3IN0A

Crystal structure of the f114p/m121q variant of pseudomonas aeruginosa azurin in the cu(ii) state
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
128
structure length
128
Chain Sequence
AECSVDIQGNDQMQFNTNAITVDKSCKQFTVNLSHPGNLPKNVMGHNWVLSTAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVSKLKEGEQYMFFCTPPGHSALQKGTLTLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Rationally tuning the reduction potential of a single cupredoxin beyond the natural range.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Electron transport
molecule keywords Azurin
total genus 31
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00127 Copper-bind Copper binding proteins, plastocyanin/azurin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 3in0A00
2GC7C 2DYSB 1ZV2A 3ABGA 3WI9A 1BYPA 2H47C 3AW5A 3FQYA 4YVUA 3ZDWA 3BQVA 4Q8BA 3IE9A 3U25A 2FT8A 1JVOA 2VM3A 4L0PB 4GP4B 4GP8B 2E86A 4GY4A 3S3CB 2UXFA 1V55B 1HAWA 1KBWA 3SBQA 1SHWA 2PPDA 1A4CA 2EINB 2OV0A 2YXVA 1X9UA 4BWUA 5I28A 1EZLA 2XU9A 4HCGA 4M4RB 4NAJA 1SJMA 2RACA 1SF3A 2PPCA 3X1BA 3DKHA 3CVDA 4NB7A 2Q9OA 1FWXA 2BP8B 2YAOA 5B1BB 4AZUA 4DP6X 1PF3A 1PMYA 1QNIA 1KV7A 2IDUA 3T6VA 4UF7C 7PCYA 1PAZA 3NP4A 4NERA 2HXAA 3DTUB 1JOIA 3NJHA 1JXFA 3T6WA 3NJMA 1L9PA 4E9RA 1NWOA 2BP0A 3KW7A 3ZX1A 4CSZA 1AOZA 5D4HA 1OCZB 3PCYA 4KO6A 3ASOB 2XYBA 2FJSA 3WKPA 4UAHA 3X1NA 4JKNA 4EF3A 5D4IA 1JERA 1TEFA 2FQEA 1SFHA 1B3IA 3SQRA 1PLCA 4WKXA 5F7BA 2CJ3A 3H56A 3ZIYA 1N68A 2GC4C 1E67A 2PP9A 1CC3A 3EH3B 2UXVA 4HIPA 2YAPA 4DPAX 1ASQA 2HRGA 3WKQA 1OE1A 2YAQA 1ZDQA 1NZRA 4KO7A 4CSPA 2DV6A 1W8EA 2AANA 4KOCA 2BZCA 2PPAA 4KOBA 1AANA 2QPEB 2W8CA 2PPFA 3IN0A 4K9JA 5B7FA 1AZRA 1URIA 2BW4A 3FPXA 2XX1A 1M9WA 1GR7A 1OCCB 3NJGA 9PCYA 5I6PA 2R7EA 1FFTB 3QJVB 1NIEA 2XVBA 3NSYA 3FQ2A 2I7SA 3QJTB 4E9QA 2YAMA 4YSCA 3AG1B 1V54B 3EHBB 2TSAA 4AKPA 5D4JA 2IDSA 1JZGA 2UX6A 3GYRA 1XB3A 2YAFA 1ET7A 1GS7A 4P5RA 2YQBA 1CYWA 4F2FA 1OOWA 3TU6A 1A65A 3AG4B 1J9TA 5I6KA 3NJFA 3NJNA 2FTAA 3PXLA 4YSQA 3WNIA 1IBYA 4DP2X 3T9WA 1JZJA 4AKQA 2XUWA 5B1JC 1AS8A 1WS7A 4BXSV 2JFCA 1W6LA 5B3SB 4YSDA 2PP7A 2OJ1A 2XWZA 1J5CA 2AZAA 2CALA 3N2JA 1ASPA 2P80A 1JZHA 1KGYE 2X87A 1JZIA 5FC9A 5IY5B 3QQXA 4HAKA 3NSFA 2IWEA 1BXUA 1J9SA 3QJSB 3UADA 1SDDB 3EF4A 4PAZA 2GI0A 2CCWA 3FT0A 3OQRA 3OMNB 3ZBMA 2WO3B 5B1JA 5I6OA 1NINA 1WA1X 1NIFA 2GHZA 3FQ1A 2BP0B 4YSSA 5PAZA 3T6ZA 4BWTA 3ERXA 2IWFA 1I53A 1J9QA 3OD3A 4YL4A 2IDTA 3PAVA 1CYXA 2XLLA 1JXDA 1ZIBA 2YXWA 3PPSA 4A68A 2EIJB 2H5UA 1KBVA 3X1GA 4QLWA 3ABLB 2VW7A 2MRYA 1E30A 4KNTA 4BWWA 4DP7X 1SF5A 4F7KA 3MBWB 1AIZA 4DP0X 3S8FB 3AG3B 4HHWA 2XV3A 2I85A 1QLEB 3QJQB 3IN2A 4JHUA 2FT6A 2UXTA 5ANHA 3SBRA 4F2EA 1E5YA 2FNWA 2Y1AA 1AS6A 4A2EA 1NPNA 1ILSA 1BQKA 2MTAA 4G71B 4YVNA 1GY2A 5AZUA 1A8ZA 4DP9X 1MG3C 1VLXA 2PP8A 1MG2C 2CUAA 4N4YB 3DIVA 2HX8A 2VM4A 5LDUA 3TBBA 2IDQA 1ZIAA 3BVDB 2YARA 4G7RB 4ENZA 4ZK8A 1HFUA 1ZPUA 3HEIB 5PCYA 3T71A 3FYIB 4YSUA 4KNUA 4RH4A 1M56B 4GYBA 1ZDSA 2FQFA 3FU7B 3HB3B 1ASOA 2PLTA 2AFNA 2XX0A 2YAEA 3CVCA 1RCYA 3NT0A 1CUOA 3H4FA 1DZ0A 2GBAA 1J5DA 3FSWA 4G70B 3NSCA 1PNDA 1CURA 1L9SA 3FU9A 3CDZB 2IH8A 5TK2A 2BWDA 3NJKA 3V9CA 2ZOOA 1GYCA 3FSVA 1SHXA 1L9OA 3ASNB 2HX7A 4AI7A 4TXVB 1AS7A 2J5WA 2A3TA 1NWPA 1PCSA 1AZNA 3OMAB 3JTBA 5I6LA 3EH4B 2CBPA 1JVLA 3FPYA 3NYKA 3X2QB 4FA7B 1AZBA 3FU7A 4BXVA 4YSEA 1NIBA 4Q89A 3FSZA 1NICA 3FS9A 1HAUA 1PLBA 3NJJA 1L9RA 3RYMA 1ADWA 2B08A 4P5SA 4W1TA 4BDVB 1BQ5A 2DY2A 2BW5A 3AZUA 3C75A 1GS8A 2ZONA 4JHVA 2VSKB 1ID2A 1R1CA 2AZUA 4M3HA 7PAZA 4E9YA 3N55A 2HLEB 2QPDB 1T5KA 2J55A 8PAZA 3NSDA 2J56A 5I6MA 3H4HA 3AY2A 3UACA 4GP5B 1TKWA 1BQRA 3UABA 1V10A 3G5WA 2ZWNA 3PAZA 1NDTA 4UANA 1L9QA 3NJIA 2R7EB 4PCYA 5B7MA 3UAAA 2BP8A 1OE2A 1PNCA 3D12B 2DWTA 1GS6X 4A2HA 1TEGA 1BEXA 2UXGA 1BYOA 4DP1X 1IKOP 4BDVA 1IC0A 2TSBA 3S8GB 1MZYA 1PZCA 1RZPA 1ETJA 3ABMB 2NRDA 1OE3A 4E9VA 6PCYA 5F7AA 3WIAA 2P80D 3L45A 5B1AB 2HX9A 3KW8A 1KDJA 3X1EA 2VN3A 1OCRB 2EIMB 2ZXWB 4E9WA 4AX3A 2VW6A 1AZCA 3V9EA 1IUZA 4DP5X 1MDAA 1PZBA 2HZHA 2XV0A 3FU8A 2FQDA 2XV2A 4G72B 1EHKB 3EH5B 4YSTA 4HCFA 1RKRA 3SBPA 3NJLA 2W88A 4A67A 4W9ZA 1SDDA 3MX0B 3TA4D 1ET8A 5B1KA 2QDVA 3CVBA 3IBOA 1A4BA 4A2DA 4DP4X 5AFAA 4X4KA 2UX7A 4E9SA 3FYEB 1YLBB 3FSAA 4N8UA 2WO2B 2OCCB 1AQ8A 2I7OA 4G7QB 4YSOA 4GXFA 2B3IA 3QPKA 1W6WA 2DYRB 1PZAA 4FAAB 5I5JA 1JXGA 3QJRB 1NIAA 4DPCX 1AACA 1GY1A 3TASA 4HHGA 1JZFA 1KCBA 3UAEA 5AKRA 2JXMA 1WA2X 4KO5A 1QHQA 1KDIA 4HZ1A 3OM3B 1PLAA 2WSDA 1AG6A 5B7EA 2Q5BA 3S3DB 1X9RA 1OCOB 2EILB 4QKTA 4A2FA 1ILUA 4A2GA 4E9XA 3OMIB 4DPBX 2PCYA 1AAJA 2PCFA 1ET5A 2H3XC 4AKOA 3X1FA 3JT2A 1XB6A 3GXUB 4DP8X 3NP3A 1GW0A 2EIKB 2BO0A 2VSMB 1UATA 2CAKA 2DWSA 2XXGA 1F56A 5TK4A 1L9TA 4YSAA 1PY0A 4HCIA 2J57A 2X88A 4YSPA 1SNRA 3PAUA 3UGEA 3PLYA 2IH9A 1NPJA 3GDCA 5I26A 1AR1B 3S3BB 3QJUB 1WA0X 1BXAA 2YAHA 4HALA 4KNSA 2VMJA 3T6XA 3CG8A 4WTQA 4A66A 1NIDA 1OV8A 3AG2B 1RZQA 2N0MA 2BHFA 5I5IA 1WAEA 2QDWA 1IBZA 2GIMA 1AG0A 1JZEA 2AVFA 4KO9A 3IEAA 1N70A 3TBCA 2IWKA 6PAZA 1KCWA 3WG7B 4MFHA 1E65A 1XMEB 2QT6A 3WNJA 1A3ZA 2GB2A 2FQGA 1AZUA 3ABKB 1SFDA 2BWIA 4YSRA 1DYZA 1TU2A 2FT7A 2Y69B 5E9NA 2GSMB 2IAAC 5EHFA 1WS8A 1A4AA 2FWLB 1BXVA 1NTDA 3CDZA 2VW4A 1GSKA 2LLNA 1J9RA 5I5MA 5A7EA 1OF0A 4G7SB 1KYAA 2BZ7A 2PPEA 1M57B 3CZUB 1MZZA 2IDFA 1XB8A 2JKWA 1FA4A 1BAWA 2HRHA 1E5ZA 4BK5C 5I6NA 2XXFA 4E9TA
