3IN0A

Crystal structure of the f114p/m121q variant of pseudomonas aeruginosa azurin in the cu(ii) state
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPPGHSALQKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Azurin
publication title Rationally tuning the reduction potential of a single cupredoxin beyond the natural range.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3in0A00
1NPNA 1AZBA 1QNIA 1A65A 1SJMA 1JZJA 1N70A 3ZBMA 2H47C 2XVBA 1MDAA 4YSEA 1AZUA 4DPCX 2XX1A 4NAJA 4QKTA 2DYRB 1ZIBA 3X1EA 2VW4A 3NJMA 4M4RB 2CAKA 4WTQA 3KW7A 1R1CA 1NTDA 5LDUA 2FQFA 3V9EA 3TBBA 1SF3A 2J55A 1AG6A 5I26A 1KGYE 2B3IA 1M56B 2NRDA 2ZONA 2TSBA 4AKPA 3JT2A 3PAVA 5A7EA 4A2DA 4GP4B 3AG4B 4N4YB 4YSQA 2AANA 2VW7A 2W88A 1NICA 1JZGA 4DPAX 4YSOA 5FC9A 3ASNB 4NB7A 2IDTA 2A3TA 1BYOA 2BHFA 1ASPA 2P80A 1BAWA 3NT0A 4HAKA 2BZ7A 3PCYA 4E9TA 1UATA 5AZUA 4QLWA 2IWFA 3OD3A 4HHGA 1CUOA 4AKQA 1JZIA 3NYKA 5I28A 3QJQB 3PPSA 5EHFA 5D4JA 1IUZA 1IBYA 4BK5C 1AOZA 2VMJA 3EF4A 3UABA 4KO5A 1URIA 4HIPA 2BW4A 2EIKB 4GP8B 2UXVA 3ABKB 4BWTA 5I6PA 2YXWA 4X4KA 4YSCA 2FQGA 7PAZA 1RZPA 1XB8A 4KO6A 4G70B 3WKPA 3X1GA 2IH9A 2BO0A 4K9JA 3UAAA 2IWEA 1ETJA 3S3CB 4DP1X 1AZRA 1OF0A 3FQYA 2YXVA 1GSKA 1A4CA 3UACA 4HCFA 1N68A 2BZCA 1PLCA 1BXUA 3T6ZA 4Q89A 4HCIA 1PZCA 1GW0A 2XV2A 4A67A 2VSKB 3NJLA 1OCRB 3NP3A 1PAZA 1GR7A 3NJNA 6PCYA 3S3BB 1ZIAA 3QJTB 4HZ1A 4G7QB 1SHWA 3ABMB 4A2GA 3NJGA 4A2EA 3TU6A 2PPAA 4AKOA 3IEAA 3FYIB 1TU2A 3BQVA 2FT7A 3X1BA 3RYMA 1ASQA 3OQRA 1OV8A 2DV6A 2P80D 4E9QA 1CYXA 4CSZA 4DP2X 1ZDSA 3S3DB 2HRHA 2MTAA 1PZBA 1AS7A 3ABLB 1AZCA 4AI7A 2QDVA 2CUAA 2TSAA 3HB3B 2CBPA 1L9RA 3NP4A 5I5IA 4GYBA 1V10A 3NJHA 4E9VA 1MZYA 1PNDA 3T71A 1B3IA 2OJ1A 2XU9A 4TXVB 1I53A 1JXGA 1PLBA 2YAMA 1OCZB 3FPXA 1PF3A 3S8FB 4KNSA 3FSVA 1GY1A 4PCYA 3WI9A 2FQEA 5F7BA 5AKRA 3OM3B 1BQKA 3S8GB 1KDIA 3ZX1A 1PLAA 1AQ8A 3SBRA 1W6WA 2QPEB 2UX7A 3FSZA 4ZK8A 2EILB 4CSPA 2ZXWB 2PP8A 2QT6A 1E67A 2Y1AA 1IBZA 1WA0X 2DWTA 3FT0A 1JOIA 1L9OA 1OOWA 4L0PB 3DTUB 1ZV2A 2UXGA 1XB3A 1L9SA 1NWOA 2PPCA 1JVOA 1WS7A 1GY2A 2JFCA 1EZLA 2OCCB 8PAZA 5I6NA 2XXFA 3NSDA 1QHQA 5B7EA 3FQ1A 3QJUB 5B1KA 1A8ZA 1FFTB 3AG3B 2VM4A 5D4IA 4BXVA 3TA4D 2X87A 5B3SB 1NPJA 4YSDA 1CURA 1ILUA 2WO2B 1JZHA 4YSPA 2YAHA 3QJVB 1KCWA 1AS6A 2GC4C 2BWIA 3OMNB 1PMYA 1L9TA 3H56A 5TK4A 2GI0A 1BQRA 2CALA 1ET8A 2HXAA 2AZUA 4PAZA 4FAAB 2IDSA 2FJSA 3NSFA 1NIAA 1ILSA 5B1JC 4DP8X 3N55A 4YL4A 3EH4B 4BXSV 2BWDA 2UXTA 4KO9A 4FA7B 1GYCA 2H5UA 3AW5A 4A2HA 2BP8B 1M9WA 3KW8A 1IC0A 2BP0B 3T6WA 4KNUA 1XMEB 4F7KA 2GB2A 2HLEB 1SNRA 1KBVA 4YVUA 4ENZA 4F2FA 9PCYA 3ASOB 2IDQA 1SHXA 3DIVA 1JZFA 1DZ0A 2FQDA 2GHZA 1J5CA 2BP8A 1E65A 3QQXA 4YSSA 5PCYA 2BP0A 3GDCA 1KBWA 1OE2A 2UXFA 4A66A 3IN0A 3QJRB 2FTAA 2EINB 1FWXA 3TASA 4E9RA 1BEXA 1DYZA 1GS8A 1SFHA 2YAEA 1T5KA 2Q9OA 1WS8A 5B1JA 2X88A 3CZUB 4AZUA 2MRYA 3UADA 1NWPA 2FT8A 4Q8BA 4F2EA 1L9QA 4A68A 3EH3B 2PCFA 2W8CA 1A4AA 3PLYA 1AACA 2N0MA 4YVNA 3ZIYA 1CYWA 1KDJA 1NINA 1MZZA 1IKOP 3WG7B 2IDFA 1ASOA 2YAFA 4HALA 3CVCA 4KNTA 4P5RA 4RH4A 4YSTA 1CC3A 2AZAA 2HZHA 1ET5A 1OE3A 2GSMB 2HX9A 3GYRA 2YARA 2DWSA 2QDWA 3BVDB 3OMAB 3X1NA 1X9RA 1WA1X 1A3ZA 5B1BB 3UGEA 2J56A 1BXAA 3FSWA 5B1AB 4W1TA 1F56A 3AG1B 6PAZA 1WAEA 5I5JA 5PAZA 1J9TA 1E5ZA 3NSYA 1PCSA 5TK2A 4BWUA 2FT6A 3QJSB 5I6MA 1SFDA 3CVBA 1MG3C 4M3HA 1AIZA 1JERA 2BW5A 2GC7C 1BQ5A 3ABGA 1ID2A 3CVDA 4G71B 2PLTA 2AVFA 3FU8A 1VLXA 3FS9A 1AR1B 2YQBA 3WKQA 1PY0A 4GP5B 1OE1A 3CDZB 3T6XA 2FWLB 1BYPA 4NERA 3FQ2A 5ANHA 4A2FA 4DP9X 2YAQA 2GBAA 5B7MA 4E9SA 1J9QA 3EH5B 1FA4A 2PCYA 2XWZA 2YAOA 4YSRA 3T9WA 2FNWA 1AG0A 3CDZA 4W9ZA 7PCYA 4BDVA 1X9UA 1GS7A 3IBOA 5D4HA 1NIBA 4EF3A 2R7EB 2YAPA 4GXFA 3NSCA 4N8UA 3V9CA 2OV0A 3G5WA 1XB6A 4DP0X 3NJIA 2VW6A 5I6LA 2ZOOA 3PAZA 2AFNA 4P5SA 1OCCB 3NJKA 2XV3A 2WO3B 3OMIB 4DP6X 4DP7X 2R7EA 4AX3A 2HRGA 1J5DA 1J9RA 2XX0A 3FU9A 4E9YA 4E9WA 1A4BA 1JZEA 3U25A 1V54B 4DPBX 2E86A 1ZDQA 2CCWA 2H3XC 3EHBB 2Y69B 4JHUA 3ZDWA 2HX8A 2I7OA 3CG8A 1TKWA 1J9SA 4G72B 5F7AA 3HEIB 4DP4X 3AZUA 3H4HA 3PXLA 3L45A 4KOCA 5I6KA 1HAWA 2XV0A 2B08A 2XYBA 1PNCA 2XLLA 4G7SB 1EHKB 2PP9A 2I7SA 4WKXA 2PP7A 2XXGA 3MX0B 2JKWA 4JKNA 5I6OA 5B7FA 4UF7C 3MBWB 1JVLA 1ZPUA 3C75A 1E30A 2IDUA 1AANA 2IH8A 1KYAA 3NJFA 3IN2A 3D12B 1GS6X 3DKHA 2UX6A 3T6VA 3ERXA 1RKRA 3NJJA 2VN3A 1JXFA 4GY4A 2J5WA 1TEFA 4KOBA 3X1FA 1KV7A 4UAHA 1TEGA 2DYSB 2Q5BA 3UAEA 1SF5A 1PZAA 1NIEA 3QPKA 3PAUA 2EIMB 3WNIA 2HX7A 1QLEB 1NIDA 2CJ3A 2ZWNA 1YLBB 4YSAA 4HCGA 5E9NA 2PPEA 4JHVA 1E5YA 3SBPA 1SDDB 2IWKA 3AY2A 4DP5X 1RCYA 2VM3A 3X2QB 2WSDA 4HHWA 2JXMA 1RZQA 2IAAC 2VSMB 3IE9A 4G7RB 5I5MA 1JXDA 1SDDA 3TBCA 4KO7A 1ET7A 2PPDA 1KCBA 3SBQA 2RACA 4E9XA 1W6LA 2EIJB 2LLNA 3FPYA 2QPDB 3WIAA 1BXVA 1OCOB 5AFAA 3GXUB 1V55B 3FYEB 1MG2C 1ADWA 1NZRA 1WA2X 2PPFA 3FU7B 3H4FA 1AS8A 2DY2A 4YSUA 3WNJA 3SQRA 1NDTA 5IY5B 3JTBA 3FSAA 1NIFA 1M57B 1L9PA 1AAJA 2J57A 2XUWA 2GIMA 3N2JA 4UANA 3AG2B 1W8EA 4BWWA 1AZNA 1HAUA 3FU7A 4MFHA 1HFUA 4BDVB 2I85A
chains in the Genus database with same CATH superfamily
