7ZA 2EACA 4MCYB 2C9VA 2ZE0A 2VL5B 5C0RH 5IUSA 3FT3A 2OZ4A 4X4XB 3UPRB 4HMDA 1AACA 3WFHB 2R1XB 3GZKA 3VYPA 4YHZH 1NM9A 4GRWF 1E2WA 4ZNEA 1KLGA 5JNYA 2HUHA 1H5BA 3HB3D 3QFJE 4OFPA 3UC0H 3TT3L 4YPGB 3TESA 5DMIH 5EPMB 1NCBL 2AEPL 3QT2A 2F53D 4FTDA 1JI2A 3QDJD 1C8QA 4UUJB 4WWOA 4PY7A 4FQCL 2ZXDA 3PJSB 2Q8BL 1KXVA 4MAYC 1U58B 2G5BA 2R59A 4CN4A 4HW6A 2JE8A 3TM6A 2PXYB 1R5VB 5E2WL 4GKLA 2R2EB 2BZDA 5CN3A 3PHSA 3FT1A 4LHUB 5I1KL 4FLRA 1KJMB 1Z32X 4P4KA 1MCOH 4DW2L 5J1AB 2Y7OA 2G4EA 5ADPL 5AG8A 2XV0A 2WJ7A 3KPLA 4P05A 1RJLA 3O2DH 4GH7B 1WWBX 3SEPA 5KJRL 1TETH 4Z3IA 2WXPA 3VWKA 4IOSA 4LLDA 4N24A 3HC4H 5JIMA 2NR6A 4Y2NA 3MLVL 3PU7A 1I9IH 2AMUA 4WUUB 2AFNA 3CFBA 1G5AA 4ZO9A 4DVBB 4Y5VC 3DBSA 1UWFA 5D2NC 1S8DB 3TWCL 5T3ZE 1TOXA 4ZX5A 3IDJA 2HAZA 4XMKH 4AQZA 3OBAA 5A2KH 4CILA 3NH7L 2AJVH 3QEQA 2ODIA 4KK9C 1IC5H 2XZQL 3NABH 4NN5C 5DVLA 1IIIA 1GCYA 4RMUA 4CDGC 1UZ8A 5FYJU 4MZ3A 2E9BA 3DRQA 3PABB 4U6VH 3S3DB 2FZ3B 1IE5A 3EH1A 3CGTA 4KVCH 3EBGA 3DMMB 4NGHL 3W82A 1M1SA 3VGDA 5E00B 2WXGA 1KXTB 4Z7WA 2ADFH 1HILB 3MRFA 4WU5B 1HJBC 2DMCA 4XMXA 4NPYB 3SE4A 2YOCA 1JXDA 1AQKH 1G7IB 3AM8A 1JF1A 4KKBC 4LEBA 3VI4A 3BZEB 1T2XA 4WJ5B 3PRZA 4QRPA 4APXB 4K94H 4DO5A 4XNYL 1UWEH 2HA1A 2LQRA 1RIHH 1JN6B 1LD9B 1TKWA 1S7WA 5HYQB 1RU9H 3VXSD 3ZO0A 3GUFA 4J23A 2DL2A 5EU5A 2WBJD 3AQDA 3MJ7B 2MCAA 3QCTH 3U83A 3GJFK 1ZK9A 3CN2A 4KXZH 4BZ1H 5LNGA 1ZPUA 4ZAKC 5GS2D 1KIQB 3BSZL 4TTGA 5JXAL 5L2KA 4HK0B 1PLGL 1FDLH 4S0SD 1CXHA 4X6DA 5C0DB 3AT8A 3DIDA 3GSQA 1IM3A 1VCAA 2C9XA 2LR4A 4L4VA 2CPCA 1MRDH 3MFFB 4C59B 3DUUB 3QZBA 1X6LA 5J56B 2ITCB 4F7PB 3LIUA 4IBUA 3BPOB 4UNTA 2ZOLA 2AJZB 1YEIH 3B43A 3I9IA 1FL3A 4L4TD 1Z7JA 1HQ4B 3JWNH 2DYPB 2OZ4H 3I50L 5HP5A 1QEWA 5IHHA 5F3BA 5I24A 3WKMH 2QPUA 2JWYA 4R2GC 4F7EB 5I16A 1N59B 1DUZB 1AKJA 1A9VA 2AK4A 1DVZA 1ZCRA 5BXFA 2NQ3A 5F21B 5A16A 4NZJA 5MEND 3MRBA 4DP2X 4Q7DA 5F1OB 3HPLA 3V6ZB 4B41A 2NUPA 3O6LH 4U6HA 2NW3A 3L7FB 1JGEA 1GY2A 4ODWA 2VZ3A 2CJSA 3DGGA 4MZ2A 3Q2VA 2IGFH 2NX5A 1IL1A 2HMID 4JO2L 1X3DA 1YEFH 4JG1H 2ZCKH 1U92B 3OL2A 2GIYA 1ETZB 1WUZA 4WO4A 5HYEA 3QQ4A 4LSUH 1FNLA 4ORGB 4Q6IA 4XZ4A 5GS1A 2F7RA 2J25A 2WUBH 3OLIA 5EO9A 1Z6JT 4P2OD 3PWLB 4F33A 3SPVA 1VB9A 4K73A 1S3KL 1L0XA 2IDFA 1ZLDA 4NM4H 4H1LA 3SYCA 1BVLA 5KOVC 1NCWL 1FHGA 4KK5D 5ID0A 2IANA 1NOLA 1BZQK 2DEXX 4F57H 3VFSA 2CR0A 5DR5L 5E99L 3MI6A 4PJHA 5KBNC 1IFRA 4OGAC 5DD1H 4JGNA 4WY7H 4QPEA 1NUNB 5KSBF 4OIAA 1WDAA 4LNRB 2F1AA 3VQMA 1LVEA 3TBBA 1ZPLA 1I8LC 5J3HC 5JXEC 1BYNA 4L1SA 3KDMB 3C5SA 3FT3B 4JS7A 3VXRA 2CRMA 3IMTA 3VXPB 4HVBA 5LXGH 5FW8A 5C9JA 2UZPA 5F93C 3KPQA 5TDNB 3RGVD 5JNYB 1ZA3A 4PJ8B 1H5BB 4OU3A 3GI8H 4X9IA 3S36X 1LNUA 2VABA 3ARPA 3P0VL 4FMFA 5AEAA 2VDMH 5F3FA 3BDYH 3SGJA 2G60L 2Z9TA 3M45A 3TO4C 1HXKA 4GB9A 4UBDD 4P5TD 2XC8A 4PJ6A 4L05A 4PY7B 5EIIA 4PCSA 5C0AB 1A3LH 3F7LA 4NC2B 1MRCL 5BRZA 2FJUB 3UBXA 4DAGL 4LSSH 3V0FA 1PY4A 1CT8A 1I1FA 2Z4TA 3RGBA 4P4KB 3TEUA 1UOWA 1N0XL 3N06B 3RY5A 3MVSA 5I71C 1K9TA 3HS0A 4OT1H 2MSPA 1KV3A 3O6KH 4OF5A 4XN2A 3TH4T 3TYGH 3KPLB 3J7HA 1RJLB 2WXFA 5HGBB 4Y9GA 4FLSA 4G5ZH 5CN1A 5F88A 2DTMH 2VLKD 1WEJL 2LOEA 4BK5A 1DJHA 3VWKB 4BFRA 4ZI8A 4LLDB 3S96B 2I9TA 3FZUC 3G7TA 3MJ8B 4OLXH 5TH2A 2X3AA 2VN4A 1JV2A 3OKOA 4OFKA 2IWEA 1MW2A 2NPLX 1RUMH 3BJLA 4LVOC 4OCXL 5IHUL 3TIEA 2NY1B 4GQPH 1QAWA 1KN4L 4Y89A 1KCKA 2ENJA 1XL6A 1ZK5A 3FCTA 2CO1A 3NIDE 1I4FA 5G2NA 3IDJB 3P4MB 4XBMA 4JPSA 5E70A 4X8JA 2DICA 4XR8C 2LT9A 2VRAA 3V79C 2MMXA 1QRKA 2Y9RT 3MV7E 3NCMA 