chains in the Genus database with same CATH superfamily
4WUUA 1ZXQA 1WFTA 4PJ7F 5I15L 5F70A 4HIIB 5DYOB 3QS3A 4J5VA 3FQYA 2KZBA 3VXOA 3MOAH 3U7YH 4HKJB 3NN8B 2VM3A 3G6DL 4LDOB 5C97A 4JQVA 4WHTB 2Z8VC 3KBEA 4R26L 4YPJA 1XF3B 3ZKMC 2HLFC 3D39A 4IHBA 3RI5K 4GG6E 1YEDA 3BFQG 3U7AA 4ZT1A 3GGWA 4J4PC 1KBWA 1NCGA 1NJ9A 4L9DA 1FGNH 2BOCB 4BHUA 4WFHE 4OCRL 3JWNG 4R4FL 1A7PH 3RA7H 3QIBC 3VGEA 5DDHB 1AQKH 1CZ8L 3R8QA 2RACA 1I1AD 1YEIL 3X1BA 4IRZA 5GRXG 3H3PH 2H4EA 3CVDA 1Z3GL 5IIEA 4NKQB 1CFMA 4Z7VE 1ACYH 1AD0B 1NSNL 1F42A 4GKZA 1Y0LB 3FUKA 3ZL4L 2Z92B 3L5WB 4AV5A 4RGMB 3TV3H 3WL9B 3ZPDA 2E9JA 4I3SH 4EIBA 2BVQA 5DEZA 3GNMH 1X4XA 4NX0A 3AU1A 2BVUA 2VZSA 2C9UA 1JOIA 2VLKB 4W93A 1JXFA 3PFQA 3CMOH 2G2PA 1F90L 2E7LC 2P26A 1MW2A 1DQML 2K78A 4GAAA 3RJDA 1DLHB 4X5XA 1W0WA 3V4VB 4EI5C 2ZKWA 1I1AC 4NKOB 1A6VH 1XAUA 1F3RB 4N9GB 2MSPA 2M2DA 4Y4HB 3WS6A 3G08A 3BP7B 1SXCA 3Q43A 4JDTL 1LEGB 1MOEA 3RGVB 1VACB 3ZHLA 3QDME 4FNLL 1XQ4A 1TEFA 2QADC 2ROXA 4OCWH 2BHYA 3BCFA 4WJKB 1UCBL 4GQRA 2H32A 2FECL 1M6OA 1SDYA 3K4DA 5IBLC 4YDNA 2GC4C 4HS6B 1O9VA 5HD8D 4G82A 2UXVA 3BVXA 1IBDA 3B9DA 4QHLB 5AZEL 5J12C 4HWZA 4B50A 4F7TA 1FVDB 1F1GA 1Q4NX 3R18A 4KO7A 1PG7X 1J0JA 5J1AA 3SGEH 4ZMLA 2ALWA 5JW5B 3NFNA 3FHAA 4WK0B 2CNZA 3ZE1E 3MRQB 1E9PA 4JM2B 4PP1D 3MRJA 2EDLA 3C60D 4RGMC 1U3HC 1M2OA 4V11A 4QRQA 2UZYB 5KVFH 3DETC 4JG1L 1FNFA 4HCRH 2EH8H 2VZVA 3KDMB 3LH9A 4HIHA 1T5XA 4PYGA 4U0RC 4E9QA 3B2VL 3IT8D 5E4AA 9CGTA 4OB5H 1OOAA 3K4AA 2DYPA 3BYYA 3MV8D 4PWHA 2K4WA 5DC0A 5JIIA 2BSSB 2IXQA 1J12A 2VB5A 4N8VA 4WUUE 2LABA 2APSA 5LN4A 1SOKA 2A1WL 4JFPA 1DEDA 2OPCA 4ONGL 5DD5L 3CSGA 4DVBB 1Q94A 3NPSC 4RFEA 4F15B 2NTSP 1KELL 1NGPH 3D69A 4R0LA 1J1OH 5I8OH 3SQBB 3L4ZA 1NFDA 1PQZA 3NZ8B 4LSRH 1B4RA 1PZ5A 2W0KA 5C0CE 3CNKA 5A43C 1FL3A 1P69B 4M9OA 2IWGA 4I9XA 1U3HA 4GMSH 5ADPL 4MB5A 1J5CA 2J71A 1BBJB 3A6OA 2P80A 1CDBA 5DD3L 5IY5B 5E95B 3T77A 2BS9A 2N0KA 3CN4A 1K2DB 3NSFA 3VNYA 4B7IA 1PLGL 3BD3A 3D08A 3MUJA 5JORB 4JANA 2BS8A 1ZCRA 3HNTH 3OQRA 1G6RL 1HQ4B 2WO3B 3EUDA 3KVQA 4DAGL 3I02A 1NGWB 2HUHA 4MXVE 2HG0A 1J11A 2PCPA 3R4DA 3BX7C 3RY6C 1RZFH 4YSSA 4X6BB 3CSPA 4APQA 4AYBA 2VDPB 2FZ3B 1KLFB 4YHKL 4F7MB 4HX1B 2G0LA 1GTFA 4KH2A 3SDCB 2FDBP 3GO1L 4IU2B 2XZAH 1JNNH 1WBYA 1BGXH 3S96A 3WNNA 4G42B 5LCVL 3AMKA 2R69H 4DP7X 4AGPA 5IR1B 5JUEH 2XWRA 1V5JA 5L2JA 4YGVB 3GIZL 5JNYA 2FIRT 1XAKA 2DQUL 1KB5H 4NKDA 3CHQA 4XNZC 5GGRY 4CL7A 4Q2ZB 2EKJA 4YE4H 3MV8E 4KTEH 4LP5A 4WEBH 1NCWH 4LCCC 2FNWA 1I9RL 2JK5A 3CJJA 4U1LB 5DVMA 4HBQA 1BQKA 4WGKA 3S34L 3FUFA 1V3LA 5AZUA 4GUQA 4H0LC 4ADIA 1A8ZA 3SB3A 3DOHA 2PP8A 3T3PB 3ZR6A 1KGUA 3HI6H 4R4ND 3N41B 4UZUA 3DIVA 2AJXH 2QPSA 4L3CB 3KYOB 4L1LA 1U8MA 4DVRL 5F7DB 5C0IA 3ARGA 1GC1C 3SPHA 3F7LA 5E0FA 4S1RH 4G7RB 1I3VA 3LD8C 2BSED 4TV3A 5FYLE 3WNPA 4BEIA 1XL6A 4JFQB 1DSFL 3GMPA 2OW6A 1JWUA 2ZSVB 3HEIB 1TTFA 5T5FL 3RGBA 4IM8A 4G7VL 2ESVD 2DH2A 4BKTC 4J23A 1KGCD 4X6CF 3FQ4A 5LBSA 3CE1A 4MJ5B 4R4NC 3L5JA 5FKAA 1SJEA 5K1NA 3SO3B 2G2RB 1XCTA 5EU6A 2RH0A 3II3A 1KXTA 4GRLC 1A7RH 1NMBH 4LSPH 4RWYL 4ZMVA 5DEGA 2IPUG 2KS0A 1HL5A 2DMKA 2W38A 3O0LA 4HIXH 3K72A 2OQJA 5F72S 4XPAL 1HJBC 3BSZA 4X5WB 4NC2B 3DUHA 1YYML 1LO0H 1GGIL 4IRZH 1FAIH 2YPKA 5LAXB 3IJ8A 4N2HA 1QHPA 3QUKA 5FUCE 1PKQB 1XIWD 3D18A 3ZDZF 1PD0A 1IC4L 3CMOL 2R83A 3GSQA 5HHMB 1OQOA 1NIBA 1TVBA 2OMVA 1LEIA 1MIMH 4GRLD 5FUZH 4YS4A 5JHLL 2CO4A 5CR8A 1P7BA 4GAGH 1ADWA 1U8JB 3D9AH 3M45A 3AZUA 5FW8A 2WXGA 1KENL 1QD0A 3F6LA 4S10A 4ZUWA 1JXKA 4QKXB 1THAA 1TJGL 1SJHA 3IDGB 1IFRA 3MLWL 2VNCA 3WJMA 2J55A 1ZJBA 3HG4A 1HHJA 2VXUL 4GFXA 1KCVH 3QDGB 1FGNL 2X3BA 2L7QA 1II4E 4TULL 1L9QA 2WCGA 4N26A 5AVZB 4P46D 1L6ZA 3D3VB 3GMNA 4PYHA 4BGLA 1AYOA 1UA7A 3L9EA 3SDCD 2CHNA 1XH2A 4KJWD 4FLHA 3MLRH 3OKOB 5GGTL 3CPLA 3K6IA 3GZQA 1G1YA 2UZXB 2FSEB 4BQ9A 4XP9H 1H3XA 1VFBA 2MNUA 3S8GB 2KKQA 1C1EL 2EDYA 2W9EL 3NMEA 3OJMB 2NZIA 3TFBA 2WZ5A 3PQYA 3K2MC 3LZFH 2GTWB 2Y07L 3D87B 3N85L 5EO9B 2FLMA 3X1EA 1IAKB 4DEUA 2NPLX 4P46C 4XE0A 3HG1E 4ZUVB 4LRIC 4X7TA 3NIGB 2GT9B 3SDCC 5E9DA 4KH9A 1DR9A 2DL2A 3EFDH 4GKZB 2X6UA 1HK6A 5BRZD 2X2UA 1KPUB 2WZPA 2DWDB 4NI3A 4Z0XB 1W72H 2R1WB 1YPZA 1CGTA 3BAYA 4I77L 3DK0A 2YLKA 4G43A 4YDJA 2ZXDA 1DJSA 4A67A 3TXAA 4HUUB 1ET8A 2BIMA 4L1SA 4OJCA 4ADGA 3IBOA 2VQTA 1H6TA 2G9HB 1NEZG 2SEBB 2AHIA 4L4TA 4N8UA 1E7VA 4OFDA 4F57H 2AEIT 4MGXA 4N2FA 5AZ2H 2EVFA 3T3MB 3TF4A 1AD0A 3N1GC 1NGQH 2OXGB 2KHAA 2UZYA 4HIQA 1QHOA 3SDDC 4P4KB 4DPCX 4LCUB 2HT4D 3QRLA 3RWHB 3DJZA 4FZEH 5JDSA 5EZJB 1KCBA 4K71B 4U1MA 1D2PA 2WC7A 1NBYB 2QHRL 1EUTA 5CS7A 3QB7C 3ILQD 4RA3A 1Z1WA 2AK4E 2ENPA 2QVKA 2QMKA 2ZCLL 3MAWA 2D7NA 1FG2A 1DLHA 4M56A 1TQBB 4WTZG 1X9RA 3AACA 4UMGA 2C9XA 4WI3A 3T4YA 5J56B 1A2YA 4N6QA 4DPBX 3WFBH 1FNLA 3MFGB 1S7QB 2V3FA 3SDAA 3ZDYE 3TIDA 1TYRA 3JT2A 1U6AH 1XB6A 4JFYB 5ID1B 1X4ZA 5IQ9B 1IE4A 2BRRH 2GCYA 5DO2D 3BZ4B 4LSSH 4LFHG 5F0LB 4NQVA 5TE7H 