3MLUL 3QHFH 4K23L 4OLZH 4AGNA 5C8JB 2ZCZA 3T2NL 5SX5H 5FUCC 4Z7NE 1T3FA 4U6XB 3V0WH 2C1OA 3P9WB 1SEBB 4N0UB 5CP3H 4AV5A 2VR9A 4Y5VA 3A21A 5EU7C 2Q3ZA 3SJVB 4H8WC 5EO1A 4TPRH 3KPLB 4TTGA 3ATDA 3VXTA 2CAKA 3GF8A 2WUBH 4Q6IA 5ITFB 3OB0K 3CPUA 5CEYA 3C6LB 4FZ8H 4JPVL 2Y6SC 3QUYA 1XF2A 4O9HL 3OVUB 2NY6B 2VUYA 3V0HA 1HI6B 4S10A 5HI5C 5F1KC 1OK8A 3D39D 5E0QA 5FF6A 1IC5L 1IBBA 4MD5A 1YEIL 1QFHA 2XA8H 3CTTA 3MSPA 4GIAA 1GGIH 2G5BB 4JFDE 2AQPA 1RZIB 1NAKL 4RMSA 1JSYA 1C5CH 2FH6A 4QHMA 4KQ3L 3BPNC 2X1QA 6CGTA 4NB7A 2P5WD 1BYOA 1BJ8A 2OQJA 5IESH 3MACH 5KYXB 4OZIB 4MJ6B 5J5EA 3CZNA 1BAWA 3NTCH 1F90L 4WI2A 3MGOA 4E9TA 1EK3A 1XZ0B 3SOBH 3LRHA 1BZQK 2R2HA 4FD0A 3AU1B 3TCLB 4IJTA 3PGCA 4JRYD 2Q3AA 3V4UH 2V3DA 3DRQA 3OMZA 2YPKA 4DAGH 3VFVB 1IUZA 3VCLB 2I9LA 3BAEL 4FFZA 4M5YH 4MB1A 3E6FA 4ZBJA 1UA6L 1SZNA 1U8KA 2NY3B 3BT2L 3UABA 5GJSH 1VENA 4M8UA 5I18H 1UZ8B 2IANB 5EFIB 4E41A 4HPYH 5CLZA 1D6VH 3AM8C 4BWTA 4EXKA 2R0WH 3REVB 2O5XL 1NDGB 3WKPA 4AYFA 2WWKO 2BHYA 5F9AC 4X4XA 1H8LA 3HNSH 5JHMA 5KAQF 4OF3A 5D93B 3ZTNL 2DQUH 2AXFA 1SDAB 2AJZB 1OF0A 5CZVL 1GSKA 2FR4A 4P4RB 2R51A 4HCFA 1RZFL 3TBYA 4IS6B 5CBEA 1EHNA 4AC4A 3EOTL 3O2WH 3IMWA 4ODXA 4L1SA 5LVEA 4HW6A 3NN8A 3UBXG 3V6OC 4NO3A 5AZEH 1RLBA 4A67A 3CFKB 2CLZB 1BFOB 4C4KO 1BWMA 1KCRH 3AM8A 5CKGA 3NZHH 3V4PL 3KJ4B 1WAAF 1AGEB 2JF1A 3QQ4A 5EU6B 5T1MA 2HB0A 4JFFE 4TQIA 4A2EA 5IIEA 3LKQB 3L3IB 4TRPL 1FE8L 4W9FC 3V9FA 5IFAH 1ZS2A 4PLJD 4GMSH 4XCEA 4DUXA 5DF0A 4E42B 2C9VA 1REIA 5EZJA 2NSQA 4GMTH 3VFTA 1DP0A 4LVNC 2B7DT 5BW7A 2OXGB 2G2RB 3BJLA 4FHJA 4WEBL 2EDOA 4Y2NA 5DD0H 3K8LA 3DPDA 3S35L 1HL9A 4G43A 2OMUA 4XE5B 1CK0H 1DVFC 3BUDA 3ABLB 3V6OA 5HI5D 1IC7H 5BS0A 1FP5A 1SY6H 4NRYB 3VNZA 3HBPA 4GYBA 2E8YA 4RFNB 3BVXA 4C47A 4UZUA 4XO5A 2GY7B 4U0RC 3SDYH 5HHNA 5LQBL 3T6QC 3QJHB 3P4OB 4JREC 4HF5L 3Q48A 1KJ2L 1FN4A 2OL3L 4E41D 3FSVA 3IDXH 4L8SC 2X9WA 2CO2A 1GY1A 2IOOA 2LU7A 2YPLE 4NWUH 4PS7A 4POUB 1EGJH 4UNVA 2SEBB 5E4EC 3S4SB 1BBDH 1QLEH 2V7NA 2LU3A 3MRHA 1UWXK 2W81C 1DVFA 2CNZA 2CIIA 1P5UC 1W6WA 4MNGA 4GAGH 3MJGX 5DZJA 1FFOA 3ES6B 3QDMA 1E67A 1RUMH 1IFHH 2AVGA 3PHOA 4PJXE 5FX3A 4P3CH 5EZOL 4X4ZA 1KB3A 4DO6A 4FULA 3FB6A 3VDCA 3VU2A 2VUKA 1ADQH 4GLRI 1ZV2A 1XF3A 4CBPA 3GSUA 3FH8A 2PPCA 4L8SA 4J8RA 4JUTA 5C7XH 4Y7OC 2C9RA 4GRWH 3GJFB 1MQKL 1DVTA 2CO7A 3DSNB 5JW3L 1MCHA 5FGCB 2AABL 4ZSOE 2DTML 1T03L 4MJ5A 1YNKL 3MJ9L 4HQQH 1P5UA 5T5FA 2X4RB 3GM8A 3T3PF 2Z9TA 2AEIT 5J11C 4M7KH 4LAQH 4MBRA 3CCHA 2D7PA 1ET8A 3D5OF 2DMGA 4M61A 4K7PH 1E8XA 3ZLQC 5E51A 3NBNA 4PAZA 4BRJA 4PI2A 3K6SA 2WZPD 4G9FE 5I0XA 4BA8A 2HMIC 1BJ1H 1I8KA 2J6EH 4L3CA 4PJ6A 5D7SL 2G3NA 3BKYH 2QKIC 1M9WA 3ELAT 3KW8A 2APTA 1KZYA 1WK0A 1NMAH 5FYKE 2DLHA 4QXGH 4XBGB 5GSVB 5JPMB 5AL8A 1FNGB 3EOBB 3TZVC 5TPWL 3LKOA 1XBRA 1FYTB 2NPLX 1NBQA 2DWEB 4HBCH 2FQDA 4RWHA 1WITA 3HMXH 2JJVA 2XDHA 1U93B 2WANA 5F44A 1KIUB 2BINA 1KGWA 3HAEA 3BAYA 3SD2A 5JOEA 2B2XH 5DFTA 4LE8A 1UB6A 5GRJL 3ETBJ 4AUJA 4ZMZA 1DVFD 3NZSA 1ZA3A 3GBLA 1BF2A 4WKZB 2PW1B 2L7JA 3FRPB 35C8L 3QDGA 3QARA 3QIBC 4K2UL 4PRDB 5CIPH 4A1RA 3U7WH 5I16A 3QDMD 2XKNA 2VDQB 3EO9H 1L9QA 2QKIA 3BUQA 3QIWD 4MWFB 4HKJB 4KHTL 3O41A 3EGDA 5C09D 2UV3A 2Z4TA 2IFFH 1YVLA 2B16A 3IJYB 2IQ9L 4NO5B 4YNYA 4YVNA 4Z7QE 1KDJA 3TZVA 1CI5A 3K6OA 3V10A 3T4AB 3PNRB 4P5RA 4GAYA 4RH4A 5LBSH 3CIAA 4L37B 5T1LA 4F8NA 4GKLA 4XCNB 4RAHA 4GINA 5BV7L 5HD8C 1A6TA 3ZT5A 2Y7LA 5KSAC 1BVKB 5EO0B 2X10A 2ZUQC 4G80B 5AW3B 2JKNA 3P3TA 4UINL 1Z9SA 3BFWA 1I8MB 4GT0A 4IDLA 1G6RB 3QIBA 4HEME 4P23C 4DGIH 1QD0A 2EYTA 3FL7A 4YC2B 3T2QA 4ZNEE 3ZYOA 2XPGA 3GRBA 3MMEA 5MHSE 5ISZA 2PXYB 4PG9A 5GGQL 1RHHA 3OGOE 3G08B 1MI5B 4R7XA 3V6BR 4PR5B 4DERA 5JHBA 1WAAA 2QHRH 1OW0C 4YAQA 1D2OA 4X99B 4JB9L 1E4WH 1VLXA 3F5WB 1Q94B 2IBZY 5FUOL 5IG7B 5K39B 4D9LH 1NMBL 5KSAA 1WTLA 2C4FU 4B9FA 4NFDA 4F58H 5AYUL 4DP9X 1F6LL 1OF2A 3MCYA 4Y88A 5I8EA 4KDTC 4PY7B 2A5UA 4LKXA 1MVUA 1MF2H 1JGEB 1FA4A 1LDPL 4HWBH 1WDAA 2F1AA 3BWAB 1S78C 4MXQD 1FSKC 1JYVA 3CIQA 4CNIA 4KH2A 1CS6A 3UYOD 2P7TB 2HMID 1KFAH 3NSXA 4HMDA 3BP4A 2ORBH 3QQ3A 4PJIB 3FTGA 2JIXB 1L7IH 1OW0A 1ANUA 2WWMC 5AWNH 3MRMA 5DFAA 1BLNA 4PJEB 3QQDA 3KYOB 3W0WB 3W9DA 4UQ3B 5FB8B 4LPYA 4YLCA 2ROYA 1DFBL 2EDKA 3TZVD 1TQTA 5EC1B 1RZ8A 3FHAA 2ZF9A 4OZHE 4MQ7B 4YGVA 2B3RA 4KDTA 4RVBA 2P42B 1M53A 4AIEA 1LO4H 1UD6A 4APXB 3PNWA 4GXVL 3VGEA 4PJFE 1JWUA 1WPCA 4PREA 1JI1A 1B4RA 4ELME 1J9SA 3QWOA 4G72B 3F7RA 1YA5A 2BVOB 2WD0A 3QIBD 3TA3D 3L4UA 3V2AR 4KMTL 3K8MA 5HBBA 2NNCA 2WQXA 4G7SB 2I7SA 3CVIH 2PP7A 2AEWA 5DZPA 4KKLC 4LIQE 4P2OC 1E30A 3OXRA 5B3NA 3P3SA 1DANU 1P2CB 1PPIA 4NQVB 5MERB 4A6YL 5T3ZL 4JM0A 4QRBA 3DKHA 1BFTA 4HG4K 5C0JA 3NJJA 4JDEB 3MX0A 1FZOB 5F3FA 2OMBA 2F19H 2WZ0A 3T0VA 1TYRA 3IB4A 4FKEA 4RMUA 3U4AA 5IJBC 5ERWA 4MYWB 3KYMB 5DJZA 2LLGA 1J8HA 2DYPB 1VFAA 2XCMC 3CH1A 3FH7A 3GMNB 3KPRB 3G9AB 2CJ3A 3PUUA 5AUMA 4LLDA 5F96H 2ARJQ 2QQKH 1G7PB 4OBSA 1JI2A 3GHBH 4BYHA 4Z8FH 1KTDA 4BZ2L 3MJ7B 4P2OA 3MHZA 2WSDA 1J48A 1OGTB 4OAWA 4OLXH 4U7KA 1RZQA 2ARJA 5DHDA 1O9WA 3TBWB 3D87B 4DQOH 4OY9A 4U1JA 1X7QA 1OSZB 3P02A 3TBCA 2F58L 1KCBA 3U9WA 1F41A 2QFRA 4ZXBC 3SY6A 4PG2C 