4Y5XC 3QEQB 4LEXL 4G83A 2ICEB 4Z95H 3COOA 1U8MA 2FIRT 1I85C 1TNNA 1YYML 3V4LA 2V33A 1UZ8B 5IROD 4P5SA 4WKZB 3DRQB 4GEJA 5GGSA 4PD4J 5DVMA 5FYKE 3BIKA 2YAFA 3PF2A 4JDVB 1IT9L 3N1FC 3RUGE 1WC7A 1UVQA 4Z7WB 1DSYA 1TTGA 3MRFB 4APQC 4OLVL 3Q05A 2EDFA 3ZDXB 2NNFA 1MCEA 3O3EA 3KJ4B 1TTCA 3VI4B 3X14A 1FJ1A 2RFXA 4NJ9H 4QRPB 1TF4A 4EI5C 3W11C 4EI6A 3ARRA 3WXWH 3QWOA 1TKWB 4NQDD 4JMXA 4JRYA 4LU5L 3ZDZE 4RH4A 1OEZW 3CXHJ 3NSXA 2DM4A 1CFSA 2OMYA 3HNTH 3QDHA 4BZYA 1NJ9A 3MBXH 5IMMA 5L8JB 1IBBA 2UX6A 5L2KB 4X6DB 4DK6A 4RMTA 4H1LH 3GSQB 1A7QH 1IM3B 1FGVH 4Y2DC 1KJ3H 3G08A 4AZUA 4NENA 1ID2A 3GFUA 2WQRA 4OGXH 1OF0A 5D7JA 1O7DC 1XF2B 3O6FC 5AL0A 1J05A 2JV6A 3CC5B 3BVWA 1HK6A 3E2HC 3CWGA 4UT9A 5I76A 2APXA 2FB4L 5F3BB 3MROA 4W4NA 4Q14A 1INQA 2O5XH 4XXDA 3GMMA 5IFAL 1AKJB 2AK4B 5F1IB 1OAQH 3WEAA 3IGAA 4YVNA 4W4OC 5BVPH 3F58L 1R24B 2DWTA 3R1GL 3P0GB 4LVHB 2V2XA 3FMGL 3MRBB 2C1OA 1XF5A 5ISZE 2AJ3B 2L7QA 4RAVA 4R4FL 1JMZA 1I7TA 5T5NF 4FP8L 1PCXA 3HPLB 2C9SA 1SXNA 4KKAC 3WY2A 4Y5YB 1TO5A 1F6FB 5D6DA 3SO3B 2VYRE 2NW3B 1JGEB 4P4RA 4ODWB 2ZYRA 4Q0XL 2YMXH 3G5ZA 5FOJA 3UROR 5IEKB 4UAOB 2GK0A 1JUFB 2EVFA 1ODAA 4B95C 2KT6A 3CIAA 3MUY1 2NX5B 2HJLA 2PXYC 3GMOA 1QQDB 3BAKA 3L9YA 1UD8A 4NZ8A 1IEHA 3QJVB 3BZ4B 2K9UA 1HH9A 1BFSA 3I74A 4XCCH 4WO4B 3QQ4B 2NNXA 3KH4A 5GS1B 3QVAA 4F33B 2QQLH 2BNUA 3O0RH 2DM7A 4I0KA 3ENEA 4K9EL 4H1LB 1T1WA 4PRNA 2R4SH 1BVLB 4L8SB 4Q9CA 4AENA 3ULVE 4ONOA 5HHOD 5L4IA 3VFSB 4Y16B 4LBEB 3THMH 4Q9RH 1AGCA 3KG5A 1R34A 4PJHB 1IC4H 2J1WA 1B0GA 1Q0XH 2EDMA 2EDTA 4KOBA 4PGEA 4ZTPL 3NQKA 1KXHA 1CFVH 4KJYA 4N3UA 1YNTA 3ILPB 3IDYB 2Z8VC 5DJCB 5CEZH 2EIEA 4FJZA 3EDJA 1KELL 5C9JB 2MHAA 2Y6TE 5B39B 3WTUA 1ZA3B 2ZUXA 5GSRA 3UG4A 5JMRA 1LNUB 3HMXL 1P7QD 2VABB 3DMMC 1SY6L 1EEYA 1K4CB 1M57B 3CFCL 1KC5H 4XO8A 2YEQA 2XG4A 4TQ8A 3PL6A 5CCKL 3HNVH 3L81A 5EIIB 3UBXB 5BRZB 2KQMA 4JANB 4PJAF 2HWZL 5FEBA 2FATH 1CT8B 1I1FB 2ICWI 3ZTJH 2EC9T 5AOIA 3RVTD 1DEDA 2FLBT 2OX5A 3Q9PA 1NGYB 3HS0B 4TLTA 5DMYA 3APCA 2D7TH 2Q86A 2EXWD 3O3UN 4GOSA 4X99A 3UZQA 3VDCA 1T7YA 5F88B 3S48A 1S78C 4RFEA 5DA0B 2IH1B 4LLWA 3H3PL 4FA8A 4G8IA 4FFVC 3AWGA 5KVFE 4JQXA 4M5TA 5TH2B 4A38A 3OKOB 4DUVA 1KCRL 3W2DH 1QP1A 2GUYA 1R3KA 3TIEB 1QSVA 3L5WB 1YNKH 3D4GA 4XP6H 1QFWH 4X80L 3TVMD 2DDQL 4GMSH 1MN4A 3FT4A 1I4FB 1AE6H 2DBJA 4QRRD 4WQOA 5GGUB 3BPOC 4HSAC 1LYQA 3MPCA 2VTFA 3EHBB 4X8JB 5BPPA 1VFOA 1N0LA 4MVBC 1JHLL 4I0CC 5KYNA 3ZRFC 4UT9H 3HUJE 3GJFA 3N9GH 1U8MB 5JHDE 2FLRT 1F3RB 1MREL 1W16A 1JRHH 3CIQA 4L3EA 3UMTA 4DCQB 3IRCA 4UAHA 1KFAH 4HIXH 4ODSL 5HHVH 4I0PB 1WC7B 5EULV 1Y7VA 2H8PA 1KLFB 2WZ5A 3ILEA 3HBZA 4HKJB 2P48B 5JHLH 1PZ3A 2CO3A 4P23A 3T04D 2JIXA 3WEMA 1IMHC 5EU6E 4FFZA 2VSCA 1XD0A 5CBEB 2KKQA 3ARGD 2RFXB 4JFTA 4Z7NF 4OI7A 2D03L 3JV6A 3TJEH 1EFXA 4EI6B 5FYLD 4XP5L 2XWRA 1SXAA 3LZFL 2WINA 5ESAA 3SDAA 1HAUA 3C08H 3FJTA 4JRYB 4V2CB 3N44F 4HPHA 5JDSB 1CFSB 2OMYB 4KHXH 3EJZC 1G9NL 2A9NH 4NLAA 5GRXG 1WWAX 1C8PA 4M6OH 1HKLL 4OF0A 4YXKL 5LN8A 1AXSB 1JGDA 4MQTB 3V0WL 4ADGA 3DPDA 1X7SA 2JLLA 4M4RB 4ANWA 1P5UB 4HP5A 2NYZA 4NENB 4PJDE 1Q94A 2AQ1A 3M17B 3CQFA 3UJJH 5D7JB 2IFGA 3RIFK 1J0YA 4BKLB 3IFPA 2X70A 4GAJH 1KJ2H 4U1NA 1J05B 2I60H 2P26A 4R4NC 4EZLA 1CL7H 4BK8A 4LCWE 4UZUA 5FM8A 4ANUA 3LN5A 5CZVL 3JWNC 3MROB 3ARDB 2F53A 1INQB 4PHXA 3GMMB 3W39A 4J39A 3IGAB 3JT2A 4HQQL 1Q72H 1F86A 4M6NH 2C1OB 2LFGA 1H5BC 2CALA 4PJ8C 2DLFH 4L4JA 5IB1A 3WFDL 2WXJA 3TF7C 1I7TB 3KLSA 1JFHA 4G6KH 5DD5H 2CQVA 5IQNA 3RFRA 3WIAA 