3X11B 4HIJB 3I6SA 4XXWC 1QSVA 4XMLH 1IB5A 3VI4A 5E8DH 3ILQC 2WTPA 2HKHH 2FO4A 5E2TL 2XWBB 3V5HB 1GZPA 5CZKA 4HVBA 5IREA 4HWZB 5C09E 2EXSA 2XTLA 3AY4C 3GK8H 3GZOA 3RIFF 5T1KD 1OEZW 4JFPB 3PQYD 2VDRL 4JMXA 4H44C 4ZUSB 1HU8A 5DO2C 1CE1H 2DWYA 3KPPA 2Z35B 4FFVC 1IGCH 2OK0H 2PYFB 1YJDC 5FFLA 1U36A 5HI4C 3TYFB 1ZXKA 3DNKA 5L8LB 1N6VA 2J8HA 2P8LB 4JS7A 1FJ1B 2E47A 2UVEA 1XCQA 3SDCA 3NQIA 1J1XH 4X4ZA 3V6FB 3WG7B 1MCQA 3HUJF 4IU2A 5I8KL 2RGSA 4G5AA 1YQVL 5DI8A 5AW0B 4JFXA 3ZZQA 5IQMA 4ACPA 2EIEA 4HCRL 2NY7H 4DGIH 1A3LH 2LVCA 3KPOB 3OLEA 2B4CC 2PCPB 4DVBA 2JF1A 3MRFB 3HUJA 1KFAL 4F7EA 4H8VA 1ITCA 4RQQB 1GKOA 3G6AB 4HZLA 4WFGD 5HI4D 2PXYC 3LKPA 3F84A 5AWNL 2J1WA 1LMKA 2VMDA 1KN4H 3JWOC 2GEEA 5C0GA 4L05A 2YRPA 3PDGA 4QHUB 2DTSA 2BOBA 5DVOA 1OAXH 1OF0A 2EQDA 1MCPL 2Y7LA 4OZIE 3H53A 1VERA 2JNZA 2G75A 3AS3A 3LPGA 4KXZH 1EEQA 3KCWA 2JKWA 1G7PB 4RMUA 2B0SH 3US9A 5IHWA 3OMZA 3MJ7B 5DJ8B 1WISA 2XXFA 3GI8L 4JFED 1FFPB 2XETA 1JNHA 2EXYD 4KRPC 2AGJL 5HI3C 3QSKB 5FYJH 1HEJC 2NNXA 2H47C 5AKTA 1NGZA 1PD1A 2H1LM 1HINL 3D0LB 3GSXA 1MIML 3L2MA 5FUZL 4ZD3L 3VI4F 5IB5A 1QSED 3FB6A 1UXSB 2ZSWA 3V0HA 4JHAL 4J3OC 2AQ2A 1OARL 2FZ3A 3QFGA 2WAHA 5F7YC 3SDYL 4GAJH 1BZ8A 1RUAH 2UWEE 4OZGA 2YXVA 1BM3H 1X9UA 3B3IB 1UJTA 3LXUX 3FT9A 5C86A 3F01A 3CFJA 2WQXA 1AQMA 1CXHA 4MD5B 3GMPB 5DHVA 1GC1H 2C9RA 3L7FB 1X7QA 5I71B 5J13B 1ULVA 1E4KC 4DP6X 3EO1B 1FORL 2ADIA 3BAEL 3BH9A 3CSFA 3PV7A 3FTGB 4FMFA 4BZ2H 1KV7A 4WO4A 3W9EB 3MPCA 2P42B 3C8HA 4Y5XA 3NP4A 5H35B 4BFJA 4EN3A 3VMPA 4NERA 3S0PA 4DQOH 4POZC 3O9WC 4IRSD 4XPHL 4BKLA 5K9QG 5FB8A 1RJYB 2A0LC 5GRVK 5E2WL 3AFLA 4P49A 4KQ3H 4J3OG 4F33B 1OZTG 4G8FA 4HA1A 3TTYA 2OQJB 3HTLX 3Q1EA 4CMHB 1P4BH 4PV1C 1ZVYA 3N0AA 2Q86B 1YEGH 4YEEA 4QRBA 3PWNB 5DZ9A 4AK1A 3ZKXB 1D6VH 2APFA 1U8KA 1UVQB 4RMTA 1PLGH 2KPNA 3FUHA 4JFDA 2VLMD 1YRKA 3UGUA 4NN5C 3SYCA 3F2LA 1DTUA 2A0LD 4HS3A 3EH3B 5T1DH 5TE7L 4PW4A 4XH2B 3GEWB 3QK0A 3SKUD 1G7HA 1MH5A 1G84A 1OE1A 1RVFL 2Z4QB 2M8XA 2HCZX 5C6PB 3M8OL 2BNQE 3HLAA 4YLBA 3UOAB 2HAZA 3V0FA 1FF5A 4XAWL 1QW9A 4Y16A 2W8CA 3IDNB 1DE4A 4K9JA 4WWNA 3BEVA 4MA1C 3CIQA 3RIAF 3KLAB 2AJ3B 1UURA 3UPRA 3GZKA 3KMDA 2C8NA 2N7AA 2JB6B 1NOLA 1XGPA 1QNZH 1EMTL 2P5WE 2APBA 1IAKA 3EGDB 2ETWA 3P9LA 1AGFB 1FV1A 3NGBB 4EVNB 3BMWA 3VXNA 3HN3A 3BZFB 1D9KD 5LJYH 1UTDA 3AT8A 4TUOB 1F1DA 3OPZH 1J0HA 5D4JA 5FOBB 2UZXA 3EH2A 4ZDHA 2YAFA 1UOVA 3DX3A 1O0VA 2HN7A 1D9KB 3AT9A 3Q2LA 1A14H 1MRDH 5FCUL 1EDHA 1TZGH 1X5IA 5AYQA 3ZE0B 2ZICA 3V4PA 5TE4H 1CXKA 1Z3RA 2OULB 2CCVA 2KZKA 1UASA 3F83A 2GT9A 5D7EA 5BO0D 4KUZL 4I3GA 2JFCA 3I6GA 1ZY9A 3HIZA 2PP7A 5DLML 1QFPA 1B88A 2AZAA 3HI5H 4KJPC 3HW7A 2B20A 4FFYH 5EBLB 2AI0L 1MWAB 5EEWA 1JGDA 1NC4B 3O41B 2J20A 3NEEA 1J9SA 1UD2A 2ORBL 5HGAB 1QTSA 4JG0L 1T1WB 1U8HB 2AQRA 3P54A 1G5AA 7FABL 5I1HH 1NINA 1Q8MA 1WA1X 1NIFA 4V1DD 4CN1A 1SGKA 1PTZA 1TMCB 4XI5C 1A5FH 4AV0A 4DW2L 4N8PA 5L6YL 4PM1A 1IGJA 4RWYH 1KIQA 5JHDD 3J07A 2K7QA 5I1GL 2A6KA 4IRZL 2BP5M 1MWOA 1H9VA 1NQBA 2ZUYA 2X4UB 5E94A 4B3EA 4MZ2A 2H6UA 3H9SD 4PP2A 1UACL 2EYRA 1OHQA 2WP3O 3W11C 3CSYB 1MCCA 3CIAA 1DBKH 4GPVA 3S98A 1M7IB 3OJDA 1I1RA 1UGNA 4YK4B 5MERA 3KCPA 1NPUA 3EJQA 5EN3A 4QXTA 3W39A 1CL7I 1RP9A 3R1GL 3SE4A 5FO9B 5ICZA 2TRYA 3KR3H 4X99B 1JYNA 1JPSL 2CIKB 3GK8L 4MDJA 4EZLA 3VJ6A 4G71B 1AXIB 4C4KO 3NCFB 4R7XA 2VXQL 2DQIH 5BUGA 4FTVA 2OMUB 4M1CD 4MA7L 2GK0B 3SGKC 5I0ZA 3X11A 3FTXA 3FZUD 1VZHA 4MMXB 2WVVB 1ZA6B 4OFQA 3WKNA 5JDSB 4FQQB 4W9LC 1T80A 2XRAH 5JPNB 4NDMB 2GFBB 1EWHA 1EO7A 4U1JB 5I0DA 5IFJA 3WKML 3OXRA 2FQFA 1QO3A 2KQNA 4OCSL 3VG9C 4DKFH 2R0LH 3L54A 2YSSB 1RCYA 2G3MA 4AJWA 2OK0L 3HUJB 4F7EB 4Y88A 3EYVB 1N0LA 5E2UL 3H4FA 1HNGA 2G5UA 2GBAA 2P8MB 3CN0A 1AMYA 3LCYA 3QG7H 3V6BR 5FIEA 1NBQA 4Y5XC 3D2UB 1HWGB 5T3XD 3BZ4A 4TMPA 3VRLF 2F19L 3V9CA 1JWSB 1XSJA 1XFPA 2XA8L 4M4RA 3EOBA 2IG2L 4JM0A 8FABB 2CHZA 3MBEC 2IAMA 4KQ0A 4F7CB 3WNMA 4FLSA 5D7IB 5J6SA 1QI4A 1CD1A 2A3TA 3ENEA 4X0NA 4NSKB 5HYSA 2Z7ZA 3CC5A 4WUKL 1FNSL 3TX4A 2EO9A 4M7ZB 5F9JA 5K33A 2RCSH 2TAAA 3KVDD 1BD2A 2ED7A 3BVTA 3LKRA 3QAQA 3LKPB 4NO0D 4AE1A 2C3GA 1QBLH 5F9OL 1RMFL 3NH7H 1JGVL 1XSOA 4G7YL 1BVOA 3KPSA 2ZONA 4KQ3L 3MBED 4AW7A 4KRNA 2ATAA 4NP4H 4XCYB 1H8OA 3ZRCC 4FQXB 2VWEC 3HZKB 1LO2L 4QXUL 3BCDA 4JFXB 4OGZA 2XG5B 1BQRA 1UM5H 5HYEA 5IBLD 3GLEA 1B3JA 3PAZA 3O2DL 2IAMC 4RISL 1L5GA 1QEWB 4UYPA 4JO3L 5GS1A 5E8NA 3D12B 3TNMA 4ZZKA 1GC1L 1D3CA 2VXSH 2WOYA 2ADIB 2C1PB 3G6AA 5AOIA 2PTUA 2UXGA 4N0UB 4LNVA 3B7UX 3QRGL 1A6TB 4PS7A 3W9DA 3DJ9A 1I1CA 2G60H 4WSJA 4PGBB 2ORBH 2EIDA 4HXAH 4YHYB 4YK4C 2ZUXA 4O9HH 15C8H 1JUFA 1MFCH 2IAMD 5CSGA 1I8LA 4WHYH 1KDJA 2NUTA 1K8IB 3RWGB 3J2PA 1MY5A 3VQMA 1IMHC 1IAIM 2DKMA 3MGTB 4ODHL 5LHDA 4OGYL 3DHUA 3W9EA 1WGVA 3DIDA 2XV0A 2YR3A 4YHLL 3UTTA 1CFSA 4B95C 4RMQA 5IMLA 1VFMA 4HCFA 1JDDA 1AGBB 1AP2A 2A9NL 3GXNA 1NGXA 4RX4A 5JR1L 5AYUH 4Q9RL 1VFOA 4GT0A 3KPRA 1WAAA 3MLXL 5DVPA 2ROYA 1HS6A 4KROB 2QSQA 1UYWH 3RBSA 2OI9B 1OPGH 4ZW5A 2O26U 5KSVB 1NGYA 2V37A 4XMPL 1B4JH 4WGWB 1RZGA 4NZJA 4Q7DA 1CFNA 3JWDL 4PJXF 2JJSA 4HEME 1E9QB 1L6PA 5ICYA 2E0PA 4OKDA 1JPGA 1N3NA 4EAEA 3CXHJ 5HVWA 5ENWB 1FVEA 5I1JL 