4M1GH 5FYLL 2EIJB 4IGBC 5DD6A 1Z9LA 1ND0B 3QEHA 1SOSA 2XIDA 3PIQB 3WIAA 1LEGA 4FFZH 2C9PA 4YHNB 2YMXL 4BKSC 2N59A 1SMOA 3UH8A 2ZAIA 3B9VA 1S78D 3KL5A 3R18A 4KK9C 4X5PA 2I60L 4AGOA 3Q1SL 2IV8A 2CGRL 5AVWB 3QO0B 3W11C 5IB2A 1J10A 1YO4A 1ZS8B 2CHNA 3D2UB 3GSNA 3H9YA 4MA3A 1NIFA 3RGVC 4OZFB 4NKMA 4UTBL 1NAMA 1NKGA 2APFA 2WWMD 2EECA 4HK0A 4D2NA 1CE6B 4CJ1A 1PEZA 1EEZA 3AREC 4LHUA 4IIQB 1DZBA 1QFPA 1U8LB 2VR3A 4ZXBA 4PG2A 5EOQL 3ZL4H 4IGBA 4N8VB 4RMQA 4A6YB 1ID5I 2W9DH 3CN3A 1B2YA 1LILA 2ZCKL 2DQFA 1UXSA 3VFGL 5B8CC 1F3DH 3IK2A 4PJAE 5JHDA 1UA3A 2OXHA 1IGMH 1JIBA 3MRJB 4FG4A 4JFHD 4OGYL 1S5IH 3QUXC 5JYLA 1E27A 2WW8A 2FWOB 4OQTL 2XX1A 4GSQA 3VVWA 1B9ZA 3RGVA 4M00A 3UOAB 4NQXB 3X1EA 3ROLA 5F21B 4WTQA 2XWTA 1F3JA 4MJIE 4WFGD 1OTUC 4UILH 3OKLB 3AREA 2P49B 5IJCC 4EN2A 4ZFOL 3QFJA 3QEGH 3QUMA 4GUPA 4P2OD 4F7PA 1A66A 5DI8A 3TO2A 3VVVA 1A9BA 4F5CA 4BKLB 5E2TH 1IAKB 4RFEB 4ANXA 2DM7A 5GRZA 3VD5A 2WZ6A 3PP3K 5B8CA 4QRAA 4KTDL 5EOTB 2E76C 5LGHH 2BVTA 4S1QL 1O5PA 2C4FT 3MV9B 2BSCA 2BVPA 3OC5A 3QUXA 5CGBA 4JJ5A 4LNRB 5I1GH 3NCYS 2HFTA 2VZ1A 5EU6E 4J3UA 4MA1C 4F7MA 2AQNA 2V9QA 4ENEC 2W65B 3OB8A 3QGVA 5AW6B 1A02N 1G6VK 1VACB 3VXSE 3O3AA 3OPZL 1MLBB 1U41A 2FO8A 4YQXL 1T4KB 3KXFB 1YEJH 4N90E 1S5HB 3OD3A 5IGXH 4N2KA 3MN8A 5DZNA 5F1SA 1HKLH 1NFDF 3PHQA 2BLFA 1AHMA 3SKJH 5EHFA 5D4JA 1KACB 2ZYHA 1ZHNA 3EJPA 3CXFA 1CFQB 4Y4HD 2P8PA 5BQ7A 4ZXBD 4FLHA 1LGVA 1KYDA 2AQQA 2VMJA 2ZWLT 4IGBD 4QGTA 2Q2LA 3APMA 4P57B 3PGDB 1OSPL 1MW3A 4ICXA 1E7VA 5I5RA 4M48L 1NUDA 1E6OL 3SPHA 2IPKB 4Z0BH 4KK9D 1PKQE 5ICZB 3GTVA 4NHUA 4XPGL 3GJFK 2Y22A 3ME0A 4UZGA 4P07A 5KW9L 3PY9A 4PTTB 4CN6A 1BM3L 3DXAA 3EYFA 3VGHA 1UZGA 3FB5B 3KCPA 2GVYA 4FNQA 1N68A 3ARED 1FHGA 2D3JA 3EYVA 3HNTH 3NSJA 3QFJD 3TYFA 1R3LA 3U4BH 1RZKC 1Y1UA 2CRZA 5T5FH 3VYPA 2XA3A 5CZXD 1F0LA 3E3QC 4NDMA 4LNVA 3OKEA 1CMOA 3L2MA 2A9NL 2AEQH 3UBXI 4IHOA 5EBMA 1KXTA 4GQQA 3PDOB 1FVEB 1QACA 3K5RA 3QULA 5E8OA 3A6OA 4QR7A 4JFOB 1OTSD 2FWSA 3JYCA 3QUXD 3ARXA 4LARH 4LPWA 4XVUC 1EXHA 1TJMA 4CVZB 4L4TA 1IMHC 2P52A 2ESVA 5IW1A 4J27A 5FGCE 4Q97A 5LWYL 3EFOA 5IWLC 3OQRA 4ZI8A 2B39A 1OTUD 3HPLB 4DP2X 1LYQA 1MCFA 2OTUB 3BGAA 4KMLB 1S6NA 3ZKMC 4F7TB 4NP9A 4DUWA 2WLNA 1A1MB 5I8KL 5CN1A 5HGAB 2RIKA 4NBZB 4BFJA 4TQEL 4Q2ZA 5JIPA 4PLOB 4LAJH 3LKRB 1Y0LB 2LE9A 3HAEH 3L4CA 3E0GA 1EDYA 3PV7A 3I74A 3RY6C 4ZFZB 4KK5C 1HH6A 4NQDA 4E5XA 2IMMA 1W91A 3ARRA 1IGFL 3C08H 2O6FA 5CLXA 2MOVA 4H7VA 1QSZA 1VIWA 3WNLA 3EW3B 4GQ9H 3E6HA 1JXGA 1XSKA 4AYDC 5C0DA 3MNMA 4KZ0A 3W56A 3KJ6H 4KNSA 2H0JA 3DV6B 43CAA 5FA4A 5MP6H 5GQBA 1C7SA 1XR9B 4LLAA 2HKAA 3EDFA 1TCMA 2L7QA 4XCFL 4NOFA 1FYTE 4PD4K 3GEFA 3O2DA 3L4VA 2N56A 3DIFA 3Q44A 4GG8A 1TSRA 1MIML 2HRPL 2JJSA 1K9TA 3TT3H 1RVFL 3S5ZA 4R26L 4YBHA 2YD1A 3DXAD 3RY6A 2FZ3A 5TDNB 4X7EC 4NNXA 4PRPA 3ZDXB 4YXKH 3VDBA 5FHAH 4BFKA 3DX3A 1A3LH 2YJLA 1E28A 4JFED 3NVQA 2X4OA 5GS1C 5KSBB 1YEFH 1NKRA 5EBLB 3V7MA 1S3KH 3C8KA 2C3WA 3U48A 2OCCB 3L4XA 3UBGA 3I84A 4O58L 1WLHA 4I48B 2G9HA 2JJTC 3EOAA 2X87A 3IFOA 1IX2A 4P5MB 1FIGH 4NP4L 4L4TD 4XCCL 2NW3A 3G3LA 3I6GA 3L1OH 1AS6A 4FYQA 4OJFL 3OMNB 3EGSA 1IGYB 2X4SB 1ULVA 5TK4A 5IB3B 4R2GC 4Q4EA 3BKJL 2GI0A 1BQRA 1GTFA 4XTRC 2O5ZL 2AK4A 3MRQB 2EDNA 2L7UA 5EEWA 2RQ8A 2V37A 5GS1A 4P3DA 3U1PA 3VGFA 4YL4A 2EE6A 3VFOB 3H9SD 2EVGA 3A6CH 2ZYIA 1L0XA 4NQDD 4PJ8B 2X4QA 4LFHD 1XGYL 1NCHA 3AROA 2XZQH 5CEXA 5L4MA 3T6WA 4LESA 5JMRA 2VKXA 3B9EA 2JJTA 3OR7A 1S7VB 4K4KA 4AGMA 2EDQA 1QRNB 2GFBB 1O6SA 4YVUA 1EMTL 4ENZA 5B4MC 2ZWKA 2ZWSA 3TWCH 3LEVH 3Q13A 4UUJB 5CBAB 1X5YA 2BH0A 2HTKC 1N10A 1EAOA 1OE2A 1PSKL 3ZKMD 2G60H 1ZGLA 1E4XI 3VQ1C 1YDPB 2E9JA 2XQYA 2Z92B 5J1AA 1OOAA 4FLOA 5HYQB 1A3RL 1RV6X 2YC1A 4WFEE 3ZT6A 2KPNA 1DYZA 3B9KC 3F6LA 3T2OA 1NFDA 4O2CA 2IAMB 3BSGA 1B4JL 4KK5D 1B0RB 2HVJB 4PRPD 2ODIA 3ZE2E 4I5BA 4KZEH 2XTJE 4JKMA 4HJ0C 3D0LB 4E0RB 1INDH 1D5BB 2JTYA 3AWGA 1OAQH 1QUNA 1W72L 1UZ6F 3QXAA 3WDHA 3FCSA 4PJIE 3LNIA 1BQHA 3P9MA 1JRHH 4PJEE 5HGHA 3O3EB 5HYJD 4N2LA 1D5ZA 2IPUK 2Q2EB 3FXIC 1M71B 4OM0L 3BVWA 5B38A 2HZHA 5CCKH 3L5WB 2FATH 1KXHA 1E4XL 4UBDD 1AO7B 3FZUC 4RDQF 3HE6C 1A3ZA 1W16A 4UYPA 4HIXH 3NCEB 3LS4L 1A7QH 3K2MC 5FYJH 1TIUA 3FSWA 2HJKB 3BWZA 5B1AB 1KPRA 1BVOA 2FLMA 4Y9FA 2AK4D 1VFUA 3QWNA 4ALAC 1SLWA 2Z8RA 4TQHA 3KBHE 3NIGE 4ZW3A 1MG3C 1CIDA 1I1RA 2B8OT 2GQHA 3FH5A 3GSWB 3OAYH 4W6WB 3ESVF 3SKNA 4BUHA 5I71B 5T3XH 4YHML 1DDHA 2E7CA 4HT1H 4KX7A 4XMKL 4FCAA 5CLTA 4PJBF 5IVXB 3B2DC 1CGSH 2PLTA 1U8OA 2W94A 4JRXB 4RQQA 4FQ2L 5LDSA 1A6UH 2F8XC 1FNEB 1CFTA 4GP5B 2NUTA 2VLKB 2C1PB 1BYPA 3HJEA 3HE6A 3SEPA 4OLWL 4PJ5A 2L3BA 4QRUB 1BF5A 5LNGA 3STZA 4UWQB 4N87A 4NENB 4G9DB 4UTCA 4H0GA 3HR5A 2PNDA 4KXDA 2AQ2A 1U92B 4YSRA 2VDKL 3F7QA 3HUJF 3HFML 1SBBA 4LEXL 2APSA 4ES9A 4L4VD 5CN3A 1GS7A 1NIBA 2DQHH 3ZE0F 2EYRA 1FNLA 5I76A 1MLCB 4BK8A 1RIUH 1KMGA 3O3DB 3VRJA 2NW2A 2HLFC 1JD9A 4JFPB 3GSNH 5CAYB 1KPUA 3S4SG 5I30L 2CJUH 4NBYB 2KL6A 4ZMPA 5L2KB 2EIDA 1NAMH 3MBEB 3MCG1 4ABUA 4F7CA 5B4MD 4LP5A 1ICTA 3KPSB 1U8PA 2XJKA 3PWPE 2VDOH 4L3AA 5CGYC 4BUQA 2HTKD 4YO0B 5ENWA 2ZSVA 1GZHC 4MX7B 4TNGA 