3INBC

Structure of the measles virus hemagglutinin bound to the cd46 receptor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
126
structure length
126
Chain Sequence
CEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin glycoprotein
publication title Structure of the measles virus hemagglutinin bound to the CD46 receptor
pubmed doi rcsb
source organism Measles virus strain edmonston
molecule tags Viral protein/immune system
total genus 14
structure length 126
sequence length 126
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3inbC02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3inbC01
2G7IA 4A5WB 2JGXA 4DJZA 4C16A 4WJG2 4ZH1D 1H2PP 2UWNA 3IU3I 2MCYA 2YBYA 1E88A 1OK9A 3CALA 5HYUB 2RLPA 1TPMA 1SS2A 4B2SA 1GPZA 3R62A 5FO8C 2YRAA 3SW0X 5I0QB 1MD7A 3INBC 5HYTB 4MUCA 1OJWA 1OK3A 3KXVA 3KZJA 4LOTA 1O9AA 4FXGG 3OEDC 2EHFA 2CKUA 2LOJA 1H03P 3M7PA 1OK2A 2W80A 2KMSA 2JRAA 1G4FA 2XRDA 1U5MA 1GKGA 2XQWC 1VVDA 3ZD2A 1QO6A 1MD8A 2CG6A 1Z92B 1TPNA 4J38B 1H2QP 4F4OC 3RJ3D 4CSYA 4JHSA 1VVCA 4IGDA 1OK1A 4K12A 2RKZA 4AYIA 5JPMG 2JGWA 1C1ZA 1OJVA 4B2RA 4AYEA 3ERBA 3GOVA 2ERJA 3EJHA 1GHQB 1Q3XA 2RKYA 1ELVA 3GXEA 1TPGA 4PZ5A 1HCCA 2W81A 4AYDA 1QGBA 2RL0A 2XWJI 4AYMA 3NFPI 4ONTD 2V8EA 2WIIC 1HFIA 1NWVA 3OXUD 3MQLA 3OP8A 3O8EB 2O39C 2RLQA 3ZRZA 1GKNA 3L89M 1UOTP 1G4GA 2XRBA 2B5ID 1LY2A 1QUBA 1CKLA 1E8BA 1HFHA 4LOSA 5HYPA 2MCZA 1H04P 4KKDA 3T5OA 1ZJKA 1E5GA 1PPQA 2A55A 4YNXA 1FBRA 3ZD1A 2IZ4A 2KRIA 3IX0A 2QY0A 2XWBF 3TVJA 2CG7A 5HZPB 2EC3A 1SRZA 1OJYA 2BZMA 2IZ3A
chains in the Genus database with same CATH superfamily
2G7IA 4A5WB 2JGXA 4DJZA 2Y8RA 4C16A 4WJG2 4ZH1D 1H2PP 2UWNA 3IU3I 3WSXA 2MCYA 2YBYA 1E88A 1OK9A 3CALA 5HYUB 2RLPA 1TPMA 2I2LA 1SS2A 4B2SA 1GPZA 3R62A 5FO8C 2YRAA 3SW0X 5I0QB 1MD7A 1RLHA 3INBC 5HYTB 4MUCA 1OJWA 3VWOA 1OK3A 3FGRA 3KXVA 3KZJA 4LOTA 1O9AA 4FXGG 4APLA 3OEDC 2EHFA 2CKUA 2LOJA 1H03P 2ZYCA 3M7PA 1OK2A 2W80A 2KMSA 2JRAA 1G4FA 2Y8SA 2XRDA 1U5MA 1GKGA 2XQWC 1VVDA 3ZD2A 1QO6A 1MD8A 4N7EA 3K3TA 2CG6A 1Z92B 1TPNA 4J38B 1H2QP 4F4OC 3RJ3D 4MSLA 4CSYA 3NJAA 2X2ZA 4JHSA 1VVCA 4IGDA 1OK1A 