3QFJE 1WG3A 4I4WA 5GRJL 2O61B 2HVKA 4JRXE 3LIZH 4NQEE 1L3NA 3OZ9H 4XNYH 1DJXA 1HZHH 5IEKB 3JBG7 4ZZFA 4QXGH 3GKWH 5C0FA 3L5IA 2D0GA 2EEBA 3R06B 4JFFE 4PJBB 2X1PA 1UWGH 3CDGB 5ABDE 4MX7B 1MEXL 1L7TL 2ID5A 1G4MA 1EJ6A 4V1DE 2DM7A 5FYKH 3O6FC 3UPRB 1Z3GH 3S8WA 5EBMB 1YZZA 1J8SA 2XN1A 2BCKA 5DRXB 3OKNA 4PRDA 4PLJD 4AYEC 4BFRA 2GSIA 2DWSA 3ZGIA 4CU7A 1OK8A 1AGDA 1OQXA 1ES0B 1P84K 5DMKB 4N6RB 5CILL 3TEUA 3QCVL 4X80H 2PWEA 1Y7VA 2X88A 2I9LB 2FLRT 3Q05A 1PJ9A 2IH9A 1F90H 2VABB 2IBBA 2WBKA 3GDCA 1KTLA 1T66D 2VO8A 2J5LC 5EO0B 4AY0A 2ED6A 3BT2H 2IBZX 1QRNE 4YGAB 2Y25A 5JW3L 3MOAL 3QJHB 1A6ZB 4TVPL 2Q8AH 1LO4L 2F53B 1E8YA 3IDUA 5FYLL 3WYRA 4LCIH 5BVPL 3TZVB 5F7EL 3BMVA 5EU3A 1FSKB 2BX5A 3PGFH 2P52A 2MTPA 5D72L 5IVOA 5BV7L 1THCA 2NY5H 5DLMH 3QFJB 3GSNA 1QBLL 5IIEB 4F24A 2IPKB 3BZFA 2E56A 2O30A 3M88A 3EGXA 1KZQA 4UOQA 3LKOB 2WN3A 2JKJA 1C08A 3UC0L 1F11A 1JCKA 3RY5A 2ZKYA 4URTB 5IQNA 3LN9A 4XZUA 5D1XD 1SMAA 2XJKA 3N1MC 3O45B 4DGYH 4KVNL 1IC1A 1QATA 2JQAA 3L4UA 4XOAA 3TWCH 43CAB 5C07A 4XP5L 4EJ1C 1P4BL 4I18B 3V4PB 1X6LA 2WBJB 1QI3A 3DURB 1A1NB 3U7WL 4LSTL 2FD6H 1PZUB 3CAFA 2QQNL 3QG7L 4P23B 4V33A 4HMDA 3TBVA 1UA3A 3RIKA 1BVLB 1F41A 1LP9E 4QOKE 1ZS8A 1M71B 5TDPA 5HGBB 4WWKC 3BAJA 4GO6B 1TG8A 4PJ9C 4ZUUB 2YD8A 4BK4A 4NZTH 5AD0A 5KSAD 3WEXA 4ZX6A 2XIBA 1J1OL 3LEYL 4QXTB 3W39B 2WOBA 1NCAH 4ZFQA 1JRHL 1ROWA 4NDMA 5IVZB 2GFBA 3ABGA 4OLYH 3UTZB 3AW5A 1RVFH 4UNIA 2R1XA 4Q8BA 2XWTA 3QQDB 4Q4EA 3UG3A 3MRQA 1KTKE 4O5LL 2FH8A 3Q6FA 4QR7A 1EDYA 1K4DA 5CJQL 1AKJA 3G5ZB 2GK0A 2UXFA 3WTXA 3CFEA 3FJTA 3QZWA 4M93B 2WO4A 3FB8A 3OKDA 4HUKB 2OV0A 3TO2B 2OMZB 4N2EA 4AYFB 4CUCA 5I74B 3DYOA 3GM8A 3QHFL 2O6PA 3L95B 4L8DA 2NNRA 3VSUA 1G7IB 2VDQB 4FFYA 2NR6D 2ADFH 3KM2A 4KJWC 2BINA 1XH3A 4BCZA 1PG7H 4NZUH 3CVHH 1ZLDA 5D1XE 5FCUH 2AEPH 1QLRA 4PRHA 1JV2A 2BSCA 3MO1B 1NL0L 4QRRD 3TPKA 1X5LA 1ADQH 1TQTA 1KZYA 4W9IC 2QKSA 3FQWA 3VFMA 5EIIG 1FAKT 5BXFA 1FO0H 2N56A 3O11B 3OR7B 4Y9GA 3AT0A 3I85A 3KW7A 3KEDA 3RWFB 5T3XL 3ZX1A 4KI5C 3KM1A 4NUGL 1SLXA 2FBRA 5I17A 2AK4B 1RUPH 5CWSA 4FNLH 4J8RB 1EFQA 4QAWA 4YDVB 4Z7UE 4PJHB 3VXQA 2IJ0C 2VUKA 4N90D 5KBDA 3HC0A 4W6WB 5E1IA 4G6AC 2NYYD 4A7UA 1X4YA 3EYOB 1XCXA 5D7IF 3T3ME 1DZBA 1MIEH 3B2UD 1UXMA 3Q01A 5AL8A 3MX0A 3OKMA 3E9UA 3ARFA 4ZFGH 5I1HL 3ARBD 5ESQB 3GSWB 3IJEA 3FBKA 3PIQB 5CEXB 1DJHA 3ARED 1LD9B 2L4OA 1BQHB 3KHQA 2PPAA 1MFDL 5AAMC 3E2HB 2UYLA 1X3DA 4KTDL 2R9HC 4YAQB 1XBRA 4HGWB 2G3XA 3ZR5A 1DLFH 3ARFD 5I1IH 1QEWA 2VZUA 2XPZA 3L1GA 4PJ8D 3G9VA 4LLWB 4TVPE 5L4IA 2I7SA 4R5XA 3MGTA 3Q06A 3DGGB 1IBFA 1P9MC 3MV7D 4O2FA 4YSCA 2NMSA 4KGLA 2XN9D 2CBMA 4WKZA 3D3VD 2H2PD 5BVJA 5A2CA 1UD5A 2BY3A 3FH8A 2I9TB 1IGYB 2DB8A 4HAFA 1A0QH 4G80B 1I4FA 1G1KA 1MJ8H 1TTCA 2I07B 1CYWA 3UCRA 3B2MA 2VZ3A 3PRZA 4YO0B 3LXCA 3AG4B 4PJHE 2CU9A 4K3EH 3GJFK 4NT6B 4NRZB 5T1MA 3WLBB 3AROA 1FNAA 4YH6A 3SDXF 4DN4H 1KIRB 3IDIB 1JN6B 4JQIH 5FGCE 2AF2A 4M6MH 1W6LA 3T04D 4J7RA 5JOPD 3ARQA 2CALA 4OVUA 3PV6A 3EO0A 4RWHA 2DTMH 5DJDA 1V7NL 4F93B 2I25N 3HJ0A 3KWWB 3DX9B 1UD3A 3JUYA 2YD4A 1LO4H 3KLKA 1IIIA 3L3IA 2DLIA 3QJOA 1EXGA 1HI6A 2WW8A 3TBSA 3MACH 4J1UB 1WRFA 2QELA 2D4DA 3CZEA 4X9HA 1S46A 2VN7A 3ORJA 5HHVH 3NA9H 4HU2A 1CD8A 2CDEB 2FYVA 1NFIA 4NN6C 2V0AA 4WJG3 4WVRA 3F12A 4MAZA 5AVSB 1GYWA 4BRVA 1QRNA 4AQAA 2ZAIA 1RZFL 3JUZA 2N7BA 4X5WA 1MEXH 4TSBH 3PPSA 1GJWA 1N3NB 2JKTM 2XV6B 4N2AA 4NKIL 2P8PB 3B7SA 1NAKH 3FO1A 4NGHL 4WZ9A 3TT1H 4Q74A 4EZMA 3FUMA 4LDLB 4X9FA 4ZW8A 5CN1A 5F88A 5AB9A 4HETA 4LLUA 3PG2A 3PAYA 4MB1A 1S7WB 2V3EA 1KELH 1PIFA 1U8LB 3BN9D 5DQDL 3TBWB 3E6FB 2QQLL 4D2NA 1T83C 3MJ9H 1DQQA 1RK7A 1F4WL 1MVUB 5ANHA 4UT6H 1Q1JH 4CDHA 5IF0A 3QR0A 2OJEA 4IU3B 4U1GC 5E6UB 5FM4A 4KK6C 2Y07H 1BBDL 2Y2WA 4PFEA 2HRLA 1GY2A 4K3HA 3ZE0F 1HKFA 1LYQA 2IH1B 3BZDA 3VXME 1O6TA 3GI9H 4L0ZA 1XR8A 2W60A 3FQXA 1T0NB 4FKKA 4NQTA 4IDLA 3ZK0A 2X6AA 4LSUL 2XIDA 5DMKA 3ZYJA 1KBPA 5LNDA 3NA4A 5JLZB 1Q9WB 4KRLB 2W07B 4F9LC 1Z9MA 4JM4L 4BUHA 4ODWB 3BDYH 4L8BA 1JPST 2EXYC 3D3VA 4KRPD 4PCSA 4F8NA 5BZDB 4JDZB 2E9WA 5IOPA 3GPSA 4F92B 4HJGB 1JZ7A 1KTLB 3UBGA 3C12A 4KK6D 3TOPA 4KNUA 3FFCE 4Z3EA 4GYBA 3L16A 4PJBA 4PY8J 3VXSE 3GSNH 2ZAHA 1GGBL 3IFNL 4OF3A 5I8EA 2OL3A 4UB0L 3QDHA 1HZHL 4IRJD 3KEHA 4EDXB 1IM9A 2QFPA 3FQNB 1DZ0A 3UL4A 5EBMA 2NNFA 3OF6D 4FJZA 1BG1A 4NFDA 1CURA 4LSTH 3RWEB 3VUAA 1MHHB 3CX5K 5F97E 2GQHA 2EDJA 3N42F 4J2XA 2VC2L 3DGCR 2WXIA 3W38A 4YHML 2HX7A 4HJ1A 5KYWB 5K93A 1OGAA 4PBXA 4ABUA 4WCYL 4YHPA 1JD7A 4WNSA 3OB0H 3AQXA 5D5ME 5SX5K 2Q6WA 4FA7B 4Y4KB 1Y18B 4ALAL 4B9YA 4ZW3A 1NUNB 1OP4A 1S7SA 4XODA 3FSZA 3NJJA 2ERJB 4Z8FH 2DOCA 4PMEA 1ZVNA 2CSPA 2ESVA 4ESKA 4NCC2 4XWOC 1GS8A 5IJBC 1H15B 4DKAA 1MCOL 4L9LB 2OSYA 1KXVA 1BQLH 1CDGA 3RVUC 1YQ2A 4OIIH 1H3PL 4LLAA 1MJ8L 2FVNA 2BS71 2Y22A 3MNZA 5JW3H 1TJHH 1WCQA 4HH8A 4YJZL 5AZ2L 5D7IE 3VFTA 4MAUL 1NCBL 1VJSA 4F8PA 3KS0J 1PG7W 4CKQA 4PCYA 5B39G 6FABH 3ARGD 2WWOA 4KY2A 2MPAL 1J8HE 4ILDA 3C2AH 4QPEA 3VTMA 4Y7MA 2DWTA 4I18A 4HJUA 4RFOH 4XWOD 1TEGA 2R4SL 1F4YH 1SRDA 4OD2A 1T22A 3HC3L 3AABA 4I1NB 4K3DH 1JFQL 4XVJL 4Q6YA 1FHGA 4JZOA 3T0ED 3CFDB 3CHSA 3C5ZD 4JFYA 2ZCZA 1ETJA 