1FZMA 3C8HA 3HS8A 3GSOB 2BHZA 4TVPL 1EEYB 3H42H 4GRMB 2VN7A 1U8CB 2A74C 3B9KD 3UJTH 1DE4A 1S8DA 3D85B 2BDNL 3AZUA 3MO1A 4EDWL 5KBPA 3SPVB 4V2CB 1U36A 1CGTA 1E4KC 2CKBB 2XYBA 4HJ0D 4OGXH 1DVXA 3U9PL 4HC1H 2FSDA 2VH5L 3HCVB 4PGEA 2DM4A 3MBWB 2AV1A 3ZQWA 1ZPUA 2V5MA 4H0HB 3TFKD 1AD0B 1XF4B 3STBA 4JGUA 5GGVH 4Y2OA 3O4LB 3VQ2C 1WWWX 3IM1A 3DECA 3QUMH 1GZHA 3ERXA 2CJTA 2F74B 3LRSB 1CTNA 1GJUA 2DQJH 4MD0A 3DX7A 4HXBH 4M6OL 3FZUD 3LPFA 2FX8L 1JNNH 2A74A 1FVCB 3AQDA 3TBSB 2BCMA 3NCWA 4A7SA 3HE6D 4A2MA 4PJ5D 5MENA 3RJDA 1YMME 4L9LC 3HJ0A 2A73B 5EN2A 4I1RA 4Q9QH 1E4KA 1TVBA 4JHAL 1BGXL 1PY4A 2XIBA 3B3IB 3FQRB 3T0EB 4NQEB 3ZKXB 5E5RB 4DP5X 1Q9OB 3SPCA 4WUUD 5J7CC 1U9KA 4KK6D 2ERJC 3ZDYE 2CLRA 4AW7A 3HHRB 3AMLA 4YXHL 3QIUC 5I5MA 1MFDL 3ZTEA 4CC4C 1M3IA 1YYLH 5KN5A 1AI1L 2MWCA 5GGRA 2P3YA 1X4YA 3A67H 3O4OC 2XZAH 1MHHB 3RI5F 5D6DC 4GG6B 4AJVA 4L9LA 3QNZB 3MV9E 4CRPA 4CA4A 2DJMA 2DMCA 1ES0A 1KB5L 2ATKA 1MY7A 4NAMA 1HIMH 2DQEL 15C8L 1URZA 4NJ9H 4R7DA 1CJYA 5E6IC 2DDQL 4JLRB 2P5EA 2XPYA 3QRGL 4NC1E 4YX2H 4XN2A 1EO5A 3TV8A 1QTSA 4NRZB 2A4ZA 2QVIA 1Q0XH 4WAFA 5KANG 4LCYB 1L9PA 2HLFD 4B5ZA 3KPPB 3MRNA 3QDJA 3QIUA 5E9DB 5L8JB 4CC4A 3U2SA 3ZO9A 5HHXH 2Z93A 2VERA 4LL4A 2YBRB 3IRCA 4YUEL 1QFUH 3ECBB 4FQXD 3LKNB 5ID0A 2DPKA 2X1PA 4YFDB 3U4EB 2H32A 3VXMA 4BV1A 1YNTB 4OKVA 5CGYD 5D6DA 3SCMD 2AJVL 3ZVVA 5IMKB 4QRTB 1CO1A 1MWAL 4FLQA 2EYSA 4YFLF 3VXUD 3I3DA 1CLYH 5DD3H 3RWGB 1O0VA 3P0GB 5JZ7C 5E6IA 1FCGA 5EZLB 2E46A 3P1VA 3Q6FA 3E8UH 4EMZA 5J13C 1H3XA 4P0DA 3G5YA 3MTRA 3R06B 2ICEB 4WWKB 5BJTA 4LHQB 4DZBB 5FM5M 2C9UA 4UV4H 2AI0H 3OXSA 1UJTA 4DZ8A 2JWYA 3JYBA 4KGJA 4MJ2A 2RAMA 1DHKA 1TENA 4NUMA 1UT2A 1R3KA 4PJBA 1RIHL 4ETQA 1TJHL 3IMVA 3NFSH 4IRZL 1RZKH 2GT9B 4P5KB 5DJCB 4Q9RL 1SXAA 5DT1L 2GJ6B 5GS0L 4YL9A 4GP4B 4UOQA 1X3DA 2WOBA 1NCDH 3BGFC 3DURB 4X6EB 1GCYA 4LSVL 1AFVH 3QEQB 1LMKA 2XY2A 2FAUA 4YSOA 1MCPH 4OVUA 3AAZA 1M1XA 5F0LB 4YE0A 1KB5B 5F3BB 5JHAA 4RNRA 3BSZA 1ASPA 3UPRA 1OO2A 2FX9H 1TZOA 3HUJA 3QJFA 3K0WA 1T20A 5CLYA 3KS0J 4V1DD 2IH3A 5EUKB 1WZKA 2IWFA 2P5ED 5C6TL 3DX6A 2VWEE 4PYHA 5C0FA 1OGPA 4HHGA 3QXTA 3SGEH 1ZRUA 4BFNA 2E59A 3O2DH 5JIQA 2VSCA 3BKCL 3QDAA 4DT2A 5BRZB 2FX7H 2N7SA 1RFDH 1ZEAH 3EDKA 4TVUA 5DJAA 5JQHC 4FL4C 4YHOL 5I1IL 4MHHI 4CSTA 3EO0B 3JWDC 4ANKA 2TRHA 5IROD 1IEAA 1QAWA 5IT2L 3GMPA 2FEEI 3BZFB 1J5OH 2AJ3B 5I6PA 1XB8A 3A22A 3ASWA 2F7RA 3I6KB 3O3BA 1MCSA 4WW2F 2RCSL 4YIQB 2ZG1A 3VRIB 3F83A 3UZVB 4CU8A 4KQ0A 2IPUG 1MQ8A 3F7VB 4K9JA 4CJ0A 3GBDA 5JUEH 2FNBA 4EDXA 5LXGH 1U0QA 4EKJA 3QCUL 1Q38A 2KHAA 1JGUL 2NQ3A 1SJEA 3MRIB 1BXUA 2XN1A 4YDIL 1OPGH 4Q89A 4XPHH 3C5XA 1PD6A 2ADJA 4JO3L 1KLGB 2ZXCA 3VO0A 5IJVA 2YWZA 4PV8B 3KPNB 3MA9L 4S1SL 5F6HI 4R97C 3GSRA 3HNVH 2FEEL 1SXCA 3VI4E 1PL3A 1ZIAA 3UMTA 1SHWA 3ABMB 4ORGA 2J4WL 4OSUH 3TU6A 3RL1A 1A14L 1KJVA 3GRWL 2PTTA 3HS0C 1TU2A 2JJUA 5EO9A 5E2VH 2BNUA 5G4MA 3S36H 1K72A 5E70A 3BDBA 3RJQB 2HN7B 1OLLA 1F6AB 2X89A 3G5ZA 1MRCL 4F57H 5I73C 1CQYA 3L6FA 3WTWA 2BY3A 5C0NC 2BRRH 1A9EB 2NXZC 3P77B 5ECJE 2YLKA 1I7ZB 5DR5H 3TC9A 3W9EB 4R90H 3EYUL 3HB3B 2Z4QA 4LZKA 4MCMA 4IRSC 4E9VA 3O6MH 4O2EB 4B9GA 3T3MB 4HIEB 2BSED 3I50L 4WZ9A 3HS0A 4IMKC 4XO4A 3VFRA 1J1XH 2AQ1A 4ZPVA 1T1YA 1QRNE 4LRNH 4UIMA 2Y0SA 1J1OH 2GAZB 3WXVL 1NCBL 4Z3GA 1PLAA 2FE0A 4N8VG 4JKWA 4L1BA 3OX8B 5LAXB 2QPEB 3MV7A 2MEJB 2OMXA 3KH3A 2WBJC 2OK0L 5ALBH 4FABH 2P44B 2QT6A 4GW5B 4UB0L 2YQ2A 1RU9H 4IRSA 1IGIL 3UYPA 1KGXA 3BD3A 5HDWA 4WK4B 4PGZA 5IFJB 3UBHA 2J5LB 4AOFA 1OCWH 4AQOA 1NCUA 1R3IL 2B1AL 4TUUA 4WU5B 1YAZA 4IMKA 5F70A 4G82A 2EVHA 4FFYH 1Q9LB 3DUUA 1O7SA 3O45A 5IM7A 4GBXB 1L9SA 1G7HB 2R69A 1WT5C 1WS7A 4EVNA 3T0BA 1JPFB 5HJGA 4C58B 4AMKH 3IETA 1WHPA 1FFTB 1CXKA 2EH8H 2VM4A 3MV01 4OV5A 4LEEA 4CSSA 1OARH 3BAXA 25C8L 1N4XL 1UXWA 2EJ1A 3KHQA 1A6ZA 2WBJA 3WUWA 1IBDA 5C6WH 2L0DA 1FJ1B 1TYJA 3M07A 1KNOB 2X89D 1L6PA 2YEQA 4RISL 1JWMB 2J12B 4QCIB 2OKMA 4JGJA 4PLNC 5C97A 1WO2A 2COVD 3RIAK 4NIYE 3MRRB 2LHAA 4HFWA 1QG3A 2WMPA 1V3LA 4EN3D 1T21A 4M43L 4ALAH 1WT5A 3VSUA 5IEHA 1KIRA 3C5SB 2HFEB 3N3EA 3LDBC 4HS8H 4D0DA 4B95C 1HEHC 3N44B 4JPWH 4TLTA 3X11B 4K71C 1E43A 4AH2B 1BA9A 4GKSA 3TH4T 1ZXKA 3EJCA 3ULUE 5DGRA 5GRUH 1TJIH 4U1NB 3E38A 1T80A 4WW2C 4XC1L 4LLUA 1PX4A 3QPXH 4MDJA 3RWIA 3KPOA 1ZT7A 3IN0A 5D7LB 4LVOB 2QQLH 4EZLA 1A21A 5C0ND 1HDMA 3VG0H 5HVHC 2YXMA 5DUML 2Q9OA 2DQTL 1RK7A 1M7DA 1BJ1J 2ADGB 2EDTA 2YGOA 4F8LA 3HZKA 5J4MA 3BP6A 5E2WL 2KDGA 4IRSD 1J18A 1D6EA 4TN9A 3EH3B 3IFNH 2YUXA 4OZ4A 2BVQA 4MB5A 5FK9A 3QG7L 4U1LB 3QNXA 4R4FH 1NINA 1ZV9A 2VLJA 4YHZL 1IC4H 4HALA 4MASA 2F5AL 4B9CA 3NH7H 1DUZB 3H53A 3M46A 3VM5A 3GZOA 1R17A 5L2KE 5F89A 3O6LH 4WW2A 3DOSA 4AYMC 3FQNA 3KPSE 4G6JL 1ONQB 3EJQA 4O5LL 3VX1A 4JFTA 4G7VH 1IEBB 4GRWB 1EO8H 3RRQA 4PRIA 5H37G 4ZUTB 1BXAA 2B4CC 4U4BA 5KJ7E 4G6FB 1F4WL 1Q0EA 3F6JA 4XMPL 2WVTA 5EEUA 4UM8B 2OMWA 3BSHA 1AIZA 1B0IA 1OANA 3WS6C 5EIIA 2X9XA 2R0ZH 3D8MA 4JZJC 1ZLVK 5IREA 3ZGIA 1DQQA 1HCVA 2VISA 3B5HA 2C8NA 3BQUB 3X3FH 5JOFA 3H0TA 2DN7A 3WFZA 4ESKA 3U79A 1PY0A 3WE6B 4KFZC 3O4LE 1DSYA 1HL5A 5A3IC 2FWLB 3HA0A 