3GSOA 2NY5H 4I48A 3MRNA 4ZZKA 1DCEA 3PUUA 4P4RB 1SYVA 3G5ZB 3U4EA 2PPCA 1KXVC 3V4UH 4IRZA 5L4JA 2XY1A 3JT0A 5DFTA 4UV7H 3GMOB 2J4WH 4TUJA 4EUPG 4FQJH 1W0VA 3FOLA 1RUQL 4KQ3H 4OZ4A 4P4KC 1NPNA 1UTDA 4ZZFA 4DKEH 3PWPD 2J55A 4IRSD 3CFJA 1UOKA 2BNUB 3PQYE 3BUYA 2VZ1A 3VWKC 1BQHG 3ZE2E 4PBVC 3ERXA 4X6EA 4NXSA 4G80B 1AGCB 4ZSOA 2NY1C 4RGMB 5K93A 1PNCA 1B0GB 2XQBH 3ALPA 3EJRA 4PGEB 4K23L 4K5MA 1N7MH 3OZKA 4DETA 1J5OH 3HZYA 4Y9BA 1B4TA 1KJ2B 4KJYB 3WEBA 3WY3A 2R0WH 4NJAH 3GJFH 2VRQA 2O72A 1KGJA 3MLRH 4XPAH 3NMEA 5DU7A 2ICEC 2QLVB 3G5YA 4AWJC 3WLBB 4ALAH 1EHNA 1X5ZA 3D39A 1WTGT 2WXHA 4ZX4A 1QBML 2DJSA 3HG2A 3I85A 4PFEA 2J5WA 1D5XA 1EEYB 2X2IA 2OI9B 3VXSA 1JD7A 4UOQA 4Z7UB 2XG4B 4Z77A 3PL6B 4FFZH 2WBJA 3SE4C 1Z2KA 1UXMA 2AXHA 3AM8C 3TA3B 4P2QE 3KJ4C 1BQ5A 4GKNA 1PYWA 1MCPH 3W0WB 4YZFE 1COBA 2ICES 4ZG1A 5F7HA 2YARA 2Q86B 3ARFA 3AS3A 5FGBA 4B6ZA 3HG3A 4LLWB 1TZOA 1KENL 4GW4A 2V3DA 1VGEH 4G8IB 4QYOA 5CR8A 5I19L 3O11A 4M00A 3L9RA 4FZEH 1G94A 3ETTA 2ROYA 5B3JE 3GHBH 1EX0A 1A25A 2YD4A 5AUMB 5H94A 1MNUL 3BWZA 4ICWA 3MOQA 3FT4B 5JQ6L 3T8XA 4NC0B 2CA4A 1AOHA 1UXWA 4W9CC 5GGQH 2BP5M 3D3VD 1XSOA 4Z18A 4XO9A 3TGXA 4HYTB 2D0FA 3GJFB 1M9WA 1GC1H 1WWCA 3BSGA 4JO4L 4JAMB 4N3TA 2EDHA 2OMTB 5D1QD 3OGOE 4Y1AA 4KI1A 1IBDA 5BMFL 4LP4A 3I9GL 1QO3A 1ZGLA 2X4OA 5IMLA 4LVHC 1HKFA 1ETA1 2EXSA 2H8PB 4YL4A 1KFGA 4ODTL 3C2SA 2D7NA 4DESA 1T03H 2I07B 4Y5YC 3SO3C 4PGZA 3MGOB 4OZHB 2VCOA 1IC0A 2DM3A 4UAOC 1OIOA 1RJZA 1EFXB 4MGXA 1CD1A 4NP4H 2R2CA 4N0CC 5A2BA 1RZKH 3AG3B 3S35L 3HKZA 2R23A 3NJXA 3FO2A 3RWEA 2B08A 2EE9A 4WO4C 2GIMA 2VXQA 4YVUA 1NAML 3O8XA 2FQEA 4C4BA 3FOMA 3I75B 5GS1C 5E03A 1FFNA 2WNGA 4KVNH 3BO8A 4PJGB 1U30A 3QNFA 4L8SC 4U3CA 5CCJA 2YWYA 3VFGH 3GZOA 1CXFA 3UYPA 1Q94B 5ETUB 4PGDA 3T65A 5DJZB 2NLJB 4P5MA 1FVEB 1RZJH 3K6IA 4PWJA 2G2PA 2COVD 4AGNA 3IFPB 2X70B 3DNKA 5IF0A 4ETQB 1E8ZA 3RGVA 4XNDA 7FABL 4U1NB 2NTFA 4BEIA 2WWOA 4MA7L 3LEXA 5FFGA 5K9QI 2PF6A 4OGQC 3HB3B 2JKSA 2O5YL 3IDYC 3SDCD 2F53B 1OAUL 1SBBA 3ETBF 3ES6B 4GLRI 3W39B 4BDVA 3BAEL 3QFDB 4JFYA 2NY0B 3CLFH 2VJ8A 5DHVA 5IB1B 3DO3A 1KBGL 1OTSD 1ZY9A 1C5BL 3NESA 4NKDB 2W0PA 3MQIA 4BIKA 2D7OA 4I48B 3V5KA 3MLZL 3NCYP 4L48A 3QK0A 3U4EB 5E6UB 1BYPA 4E9LA 3E1F1 4WTQA 4IKNA 3UGUA 2WVUA 6FABH 2CK0L 4C47A 1Q9LA 4DT2A 3OTTA 5F7LB 1MHEA 4UTAL 4KX7A 1W0VB 3D52A 3L3HA 2YAPA 3LKRB 5I5MA 3EH4B 3QW9A 3O45A 4S1QL 2G5UA 5GS0H 2X87A 3LPOA 3HS0C 1HCVA 3RE0A 1HVXA 2A83B 3E6FA 3FH5A 4IMKA 1E27B 4X6CE 2J1KA 1KBWA 1OWWA 4JB9H 3TBVA 4BK5C 3GMRA 3QPXL 4S1DC 5C0IA 2V17L 4TNFA 1EAJA 1DQTA 4X6EB 1J1PH 4HUXA 3NIGF 3HR6A 2YXFA 2YIHA 2H2SD 2B59B 3C9NB 1GAFL 1QFUL 5F6IB 4ZMLA 5IROA 4OF3A 1MCJA 4TTDC 4W70A 3GXPA 3GBEA 3P4LA 5I17A 1XFPA 3HZYB 3QQXA 4LAQL 4MCMA 1PZBA 3EHBC 4W9LC 3V0GA 1R0AL 2GY7B 2JJVA 4AQ1B 3QNZB 1Q1PA 5I8CA 2Y7MA 4PP1D 3NFPA 2UVFA 2ZOKB 3PV7A 2FJHA 3D39B 1XMEB 2R8SL 2WTOA 3B4NA 2W60B 5EO0A 4AUYA 4BFKA 4LVNB 2WLYA 3CQQA 4GSDL 1QWNA 4YBLB 4YO0A 4I0PC 5E08L 4W9GC 3EYQC 4FG6D 1BDYA 4LIQH 4NPJA 3RZCB 2JK5B 2YN5A 4N2EA 2P5EE 4DKFL 1EGJL 2VOTA 1SN5A 4G9DB 2HX9A 4GKNB 2BNQD 4NO5A 4BA8A 1OGAE 3LXAA 3ML9A 4KUCD 4HKZA 4UNVA 4I2XA 3DJ9A 4JZJA 3L2LA 3KS0H 3ARFB 2WTPA 2VXQH 5ENWA 3ULSA 4CW1A 2ZOTA 3NDYE 3RWFA 3LQAL 2QMJA 4OKVA 3KPTA 2YC1B 4GW4B 5DURB 5GQBA 2QHRL 3MLYL 4QYOB 3LH2H 4BRJA 3L9RB 3DV4A 4PH8A 1F4WL 1P5UC 2GAZA 2K4AA 4HH9A 1PMYA 3NAAH 3TPKA 1H3UA 4N2GA 4KJQD 3QZMA 1P4BH 1XGUA 4JM2D 4IDJL 1DJYA 5D7JC 3BLKA 3GBNH 4JFPA 2JB6A 1IKFH 