5HVGB 2IBZY 4OFPA 3TO4B 3MV8A 4P2QE 4G8EA 2KERA 4LVNC 1W0WB 2YUWA 4L8DB 1IVTA 2OMXB 3V8OA 5CM1A 2HX9A 2AQPA 3ARGC 4KKZA 1Z5LA 1TKWB 2D7OA 1E4XL 3HE7A 1RUMH 3UFIA 4PQXA 1T03H 5DR5L 2HZHA 4ZFZB 1KNOA 1H8LA 4B0MB 4NC0B 5F7EH 5F6HJ 4PJ9A 1T20A 4TVPH 5BZXA 5DJAB 4ZUSA 4HPOL 3S88L 3HMXA 1BQUA 3SKOA 2CA3A 2F54D 1Z0MA 2WWKO 1CICB 2HG5A 4R3SB 1VEOA 2PXYB 4PPTA 2D0FA 3OG6B 5CNHA 3SCMC 5AFAA 4J39A 4X4KA 1EXUB 1UJ3C 4NIKB 1SY6A 1B0WA 4PRAB 3ZIMA 4L29A 5IM7A 1ZT1A 4EEEA 3VFUB 3FN0H 4KJPD 5D7LE 2NY0D 5L0QC 2QJDA 3ULUL 3MLPA 1VGKB 4QRQB 5FYLD 5DA0B 1JGUH 1UXWA 2Z1KA 1YAIA 3G5XA 3FOLA 3GBNL 3QJRB 1AACA 1OAKH 5A3IC 3BGMB 3ARFB 1CL7H 5DK0A 3QDMB 1JZFA 4YIQB 2VGLM 2JXMA 3DGGA 1GVIA 1X9LA 5JO5A 1RFDH 3IDYC 4OIFA 2FIKA 1WBXB 3WGVB 4ZTPH 3IXTA 3V0IA 4A2FA 1ILUA 4A2GA 5HHQB 3BAEH 4EUPG 4KZDL 3O6LL 4OQTA 4EN3D 2VL4A 4WTWA 1OTSC 1QLEH 4R5VA 3HZMB 2MCPL 3US1A 4RGNC 5I19H 1XGYL 2HFEB 4R4BA 4PJ5E 4PSPA 2P7TA 4HWEL 1W16A 3MCKA 1ECYA 4Y9EA 5DJXB 4UDUA 3JTSA 5IMMA 4UIMB 3U4EB 4D0DA 2AJYH 3MJ7A 4Y5VB 3NCYS 1LEKA 1PAMA 1SY6L 4YSAA 3HE6A 2LLGA 3EDFA 4H1LG 5LO7A 1T5WB 3IMTA 5J4MA 3G7TA 2Y7QA 3QISA 2D4FA 4JFEB 3RTQC 2ATKA 4U3HA 3SY0A 5KN5A 1P7QB 4JFZL 4POUB 3B9KA 2AQQA 2XFGB 1OTSD 4B60A 4NRYB 4MJ6B 3T6XA 4GQ9H 5CMAB 2ZUUA 4A66A 4M93C 5FDYA 5EUOB 2YK1L 4JKPH 3SD2A 4L8SC 1EO8H 2N0MA 1BLIA 1MLBA 3LHPL 2FB4L 5DFAA 4W4OA 4NKMB 5EO1A 1LTXA 4KUZH 3HG5A 4W70A 1DVXA 1OTTC 3DVNA 1DQJB 3TBCA 2IWKA 4PY7B 3K1DA 1B0RB 4XRCB 5GGVL 2NW3B 2HTKD 3SGDH 1I8IA 4EQ2A 2QT6A 3FB5A 5TFSH 1QZNA 1AC6A 3ZDXE 4X7CC 5H35A 2WXKA 3FL7A 4MDRA 4EN3B 5AW5B 3MUGA 4LSVH 3HAEB 1I4FB 2XN9E 4KWUA 4U3SA 3IAGC 1KGWA 5T33H 5E0QA 5TDOA 4DGIL 4M8QA 1A4AA 3OAUL 4JG0H 4D7BA 2I69A 4HF5H 2CO6A 1LK3H 4LRNL 2JH2A 4EZKA 3BSGA 1CF8L 2B39A 3QEHA 3ETBF 4MQ7A 1KEGL 1FNGA 2Y7NA 4JFHD 4KPHL 1UVQA 4XBGB 2BZ7A 5BJTA 1AR2A 4A2LA 4XMWA 2E27L 2XICA 3DECA 4XNXH 3CZUB 2QQLH 2CM6A 2FO1A 2Z9TA 4LARH 5TE4L 3B1TA 2ZKXA 3B9AA 5FM5O 5LGJB 3L6FB 4TOYH 3QI9A 2AKRB 1E4XH 5HDLA 1N8OE 4PG2A 3MRRA 1YEGL 4NWUH 3UTQA 4GP4B 4MTMA 1O7VA 2MJWA 1RY7B 4PVBA 4OZIA 4K23H 4RMRA 5I8EB 2AERT 2V9TA 3D30A 3NPSB 2FJGB 1TQVA 3G6JA 4LMQE 4OM1L 3ROOA 3WFEL 1IAMA 1J8KA 4OGXH 2ZWKA 3BDYL 3MCG1 4QMEA 1HOCA 4MAUH 1CLOL 3EGDA 3OB8A 4RAUB 4X7FC 3FRUB 3B5GA 1QUNB 4GO8A 1PSKL 4JDZA 4WFED 1TJHL 5IOPB 4HJGA 1QVOB 5K1JA 3KLDA 2XKSA 4X7DC 4OF5A 3O3EA 3GBML 1YVLA 1FWXA 2DICA 5D7JA 2E59A 5DZLA 4LLDB 3MLYH 1QNIA 4ONHA 4HJSA 3I75B 2Q3ZA 4J3XA 2ITFA 3MRLA 3WXWL 1TMQA 1PAZA 3IS0X 4XPHH 4ZW6A 5AVYB 4RDQG 2H7WA 2WUCH 4DKFL 4JO2L 5ELIA 1I7UB 2W65B 1S78D 4WHTA 3PNWB 4HUVA 4KMTH 3ZL4H 4ALAC 1X5HA 3TH3T 2AC0A 3M86A 2OL3H 4JRXB 3H85A 1J0YA 4J3OH 4NQEB 5AUMB 1OHZA 5AAWA 1K6QL 2Z7UA 3HMXL 4NFBA 4GIAA 3MV9D 4FNTA 4P3DA 5F8RC 3D7PA 1X5XA 4MSWB 4WO4C 2XDHA 2DMGA 3QXDA 4FXGB 1MCIA 4B7LA 5D4IA 1BPLB 2DIAA 4XGZA 3CBRA 4M00A 5F7BA 4L4JA 1A1MA 3DHJA 4HU8A 1CU4H 2WNKA 4FFYL 5EUKB 5JIKA 3GHPA 2O6CA 1GGCH 3HMWH 3P4MB 5F2FA 3WDIA 4DPAX 3EFOB 2R8SL 2JB5H 1MRCL 4XC3H 3S35L 3V4PL 1CDHA 3ZHNA 4FNSA 2HT3C 3LS5H 2IALB 4CSPA 4XB7A 4DGUA 1W8EA 4OIIL 4HT1H 1BLNA 3AC0A 2AXFB 3DX4A 2VTFA 1V3JA 2OX5A 2KMWA 1KC5L 3DXAD 3R0MA 4TTDC 4NKOA 3UZQB 1JPFA 2EYRB 3VMNA 1ACXA 1K3ZA 5IV2A 4GMSL 5EU7E 3WU1A 1CI3M 5AW3B 3I50H 1TZOA 5EO9A 2XBZA 3TCLA 5IMKA 1AGCB 5FECB 5DUPH 4OY9A 2P43B 1UENA 3CU1A 5JPNC 2CDFB 3HHSA 3BLBA 4IQHA 5IB2B 2VKXA 4MMYB 4NM4H 3AAZA 5FUOH 1R0AH 3F00A 1JHLH 3QCUH 5DHYB 4X99A 1HYRC 3ZRSA 4MA8H 1OT1A 2TSAA 4Z0XA 2NW2B 1I3RB 4P46B 4AH2B 1JZ6A 1UA6L 2JKLA 1FG9C 1XDTT 3AXIA 4PREA 4TQEH 3GNML 3QUYC 4FJ6A 1Z9SA 4NQUA 1EUUA 4LSVL 5JXEA 3O3BB 4UBDC 4YQXH 5KOMC 3VQLA 2DQIL 4J6RH 3KBPA 1ZA6A 5IB4A 4DSYA 4PRPA 1QRKA 3C08L 4ELKB 4L3ED 1VPOH 4NUPA 2KUTA 1OZUA 3MZTA 5KZCD 3DV4B 2VLKE 3GXFA 1MW3A 1WZLA 3GSNL 2UWEA 1WTGT 1M2VA 4QRPB 2ARJB 1HEZB 4WI0A 3WJLC 2K7PA 1JZHA 2FX8L 1IGIL 3MRKA 1D5BB 3QQXA 5HHMD 2JJVA 4KJQC 2X1OA 3TL5A 4UBDD 3KLHD 2DYPB 2D3JA 2E7MA 1ACZA 4R4FH 5I6OA 3T8VA 1IC4H 3ML8A 4Y2NA 3NJVA 2J43A 3BC9A 4GS7C 1KLGB 5HVFB 2WYIA 1HXYB 4MXWL 3NIFB 4H2CA 5BZWB 4AXWB 4QRTB 4A68A 5GGRA 1A4JB 1F4XH 2VW7A 1MJJB 3D51A 2YA1A 4ATTA 1XF2B 5AALA 2ZYSA 1AQDA 1T6BX 3JV4A 3QUMB 5JHDB 1RJCA 5KJRL 1T3FB 4JHUA 4FYQA 2FIKB 3B8YA 2F54B 3EJTA 1HXMA 5CP3A 3D06A 4B96A 3JTTA 5D4QA 4ODUB 2JELL 4A2EA 1TXKA 2WLLB 3X3FH 4J3UA 4XAKD 3P77B 1SPDA 3TZVC 1CG9B 1LNUA 4K7PX 2C7UB 3GXMA 2Z35A 2CQVA 2AK1H 1EGJA 3ARTA 2QSCH 1CQKA 3D25B 2AEOA 4GW5A 5ESAB 4HJJL 1U3JA 3FCGA 3I3BA 4NFCA 4NO3B 1WF5A 3L13A 1KYDA 1LE9B 2WZAA 4JREB 4NNXB 5C0GB 4DCQB 5KVDH 3T71A 1P7QA 5B3NA 3NCJL 3B9KB 5TF1L 3FB5B 1MVFA 3NZUA 4B9JA 2V7HB 4Q2ZA 2VLLB 4G1EB 1ASOA 2FJHB 2OTWA 3TZVD 4X6FB 5FO8B 4XCCH 4XBEH 5L2KB 2CUMA 2Z8WC 2NY2D 3MLZH 2YBGA 4JFWA 2WVSA 3MCKB 2PNDA 2AJUH 1AR1D 4G70B 5DJXA 1MCLA 2QGEA 3OLGA 3U4EA 5I1JH 3HB3D 1XGZA 1ZV5A 4ZG1A 2ZOOA 4MQXC 1EDQA 3FT4A 2DBLH 2H1PH 1CDCA 1P2CA 3N42B 4K15A 2X44D 3HZVB 4WFHD 4Y2DB 5CF3A 3GT6A 4HWEH 1MCRA 2YWYA 4J3SA 4N20A 1QSEA 2XVLA 1QLEL 4QYOB 3LRMA 3FUDA 3QWRA 4N2OA 1S3KL 4PV9B 4HD9A 3OSKA 4KKLC 5E9DE 1G5GA 2WCSA 3ARVA 4FKEA 4XR8C 4BBWA 2R2HB 5D1XB 2RIKA 