3PQYA 2VZUA 1U8HB 2I9TA 2JK5B 1CTMA 1TTBA 2OJZL 3ZTJH 2EUVA 4APQB 4TUOB 2Z6FA 3MREA 2AJUH 3LPPA 5DMJB 3S3JA 2LGNA 3FQUA 2VR5A 1M05B 3EJTA 3PWVA 1R3JA 4KRNA 1FL5B 3OF6A 2VXQL 1N59A 2R7EB 2E9WA 3T0EE 3WS6A 1WFOA 2D8KA 5J57B 4MAYD 3LIZL 3LTVA 4GT7A 1AVAA 2R56H 3VXQB 4DP0X 1ZMYA 3FU3A 3L3JB 3QC5X 4O02L 5C0AA 3ULVL 3ABZA 4G6KL 5I6LA 1A0QL 5GZNC 1SUHA 3MXWL 1QRKA 2XV3A 3CSYA 1AIFA 4U1GB 5CIPB 5FGRA 1NC2B 4DW2L 3BKMH 2PYEA 1YY9C 3LN4B 3BMVA 2A38A 4JANB 1L7TH 2AXJA 4XZUB 4ZNCD 1J1PH 2WINB 3SDDB 5C08D 2CLVA 1XDTT 4TL5A 1KCVL 5D8JH 4Y5XC 4E9WA 3LNEA 5KYUA 2CXKA 1V54B 2BSTB 5I8OL 1PGRB 3ARGB 3NPSB 2H32H 4GG6E 1G5GA 3COOA 5DS1A 3ZDWA 5EOCJ 4EBQL 2P9RA 4OBRA 3CFBB 1G9NC 3GUFA 1TETL 4JN2B 4HVBA 1RK1A 3F58L 2Y5TA 1XGZA 5DJ0A 3ULAB 1QVOA 3QYCA 4U6YA 2XLLA 3WKMH 5JPNC 1JBJA 5GZNA 3RX8A 2EO7A 1YY8A 2R4SL 2XXGA 2OTPA 4R7NA 3T8MA 3ISYA 1YEEL 4QHKI 4DGVH 5E56A 1JVLA 3HZ3A 4QT5B 2FL5A 2ZUSA 3C75A 1N5AA 2W91A 3NCJL 1VFOA 1E9PA 1AANA 3KEDA 4BFIA 2HWZH 4M62H 4A7GF 3IN2A 2VKWA 1PVHA 4Y5XA 4QHNB 4AZ8B 3RL2A 2MTPA 3GI9L 1N67A 3MRBB 3TYGH 1NDMA 3PQYD 2X6BA 3C6SB 2PO6C 4UAHA 5LO7A 5DJDA 1LMIA 5AD0B 3NACH 3WNIA 2OW6A 3RNKA 5F1IB 1MCRA 1IIIA 4OGAC 2CDFA 5JPNA 4X4YB 4O2FA 1LLAA 3GSVB 3DI3B 3ET9F 4JHVA 1YCSA 3CBRA 5GRWA 3K72B 5I24A 1KEGH 2G3XA 1FL3B 1U91A 5FKAB 2BY0A 2OP4H 2FIKB 1F11A 3OKMB 4NC2B 2A9MH 1F58H 4O02B 5C0AD 3MOBL 1RIVH 5EPMB 2YK1L 4AT6A 1HXYA 1A7NL 5D70H 4OV6F 1LP9B 4ACPA 4Z78A 1MCWW 5A3ID 3P69A 2PYED 3QUZB 2XFGB 2GJJA 5L0QC 1VFBB 1RP8A 3RU8L 1EJFA 2NR6C 3RKPA 1KY7A 3RURA 3CBKB 2H3KA 4HLZH 3SQOH 4XPAL 2TRYA 2G75A 4LO9A 3U36A 2XN9B 5I1CH 5TE4L 1AGDA 4KI5E 3GC3A 1N18A 1N9PA 4M5TA 5T1JA 2RTTA 1Q90A 1YEKH 2DY2A 2EO1A 2OBGA 3GLAA 5CP7A 3S37X 4X5XB 4QXTA 3JTBA 1AC0A 3QI9B 4NCC2 2V7HB 1MKFA 5CINH 2M83A 3OHXC 2K1MA 3D25A 5GZND 5SX5K 3TH3T 5KANI 5DC4B 5E23A 1T3FB 5E2UH 2X1OA 2C1OB 1TDQA 5E8DL 4KU1A 1L0PA 3HZMA 4P5TB 5AG9A 2BNQD 3MCKA 3FUDA 2I85A 4Y5VB 1BF8A 3I6LE 2DJ4A 2B14A 4JY4A 5DQDL 3VXTB 4DGYH 3FJTA 2XQ0A 5MI0C 1I1AD 3JWDH 3RAJH 4TMPA 1SXBA 2E7LC 3QUYB 3BRDA 3FTWA 3NDYE 2NNAA 3P0VH 4L3FA 2W9EL 4XO8A 4NIKB 2A83B 3QE5A 5E1QA 4L23A 3OHXA 5A6LA 4OIBA 1FNHA 1UJ3C 3LHAA 1NC4D 3P2DA 3IVKB 1W80A 3V9EA 2XG4A 1OWRM 1XCWA 1W8NA 4MQTB 3J2PA 1J8RA 4MA8L 2JKLA 4N0CD 4QRQA 2NRDA 1QBML 1JWSA 2LABA 4O51A 4QHMB 4D0CA 4EZJA 4P4KB 2WQRA 2OQJB 5GS2H 3CZKA 3MJ8A 1F4HA 5HHMD 4FQLH 1IBGL 4A04A 3GBEA 1MY5A 2CIKA 3CFEA 4OM1H 3ESPA 5J9PB 3F01A 3MGOB 3S88H 4GKNA 5DYOA 2PO6D 2E7LA 4WTZG 2BS71 1I9RL 5ETUA 2R2HB 5TE6L 1KYOK 1UWFA 2X7LB 4WU7B 3AT8A 2IDTA 3QJOA 3PGCB 4NN6B 3LH8A 1ZTXH 1UJ3A 3DRQB 4X9IA 4RRPA 4MKMA 2FB4L 2YPKB 5JDSA 3S5LA 3W82A 4YHKL 4Z6AT 3KLQA 4J4PC 1JXKA 2JI2A 1U8KB 2R0LL 1P0SE 3UG5A 4YH6A 5AW0B 1U3YA 5C0EA 2EXSA 4P3WA 4E41B 3OGCA 5INDA 1S46A 5ANME 2CD0A 3BYYA 3L2LA 3MV8A 4N20A 4KXCA 4OI9A 3C60C 4AYFB 1DBAL 3KLAA 2WXFA 4POYA 3O6FC 1R33A 4X4XB 2NR6D 4WENB 1HEZA 1YSOA 2YD7A 1QA9A 3FCUB 3CXHJ 1QYGH 4ONFH 4TSCL 5TGBA 5HVGB 2AXFB 4H1LA 4AYBA 4JG1L 2UZYA 3T3ME 1C12A 3K91A 3WHE1 2F6AA 4H5SB 4L29B 4V11A 4GS7C 3VFSA 1XCXA 7PAZA 1BYNA 3UTTA 4X6DF 5I6XB 3RTQC 4FCHA 3D9AL 5HHQB 3K3QA 2R69H 1JPEA 3CLEH 2IH9A 4MNQA 4ODXB 5GGUA 4J4PA 1NGZB 3HKZA 5DU7A 4B9KC 2FJUB 3NN8B 5EN3A 4NO3B 2K3TA 3L17A 1S7UA 2R23A 5LGJB 2PWHA 1BVLA 4NUQA 2WHVA 3ZL2A 1KELL 4P05A 3QQ4B 2CK0H 3C60A 1E5CA 1OAJA 3O6FA 3HOGA 4ODWA 2XV2A 3GI8L 4XX1E 3UCQA 4UMGA 3DX8A 4LCIH 4A7GA 2X0UA 4XCEB 32C2A 3DDFA 3DBXA 1OCRB 3REWA 1ECYA 2YGVA 2IDCA 2IMNA 1CDYA 1WFMA 4I2XA 4KTEL 4XWOD 1OAUH 1MPAH 2OZ4L 5EEYA 4MYPA 3RTQA 4YZFF 3LNFA 4G43B 4OUUA 5IP4A 2OMUB 3FYIB 3RVWC 3ZXAC 3A0OA 3OV6A 1ASQA 5BS0B 5DZAA 3N41B 1AGFA 3IS1X 3ULSB 1ERNA 3VB9A 2Q10A 4DKTA 1PZBA 2UY6A 1HZKA 1YEGH 2J8UE 3V6ZA 4QRRA 1TQBC 1UCTA 2CUAA 3AWEA 3S34H 4QTHB 4Z7VB 5J3HC 1KULA 2A9BA 5HGBA 1ETB1 4CKQA 3L3OC 1XCTA 1I53A 3FF8A 4WTXA 4L9DA 3MRHB 3BC9A 3CSTA 1TZIB 3VTTA 1PY9A 2N4IA 1TT6A 1G4RA 2CIIB 4ZX4A 1FFNA 4MNGB 3PV6A 3ZDZE 5FWRA 3VTAA 5I0DA 1WWCA 2FQEA 4L1DA 1FFOB 4XVJL 3UTTD 5CFAA 1NOFA 1ZVSA 4MNQD 4ODTL 4U0RB 4J4PD 1LEKB 3CU7A 2BXYA 3FB6B 4JFYB 4MQSB 4OCYH 4FA6A 2DJUA 3ZTDC 4G59C 3EF7A 1UCBH 2FLBT 3GSUB 1CF8H 3QUKA 4LQFL 2ED6A 4X6CE 5G55A 4DFIA 3C60D 1UWGH 3L3OA 5E4EB 1QFOA 2W0FA 4NUPA 3FMGL 4ATWA 5TH2A 1ZANL 1CLOH 1P5UB 3QDHA 3MROA 1I7UA 1HOEA 4Z7WE 1WIPA 1HX0A 2LR4A 3RTQD 5D4IA 3QCTL 4RGNE 4M61B 1KYUA 3IS0X 4OLEA 1NANI 2GY5A 2YD8A 3O0RL 4JY5H 4YSDA 5ABAA 1RSFA 4Y2LA 3K6SB 2OTWA 5FUZL 1WFUA 1R0AL 3SDCC 4L3CB 4GRWE 3GLZA 4HSCX 1GAFL 4UTAL 1JYXA 2B4CH 4ONGL 1MHEA 5KTEH 3U82B 3WL9A 4YDKH 1JZ5A 3U83A 1T0MB 3LKOB 4BXSV 1MHCA 2UXTA 2VN5A 3CJJA 3MUGA 2FO1A 4RMBA 2NY0D 5J11B 3MLVL 2WNGA 4HLJA 4IRJB 3A6BL 3HAEB 4Z3IA 3GGWA 4LMQE 4HX1A 2VDNH 3KBEA 1UB6B 3RVWD 3RWCA 2ILLA 4OF5A 4BFFA 1ZA3B 4HEPG 4P9HH 3B1UA 1RAMA 3NCCB 4Y9BA 4UNTA 3QDGB 5DJ6B 5J12C 3IXTA 1E65A 3BX7C 2XY1A 3SDCA 1KBWA 3RVTC 2QGEA 2QKIB 1IQWH 2O5YH 4EO5A 3O41B 1OD9A 3EGDB 1J7VR 3N0PB 3CHPA 5E99H 1HCFX 4PJCE 4YNYB 5JTWA 1T5KA 4WWID 4RWYH 4W9IC 3FT4A 2WBKA 2E6QA 1INQA 3DJ9A 5CJQL 5J3HD 