4K12A 2RKZA 4AYIA 5JPMG 2JGWA 1C1ZA 1OJVA 4B2RA 4AYEA 3ERBA 3GOVA 2ERJA 3EJHA 1GHQB 3CI0J 1Q3XA 2RKYA 1ELVA 3GXEA 1TPGA 4PZ5A 1HCCA 2W81A 4YIZA 4AYDA 1QGBA 2RL0A 2XWJI 4AYMA 3NFPI 4ONTD 2V8EA 2WIIC 1HFIA 1NWVA 3OXUD 3F6KA 3MQLA 3OP8A 3O8EB 2O39C 2RLQA 3ZRZA 1GKNA 3L89M 4PO7A 5DN5A 1UOTP 3ZLDA 4BWCA 1G4GA 2XRBA 2B5ID 3FGTA 3WSYA 1LY2A 5DN4A 1QUBA 1CKLA 1E8BA 1HFHA 4LOSA 5HYPA 2Y8TA 2MCZA 1H04P 4KKDA 3T5OA 3ZLEA 1ZJKA 1E5GA 1PPQA 2A55A 4YNXA 1FBRA 3ZD1A 2IZ4A 2KRIA 3IX0A 2QY0A 2XWBF 3TVJA 2CG7A 5HZPB 2EC3A 1SRZA 1OJYA 2BZMA 2IZ3A
chains in the Genus database with same CATH topology
2G7IA 4A5WB 2JGXA 4DJZA 4C16A 4WJG2 4ZH1D 1H2PP 2UWNA 3IU3I 2MCYA 2YBYA 1E88A 1OK9A 3CALA 5HYUB 2RLPA 1TPMA 1SS2A 4B2SA 1GPZA 3R62A 5FO8C 2YRAA 3SW0X 5I0QB 1MD7A 3INBC 5HYTB 4MUCA 1OJWA 1OK3A 3KXVA 3KZJA 4LOTA 1O9AA 4FXGG 3OEDC 2EHFA 2CKUA 2LOJA 1H03P 3M7PA 1OK2A 2W80A 2KMSA 2JRAA 1G4FA 2XRDA 1U5MA 1GKGA 2XQWC 1VVDA 3ZD2A 1QO6A 1MD8A 2CG6A 1Z92B 1TPNA 4J38B 1H2QP 4F4OC 3RJ3D 4CSYA 4JHSA 1VVCA 4IGDA 1OK1A 4K12A 2RKZA 4AYIA 5JPMG 2JGWA 1C1ZA 1OJVA 4B2RA 4AYEA 3ERBA 3GOVA 2ERJA 3EJHA 1GHQB 1Q3XA 2RKYA 1ELVA 3GXEA 1TPGA 4PZ5A 1HCCA 2W81A 4AYDA 1QGBA 2RL0A 2XWJI 4AYMA 3NFPI 4ONTD 2V8EA 2WIIC 1HFIA 1NWVA 3OXUD 3MQLA 3OP8A 3O8EB 2O39C 2RLQA 3ZRZA 1GKNA 3L89M 1UOTP 1G4GA 2XRBA 2B5ID 1LY2A 1QUBA 1CKLA 1E8BA 1HFHA 4LOSA 5HYPA 2MCZA 1H04P 4KKDA 3T5OA 1ZJKA 1E5GA 1PPQA 2A55A 4YNXA 1FBRA 3ZD1A 2IZ4A 2KRIA 3IX0A 2QY0A 2XWBF 3TVJA 2CG7A 5HZPB 2EC3A 1SRZA 1OJYA 2BZMA 2IZ3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2G7I A;  4A5W B;  2JGX A;  4DJZ A;  4C16 A;  4WJG 2;  4ZH1 D;  1H2P P;  2UWN A;  3IU3 I;  2MCY A;  2YBY A;  1E88 A;  1OK9 A;  3CAL A;  5HYU B;  2RLP A;  1TPM A;  1SS2 A;  4B2S A;  1GPZ A;  3R62 A;  5FO8 C;  2YRA A;  3SW0 X;  5I0Q B;  1MD7 A;  3INB C;  5HYT B;  4MUC A;  1OJW A;  1OK3 A;  3KXV A;  3KZJ A;  4LOT A;  1O9A A;  4FXG G;  3OED C;  2EHF A;  2CKU A;  2LOJ A;  1H03 P;  3M7P A;  1OK2 A;  2W80 A;  2KMS A;  2JRA A;  1G4F A;  2XRD A;  1U5M A;  1GKG A;  2XQW C;  1VVD A;  3ZD2 A;  1QO6 A;  1MD8 A;  2CG6 A;  1Z92 B;  