3BKCH 1HAUA 3TT3H 3WTWA 4OBSA 2B08A 3HB3C 4LVEA 4HGMA 1BQ5A 3MRRB 5I23A 4MQXD 4ZQKA 2ITCA 3L3GA 2UUDK 4HEPG 4HLEA 3VW3L 4CVXB 2FH6A 4ZMXA 1RIHH 3DHMA 1R1CA 4M3HA 4FQ2L 1INQB 2VT0A 1RPUA 5C0EB 3ZHFA 4U2ZA 1KPVA 2CD0A 3AY2A 2CR0A 2P9RA 3BQUD 3A4FA 2G30A 3JWDH 2FB4H 2HVKB 3OC8A 5E03A 4PRPE 4MVBD 3OB0K 2LV4A 1R6VA 4OM0H 1GW6A 3TYGH 4HH9A 4N1EA 1TJIH 4NO2B 3O3EB 3K6OA 4LCIL 1LMIA 4GW4A 1MQKL 4XMLL 4M8QB 3RX9A 4CVUA 3BVUA 3OHMB 2GJ6D 4KROD 5ISZA 5B4MC 5SV4A 5G55A 2X4SB 3QUZA 1U8JA 3S7GA 1QX1A 2WMPB 1CGYA 1NAMA 4OLYL 3S4SB 3SD5A 1RZPA 2KZWA 2MCPH 3AM8C 4OKVA 3IGUA 4PGEB 5GRWA 3WMSA 4O02A 4Q9CA 3GSOB 1KB5B 3DX7A 5TDNB 1DSWA 4AM0B 3OHXA 4UILL 2AJYL 4YHOH 4JHWL 4ODHH 4JO2H 5FEBA 3P2DA 4R90H 4S1SL 1NKOA 4JPIA 3SPGA 3KPRD 1UEYA 3IETB 5CLYA 4ONHB 4U6TA 4QTFA 2PF6A 3V2AR 2VDKH 1BA9A 1H0DB 2QKIA 3MRBB 4LKCA 4OGYH 3EADA 5C0BB 5JA8B 5AVXB 2Q7YA 2VDPH 4AZ8A 2W88A 2XQYK 1H3GA 5IJKC 1N12A 4WWPA 4PJDE 3R19A 5D2LA 3STZA 1OWRM 2JI2A 2WBJC 1RAMA 1DJWA 2R8SH 4JRXA 4NQEA 2AQTA 3C08H 5LQBH 1SUJA 4GKOA 4JZJC 3LTVA 4QF1A 4XPFH 3QIWD 3ZW3A 4ZMQA 2F6AA 5ICXB 2V6HA 3D39B 3UP6A 3UTSB 1YEDB 4M03A 1JDCA 2AV7B 4S0TD 4M7ZC 5KSAB 1CFQA 2A4CA 1LO3L 2J6EL 5CD3B 1BFSA 1S9KC 3PDOB 4XMPH 3LRSA 1A1MB 1BX2A 5F3HA 3KHOA 1NIAA 1KY6A 2VXVH 2F68X 3QEQA 4XC1H 3QS2A 2DWDA 4KI5F 2X3AA 2JTDA 1OSZA 3KLQA 3V6ZA 3TNNB 1KJ3L 4NJ9L 4C4UA 2R69L 3LZLA 1WAAE 2FATL 3QIWC 4ZOBA 2KYIA 2XZQL 1PLAA 4D9LH 3WL9A 1M9SA 3H7LA 5AKVA 4CA4A 4P8QA 4ZPVB 2JCWA 4BZ2A 3GD1C 4K5OA 3MMEA 2BNRA 4QKTA 4Y9CA 2YN5A 2DJSA 1RXLA 1SBSL 3L4WA 3NPZB 1V05A 2YMXH 4XX1E 4ONFH 4ZXBD 4KK9C 3TCLB 5JTWA 4JQXA 5TTRA 3A24A 3FO2A 2BOCA 2EIKB 2BO0A 2VSMB 3GXIA 5CFHA 5AKSA 5EOCL 4ZPTA 3ZLQC 4JUTA 2FEDD 3RWJB 4S1DC 1PY0A 4NIYE 1J0KA 4XPBL 4L0YA 2HKHL 1MWAA 3RZCA 5LXGH 4HS6A 2IV8A 5I82A 2MNJB 4ZXBC 4APQD 4HK0A 1R5VB 2JCCA 1OAXL 2HJFA 4WGVB 5IK3B 4D0BB 3ZGHA 5T3ZD 4ELKA 2NXZD 3MRHA 1RZKL 3MCLH 4OI8A 3ARYA 1NCDH 2CG9X 2P3YA 2QDWA 2ZG3A 3NSXA 1MWAH 3MRNB 4N9GA 5KG9A 1CN4A 2XSKA 1D5ZB 4JQIL 3BKJL 3ZUCA 2PWGA 1O75A 4WFEE 3NZSA 5E1GA 3P3UA 1J9CT 3L9RB 2YQ3A 1OTUC 3FW6A 1OD7A 1SYVB 3FULA 3QULA 1NC2B 4WI9A 1T21B 3INUL 4G8GD 3WNJA 5L0QB 1WP6A 3CVIL 2XBDA 4G6JH 4HK3N 5E08H 1U92B 1Q9KB 2QTEA 2JKSA 1SFDA 5KSUA 4F1SA 2NXZC 3L7EB 3O3BA 1WEJL 3IJYA 4AENA 4PRHD 2Z31C 4JR9H 5J1AB 2IXQB 4KKRA 4OZFA 5IHZA 3T1FB 5HYFA 3CDZA 5GZNA 5BZWA 2WIMA 2YLHA 2XNAA 3BPLC 2NNAB 2AEWA 4ZSOB 3L1OL 3P69A 3P77A 3RDTA 2ODHA 2EDDA 3MJ8A 4KAQL 1LDPH 5A7EA 2E6PA 3D39E 3CLWA 3IB4A 1FJ1A 1G0DA 1FL3B 1HHHA 1UKSA 3QUZD 5INDA 3H9SB 1BAWA 1EHLH 1XCWA 2X28A 2CRYA 1ED3A 1KFGA 4LCWD 4NNXA 5C8JA 3CFMA 2IPTL 1QZ1A 4JFVA 5HYJB 1R3IL 5EIIB 5TPWH 5I1CL 3IE9A 3U25A 2NT1A 1SQ2N 2BSSA 3GC3A 4FA6A 2DKSA 1HCYA 4FG6D 4GKSA 4P5MB 1R3KA 3T08A 4QRSA 4GY4A 4PJCE 2Q87A 1CVSC 4OIBA 1I85A 1IO4C 1KACB 5CZVH 5SWQB 4FHKA 3QUZC 2VAAB 2BNRE 4LCWA 1JMZA 2AMUA 4ZTEA 1MFAH 3FONB 3I9GL 3FCTA 2QHRH 5TH2B 4LRIA 1IGCL 3MRPB 1AI1H 4YFLF 5BVJB 5DJ8A 3TYGL 5D6DA 2I9TA 2EYSB 1FFPA 1K2DA 4N0FB 4DF9A 2QZQA 1A9VA 3CC5B 4I13B 4NWTL 4BH8B 4PHZA 1Z9NA 3IFNH 3NABL 4JCWA 2Q20A 5IESL 4DEWA 5KW9H 3DROA 5DJZB 3Q48A 4M7KL 3V6OA 2ERJC 1GYVA 5C0DA 5DJ2B 2HMIC 3O0RH 2XQBH 1AY1H 5CFAA 2CWRA 1DVQA 1BVKA 1E8WA 3LPWA 4LPVA 2ZF8A 1ORSB 1ZEAH 1JXJA 3LEVL 1IEAA 2OS7A 3F7VA 5GIRA 2DL9A 5CJXC 4A1RA 2CK0L 4L3CA 5C0EA 1FL6B 1M05A 4N8CL 2AK1L 4K9EH 1EANA 2VDPL 4V2CB 3L2LA 4HCRA 1JS4A 4IK7A 3GI9L 5IR1A 3VD4A 2O4EA 1AMXA 4NO0A 4Q56A 5CJQH 3TVMA 2PUQT 2VSCA 4XHJC 1RZJH 1E67A 4KFZC 4PJDF 4HIPA 2X1QA 4WNJA 3WIHL 3D05A 1ZHLA 4CMHC 1ZDQA 1NZRA 3EIFA 5G4MA 1SXNA 2FUQA 2X6VA 3U2SB 4PJAA 5IHLB 2WMPA 4PW3A 5AG9A 4Q97A 1HEHC 4P3CL 3ECQA 3VG9B 5B7FA 2ZCHL 4RSYA 1G9NL 2NZ9D 5F88B 3UBXI 4MA3A 4LP8A 5CJXA 2Z7WA 3KWUA 4AE0A 1FFTB 3ZE1B 4ZOEA 4HH9B 4Z0BL 4NJ9H 1BMZA 3GUTB 3S37L 4ZO7A 2FL5B 1MQKH 2ITDB 1MVUA 3ZTDC 1DQIA 4ORGA 2BSDA 3GF8A 3B3BA 1KV3A 2YIHA 2OZ4H 2H26A 5C0NC 4KKPA 4HFUL 2ITCB 1XB3A 4CGTA 1QABA 4PV8A 1GS7A 4ICXA 2FGZA 3HLAB 4OU3A 4RGND 1BXXA 2NZ9C 2X5PA 1N8ZB 3BOVA 3S5ZA 4TL5A 1J9TA 1NANH 2NSQA 1C12A 3O4LB 2FTAA 1R47A 3H55A 3AGWA 3QG6B 4YDKL 5AOMA 3WEBA 4F2MA 5CSBA 4JY5H 3S5YA 2WVTA 2J73A 4MQTB 3KYNB 5E7FA 5FO7B 1NDMB 3W56A 2ZX7A 4EVNA 4P57A 1MCEA 3VSTA 1AZVA 1ASPA 1HSAA 4OT1H 1OSEA 5BPPA 1JZIA 4NZRL 1CXLA 5EOCJ 4DHLA 2DQCH 3GMNB 2X4TB 1OARH 1C8PA 4TVUA 4H13C 3FT0A 5BO1L 4NCC1 3WMPA 5KZCB 2HYMA 2B8OT 4JDTH 3NCWA 3RL2B 1S7UB 5JMRA 2YD7A 5FYKU 3ZU8A 3LRHA 3GHEL 4Z7QE 4XMXA 3D07A 4IJTA 4UM8A 1J88A 4GI6A 3MRGA 3OD3A 3RNKB 4RVBA 4JB9H 4H8QA 5CEZE 2GJZA 2AVGA 1B0IA 2YEQA 2Z3FA 2OMWA 4I9WD 1IC7H 2FWOB 2HP4A 5ALCH 4H25A 1HHJB 1ZGLM 1E30A 3NFSH 5BMFL 4PJFF 1ZT7A 5DQ9A 3V5DB 5F7LB 4F7KA 3IF1B 5K59F 5B8CC 1P9MA 1O7DE 4BE6A 5INCB 4F8OA 5LDSA 1G7LA 1KPUA 3QJQB 2BZDA 5A16B 5F7WC 2Y1AA 4I3RH 2HPOA 4LHUB 4Y5YC 4OZFH 1D7DA 5DO8A 2MCG1 5DC4B 1A14L 4BV1A 2COQA 1U42A 2WKGA 2HX8A 4L5FH 4QRAA 5KAQG 3RGVA 3EJRA 3IDJB 3QQ4A 2Q0ZX 4ZI8A 1MHPH 1BM3L 4X7TB 5HGHB 2YARA 4KC3B 4ANKA 1EFXB 3ESPA 5HI5D 1CS6A 2LU5A 5HHOB 4FTVD 5AW8B 1UM6L 4MD0B 4N1HB 3CZKA 5C92A 2IH3B 2FJFB 2XPYA 1ONQA 2VDMH 3I2CL 4YSUA 