2P24A 2UZIH 1YPZF 3ISWA 5T1LB 1R19A 4RSYA 2Y1YA 5DXWA 3ZRSA 2VXVH 1A6TB 4M5SA 1YQVL 1ZLSH 2WLKA 2ARWA 5EBWA 2CJSA 3EO1A 1OP3K 1JGDA 4HUXA 1ETA1 4K3JL 1Z9SB 3VMPA 2JB5H 1J0IA 1T89C 1UADC 2NY2D 2ZKMX 3QIBB 4YHLL 1O7DC 1CC3A 3IAGC 2VLLB 2ZOTA 1JPGA 4X6DA 3QH3A 3DVGB 3S9DB 1MCOL 2VDLB 2EYTB 3P2TA 3JV4B 5DURD 3VFPA 4PWIA 2X41A 4OGZA 5ISZB 3WTTA 4PG9B 5ACMA 4JQIA 1S9YB 4M3KB 1RHHB 4DKFH 1F8TH 4KJWC 5CJOH 2EDRA 1TNNA 3WJJC 1IFRA 4J3TA 5FCUH 1RMFL 4YAQB 5L2JA 5SWZA 3LCYA 1XGRA 5DMYA 1SFDA 3P30L 5TF0A 5KSAB 4HH9A 1FGNL 2ZUQB 2WLLA 3PDGA 3WSQH 4X7FC 2EEDA 3DLQR 4X8JB 1T89A 2XTLA 5JORA 1D9KD 5D1ZI 3T4YA 1SMDA 4MXWL 4LKXB 1RPKA 1MVUB 3UEQA 1PZUB 3FS9A 3VI3F 5IHLB 1Q0YL 2AGJL 3ZKND 1T1ZA 2PKDA 3TEZA 2V6HA 3OLDA 4M8QA 2OLDA 1WYJA 3DSFL 5ALCL 4KXBA 5ANHA 1TSHA 3M88A 3BP4B 3WJJA 1DEDA 3QQ3B 3IGUA 3FTGB 1BOGA 2WGNB 5FOBB 1AG0A 2NY6C 4JG0L 1NL0L 1IRAY 3W9DB 2EH7L 3DVNB 3BFOA 2ICWI 3QFDB 4EF3A 4ZW8A 4YMPA 3D39E 4WSJA 2DH2A 2EO9A 2HFFB 2VT0A 1RZ8B 3JWNH 2Q3XA 2R1XA 3KWVA 4YGVB 1ACYH 1XB6A 4PGJA 5T1KD 2W92A 4NZTH 3AUWB 4WEEA 4JPKH 1T7ZA 43C9B 2BY1A 2JNZA 3NJKA 3PNWB 1LO3L 3H3PL 2ATAA 3SJVA 1VGEH 1G9EA 1FSKB 2PTUA 4PREB 5D55A 3I9GL 1A8JH 1H3PH 2P5WE 3KPLA 3QWOB 4J3XA 2VO5A 1MN4A 4KRPD 1LP9E 2HJFB 1K4DA 4XX1G 4DPBX 2CCWA 4NN7C 3ZUNC 1HINH 1QWUA 3OAUL 1DO6A 1GGBL 3RP1A 2XN9E 3B9DA 4JN1H 2RMNA 4KOCA 1NEZA 2XV0A 3JSSA 1P84K 4YEEA 3GXTA 2Z31D 2G5BA 3B8SA 1AGBA 4OZGF 4LOVA 5SWZD 1EHKB 5C0JB 3MX0B 3DYPA 1N2RA 2NQDA 4OF7A 3VGDA 1OALA 5IQNA 4QXUH 1OGSA 1FNSH 2IDUA 1T0NB 4ZDHA 2R29L 5ERWB 5KYXA 1F1AA 4MJ6A 1JN6A 3CXDL 1FQ9C 1J8HB 3IT8D 3CH1B 5I1JL 5JO5A 5DHXB 4G42B 4LLDB 1P7QA 3L9BA 3PWUB 1JXFA 1XZWA 3ATAA 3AU1A 5DD5L 4Y1SA 2VO8A 1PS3A 2BVUA 1KTDB 5EORL 5LLIC 4KJWD 1UTDA 3DK0A 3MR9A 3BW9A 1JUFA 4U3HA 3FB7B 5D5MF 1NCNA 2ZX5A 3B2UC 3VCLA 5L6YH 3KLHC 2ARJB 1I3GL 2APBA 1OLZA 5AZ2H 1XSOA 4K3DL 4PV1C 1X7QB 4QYOB 4R5XA 2EC8A 4OCLC 5TFSH 3KGTA 2IANA 2VM3A 4KBPA 5C6PB 5DD6B 5EA0H 5FUCE 4OD3L 3MLXL 4JW3A 4K07A 3REVA 3QEHB 4IMLB 5M7QA 3DUSA 1LEGB 1NDGA 4NO2A 1DQML 5EU7E 2E27H 4NUGH 2PPDA 4P59H 3SJVD 3LN5B 1YEHL 1JDCA 1JXJA 1ECZA 5IB2B 4UQ2A 3GSNB 2I07A 4P4RA 4MA3B 2D7TH 4JFSA 3TP4A 3M45A 3HZYA 4NKMB 2OSYA 1A6VL 3C6LD 1U8QB 2VITA 1G7MA 1V55B 4ZO9A 3TURA 2NY6D 3O6KL 3UEZA 2YXFA 2VDOB 2VC2H 1EEZB 1UM6L 1XMWA 3P40A 1E6JH 1IARB 4H1LH 4JDTH 4LHUB 5E8EA 3THML 1AS8A 4ZXBB 4IK6A 4X5WB 3HBZA 4IGBB 4Q7DA 1E4HA 4LSRH 1Z3GH 1GW6A 4RFNC 1AGEA 2Z3FA 4IM8A 3LKQA 1UXSB 3JV6A 3L3IA 1JZ3A 4LPVA 2F7IA 3PUCA 1RXLA 4X9FA 5JHDB 4NS0A 3RWDB 1EBAA 5KEZA 2OXHB 4YDZA 5JXAL 1GCFA 4E41E 4NSKA 1MFMA 4MFHA 4ZS7H 1QNZH 4PHXA 4HIIA 2OXGA 2X4TA 4EUPA 5J6HB 3RGVB 3ROLB 2AXHA 1GKOA 1F3JB 2Y7SA 4F15C 4LSUH 2YIHA 4PGDA 12E8L 1KFGA 3PDDA 3QUMB 4GUPB 4F7PB 3EJJX 3MKGA 4JFXA 5DI8B 3IGFA 3TO2B 1A9BB 3BOVA 2DYRB 3F62A 5AVYB 4G7YH 3PPEA 3M7OA 1IZKA 3QJHA 1IKFH 2NY3D 4PTUB 2IAND 2JLPA 3KLDA 4Z23A 1A7RL 4JJ5B 2CDGB 2GABA 4D3CL 3L5XL 4F7MB 4AKPA 3JT2A 3VI3A 3B56A 1MJ8L 1V05A 4OF8A 3O3AB 4RGOH 2DIJA 3S3PA 5K59E 2HT3C 3M6DA 5TF1L 1SRDA 2EDEA 2WO4A 3ES6A 3B2UD 3R0MA 1TFPA 2FGZA 2QSVA 2PR4H 3PHQB 3STLA 4QJ4B 3V6OE 1M3JA 4IBYA 4JE0A 3PCYA 2P8PB 5BQ7B 2H45A 1OSYA 3ULUL 3BUYA 1SBSL 1MRDH 2G0LA 3WN5C 3V4PA 4YS4A 1WBXA 5EU6D 4MA1B 2WIIB 3Q43A 1WCQA 5CILH 5I66A 1SLUA 2YKLL 4Y8DC 3PJNA 5KUMA 4FHBD 4GI6A 5TJWK 4X7SH 1M9SA 4B97A 1P4BL 3AJ7A 1KWGA 4KHXL 2X4RA 4N90D 3ME0B 2XVLA 1I9IL 2UXVA 2DQ6A 3GNML 2KKQA 3EYFB 3KCPB 4RIRA 4WEUD 1CD8A 3CQQA 3NRPA 2P1YA 3D34A 1D5MA 1BVNP 3EYVB 4MNGE 1R3LB 3TYFB 1PCXA 1D5IL 1HQRA 2IWEA 2OR9L 5EZIL 1DJGA 1Q1JL 3QDME 3A4EA 3OKEB 1X5IA 4H0LC 3WN5A 4Z18A 3A4FA 5CEZH 5C09E 4CGTA 5EBMB 1KXTB 3QULB 4P8QA 5E8OB 4AEIH 1KJ2A 3EOBA 2WQVA 1PZCA 3T4AC 2DWEA 5BZDA 1B88A 4KITB 4AE0A 2ESVB 5IW1B 1GR7A 3EFOB 5CCJA 2FK9A 2XVKA 4HS3A 3N43F 4Y5YC 5EDSA 1CXLA 1GOGA 3IDMB 4NGHL 4WRLA 3RB7A 3UZQB 3JQOB 2EEFA 1H19A 2Z7ZA 2VMDA 1HSAB 4JKPH 4Q2ZB 4R8WL 1XD0A 3GHEH 2XXCB 1FV1B 4KKBC 4YC2C 4IBLT 4E9QA 3SE4C 1DSFH 1HH6B 2PXYC 4E5XB 3IJYA 2DIEA 1MFBH 1WIUA 2WV3A 4CN1A 2HLAA 3E6HB 1JZ2A 5C0DB 1XGTA 2AJXH 2GITA 1KN2L 3HC3L 4GUCA 3S37L 4Y5YA 3WEBA 1BVKA 3X3GH 3OR6B 4HJUA 1BIIA 1G7QA 3HKFA 1QEXA 3MJ9A 4PRAB 4LDOB 1N0XL 1BM7A 3KM1A 2HT3D 3O2VL 4GG8B 3KWUA 1KENH 2JE8A 3IDNB 3M1CA 2J7LA 2ID5A 3SE4A 2FZ3B 3VD7A 4NNXB 4PRPB 1E50A 3QS2A 2Y36H 1QEWB 3QDGE 3KM2A 1MI5A 4ODSH 5CNHA 4PR5A 1MIEL 2J21A 4N2MA 2YGPA 3BI9X 2VZTA 3C8KB 4X99A 5K39A 5IG7A 4JQIH 2UVFA 4BZYA 4UMSA 1FYTD 4WI4A 4WI6A 4Y2DC 1SJVA 4J7RA 4PB9H 2IEPA 3I6GB 5BV7C 1JGEA 3EGSB 4RMWA 1GY2A 5AVUB 1J87A 2W60A 3ZQ9A 3BWAA 1MJ7L 5D1XB 3FFDA 3CZGA 4XC3H 3PP4L 1A8ZA 4IOSA 3TA4D 4QD2E 4AQ1C 2P7TA 2ZAGA 5K9QI 3NCBB 4IK7A 1GJWA 4UAOC 2WN2A 4P3DB 1MNNA 2JIXA 3V52H 1COBA 3H56A 3KYOA 2DF3A 2WXQA 4UQ3A 5FB8A 4OFVA 4XP6H 3E1ZA 4KY1H 5AW7B 3OR7B 4HHAA 2QPUA 4Y2DA 5F9OH 1O6SB 1JG9A 4N0FA 3W38A 5FO9A 2ZPKH 4AL8L 3AW5A 2H0FA 2H6PA 5ITBL 4A2HA 4R2GB 1DEEA 2X2JA 5BOZG 1DBKH 1H3GA 1ZGLB 2BNRA 4AQ1A 1SN2A 1CDGA 2AJYH 2QSQA 4KV5E 4WQOA 4XP5L 2R4RH 2OMVA 3QUGA 5CHNA 3IDYB 1DQLL 4KKBD 