1UXWB 4P06A 2GEQA 4LKCA 1AG6A 2BNRD 4Y9EA 3T09A 4FNRA 1FGNH 2VNCA 2R51A 1D5BA 1I1RA 2BIHA 3BLBA 1QHOA 3ECBB 4NBZB 3VFRA 3VX1A 5C6WH 3ARDC 3IPBA 5HHME 4CMMA 4FYQA 1QZ1A 1PAMA 3BGFB 3IM1A 4Y1AB 2H4EA 1RZIA 2YJLA 4EXKA 1QO3B 1ZGLB 2ZKXA 2X4OB 4IRJB 1WGVA 4ZODA 4OLUH 4D9RD 3JWNE 4RMRA 4HS6A 4L1LA 1Y6MR 2ZNXA 4ERSH 5D6DC 1H8OA 4OR1A 1II4E 3MJ9A 3D2TA 1TQTA 2JCCF 5DRXB 1BREA 4ZNEE 2BLFA 2ITEA 2G30A 3NJGA 1XCQA 1RJZB 1DJZA 3KMDA 5BOZG 5C0NC 5HHXL 3HLKA 4L5FH 3CN3A 4EUPA 4L0PB 4QT5B 5I73B 5E6ID 2R23B 2NY4B 5HHOA 3MLWH 4IJ3B 4KNUA 5E8DL 3FO2B 3RILA 1LEGA 4FYTA 3MKKA 4LLYB 2ARJQ 2WXRA 2GEEA 3O8XB 3V0VB 3FOMB 3W9DA 1E5UI 4WI7A 1NBVL 2E9JA 4NUGH 3BKJL 1EBPA 1FFNB 3BO8B 3KCPA 2O6PA 2OXHA 4GIOA 1BQHA 1H3VA 1DO5A 3PHOA 4GQZA 1L6ZA 2W9EL 5CJQH 4CJ0A 4A04A 2DLTA 3QQDA 4S11A 3MRQA 2FJSA 3IPFA 4P5MB 4RGMC 5DVOA 1VZIA 1WBYB 3SGDI 5IF0B 5J6HA 4K7FA 3BC9A 2NTFB 1M7DA 1P7QA 3LEXB 4JO3L 3VSTA 3QB7C 2ERJB 1U3ZA 4AQAB 4DK5A 5CM1A 5JW3H 3C6LB 3EOYG 1EHXA 4FQCH 3T2PA 2VGLM 2CNYA 2BHFA 2XVBA 3CFNA 3EOBA 3ECQA 4BDVB 4QXUL 1LTXA 5F0MB 4P49A 5E2WH 4D7PA 3IMBA 4U1HA 3SB3A 4BINA 2DS4A 3C87A 3QHZL 3QEQE 4DW2H 4NEHB 4JPIB 5ADPH 2DBLH 4YX2L 3BMVA 1BM3H 1X5FA 3JWDL 1TZIA 4P5RA 2OI9C 1UOLA 3V5KB 2WQWA 2YPKB 3PL6C 5JDSA 4BSWA 2NY5C 3CH8A 2HT2D 3TA3C 5HJDA 1XO8A 3KGUA 2ZSWA 1V3LA 1RAMA 1MSPA 3P77A 4G1MA 3HG4A 4JJHA 3ZDXE 5T3XD 1WD9A 2CLRA 3VU2A 1OGSA 2GJZB 3VI4E 3E6FB 1UGKA 2BPBA 4NKOA 4JFOA 2MCMA 4MJ5B 1KXQA 1SMDA 3DHMA 3LRHA 4HUNB 3TBVB 1M56B 3QR0A 4YEEA 1LWJA 3GMRB 1JGUH 3SPHA 3K2IA 4FXTA 1C12B 5E2TL 4MYWB 3FSVA 2IWGA 1TO4A 4HWBL 3ATAA 3B2XA 4EE2A 1KOAA 2BK8A 1JCKA 2D3NA 2JJTA 4HISA 2A74A 4KQ4H 4X6DE 3TOPA 3SBWA 1FIGL 5FGRA 1F0LA 4UMSA 2IALA 3PGFH 3HJEA 5JZ7C 3QUKA 2OCJA 4L4VE 1JYVA 2MKLC 1WFUA 2JMRA 4HZLB 2GHWB 5I8CB 5BUGA 1UYWH 2CR3A 1OCWH 3L4TA 2AV1B 4A37A 5L8KB 3CVDA 3D2UD 3V9FA 3FQYA 2A3TA 2FJHB 5LBSA 2P44B 3ARGA 5D7LA 4ALAC 6TAAA 3Q6FA 1B4RA 2HTLC 1ESOA 4J6RL 1XXDC 2BMKA 2W8CA 4HJ0D 4BD4A 3H7BA 4DGIL 1MUJA 1RURH 5GGVY 3MRCA 2V3EA 4OQTL 5FYJH 4HAGA 4UM8B 5SWSA 4DKTA 2AK4E 1SEBA 2R29A 3MJ9H 1WVZA 1OP3K 1VZGA 2QVIA 2YPVA 1AGFA 1PLGH 4NO5B 2ICWA 4AYDC 1BAFL 1NEZG 4EUPH 3F5WA 1ORQA 1CLOL 2BHZA 1W8OA 3DDFA 4I2XB 4I7ZC 4XCEA 4JZJB 3SDAC 3MA9L 2ZYSA 4FABL 1IJNA 5IW1B 2H9GA 5ENWB 3ULSB 1ZDSA 3VD3A 4CW1B 5B1BB 5IJVA 3RWFB 1RK0B 2Y4SA 2E27L 1V8HA 2NX5E 1HI6B 4NOBA 1T3FA 1A8JH 1P53A 4PCYA 4YDMA 1WIOA 5D6CA 4MD0B 4WI6A 5GZND 1WISA 2X1PA 4X4YA 2GAZB 1SDDA 4HH9B 4PRDA 3CU7A 4P57A 3ATBA 1I7RA 1XGUB 4JHBA 4EZJA 1MHCA 25C8L 1KB9J 4GIPD 3MLUH 2JB6B 2CO4A 4H20H 4X7TB 4K4KA 5AW5B 1HL8A 3G6JA 1GS6X 2JKRM 2IANE 5K33A 2WGXA 1XXFC 4KXBA 3HB3C 5E9AA 1D5BB 2YRPA 5DO2C 5E5LA 3QUXA 3VFRB 4JKNA 1C08B 2Y3NA 4QTIL 2VWEC 2QSVA 3T0XA 4CMMB 1N8ZA 1XF1A 3H9SB 3L45A 2ZWKA 1RZIB 1OPGH 3IJ8A 4M7JL 4R9HA 2FO1A 4S1SH 2NY0C 1W0WA 3N91A 3P9MB 3FRPG 3WHXB 1BQUA 3C8KA 4F92B 3Q06A 3VXRE 3V7AG 5IWLC 3WIHA 2BDNH 4PJBF 2ZUQB 4QOKD 3HS8A 4WDIB 5HI3D 4ONFH 1ULVA 1RPQA 3GK8L 3CSYA 4IRSA 1HNGA 3ZSSA 1XCQB 5BRQA 2AQSA 2NXYD 2WGNB 3MKGA 1NCWH 3AC0A 4H25A 1S9XB 1HQRA 4NSKA 4EUPB 2Z34A 5IFJA 1OD9A 2EKSA 1RZKC 1P6FA 2IMNA 3KVDD 5BRZE 4RDBA 4KMQA 1O6SA 5FDYA 2BWIA 2RACA 2PWHA 1S7VA 1U3HD 5E6YA 3RRQA 5ECGA 2HH0H 3NN8A 1GJWA 4L37A 5D7KE 5I0XA 2OXHB 3PHOB 2JF1A 2YGVA 3BIAX 1DQJA 2B2XH 4XNQA 4M8UA 2AQ3A 3QQDB 2MFNA 3GSWA 3MRQB 1T0NB 5GJSL 4G8GD 1B3IA 5F6IC 1ZHBB 3D18A 1RZJC 2GI7A 3R06A 5J6HB 4G70B 4K7FB 4PRPD 1RUAL 1M7DB 1KYFA 4GQ9H 