1I1AA 2X42A 4QHLA 1UKTA 4J3BA 3FU7B 4QTIL 1N64H 2AFNA 2XWCA 4NKIH 3GMLA 2OA9A 1MLCB 4Z7OE 4DGVL 2G9HA 2EDNA 1X5ZA 4JM2A 3TBVB 5TK2A 3IRPX 2WVVA 2Q76B 5HDBB 2JKRM 3RA7L 1MI5A 5C0JB 5IVXB 3UO1L 4DJMA 2CNYA 2D31A 2BIIA 4XMVA 1WBZB 3D1MC 1BBJA 1ITBB 1OVZA 3K5RA 4O2CA 4OUUA 5T5FH 1XH0A 4JEGB 1AS7A 3EG9B 5HDBF 5BRZE 1OKEA 2R2CA 1A6UL 5DU7A 3X2QB 1NBYA 2DM3A 3L4XA 3QRGH 3VG0L 1PYWA 5EOCH 3GMRA 2CO1A 4F58L 4JY4B 1PLBA 1CGSL 1QW8A 4OD3L 4OH2A 3N91A 5KSBF 2WQWA 1UT9A 2WVUA 3ZT7A 1C5BL 3MV11 4R7DB 3NTCH 4EMZA 2Y1VA 4JHVA 1T4KA 3Q13A 3HRZC 4FQLL 3W0WB 5LBSL 3WD5L 1P53A 4MS8C 3NIDE 5FYKD 1WFIA 3ZKMD 5E23A 3IGAB 3HZYA 2H32H 1K8DB 2J56A 4NZDA 4PB9H 4UQCA 1ZTXE 2FATH 2ZP9A 3APCA 2P1YA 3MR9B 4WENB 2YMTA 2ADGA 2GJ6B 3D4GA 2CCLA 3MCLL 1AXTH 3QHZH 5C8JB 1JK8B 5JORA 1UOLA 1WZKA 3C2SA 3BJLA 3H3PL 3NIDB 4LPWA 5DQJA 2BSTA 1NOAA 2EYSA 4X7EC 1EAOA 1AIFA 5DSCA 1BD2B 2AJVH 4XWGL 1BPVA 1WD8A 3DTDA 3HS0B 3R7QA 4TTDD 1WC7A 4BDVA 3HZMA 1C5DB 1BOGA 4XCNA 5GRUH 3RP1A 2VMEA 2HFEA 3WSQL 4BELD 4AEEA 5BXFB 1JI2A 5E70A 3TJHC 3WIAA 3IRCA 2OXHB 2VDLB 4XN1A 1IM9D 5FHBH 1KGXA 4LLYB 2DI7A 2F5AH 2BMKA 2JIXD 4G9FB 4HUMB 2WTRA 3RB5A 4F37K 5AG8A 1F4HA 3VXUB 3E6HA 4PWGA 1G9MH 3U6XS 4EI5D 2DKUA 3UYPB 2ZXWB 4Z95H 1NH6A 1TNMA 2VYRE 4YPGA 3SGEI 3H2PA 2NY5L 2RQ8A 3GTTA 3IBEA 2F15A 5E8PA 1SYSB 5JNYB 2MCMA 1MCOH 5FYJU 4G9FD 1SEQH 4LRNH 1E4XI 1MELA 4N1CA 1IJNA 2C1PA 3UAJA 1CICC 1D5XA 4ZNCD 2YHGA 3QEGL 2YPVH 3MRFA 2E7LA 4PR5B 3T0XA 5B1KA 5CSZB 2WLZA 2EDQA 5D2NB 2YGOA 3CSTA 4OLUL 2R39A 5CN2A 1Y6KR 3U9PL 3F62A 1KIPB 4LL9A 4FHBD 1NKRA 3QI9C 4AG4H 1FZJB 1UB6A 2HPTA 3SYPA 1FL6A 3ZTEA 4F91B 1U8MB 4FP8L 5TH2A 3U0WL 2VZOA 3VXRD 1X5AA 4KZEL 1W6WA 4LVHB 2EAEA 5C0CD 5LB1A 3H9ZA 4PY8I 3RUGB 3C60C 4K5PA 4DERA 3IFPA 2VLJA 2R23A 1GMEA 4AYID 1CR9L 3H2WA 3UTTB 1QA9B 3EAKA 3SDAC 4KO5A 1KCVL 1UZ6E 2DLTA 5F1SA 3GSRB 1QHQA 3WLWD 4TSCL 4Y5XB 1BZ9B 3HE6D 4FJYA 3QR1A 4Z7WA 4XN9A 3T2QA 3HMWL 1F3JB 1JF1B 1NC4D 2HKAA 4ZFOB 4G7VH 5KYXB 1HWHB 1XGQA 3BO8B 1DVFD 2C5DC 1E6OH 4HXAL 4DKDC 1N8ZA 1UKQA 4Z3TA 3BT0A 5MEPA 4M5ZH 3DX2A 4Q6KA 1X5MA 1LWJA 3N1PC 1SHMA 4YXKL 3HE7C 1BF8A 25C8L 3BHBA 3QJXA 1GA2A 3QDGA 4OF6A 4DGYL 3G04A 4NQSB 4ORGB 5LGJA 3OLIA 1RLBA 4K8RH 4YSPA 4NM4L 1C1EH 5FUOL 3WLWC 1RPQA 5TGBB 4YDIH 1L0YA 3SJVE 3V0EA 4RRPM 1I7TA 2DLGA 1TVBB 3PHOB 5AVRB 1LK2B 4Y4HD 2QGDA 4V1DA 3D85D 1RIUH 5IFAL 4RGOH 3K4ZA 1FGVL 1WHPA 2R56H 2FSEA 4R83A 5TE6H 4QHMA 4Y4KC 2IGTA 5DTFB 3RL2A 3FRUA 1KMGA 3F6IA 1I1YA 4MJIB 4R7NA 1YC7A 2G5RA 2H3NA 3L3KB 3PWPB 4MMZA 3VI4E 4MNQD 4A7QA 1MNUL 4L1BA 2OTUA 4AUYA 2MHAA 5HHOD 1AE6L 1WWBX 2IGLA 2CUHA 2WLMA 2Y36H 5IJDC 4Y4HC 4FQIL 1K5WA 1VRSA 5GJSH 3P9LB 2JKNA 2YPLE 2I9LA 1IILE 4IK6A 5B3JE 2YEZA 4R2GC 2G0KA 5INCA 3DARA 3LH2H 1DYZA 1PSKH 1TU2A 2FT7A 2I60L 5E9NA 3JSSA 3F8UB 4HKJA 5FYJD 4ERSL 3ZDZE 1JE6A 4FZ8H 1G7JA 1RHHA 2KH2B 3O9WB 2EDKA 3M6DA 4RGNE 1ETZB 2DQUH 4FQPA 3EBHA 1L7TH 1NJ9B 4P0DA 1IZKA 1YYMH 4P4KD 1IAIH 1LO5B 3MRIA 4CN4A 3K71A 1QMUA 5I73C 2FGWH 3ZYIA 4ZQTA 1CFTB 1LILA 5F1IB 1HHIB 3H3KA 3VXTB 1AGFA 2H2SD 3QQ4B 4H5SB 3ULVC 2HVJA 3RWHA 3D09A 1NC4A 1MFUA 2IALA 4L3FA 4HPYH 5HGAA 3BQUB 1U58B 4YBLC 5JXAH 1MHPL 4WEUD 2WZPD 4KTGA 3U82B 5DD0H 1F00I 3UZQA 1TJXA 3ECUA 5LNGA 1Z32X 5DZVA 3IDMB 3NIDF 2NXYB 5T3XH 4NQDD 1U4EA 2OMYA 4L4TB 3QQNA 2FWOA 1BVLA 2NY6D 1ZS8B 5HGBA 5IOKA 5MP6L 3IF1A 1MAKA 2VXUH 4NQVB 2OXGA 4LHJB 3ZTNH 4Z7WF 4APXA 3ILPA 4XNQB 3LB6D 1CLYH 4GSDH 3BZEA 5CGMA 4YMPA 5AB2A 4LNRB 4TUJA 2FE0A 1BDYA 4C56B 1JGDB 3OJDB 5EBWA 3RL1A 3V4VH 1K9TA 4F7PA 3DUSB 3P3SA 1Z6JT 5CCGE 7PCYA 1J8HB 2IMNA 1BZDA 1Y18A 4FABH 4FDWA 1QWNA 4L1DA 1XIWC 3GJEA 5IB4B 1GH7A 4NC1C 5JYMA 1YEFL 3CN3A 1IKNA 4PGCA 1JHLL 3QCUL 1KWKA 3CFEB 2ZXBA 1CXIA 2ZCKH 1AOZA 2PYEE 5FA4B 5AAPA 4XN8A 2XYBA 4XPGL 2WUBH 4Y1TA 3PUCA 5HJ3A 1KUMA 1OGPA 1J0IA 4MMXA 3A22A 5BO1H 2NNCA 3NCCB 5DC9B 2XWDA 3TCXA 5DI8B 3A0OA 4AQ1C 2K6ZA 5I76B 1L0QA 4Z7NE 2JE8A 2ADGB 2GJ6A 3SE8L 3V0WL 3VFOA 3VRIA 5ISZD 3ZIYA 3LEYH 4XVSH 2GEQA 1BQHG 3C5ZA 4NNYA 4F3FA 4Z6AT 5HYQA 2HRGA 1JDAA 1I1FB 3WEMA 5ICZB 3CQQA 3T0AA 1DVZA 4U2YA 4ZX5A 2CXKA 1MCKA 3MJ9L 4FG4A 3T2LA 3GS4A 1Q94B 4LQFH 4RFEB 4KOCA 5EWIL 3EYVA 2B0SL 5HYJE 4RX4D 4LGSB 1QSFA 3KPQB 2F7OA 3RUGE 1UWGL 3ZOAA 5EC2A 5JPMC 5DHMC 3WSQH 3UTSE 4LAQH 1QFWL 1NUDA 2AMGA 5EC1A 1JWSA 3VD5A 3GINA 4A6YB 3T0EB 2VQ1B 3IKCA 2F5AL 1AZZC 4GAYB 4LSUH 4ZX3A 1U2YA 1T1XA 4O00A 1PZ2A 2F54A 4JM2C 5CGTA 1HIML 3OZKA 5IHUL 1PVHA 3EHBB 3QQ9C 3BKML 5DWPA 2ADJA 3PUUA 5DRNB 3NUKA 4JRXD 4NQDA 3GYRA 4NQED 3TBYB 3ME0B 3MNWA 1HKLL 3ULVF 2DQHH 4PWJA 2GTZA 4K2UL 3D4CA 3BGFB 1ZLSL 3ZSTA 4F2FA 1N0LB 3ULSB 5HPMA 2P8MA 3WFBL 4UAOC 5JHLA 3ML9A 3ZQ9A 2FEDC 3B3IA 5IQ7L 3UYPA 2WXJA 4Z7NB 1EFXD 2F2HA 3IU3A 1S9XB 2R2BA 4JM2D 2Y6SC 4ECNA 1WBYB 4FXKC 3QQ9D 2K1MA 3CFBA 4OCRH 1RZ8B 2BC4B 2XTJC 4G1MB 4X6CE 1WITA 2DEWX 4F7CA 1RIHL 1U8PA 4UNVA 3G5XB 3FTGA 5ES4B 2WBXA 2Y7OA 3BGMA 4FI6A 1NGZB 4JAMB 4MCZB 3M7FB 3SJVD 3VA6A 4F1ZA 5B38A 4U1KA 5D93C 4RMSA 5ADOL 3MACL 1RJYA 2XXMB 3CHPA 5FWQA 3FNKA 1S7RB 5PAZA 3P2TA 4NPKA 5HYJD 5I30H 4G8FB 1W9XA 3E6HB 3S5LG 3O3DB 1KCSH 1OLLA 1OW0C 5C0CB 2WLIA 