1NFDB 4O2CB 1JHLL 4EI5B 4J1UA 2PXYD 3VFMB 5BVPL 1V7NL 5SV3A 3R1GH 3Q1EA 4Y1AA 5FWQA 3H2QA 1MI5D 1U8MA 3RWJA 3ARDC 1S9WB 3FCSB 3MLWH 4PRNA 3TEUA 5MERA 1BQHB 2NY7H 3P9MB 3MUY1 5IMOA 3QXDA 3KMDA 3GKWL 3CZUB 2KH2B 4JDEA 1D5ZB 2CR6A 2B5IB 3ARYA 3ENEA 1QASA 1KXVC 5B38B 5JW4Q 3O9WC 4ZYKA 3JTTB 4B6ZA 1ZTMA 4WFED 1MZZA 4M1DH 3GMNA 2CNYA 3KPRA 5DEGA 1P6WA 3INUL 4ZD3H 1I4FB 1KPRB 2AZAA 3MRPA 4BFEA 1EJOH 3W1ZA 1HWWA 2HX9A 2X4PA 5A16B 1SM3H 5AW4B 2Y7QB 4NQCA 2HKHL 3ARDA 1MJJA 3OAYK 3UTPD 2JIXD 5B1BB 3IDUA 5HP5A 1DJWA 1YYMH 3W0WD 1WAEA 1CICA 1IM9A 3G6DH 1BQSA 4JHBA 2F8OA 4FGMA 3B3BA 1EHXA 1KTCA 2FEDC 1KXVA 2ZQKA 3EDDA 1QBBA 3O9WA 4Y2DD 1MFAL 1YECH 1ND0A 2NUTB 1R5WA 3LOWA 4YHNA 4M5ZH 3HE6B 5BMFH 3K2UH 1JD7A 4LDLB 3EJSA 4IIZA 5FYJE 1NFKA 3K2KA 3QS3A 3STZB 3WE1A 3MLUH 4K23H 4JFHE 5AW8B 5IZ7A 1NCTA 3T2NH 4PFEA 5GSRA 4HWUA 4JFUA 3D2UA 2HG0A 3T3PE 5SX4H 1E90A 2WXKA 3FUMA 1J8HE 3FBQA 3HVDA 4OZFA 1PG7X 2IPTL 3BPOC 4FJYA 1Q72H 3MNDA 4WFGE 5ELIA 2EYRB 5T3XE 1SJXA 5I76B 3ZDXF 1XTLA 3CC1A 4XMLH 2NNFA 2V2WA 5F7KC 1U8LA 2QGBA 1SLVA 2XRAL 3T9WA 1DQIA 3GTTA 4Y1AD 3X14A 1KPUB 4F8TA 4DHLA 2QVTA 4A6YA 3FUEA 4K5OA 4NXSA 5GIRA 1NPUA 3LAFA 2YAPA 4JPVH 5AKSA 3GQFA 4O9HH 3S2AA 2DQCL 1RUQL 4KFMA 2YA2A 3F64A 4N2DA 4XB3A 5ENWB 2ZSVB 3ECQA 2VW6A 2VLRB 1IC5H 1OCCB 1YEIH 3UC2A 1W9XA 3KPRD 1S8DB 1J5DA 1NAKH 5D7IF 1MELA 3MO1B 3UAJD 3V0DA 3DOIA 3VH8A 5CF3A 5FYKU 3LPOA 4UU9B 4KQ3H 1ROWA 3AQXA 4IOIA 4AC2A 3N04A 4BZ2A 5JNYA 1TVDA 3SOBL 2H3XC 1KEMH 2AXWA 2V5SA 4JHUA 4PGEB 4EUPH 1IAKA 1F90H 4RFEA 2BP3A 2IGFH 4TNWK 2AV1B 4D0BA 1PQZA 4YBLC 5DO8A 1A64A 2ICCA 5T1DL 5EOTA 4UYQA 3WLWC 3KR3L 4I85A 5GPRA 1MNUH 5AYTA 1UXLA 5J06A 4LNRA 3O9WD 4WJ5A 3DROA 1ORQA 2DM2A 3DX7B 1ZAGA 4TUKH 4X6BB 5FLUA 4QAWA 2A74B 1L9MA 3MNWB 3BAEH 4G8IA 4WEMB 5I18L 2W65A 1UA6H 1WUZA 5JHDE 5MENB 2E0PA 3BT2H 4AQZA 1VACA 4D7PA 4XNQB 3T6VA 3KXFA 3D2UD 1NOLA 2O5XH 2Y7MA 5LUMA 2PTVA 1CZ8L 4D7BA 5FXCH 4UTBA 1BIHA 2L7EA 2XNAA 4XE0A 4QTFA 3ZTNH 2CLRB 5GGSA 1ZGLM 3QFJE 3AMKA 1YLBB 3NCXA 5CZVH 3WD5L 2FEDD 3HAEG 3HG3A 1UHVA 1RUAL 5E0FA 1RZFH 3QZMA 3EAKA 1QKZL 4FG2A 4HU2A 5GGRB 5IOKA 4HUWA 3EOTH 4OIAA 3AITA 1E5AA 1Z3RA 4L9LB 5K9KA 2P8LA 5ICZA 2ATKB 1M6UA 1G7IA 2EIEA 1J8KA 4TVSa 9CGTA 5IQ7L 3V4PH 4OQTA 4R7DB 4WK0B 1KCLA 2CO1A 2D3VA 1FE8H 2C26A 3FB5A 3FPYA 1DLFL 4MDRA 3QO1A 4ZFOA 1RK0A 3QZOA 3POHA 3CLWA 3MRNB 3QDJB 3QIUB 4HIHA 4X5RA 4WEBH 5A40E 1CK0L 4KJQC 3IPBA 3S35H 3IU4L 3JWOL 5ID0B 3VFWB 3NEOA 1MW2A 4AYGA 2H32B 3VXMB 3PDOA 4OKVB 3KVQA 3OKOA 3MV9D 4FFTA 5DK2A 1PZSA 5FYLD 1T2QL 3R0NA 2H9GA 3ILEA 5E6IB 4Q14A 1I85C 3PU7A 2BIOA 3Q6FB 3JUZA 5LQBH 2VIRB 1QLFA 1E9OB 4HF5H 1KJ2H 1AZBA 2EDHA 1FVDA 3G5YB 3MOAL 1Z6JT 2L8AA 5BJTB 1A1MA 3KXFD 4NQUA 5JIKA 5HGAA 5K93A 3BLPX 2HSIA 5AOJA 3E7JA 3OXSB 2FUQA 2XVBA 1Y0LA 4QRPA 5DZOA 4DZ8B 4ZMXA 4YSEA 2WLIA 3DXAE 3FHQA 2YWYA 4DPCX 1R3KB 2AQTA 2YGNA 2GSGA 4ETQB 4LMQI 4BFBD 1IFHL 4JFEE 3IPEA 4N2FA 4QUOA 1K4CB 4PI0A 3ZW3A 4MSWA 1HZHL 1I85A 5EZOH 1DJHA 4Y89A 3K6FA 1VDGA 4F7EA 1M1XB 3U7YL 3MLSL 4KC3B 4RNRB 3TVMC 4HZLB 5FA3A 3UPRB 4L4TE 2AANA 4PRBA 1EERB 1UM4L 3QJFB 1MQKH 4G8FB 4JO4L 5JW3H 4H88L 4C59B 3GMMA 2F68X 4ODBD 4Z76A 1K2DA 2AABH 5CU9A 3WTYA 2DTMH 3KVDD 1T03H 5FC9A 1YNKH 3MJ9H 4LSPL 2YUWA 4LAQL 2P80A 4K9EL 3E3QE 2AK1L 1HCZA 3PXJA 3QHZL 1KG0B 3BGFB 5DJAB 3PGFL 3H9SE 3K71A 2O5NA 1MCIA 1DSWA 2ZOUA 3MRDA 4NQDE 3VQLA 3VWKC 4PJ8C 4XXCC 2AXGA 2WCPA 1IEAB 5CFHA 4MB4A 5KVDL 3QJQB 3GMPB 1OM9A 1MOEA 4GLRH 4I48A 2XZZA 1FNFA 2FWUA 3TVMA 3MYJA 4K94L 3IKCA 4N0RA 1P5VA 5D7SH 3V55A 3O3BB 5BO1L 2F54A 3WXWH 2EDXA 5E7BA 1AOZA 5D7IA 1ZCRA 2E9GA 1IGYA 1M7IA 2A6DA 2P26A 2X4SA 4HIPA 3EYOA 3ZPDA 1YEDA 4EDXB 2EDLA 1R3HA 2JSFA 2OYLA 5TPWH 3S7GA 4GQZA 1M42A 3KNBA 7TAAA 4GAJL 3IE4A 1SJEB 2B2XL 3ESUF 4KJQD 4PRHA 3LXUX 2VXTL 3B5GA 3MUZ1 3UAAA 2HKFL 3FTZA 4QGYA 4PRPE 2ADJB 5GRJH 4KGLA 4UT9A 4PJ8A 3VWKA 4XXCA 1JYWA 3FQYA 5IJVB 2J71A 2JH2A 4H20L 4XODA 3UACA 5KYNA 35C8H 4K2UH 3LIUA 3FFOA 1S7VA 3H6AA 2XSKA 3VXRA 2GFBA 1MCBA 3LEYL 4HCIA 4KHTH 2PTTB 2Z1PA 3KPQB 5HYJE 1TU2B 3KLKA 2IQ9H 3UBFA 4X7DC 2E4FA 2BNUB 1YDPA 4FEMA 4PJHB 6PCYA 1N6UA 5I0YA 3SYQA 5HYQA 4U1SA 3MXVL 2NLJB 1TPXC 3G5ZB 3LHPL 4PMEA 5BV7H 4LLQA 5IBUB 3D05A 1IAOA 2Y6TE 3HHSB 1C16A 1S7WB 3BQVA 3X12A 1B0RA 3HI5L 3T2LA 4S0HA 3MRCA 4BZ1L 1FDLL 2ENJA 2AK4E 2YD6A 2BIQA 2XQYK 3D0LA 3I3EA 2Z4QB 4UOZA 2P80D 1G0DA 3D09A 2NYYD 5DRZA 3HZVA 3NIDF 4IKNA 5I71C 1FBIL 1OZTG 1RZGA 1YNTF 5J1SC 3HS0B 1FYHB 1WFJA 2OMTA 4WHDA 5GGQH 4F20A 3VFRB 2LU5A 4N1EA 4XVTL 4ZMAT 4ZPVB 5EB9A 1E4WL 3SZ6A 4UIMB 2FSEB 1XIWC 4J6RL 1B3IA 4LHUG 4JB9H 5FUOH 3Q6GL 4D9RD 1NMBH 3FPXA 1ZLWK 4U7MA 2NXZB 3MV7B 2OMXB 1MFVA 4MRBA 4WW1B 5AYUH 2ENPA 3LH2L 4ZFQA 1FAIL 3K4AA 3UYPB 3IDJA 1N12A 3KVPA 3S8GB 4P2AA 5EOCL 1WGVA 1NFDE 4PRHD 1LDPH 2JQMA 3V79C 1UOKA 2AQRA 2E6JA 4LRIC 3VWKD 3KZ8A 4PJ8D 4IQHA 1U6AH 1VZGA 3O45B 4JRXA 5IM7B 3RUGF 3OBAA 3TL5A 5EF3A 4EVNB 5DC9B 3HI1A 4BGDA 1FNEA 4H40A 2VLKA 4S1DC 1QRND 2X2UA 1FF5A 1XIWA 3DK2A 4Y16C 1WA0X 3APDA 4I88A 3TLRA 4HKXA 1BG9A 2PR9A 1EZVY 2IJ0C 4L0PB 3SE6A 3DTUB 