3MX0A 3QYCA 5IZ7A 4KI5C 3UPAA 4W6YB 4P46B 3IDXL 4AQ1C 4U4IA 2XDHA 4DN3L 5DXWA 2WP3T 3T5WA 3LQMA 2VN7A 5HDRA 1MRCH 1PAZA 5DEGA 3ECWA 4DAGH 1NH6A 1CXEA 1N19A 4QRTA 5GIRB 1GYCA 2AQPA 4U1HB 4KKNA 3U4AA 1N12A 1U36A 3QIUA 5EFIA 5FYLH 1VPOL 5GRYA 4LVNC 2VLRE 3DETD 5C08D 4NQTA 4HULB 1E9QA 2EXTA 1ZHLA 4YBLC 3ROOA 1AXTH 5CEZE 5KVGH 3UCRA 5F0LB 2R27A 3QQ3A 1KBVA 4IBSA 4CC4A 2YPVH 3KPMA 4BSWB 1WEJH 3QPKA 3RZCC 2PCXA 1U3YA 4G6JH 3Q8BA 1GIGH 4PBDA 4LEOA 2ZSWB 4W9FC 3P77B 3WKYA 5AAWA 1DYZA 4OCXH 2QQQA 5IHUH 1WITA 4H5SA 3SGKC 2CLRB 1G0YR 3U6XA 1KN4H 2ZZUT 1GXEA 4JDZB 4Z3FA 3ARFC 3FU9A 4FHKA 4NKOB 5GS0C 4JFOB 3SSGA 3WXVH 5FGBC 1OAZL 1QWHA 4UU9A 4XMWA 2X2UA 4IIQA 4ZMNA 2Z8SA 4NO0A 2H47C 3QRGH 3BT2H 4JRYE 2VAAB 4WTXA 1I8UA 1Y18A 2D9CA 2OMXA 3VTTA 4KY1H 5AB2A 2C8NA 3E6HB 4MX7A 1M2OA 3GUTA 2DIBA 3FTUA 4LZKA 2MTPA 5D1QA 5I1GL 5MP6H 2VZVA 4XMPL 1ZS2A 5CMAB 4Z7WF 1IT9H 4HS8L 2IALB 1K3ZA 4ZD3H 2O6CA 1ZXKA 3MRKA 1XBRA 4TNGA 3ZKQD 4A6YL 4Z3JA 1F2XK 5LXVA 4ICXA 3M88A 4JQIA 5MHSE 2HFGH 1IIKA 2DQGL 5D7LB 2EILB 3BGFC 3V8CA 4MDRA 3F6IA 4H26A 4IRJC 3H7BB 4J3OD 4PD4K 5KAQF 2ZXQA 3MRCB 1BFVH 1G1OA 1HDMA 3WIHH 3EXJA 5SWSB 3VG0L 1ASOA 3LNIA 5EOCJ 1JBJA 1SEBB 3QDMB 2OBGA 1QKZH 1PZDA 3UPCA 5DC2A 3AG4B 3P11L 5ID1B 1S7QA 5IQMA 1QSED 5DRZA 1LQBC 4Q6YA 1CFTA 2P1YA 1M6OA 5ALCL 5FA4A 5FW6A 4XCEB 5I73C 3MLPA 1J5IA 5CGTA 4JMNA 1TCRA 2NY4C 2Z31A 4A39A 2H9GB 2VXSH 3BH9B 4IJ3C 3RY4A 5IJVB 3O8XC 5TDPA 1LK3H 1T3FB 4CJ1A 3T08A 1PZCA 3K72A 5D6CB 3CHXA 3VD5A 5KVDE 35C8L 3WUZA 4X8CA 4OKDA 4PJ7A 4AYMC 1SDDB 1TVBA 3ZQ9A 2ZT9C 4TLSA 5FB8B 5KG9A 2GSGA 3FFDA 4JDEB 5EZJA 3HIZA 5GRUH 2VR5A 1MHCB 2C4FU 1BZOA 1ZD6A 2ZOWA 4IK7A 1GRWA 4LL9A 2V8MA 5DJ6A 1RZ8A 4DO4A 3G6JB 2R7EA 3CZGA 4FP8H 5E95B 2BP0B 4FC3E 1CURA 5DK2A 2ERJC 4KFZC 3KYKH 2VDLL 3QUXB 2WSPA 3W1ZA 3C6LC 4WI4A 3SPCA 43C9A 1N8ZB 1ZHKA 4ELKB 3OXSA 2Y7SA 3UG3A 1E4XI 1W0WB 1B0RB 3QJZA 3KBFA 1TEYA 3C8KB 3U9UA 1FLRL 1FL6A 3RQ3A 1HZHL 3K2UL 1Y1DA 2CUHA 3GSVB 1UADC 5GRVK 4E9QA 3BFOA 5KTEH 5LDSA 1YN7B 3CSYB 2BSTB 1Z9NA 4N90D 2FCBA 2Y7NA 4NSKB 2AGJL 1HQRB 2XN0A 2WO3B 3NCJL 5EN2A 4O2FA 1Q9KB 1HAWA 2GJRA 3QUGA 3RVXD 4JFQA 1O6SB 2AJYL 4Y88A 1S7VB 3PHQA 3ETBJ 3NN8B 1ZEAH 4L37B 5IB2A 4NKIH 4XE5B 4FNSA 2P5WA 1FE8L 1OT4A 1CTOA 2CSPA 5CEYA 2G75A 3HKFA 4XNQB 2GB2A 2A1WH 4GUPA 3GSWB 4OZIF 1JWMB 2WWMC 3BOVA 2HKHL 3HMXH 4PJIA 3V95A 1HJCA 4JE0A 2ZTBA 3IJ7A 4ODHH 5GRJH 3J07A 3MX0B 3NCCB 3IFOA 3N50A 3BCFA 2VLJD 4LMQI 2R0ZL 3QRBA 1OTTC 5B8CA 4JQIH 3AW5A 2KZKA 1S7RA 4RQQA 3MGAA 4JRXD 4BM7A 2NY6B 4WWKA 4MMYA 2BNQA 2LAGB 5FUCC 3QIUB 2Y1VA 4FNTA 4QHKJ 1NGQL 4IU3B 1ZHLB 5IW6A 3ROOB 2GW5A 4NUJB 4L3EE 5KANI 1MJJA 2ITFA 3Q8CA 1QBLH 4TOYH 2C4XA 3KPMB 5AVVB 5CGMA 5I1HL 1CLYL 2CA3A 2OMVA 5CD5D 4AC2A 4AEEA 2VE6A 4LEOB 2WWKO 1NEZA 5ABZA 1KCRH 5DDHA 2KLRA 5F7EL 5DGQA 5ERWA 1J5CA 1BEXA 1J1XL 5C07A 3UJTH 4K0OA 4JZJC 2XSKA 3JZ7A 4DHLA 1JYNA 5TDOB 2KMWA 5JUEH 4NO0B 3VMPA 1JHLH 3MV8A 1IBFA 2XWBB 2BW4A 1M7XA 2BNRA 1I7UA 1L7TH 5FV2A 2OMXB 1MREH 1U41A 1FO0A 4MX7B 2DJ4A 3GUTB 2VDKL 3MOAH 4ELMB 2PMZA 3AVEA 4JZOA 4ZMTA 1N6VA 4ODSH 2PWEA 4A66A 1SJEA 4FQXA 4MYPA 3WCYA 4HX1A 5TPWH 3MRKB 1AG0A 4K71B 2YPLA 3ASWA 4HLZG 1MFDH 3BVDB 4OIIL 2D03H 3MTXA 3LIZL 1INDL 4OZGA 2OSYA 4LCVA 4MQ7A 4H26B 3I6LD 3OR6A 3NFSL 4JFUA 1F56A 3FRPA 4TPRH 2F53E 1U8CA 5E6IA 2VWEE 5ICYA 2XUWA 1G9NH 3ATFA 5E8PA 3QJOA 3ARSA 4XN7A 1HKLH 2ZUQC 4N68A 4TSBL 2YBGA 5D7SH 1S7QB 4JGUA 1RIVL 4FI6A 43CAA 2CKBA 5DRZB 4PV9A 1WE5A 3RTQD 