4HKXA 5E6IA 3POCA 5DD0L 1I8MA 1F6AA 2H5UA 3LV3B 3WTSA 3IMVA 3ARGB 3P0VL 4ZNEA 2VH5H 3JWDC 3UYOD 2K8QA 4L3EA 4JRYA 3APFA 4X8JA 4Z23A 2AJUL 4Q6IC 1ZE3C 4GBXD 1KJVA 2Y2TA 2WY3B 3TNMB 3WGUB 4AYGA 4MAYA 3MOBH 4OFYD 4S1SH 1G7HB 1MH5B 5KN5B 2MQ3A 1BIIB 5KYXA 1GOHA 2EEDA 2QR0A 3AQYA 4OIAA 3NRQA 2XQYA 1YMMA 3H8NA 3WIIH 4P2RB 5BRZB 1E4KA 1UT2A 4CADA 1E2ZA 2ZD0A 3QUXC 4WFGE 4FMKA 1MG2C 2VIRA 2ICWJ 1GOFA 2JJWA 3H7BB 4OLUH 4BM7A 3Q9QA 1A0QL 1OP3H 1BBDH 1XEUA 3EYFA 5AVWB 3IFPB 5T5FA 2YPVL 2BDNH 3PWNA 5BOJA 4GBXC 2B15A 4YDMA 4HP5A 4UT9H 2DBJA 3S3JA 4K94C 1LK2A 1WFMA 4RZKA 2LW3A 1VF5C 2K4AA 5SWZB 3DRQA 4FQIH 1DBKL 4JHAH 1BJ1J 2A77L 3GSQB 3HAEA 3U7YL 2WXHA 3ZUNC 4BA8A 3V4UH 3BXNB 5CU9A 1XF3A 2BPBA 4XE5B 2X0UA 1I1YB 4R7NB 5FGBC 1A6WH 2AITA 4ZUWB 4LU5H 3LQZB 4YHIB 1XF1A 2IH8A 4NAMA 4UB0H 1KPRB 2YPLB 3BVWA 3K1KC 2VR5A 4OLWH 4IGBA 3PE9A 4OSUL 4JHWH 3ZSSA 1BAFH 1IFGA 1H0DA 4LKCB 3ASNB 3KXFB 3GRWL 1NUGA 1Y1DA 4X5PA 3X14A 3O2WH 1CGUA 4TUOA 3C5SB 2CJTA 5ITBL 2BFVH 4TF4A 4WCYH 3K6FA 3GBEA 3QO1B 3T4AA 4NM8L 1AYRA 2ZF9A 4JQXC 3EKCA 4ZODA 3BUDA 1EMTH 1U8HA 3ABZA 2NCEA 3CV5A 4HWBL 4Q89A 4HG4J 5L8JB 4TTGA 1E0OB 3TIEB 6TAAA 5HI3D 1XGRA 4MJIA 1XIWB 1OP5H 1T7XA 1S4IA 5I16B 5CP3H 2OSLB 2QVIA 4FQ2H 1YEFH 2WXRA 3CXHK 1KULA 2AZUA 1ETB1 2VJXA 2GPZA 5FA3B 3G6JB 4PCTA 1T7YA 4ZTPL 5HTSA 4D8OA 4U0QB 1JHTA 4WNQA 4AOFA 1WIOA 2VZ1A 1FYTE 2ZXGA 2VISB 5J3HC 4XX1G 2FRGP 2VUYA 3DPDA 4M43L 1KTBA 2HSIA 3HPJB 4PWFA 4OAWB 4GRMA 2FYYB 4BRJA 1CCZA 2ZWNA 3O3UN 1URZA 5EFIB 2R7EB 4N2NA 3A67L 5HDWA 5GISH 2XTJB 1KXQE 4GXVH 3ZT5A 1OLZA 2BIHA 1YPZB 4L37A 4A2HA 3MRMA 3K2UL 5EBWB 1ZT4A 2LLLA 2BFGA 3BP6B 4KRMB 1FDLL 1LQSR 2WQUA 4UM9D 5FHAH 3TEWA 3FN0L 4Y19A 4G9DA 1MZYA 1PZCA 3TZVA 4P4RB 3CVIH 4G6JL 2NRDA 4UOJA 4Y16C 5J3HD 1QBML 2ZOLA 1ZAGA 2XKUA 4Q9BA 2HRPL 5AUMA 4X4YB 2EZ0C 4A2MA 4KDWA 3VU1A 3CH1B 3MNZB 1Q1JL 4FG2A 3G3LA 1DQDL 4F27A 2LAGB 4FXGA 2B59B 3GZPA 4CNIB 3HBGA 1IUZA 2PTTB 4BQ8A 4LIQH 4GSUA 1ACYL 4N0YL 1T03L 2N3JA 2UY6B 3MI6A 4JL1A 2BNQA 3MYJB 4YSTA 3AS1A 1RFDL 5K9KB 3NJLA 4XMUA 5KVFE 4D0BA 4Y16D 2DEXX 2HT2C 4UTBA 1SDDA 3GO1H 4MDJB 5BQ7A 4L9LC 2Y9RT 5T1DL 5E7BA 2QDVA 2EZ0D 4KK5D 2Y3NA 3MLTA 1USQA 4QIRA 4YHKH 1E3ZA 4A2DA 4N86A 3OPUA 1TZGL 1CTOA 1UWEH 1MQ8A 1JD9A 4LP4A 4A7GF 2UX7A 3LRLA 4K7PY 2YRBA 5D7JD 1ZVSB 1YLBB 4XVOA 4AM0Q 1FUNA 3ULAB 3DLQR 1FH2A 2NR6A 3CZFA 5DD1H 2JQZA 2Y36L 3G6DH 3QWRD 4MJHA 1U8CB 2GCYB 2C4FU 2NYZA 4D3CL 4N2CA 4GSXA 3FT3B 1AQ8A 2B3IA 5AEAA 4GLRH 1OL0A 5I76A 5ANMB 3VXMA 1QFWH 4HWNA 2OJZL 4AEIL 4FAAB 1A7QL 2EXWC 1G7IA 3WO4C 3B34A 1KTCA 2D7TH 5KSBA 5HHXH 1XT5A 5GGQH 3HKZA 3BUYB 3U0TB 4H7VA 3DO7A 2JMRA 4TLSA 3S34H 2CPCA 4F80A 3C09C 4LOFA 4W9HC 2NW2A 4GNKB 1JK9B 4MB4A 4FKHA 1K3IA 2B77A 3CXFA 3OJVC 2XNAB 1CICA 4R3SA 5E4OA 3CMGA 4X6BA 4ZSOA 1TTUA 4ZAKD 1G9MC 5CEYA 2PCYA 2PCFA 3EZ8A 3FFOA 5I1GH 2H3XC 4UUJA 2FHBA 4WQOA 4NUQA 4UTAA 1FH5L 1IU1A 2W1NA 3RWFA 4DP8X 1IL1B 4PS4H 1UUSA 2J3SA 2P45B 2XZAL 5JW4Q 3MV7A 2A6IA 5DMGC 1B4JL 1ED3B 2X4NA 1UWFA 3BKMH 1DANT 1W80A 5H2BA 3JV5A 2WQ8A 4A55A 4AVHA 5DMIL 2CMRH 4U7SA 2C3WA 4ZAKA 3G5VA 3O0RL 4Y7OC 5D70L 2GY5A 3FSOA 4NUJA 2CK0H 2MCAA 2N1TE 1P4IL 5EOQH 4UZSA 2PR9A 5SWSE 3FCSA 4QXGL 4QLRA 3QDAA 1DQLL 2F1AA 2ZXAA 1NIDA 2ENYA 3C9NB 4G5ZH 4GLRI 2F5BL 1ZK5A 2EICA 5DMGD 3II1A 3OL2A 1EZVX 1RK0A 1SOSA 2CO7A 4OF7A 3T1WA 3VXMD 2ODIA 1K8IA 2BOBB 2CZNA 1P6FA 2LOEA 4QRTA 1MHCB 4LLVA 3QC5X 4FFWC 5C7XH 2AJXL 4IBYA 1G7PA 3CD4A 2F7QA 1OPGL 1DBML 1XMEB 2DIJA 2QKIC 3O8XD 7TAAA 5IEHB 3D4ZA 4BH8A 3F7YA 3HCVB 2W5PA 1HH6A 2Y1YA 3QT2A 5H94B 3QPXL 4PEEA 1OF2A 3JZ7A 1AGBA 3KJ4B 3W2DH 5B38B 2YZ8A 4TVSa 1P84J 4HKZB 3GSVB 4ETQA 4ALAH 3U1SL 2CLZB 1E4JA 1BXVA 3GXPA 4P2QD 4PJFA 5D72H 5LG6A 4O2EA 1U41A 4I2XE 4DKEL 5IZ7A 5AQ0A 3T0EA 4KZDH 1T89A 4IKJA 2JQMA 2NUTB 1NGYB 1I3UA 4OZGB 1RZ8A 1RZGB 2VH5L 5EZPA 2CHWA 1EK3A 3QA3A 3E8VA 1LHZA 3IDIA 1EX0A 3HNSL 5C0BE 3TVMB 4M1CC 5FKPA 1L9NA 2DQJL 2BNUB 5KANI 2Y23A 3MLYL 3PPEA 3VFRB 1E5ZA 4JFOB 2VITA 2IMMA 3DX0A 4FQCH 2GC7C 2WBWB 1DJZA 1AP2B 1IC5L 1ICTA 3HC2A 3MNVB 4JKKA 1NGXB 5BMFH 1Q72H 1VSCA 3WS3A 5CILH 4YVUA 4U3SB 3L3IB 4P3WA 5DD6B 3P1VA 3CUPA 4JFTA 4ODBD 1U30A 2YGNA 4L23A 4OQTL 3ZE2E 4P06A 3O3DA 3CDGA 4BZ1A 5FB8B 4MX7A 4AGLA 5F6HI 1SXSA 3BXNA 4NENB 4UNUA 3HMXH 2CDEA 1C9SA 4ES8A 1GRWA 4UI2A 3B2PA 3UG4A 3FHQA 4BGDA 1DJGA 2VR6A 4QGYA 1I9IH 4P9HL 2B3RA 1LO2H 4NAJA 2YMOA 1FVEB 1KJVB 5CR1A 1E5UI 3EHBC 2XN9A 4JPWH 1KG0A 3PV6B 2BVTA 1TTBA 5HVHC 3PGFL 3D85A 5D1QB 1AI1L 4PHXA 1EZUA 1CBVH 4U7KA 2IADB 2HLFD 3BE1L 3DMMB 3C8KA 1YYLL 3BIKA 5IQLA 4KY1L 5I66B 5BRZA 3LZRA 4FQJL 4CADB 2CR3A 3PGCB 4NXSA 5F71A 5CD5C 4KZCA 3NSJA 2NLJB 3GIZH 3MCYA 5CLXA 3F12B 2H6OA 5IP4A 1JZDC 5JOFB 3IDNA 1JWMB 3NH7L 2IANE 3PHSA 5EU7C 5DMYA 3HG0A 3BLPX 3GIVA 5EIVA 4R7VA 1FFOA 1BF2A 1Z0NA 3AXLA 3IDXL 3UTTE 1NBVH 5EZOL 4KI5E 5I9QB 4QXVA 3LQAH 5IT2H 2C9PA 2XG4B 4RMBA 4WRLA 3UJTH 3OJ2C 2FK9A 2VABA 3NCMA 5I0VA 4LARL 5EO0A 5EFIA 5D1ZB 3U46B 3EFDL 4IRJA 3I3EA 3WKQA 5ADOH 4XNXL 3CN1A 3ULVL 3HNTL 3VFGL 1PFCA 1JMXA 1A47A 4OD1L 2DV6A 3LSOB 2N01B 1KWGA 5FA3A 1H3WM 2W92A 3O4OB 2Y7SA 5SWZE 1X5GA 3UIZA 5AWNH