2MSPA 4LBEA 1UXWB 3H2WA 3U2JA 4JK0D 4PVBA 1DFBH 1SHSA 4NFCA 1ZT1B 1G9ML 2E75C 2WBJB 4Q6YA 3WUWB 3FOMB 2GYSA 1HT6A 2K70A 5EBGA 3C5JB 5H35A 3MRFA 4OCSL 1CURA 4GXVH 3CFJA 5I0VA 1MLCA 2IAMD 2WBXA 4LRIA 1JZHA 4KVCH 1DJYA 2X1XR 4HFWB 2WMPB 3K2IA 4J2QA 3IYLW 1WZMA 1W72A 1N26A 4LL1A 4OZFH 5IEHB 1UH2A 4Y16A 3B6SB 4PS8A 4G3YL 3LPGA 1TCRA 4BFRA 3E2HC 4GKSB 5JQ6L 2IDSA 3NSFA 1S7TB 4TNEA 4MX7A 4PS4L 4R4NC 3BLKA 4PJXF 1GYCA 3CDCA 3GSOA 3WIIL 1EEYA 2HVKB 4A6YH 1AO7D 1C5DB 1TOXA 1U8CA 2Q7YA 2Y06L 4LLUB 4MMXB 4UOW0 5T3ZH 3WDJA 1YN6A 3KPOB 1ZT7B 4PJ5E 1GH7A 3F3HA 1KC5L 3CVHL 5ACZA 1SYVA 4LPXA 2FLRT 1SNRA 1KBVA 1XCQA 2DW5A 1MAJA 4W6XB 9PCYA 2GCYA 2CKBA 1UURA 3DVFA 1M7DB 3HZKB 5DVKA 3QQXA 3MTXA 3ZKXC 2WYHA 4L1TA 1D6EB 4UM9A 1DJZA 4H8WL 3ZK0A 4NO0A 4OZ4B 4TS6A 2YBGA 4K71B 5HI4C 3QNXB 2VLJB 2FBOJ 4DN3L 4JRXD 4BZ2H 2ICES 3U6XS 4DQOL 2VLKD 5F6IC 3BHBA 4QTIH 4WW2B 3TBSA 3DOSB 2NT0A 4B27A 3FQNB 2WVVA 1ZE3C 1X5JA 4DOHB 3GXMA 2BIMA 2ZOKA 4HUVA 5K33A 5HVHB 4PRIB 5FYLH 5FO8A 4JFDA 4BFOA 4JNXA 4NQEA 5C0RL 2UVEA 1NSNL 3PWJB 1Q9OA 2YMXH 4U1MB 2XOTA 3GUTA 2QJDA 3BWSA 4XN8A 2YSSA 2OMWB 2I60H 3Q1SH 2GJZA 3OJ2C 2CGRH 4U2YA 4WI9A 5EIIB 2O26U 2CA3A 1ZOXA 4F92B 1DQQB 2VISB 5JOFB 4S1DD 4UTBH 4LSSL 2JI3A 4EEEA 4FP8L 3CN2A 3KPSD 3VW3L 2GC7C 4NCDA 4YHIA 1KV3A 1SEQH 5L4JA 4Z0XB 2I9TB 5EOQH 4Y7MA 5AQ0A 5IQ9A 1QBLL 4KROB 4E5XG 2GI7A 2WLZA 3DOHA 2ZCKH 3LKPA 4CL7A 1AR1B 1BOYA 3D85D 4NPYA 3VFGH 1UEYA 3NIFF 3BVNA 3R7QA 3MLYL 4CVWA 2R1WA 2WWOA 3PWVB 3UTSB 1R3JB 4NRZA 1DVQA 4OGYH 2A77L 3VFNA 1N59B 1JPSL 5E9DA 2VUOA 1UASA 3HMWL 1JZDC 1WWAX 2VDNB 4OQTH 4NQQA 1V7MH 2J1YA 2CBQA 4UM9D 4UILL 5EC2B 3ZUCA 4E9SA 1M6OB 3IMSA 1KB9J 2EDDA 2PCYA 3ECBA 5G2NA 3RKDD 3ELQA 5K9OA 3RA7L 2MMXA 5KJRL 1YNTA 1AIFB 3CSYB 3IBOA 5BXFA 2WXIA 3D51A 2AITA 4MZ2A 4S11A 1DCLA 3BD4A 2CLVB 1QMUA 3MOQA 5KYUB 5LGHL 2D4DA 4JCMA 5EZLA 3PWLA 3I6SA 4I3SL 3IGLA 4KTDH 1KCSL 3R06A 3ARUA 1PZ3A 3T0ED 4DZBA 4IJ3C 1RK1B 3FU9A 4NQED 2Y2YA 4C56A 2Y5TB 5GRXG 1XH1A 5DJ0B 1QVOB 1Z66A 2P5EE 5IBTL 2Y69B 4R7NB 2HX8A 3OPZH 4I77H 4YQXH 2GT9A 3RUGA 5DJCA 1E9PB 2GTWA 3X13A 1HKLL 2GJ6A 2WXJA 1JTPA 3DURA 1PNCA 3SKJL 1OB0A 3E9TA 5C9JB 3C5ZC 3RL2B 3VXME 2AQ3A 3BUBA 5LGYA 3QEQA 5F9JB 3Q8FA 3SBWA 4L5FL 2K3HA 3LZQA 4WF7A 1BW8A 1KB5A 1CBVL 4O4YL 5DJDB 4NPJA 3GBNL 4HUUB 5F9WB 3FB8A 2V5TA 1OSPH 2Z34A 4I7ZC 1SN0A 2CRIA 2W5PA 2F7PA 5EUKA 1UM5L 4M48H 2CPUA 1JMXA 2MOGA 1E6OH 1PIGA 1U2YA 4H8HA 4GY4A 4K3HA 4O2FB 4XVOA 1CF1A 4IW4C 2YPLA 1J5HA 5E9DD 2DI7A 4OI7A 4Q56A 4FNSA 4WJG3 1ZSDB 1U91B 5BRZA 2OFQA 1F11B 5KW9H 1QW9A 1BM3H 2HFGL 1GJIA 3C5ZA 1JZ4A 1HXYB 2V8LA 4OFYA 1OTTC 3EO0A 3CZJA 4U2ZA 2XQYG 3AY2A 4PJBE 3WV0A 1VSCA 1JZ7A 2I25N 4LP8A 3BZFA 2AJ3A 4PJXA 4NM4L 5GS0C 1IM3B 1LTXA 4AVIA 2A9NH 3QUHA 2HP4A 2PN5A 2VYRE 5AKTA 2G75B 1OAKL 2VXUH 1SDDA 3AS0A 1AGDB 4KO7A 4EOWL 4YR6B 5FPIA 2CBMA 4WWKD 3TIEA 3HUJE 4PWEA 5IB4B 3QAQA 5AFAA 1II4E 3VMNA 3ZE0E 5B38G 4P2CG 3D25B 3WFDL 4DKDC 5LWYH 4FTVA 1KLGA 4BE5A 5F7EL 1D2PA 5CN2A 2E7BA 4PV8A 4UZSA 1NGQL 3HZMB 4IRZA 1JHKL 5HYEA 5I8KH 4LOUC 2GJ6D 3MCKB 4TQEH 2AAVA 1OAZL 3HG1A 3KBFA 4AITA 1UVQA 5DHMC 5KVEL 1G7JA 2C9AA 3QEQD 4G9FA 4GI9A 5KZCB 2FJFB 1Y6NR 1CTOA 3LKSB 5I82A 4IEFB 1EZSA 3I2CL 3BIKA 2NXYB 1GRWA 3OHXB 2XWDA 3RDJA 5L88L 4MGXA 3G04B 2XG4B 3CX5K 4PJDF 4WO0A 4XCFH 5DFVD 3KYAA 4S1RL 4IOFC 4QRQB 2F08A 2VLMD 4NAJA 4P49A 1MIMH 2HRPH 4D0CB 4O51B 5BRZD 4AEEA 3NJMA 4FQQB 1RVFH 3Q3GA 3KW7A 1PG7L 3I6LD 4O2EA 4PJGB 1A3LL 1PTZA 5J1TC 4OFYD 3CFEB 2CIKB 2Y25A 2X12A 4K73A 1BXXA 4GKNB 3BUPA 5DYOB 1KBBA 4LLMB 5C0GA 5HDRA 5EF2A 2CE6A 3RI5K 3PJSB 5JDSB 4KVPA 2W88A 4O58H 1T5XA 1FORH 1DBBL 4LQ1A 2QZQA 4G6AC 3UFIA 4EQ2A 3FAXA 4FOMA 4GW5A 4NP4H 3H8NA 3HLAA 3QXVA 4XCCH 1SVZA 5C0EB 2LW3A 2BHFA 3UROR 5IFJA 4OJFH 3SIKA 3OGCB 1PZ2A 3K5SA 5INDB 3RX9A 1XD1A 3GLDA 3MV8B 1OTTD 4FTVD 4HAKA 3BKJH 1TYEB 4BBWA 2O5ZH 4XN1A 5K9QG 1G7HA 4HKBA 3SD5A 4F1ZA 1DL7L 4LGSB 1HEZB 4G1MA 5TGBB 3A6CL 3B7SA 2VC2B 4H1LB 3QR1A 2UZYB 1ZTXE 3EJUA 3LSOA 3GRWA 3VFSB 5GGVY 2EXWD 1QR1A 2BPBA 1XGYH 1NCGA 1JRHI 2JKIS 2QL1A 3GSXA 4MNQB 1E8YA 5I9QC 1SN5A 4H44C 2AEOA 5IUSA 3MI6A 4YPGA 1S7UB 1EMTH 1A7PL 2OCFD 2VMFA 2WLYA 4LGPB 5DJ8A 1UQSA 1NUNB 1BVLB 4P2QA 2CUHA 4G70B 5C07A 5DZ9A 2ALAA 1IGTB 3L95A 1PSKH 3MV7E 4X2UA 3HB3D 5HYIA 3CBJB 3O6FB 1A3RH 4LOUD 3HHMA 1AZRA 4U3CA 3ULVF 1LWRA 3DYMA 4FI6A 32C2B 3DBXB 2P45B 3W81A 3REWB 4I0PC 2D3LA 1XX9C 3X11A 5BVJA 1JF6A 4I2XB 4GS7B 1B4JH 2YUVA 3TH2T 3T0XA 1GW0A 4XO3A 1W72H 2AQSA 3HRZB 4J2XA 2WYZA 3BCDA 4U1NA 4FFVC 3UO1L 1GTNA 1WWBX 2J2ZB 3DX9B 4NLHA 5D7LA 1RI8A 3LXAA 4EIBA 1AGFB 4I8DA 2FATL 4QO1A 4XVSH 3ZTJG 1E9QA 2UY6B 2Z8VC 1HNFA 3RVVC 4HETA 4IOFD 4HIXL 1GYVA 5M94B 1E4XH 2X6VA 3G6AB 3Q8CA 4QRRB 4PBWD 2DICA 1BREA 1H3VA 2VAJA 1OV8A 3LS4H 3LZPA 4I0PA 4JZOB 1ZDSA 2ZF8A 1C8PA 5HGBB 2CKBH 1BPLB 4GBXD 4DKEL 1CDIA 3ZRFC 3LV3A 1IEHA 4YEFA 2YHGA 2WJ5A 4IKLA 1J0JA 3AQYA 2X5PA 1FFNB 2CBPA 1XO8A 2L04A 5HGDB 4XMKH 1HXMA 4B9PA 2IBZX 4WNQA 1IEBA 1ZVSB 4G5ZL 4FQ2H 4G6AD 2WM0A 3A5VA 2DLEA 4APQC 1PF3A 1JHTA 1G1OA 2FBJL 4OLWH 4AM0A 2COQA 4P2QD