5CKGA 1J7VR 2X4PB 1CFTB 4Z7VF 5FA4B 4BFOA 5AKTA 1E5BA 3EFFA 2Z31B 2GQHA 4AIOA 4PJ5D 5TDPB 3CVIL 4JUTA 2OMBA 2F1EA 2VQUA 3CE1A 1XCWA 3STZA 3K72B 2DMBA 3D51A 2ATPA 1FCCA 1SLUA 5CIPB 1D9KB 1NFDA 2VM9A 2E46A 3CVHL 4Y19D 4XXWA 4XODA 1TVBB 1DBBL 5KG9B 4N2DA 3FFDB 5EZJB 3V5HA 2BIOA 4HU8A 2EXYD 2X0VA 3CX5J 4MNQB 4U1KA 5DMGC 5FO8A 4S1RL 5GXBB 5DJ6B 1GZPA 3B56A 3BAJA 3QEHB 4F9LA 4BSVA 2XTSA 4QYAA 1LE5B 5ITBH 4ZSOE 1PLCA 1GGBH 3FTSA 4UQBA 4GLRH 4P46C 1M7IA 3ZGIA 4OTXH 43C9B 5BQ7A 1NCNA 1WA0X 1SXBA 2IG2L 4KRPB 2XZAL 4LPYA 1KB3A 5CAYB 3VI3A 1RUQH 3WD5L 3LRKA 5BUAA 3V6OA 3FQTA 3CK0L 1PX3A 3T0AA 2CGRL 1FL6B 1GYVA 2VC2H 2Z4QA 3U1SL 4KU1A 4X98A 3D39E 4GW1A 4MAUH 1NAMA 2EXWC 2X10A 3SBPA 4CU8A 4M7KL 5GJTH 4FN0A 1E6JH 1PY0A 2OR8A 3ETSA 4CADB 2GITB 2VERN 4JL1A 5EIQA 4AKQA 1G1KA 3VXSE 2NNRA 4ATTA 5EN2B 1MW3A 2Y24A 5IV2A 1GTFA 1ZANL 1AVAA 1K8IB 4JFQB 2CBPA 5IQLA 4K23H 3AABA 2XPGA 3ABGA 4P2CG 1URLA 4J3XA 2P5WB 2QT6A 1ES0A 3ZE0B 5CEYB 1L0QA 3FT0A 2G75B 2ZONA 4P5KA 4Y4HA 2CIKA 2V9RA 1FO0H 1OP3H 4AMXA 2EJ1A 1DQQA 4GUPB 1G43A 1TZAA 1WAAF 3CHSA 3QEGH 4R7DA 3U46A 1R33A 3GZQA 4C4KO 2JJTC 1QBMH 2HYMA 4PJIB 3SBWC 2YZ8A 3CH1A 2W0KA 4HC1A 4OD2A 4Z7UF 4Z7OE 1RD6A 2IXQB 1ZKAA 2FD6L 2QVFB 3IFOB 1OM9A 2A6JA 3MODL 1J88A 4NQSA 1K5NA 5EUOE 4JFHE 4PG9A 4BELD 1JZ7A 1RV6X 5FM4A 4WWKB 3FXIC 1ROCA 3IK2A 4G71B 5BZDB 4UQ3B 2C9QA 3P3YA 4DGUA 1MJJB 2VC2B 4LT7A 1KBBA 3GO1L 4HCFA 5HGHA 5BV7L 4YHOL 5DUJA 2CKBH 2E75C 3ZXAC 1N5YL 2XQYK 1T7XA 3HI1B 2UXVA 1NEZB 3IFLL 4LSDA 5DDHB 4KUZL 3MTRA 5ERWB 3ZKNC 5MERA 2ZP8A 5C07B 4LIQE 1MNUH 2CKNA 3BN9D 1TZHA 1X9LA 3QO1A 3DOHA 2EH8L 3IDNA 2BVTA 1LO0L 4L2YA 3PXHA 3O2VL 5B38B 3INUH 3CD4A 2Q87A 5AVYB 3MV8B 3TX4A 3RNQA 1A6PA 2NY7L 4JHWL 1I7UB 3BJ91 4JN2A 2Y2TA 4G9FD 4JO4H 3UTOA 4EIZC 1JGLH 1E7UA 5FHAL 3S6CA 1O5PA 2VIRA 2ZD0A 4OB5L 4GO6B 1P9MA 1PSKH 2XXGA 1SVBA 2XQYG 5BMFH 4DUXA 3VRJA 2BOCA 5F7AA 1AR1B 1SJEB 4FQXB 1FA4A 1FZMA 2UY6A 4I1PA 2Q2EB 4YN3A 1L4IA 3VQLA 4ODTH 5HYFA 4OZHF 2YPLB 2WXKA 4UM9A 4PWKA 3RB5A 2UZYA 3QUXC 4JO5A 4FFYL 3ESPA 3STLA 2EE6A 2E74C 3NSCA 4LLQA 1ERNA 4KKRA 2OTWA 3VH8G 4MQ7B 1N26A 3OR6B 3AWFA 3FRPB 1UWYA 3LSOA 5KANG 2YUXA 1MY7A 1RZ7L 5T3XH 2B39A 1U8CB 5E6IB 2XT1B 5E56A 5ICYB 5B21A 1MLBA 4G6FD 3TT1H 4FG2A 1NAMH 1OXYA 2R69A 4N5ED 3S9DB 1EXHA 4PJGF 1U3HA 3B8SA 2E9WA 1BWWA 1AZCA 3K1DA 4RA3A 2HKFL 2CKBB 3A67H 4PV9B 5GISH 2HT4D 5DWPA 3DBXB 3ILQC 1U21A 2A4CA 4HBQA 1BD2B 1BQKA 4C58B 4P9HL 3IT8D 5C7XL 3EFFB 2ZX6A 3PWVA 3L08A 1VHPA 1MFBH 2XWDA 2J7LA 4G8GA 5DFWH 1CLZL 7FABH 4YHML 1CN4A 2HXAA 3N6YA 3SDXE 3SY0A 3WNPA 2VERA 3MRPA 4PRPA 1NMBL 1ODUA 3MRDA 4L5FE 1X9RA 2ATPB 1D6EA 3D5OF 4QGYA 1NFDB 4JM4H 2WBWB 4MJ2A 3T4AA 1CGUA 2CPUA 2AXJA 1OAUH 5HDBE 4H2AA 4LKXA 2F2HA 4G1EB 3C6SB 1N6QL 3SGDH 4JRFA 3GLZA 2VR7A 3MNWA 1TMCB 3J8F7 3VFTB 1KCUL 4HC1H 4U1KB 5FO8B 2EEBA 1FLTX 3OG6B 1C5BH 4RMWA 4EBQH 1HWGB 3EOTL 4HK3J 5C0FB 4N6QA 4FQLH 3K6FA 1A66A 2YD6A 4CRPA 3MLZH 3GEFA 4HEMA 1F11A 1TT6A 3BN3B 1P2CA 3L3JA 3I84A 2R2BA 5F9AC 3RPIA 2VW7A 3V5DA 1MHPL 4CVZB 4HLJA 2EE0A 2NY6C 1HXMA 2X40A 4UTAH 2NMSA 1JZ5A 3CLWA 3PJLA 3VI3B 4KROD 3QIUC 5I1IH 5CWSA 1NGXA 3O81A 4LOUC 3LRSA 4S1QH 4UTBL 5I66A 1AQHA 3FB8A 4V2BA 1T7VA 5FKPA 1EAQA 5FKAA 5CSZA 4FG0A 4X9GA 4X98B 2YGNA 2AV7A 4GW1B 1NAMB 5IJKA 4EIUA 5FUCE 3BW9A 1D5MA 1G6RL 2F8VA 3BISA 3QR1A 5SV3A 1Y6KR 1YYLL 4X7EC 5B7EA 2BSBA 1MZYA 1QUNB 3HJ0A 4OJFL 1UT2A 3VD9A 2B1HH 5IV2B 3U6RB 1AJ7H 4LFHG 3UAEA 1F4HA 1MCWW 1XZWA 1UCTA 5IB3B 4NQCA 4HJIA 2XPGB 1T4KB 4KI5F 4RMQA 1JP5A 2IADA 2DQHL 2IPUK 4XP1L 2FX9H 3ZX1A 5IVXA 1DBJH 2YKLL 5C09D 3UIYA 2C26A 4N8VG 4TVPD 2C34A 1A02N 1ES0B 2X41A 4I2XE 4F3FA 4M9PA 1KIUA 3P4OA 4LOFA 1MCNA 3QQ9C 4P5KB 4Y4HB 2Y72A 5C3TA 1CC3A 3FSWA 3KPOB 5BOJA 5E24E 3CFTA 5GS3A 4LPTA 3X2QB 2J6EL 5IBLC 1NUFA 2R8SH 4YSUA 4H2CA 1A5FL 5E1IA 1MLCB 4GG6F 1ADQL 3CH1B 2HZHA 2X6MA 5KN5B 2OM5A 3SOTA 2BSED 4OGZA 1EAPA 4AX3A 2WNWA 5A2CA 4IGBB 3U6XS 2MPAL 1GZQA 4K71C 5KBKA 3RX5A 3O3BA 3GJEA 2IPUG 1EGJH 4M7LH 4NN6B 3UFIA 4LCIL 4DZBB 4XHJC 2IGLA 5JW4R 2KERA 5GGSY 2V7NA 5EC2A 4M62H 4JKPH 1KJVA 2WXMA 4LPCA 4LSRL 2OCFD 1QSEA 3JSSA 1RHFA 3NUKA 5D4HA 4N2FA 1GOFA 4AV5A 3PLYA 2VDNH 1R3JA 2R69H 1LMKA 1EZVX 3LQAH 4WSJA 3FHAA 2BOBA 2KUTA 5A2AA 4LO9A 3T3MB 4C83A 1ZLSL 2XKSA 4AGMA 3U48A 5FM5O 5FYJE 5ABAA 2O4EA 2VDRL 4P04A 1MH5A 1DBKL 3RL2A 4X8XA 3QO1B 1TZHB 1TJIL 2FEDD 2Z31C 4IDJH 1I8KA 2LLLA 2RTTA 4XPGL 3ZO9A 1H15A 4CKQA 3VMOA 1MJ8H 2B5IB 3DA0A 5AW6B 1AZVA 3HG1D 5EB9A 1WO2A 4JN2B 5CILH 5HHOE 4IYKA 5I6NA 5DLML 2J8UF 3KXFD 1D9KC 3KPNA 3KWVA 4P3DA 5EF2A 3UADA 1NBZA 4NPKA 3ULVF 4BSJA 3FQNA 3CFEB 1WZAA 5AENA 2F61A 2HT3C 4PB9L 3WNLA 1FZMB 2UY6B 32C2B 3FCSA 3Q8EA 4XO3A 1H3PL 1S3RA 4S2SB 3X11A 1IM9B 4KMLB 1F1AA 4G7YL 3DURA 3G6AA 2LU4A 4UM9B 1QYGH 1ZT1A 2UZYB 3QUML 5I8EB 1VSCA 2KH2B 2MEJB 2Y7QB 3STLB 4O9HL 2KBGA 3MNVB 1RJCA 2OTWB 3ZMRA 1IGIH 3EKCA 4G42A 4KRPC 1K2DA 3S4SG 3DX4A 4ZNCD 2HLFC 4YHYB 5INCA 5DT1L 2FSEA 4YQXH 2AABL 4KKZA 1MLBB 3VD7A 2XZCH 4IS6A 4UZSA 5C92A 1G9NC 4QRFA 4HZAA 1A9EB 3ARQA 2H0EA 3HNSL 2NUTA 3H9YA 2APBA 3WFBL 5J11B 4KO9A 1S2EA 2GTQA 2W9EH 4OGYL 5LB1A 4LDCA 3WJLA 3CVCA 3EJPA 3MLSL 4GXVL 3P3TA 5I5RA 5M7QA 1D5IL 3U1QA 3PWVB 5LGHL 3B2UD 4XBGA 2HVKA 4DN4L 2EVHA 1OALA 4YHNB 5C0BA 4YBQD 2FK9A 5MI0B 2R9HD 3MRPB 2X9YA 4JO3H 4PRPB 5K9KA 5J8OA 1D6EB 1YY9C 4YFDB 5I1JL 4JPVH 3GRBA 1WH0A 4WHYG 4LKXB 3APFA 1WRFA 1JNNL 1CFQA 1KXQE 3NJNA 4PP1C 4QXUH 2PABA 4BFNA 4PQXA 2LU5A 4XHQA 2O61A 3U9PH 1MFMA 5IQ7H 3QHZH 3HVDA 3KHQA 4F7TA 1AHMA 5FYKD 3U79A 3JWDH 3VD1A 2PPFA 1CPUA 2DQEL 1USZA 4EXPX 4G43A 4ONHB 4PGBB 3N40P 4YXLH 1FL5B 1TTUA 1F11B 4HLZH 5HDLA 3GIVA 3K81A 2ZWYA 5HYJB 2R2BB 1NCAL 3RPIB 1C1EL 3DXAA 4WWKC 4QRUA 3NZ8A 4K3HA 5CUSL 3SGEI 1NGXB 5I66B 3LRSB 3REVA 3FB8B 5FKPB 1IGYA 5LAPA 1T83A 1SLWA 4JG0H 1BXAA 1CVRA 2AV7B 4Z7QF 4JKLA 3EFDH 5D7LE 1U8OB 4Y7OC 3BW9B 1ZV9A 5T5NG 5DGRA 1D5MB 5E51A 4GPVA 3UAJA 8CGTA 5FYLE 1GJUA 3Q0HA 1P7BA 1WZ1L 4IIZA 1HZKA 1AYOA 2VM3A 3FQXB 3UYRH 3UBHA 3T2OA 5KVGE 3WKPA 1CYGA 1I75A 5AW3B 3BVUA 4NQCB 1FIGH 1A3RH 4J8RB 5EU3B 4UI2A 2IADB 1BECA 3KYNB 5IVXB 4DZ8A 4AK1A 1YEHL 3ZQXA 4LESA 4F3FB 1KIUB 1EHAA 4JO1L 2G0LA 2JI3A 2IAMD 5AOLA 2V7HA 2IH8A 2XQYA 4PJDF 3PG2A 2FT7A 4O2EA 1KGCD 1AR1C 1QASA 3EYFA 4FQXC 2Y06L 5EORH 1GYUA 3VTMA 4OQTH 4LPUA 4ZMZA 4HHAA 4W93A 3FU6A 2KS0A 3O3BB 1QG3A 5ISZD 3GJEB 1Y1UA 3HAEG 3QORA 4JDTL 3JV4A 2HB0A 1FH5L 3Q1SL 2HFEA 2ZCLH 3N40F 4GUCA 2V7NB 5I75B 4FEMA 3G6JE 1ZT4A 4ZDHB 3VH8A 1QSEB 2C7FA 5KJ7E 1NIDA 2P80D 4KDTA 2QGDA 1MJ7L 1RKRA 3O4OB 1TQUA 3R18A 5LAXA 3P30H 1XH3B 2Z0BA 4XTRC 3DSNA 5E6IC 3BZ5A 2DD8L 1HYRC 4ZPTA 5T1LA 2E27H 4MAYD 2BOBB 4R7VA 1VIWA 1INEL 4C83B 3GSRA 2XTLA 3GNML 4LARH 4AJYV 4NUMA 2DWDA 2IPTL 4DOHE 1DQKA 4Y19A 3OJ2C 3RL2B 2D7PA 4OCRL 4OM1H 4JFEB 4D0BA 2ZJSH 5AL8A 5HD8C 3ESUF 4RWYL 2BFVL 3L7EA 3BI9X 2XFXA 4B0MM 3RWJA 5F9WB 1G1YA 2C3VA 1PY9A 3RX8A 4AQEB 3KPNB 4P3DB 3MDJA 4WWNA 5KW9L 4PRAA 3M86A 4XXWC 1A6AB 2YWZA 4X4KA 2OYPA 1RK7A 1MRFH 3N41B 1KEML 3ABKB 3VVWA 5LGKA 2QSQA 3OZ9H 1O0VA 1EAOA 4BE6A 2VH5H 5HHNB 1QLEL 4W9EC 4KJWC 1EMTH 4MMZA 3X11B 1AGEA 3RIFF 3K4DA 3VFVA 4FF9A 1KB9K 3ZHNA 3X1GA 3B6SB 1OOAA 3OPZH 4KK9D 1ZT1B 2D0HA 2ITDA 5F0PB 3SE9H 2EDBA 1EDHA 3GK8H 2JKWA 1E4XH 4KTEL 1UASA 1QNZH 5F7FA 4PTTA 3UL4A 3K0WA 1K2DB 2IDUA 4QHMB 5B3SB 2FSEB 3EZ8A 5JR1H 3KVPA 5JOEA 4F8TA 4TF4A 1T0PB 4IS6B 3US9A 3BEVB 4KKBD 2AQ2A 4D8PB 3RVVC 4PPTA 2H6PB 1PS3A 4NC1C 3MU3A 4YWGH 4IKIA 5DS8A 2FEJA 3CVBA 4UNIA 3S98A 1WK0A 2ZX8A 1D2PA 4AJWA 3DX9A 3KLHC 1QR1A 1E4WL 2H5UA 1XBDA 2CH8A 2AAVA 2HVKB 2GC7C 3LX9A 5C0BB 2NTSP 3KR3L 1EQWA 5IJCC 1OAKH 1JPTL 1FPTL 4AE0A 3PPSA 4H8UA 4N8VA 2YK1L 4M9OA 4DN3H 1CDUA 2ZXWB 4Y4HC 2V5RA 4QHKI 3SDYL 3ZW3A 1QI3A 2DI7A 1TLMA 2MIZA 3P3SA 1CFQB 4P3CH 1AZBA 4BFIA 1DL7H 4Y2OA 3UXFA 2O61B 5JHDD 3WG7B 4OBSA 4AEIL 1MF2L 2E7LA 5HGAA 4K7PX 1IV8A 4F7TB 3L3DA 5BO1H 4DVRL 3ALWA 3HLAB 3WGVB 4NO2A 5D72H 4G43B 1C5CL 4IGBC 1RLWA 5KSBA 1OWRM 5I23A 5D1QE 1YEKL 1DJSA 2ZUVA 3GIVB 4N9OB 4R2GD 5T5FL 5BZWA 1IGJA 4MD5B 4N4YB 5FFOA 3FF8A 4NN6C 4AV4A 3LKQA 3DXAB 1CGYA 5EU6D 1GKOA 4QRUB 4ZOCA 3NZ8B 3L3GA 3U7YH 1KN2H 2BJML 3SJVA 3REVB 1QBAA 3KLDA 3VDAA 2BWQA 1XWVA 1IGYB 1R3HA 4M48L 4XWOC 3FPXA 1OAZH 3CPLA 4AITA 1YMMB 2GHZA 1KCSL 5AW2B 4F15B 3CSFA 4XPBH 1DE4A 2HFTA 3EF7A 4TS6A 5EZIH 4A7UA 4FA6A 4G9FA 2V3FA 3GBMH 3SKJH 1KEGL 4BCZA 3SPIA 2F5BH 1G7LB 1IC7H 5T8IA 5I1GH 1RK1B 1XF3A 4JPKL 4N2IA 3ZZQA 4WFHD 3HRZA 3KJ6L 5D71H 4O2CB 4P59H 4HS8H 2F5AL 4DZ8B 3QHFL 2B5IC 5B1KA 1WCBA 1MIML 1U33A 4IHOB 4U49A 3WFEL 3IMWA 3VVVA 2ZUYA 1BJ8A 2QQKH 1HU8A 5AAPA 4HCRL 4IOFC 1VA9A 3MJGX 2V7HB 3MCLL 1P9MC 4OGAD 3EZJB 1LWRA 4XC3L 4O2EB 3QZWG 2H1PH 3ABMB 1JDDA 5DJ2B 3WSQL 1SLXA 4PJ7E 1W9XA 1F1DA 1O9VA 3DVIA 4RBPK 3VG0H 4HHAB 3SQOH 3VGFA 4AH2A 4CSSA 4ZMPA 4HUCA 5JXED 3LVTA 3QORB 4NKMB 4XMZA 3JV4B 4MASA 3IU4L 2VQ1B 2EICA 4RNRA 1PIFA 2HFEB 4F9PA 5DJYA 2BVEA 3VH8B 2VMJA 1MQKL 2VW6A 4OIBA 3QUYB 5LAXB 3C5XA 3TO4D 3WFCL 4YHYC 4BBWA 1KCVL 4PRIB 1UB5A 3TZVB 5KSUA 1AAJA 4B9JA 4F2EA 4ZPTB 5T1LB 3KLAA 3L4ZA 1AQDB 1D7BA 1VEOA 3LQAC 3GSRB 5EEUA 3B5TA 5J11C 5L6YL 3QXUA 2AI0H 1RMFH 2DWDB 4M5YL 5SX4I 2XVGA 3KPSA 1JE6A 1NFAA 2GSMB 1OB1A 2AQQA 3F7QA 2GSIA 3S0PA 3E8VA 1VGKB 3EAKA 1RI8A 4TKWA 2L04A 4YGVA 4D0BB 2FR4A 9CGTA 3L7EB 5JOFA 1ET7A 3AB0B 3LKOA 2XFXB 4MDJA 5MI0C 3KDPB 5T1KD 2VDLH 3GXDA 2Z8RA 1B4JH 1EXGA 5BW7A 4PRAB 4HIIA 1D6VH 3WTVA 3VYOA 1QFWM 1IFHL 4GNKB 1L9TA 3LIZA 4O02L 4NRXA 2OR7A 3FSZA 2H3NA 3DX6A 1AC6A 1HHKB 1T2QH 5CP3A 1ZMYA 2P5WE 5KYUA 1HN1A 4A7QA 1U8JA 5AOMA 2EYRB 5AWNH 4MJIB 4MMZB 4KXCA 1AGEB 1FLRH 5F7KC 4D9QD 1R3LA 3K2UH 5LWYL 4ZUUA 4YXHL 3RTLA 4CC0A 5DF0A 4H8PA 2OV0A 4U31A 1XSJA 4JREB 4PJIE 1Q0YL 2IDCA 1ILSA 1KY7A 2CNZA 4O5LH 3B7SA 4LP8A 1A7PL 2M1KA 3CN1A 4PTTB 5HHPB 5C0GA 3IXTA 3NCJH 4DFIA 2X53A 2WB1A 4NP9A 5F0JB 4X9BA 4APQD 2ZXGA 4Z78A 3JBG7 2VDPH 2IPKA 1R5WB 2VDQH 3IDGB 2HJKB 1T66C 3AXLA 1ZTXH 3ARWA 1IEBA 3NJKA 3RGHA 5F2FA 3ZKSD 5AW7B 1PG7H 2BNQE 2YSSA 3NEXA 1VFBA 2YGQA 1CFMA 2TSAA 4EI5D 3W11D 2DLEA 5HGGS 2YMOA 4YFLF 5KYXA 2H1LM 3KM1A 4OM0H 1IAMA 1HL4A 5D7HA 2ISDA 1CZ8H 2P49B 2G0KA 5EC1A 4RISL 1QR1B 3LRMA 1G4MA 5AOZA 1ZVHA 1J9SA 4ZW8A 5F7DA 3EOAA 5DI8A 2RALA 4GT7A 5EEXA 1BZ8A 4N8VB 3OSKA 4PJXB 2X0UA 2ZSVB 4YDIH 2VKWA 5C07E 2R0ZH 4HWNA 4Y2DD 4EI0A 2JXMA 2VDLB 1I82A 2KQNA 4PJFB 4BXVA 5AYTA 4BFIB 1XX9C 1W2KT 4LPWA 3T2QA 1EZLA 1QPXA 3MV8E 5ICXA 4RGOL 1SUJA 2V6HA 1NGQH 3O6FD 2BNRE 3L3DB 1EFQA 1Z5HA 2WCSA 1GYWA