1TPN A;  4J38 B;  1H2Q P;  4F4O C;  3RJ3 D;  4CSY A;  4JHS A;  1VVC A;  4IGD A;  1OK1 A;  4K12 A;  2RKZ A;  4AYI A;  5JPM G;  2JGW A;  1C1Z A;  1OJV A;  4B2R A;  4AYE A;  3ERB A;  3GOV A;  2ERJ A;  3EJH A;  1GHQ B;  1Q3X A;  2RKY A;  1ELV A;  3GXE A;  1TPG A;  4PZ5 A;  1HCC A;  2W81 A;  4AYD A;  1QGB A;  2RL0 A;  2XWJ I;  4AYM A;  3NFP I;  4ONT D;  2V8E A;  2WII C;  1HFI A;  1NWV A;  3OXU D;  3MQL A;  3OP8 A;  3O8E B;  2O39 C;  2RLQ A;  3ZRZ A;  1GKN A;  3L89 M;  1UOT P;  1G4G A;  2XRB A;  2B5I D;  1LY2 A;  1QUB A;  1CKL A;  1E8B A;  1HFH A;  4LOS A;  5HYP A;  2MCZ A;  1H04 P;  4KKD A;  3T5O A;  1ZJK A;  1E5G A;  1PPQ A;  2A55 A;  4YNX A;  1FBR A;  3ZD1 A;  2IZ4 A;  2KRI A;  3IX0 A;  2QY0 A;  2XWB F;  3TVJ A;  2CG7 A;  5HZP B;  2EC3 A;  1SRZ A;  1OJY A;  2BZM A;  2IZ3 A; 
#chains in the Genus database with same CATH topology
 2G7I A;  4A5W B;  2JGX A;  4DJZ A;  2Y8R A;  4C16 A;  4WJG 2;  4ZH1 D;  1H2P P;  2UWN A;  3IU3 I;  3WSX A;  2MCY A;  2YBY A;  1E88 A;  1OK9 A;  3CAL A;  5HYU B;  2RLP A;  1TPM A;  2I2L A;  1SS2 A;  4B2S A;  1GPZ A;  3R62 A;  5FO8 C;  2YRA A;  3SW0 X;  5I0Q B;  1MD7 A;  1RLH A;  3INB C;  5HYT B;  4MUC A;  1OJW A;  3VWO A;  1OK3 A;  3FGR A;  3KXV A;  3KZJ A;  4LOT A;  1O9A A;  4FXG G;  4APL A;  3OED C;  2EHF A;  2CKU A;  2LOJ A;  1H03 P;  2ZYC A;  3M7P A;  1OK2 A;  2W80 A;  2KMS A;  2JRA A;  1G4F A;  2Y8S A;  2XRD A;  1U5M A;  1GKG A;  2XQW C;  1VVD A;  3ZD2 A;  1QO6 A;  1MD8 A;  4N7E A;  3K3T A;  2CG6 A;  1Z92 B;  1TPN A;  4J38 B;  1H2Q P;  4F4O C;  3RJ3 D;  4MSL A;  4CSY A;  3NJA A;  2X2Z A;  4JHS A;  1VVC A;  4IGD A;  1OK1 A;  4K12 A;  2RKZ A;  4AYI A;  5JPM G;  2JGW A;  1C1Z A;  1OJV A;  4B2R A;  4AYE A;  3ERB A;  3GOV A;  2ERJ A;  3EJH A;  1GHQ B;  3CI0 J;  1Q3X A;  2RKY A;  1ELV A;  3GXE A;  1TPG A;  4PZ5 A;  1HCC A;  2W81 A;  4YIZ A;  4AYD A;  1QGB A;  2RL0 A;  2XWJ I;  4AYM A;  3NFP I;  4ONT D;  2V8E A;  2WII C;  1HFI A;  1NWV A;  3OXU D;  3F6K A;  3MQL A;  3OP8 A;  3O8E B;  2O39 C;  2RLQ A;  3ZRZ A;  1GKN A;  3L89 M;  4PO7 A;  5DN5 A;  1UOT P;  3ZLD A;  4BWC A;  1G4G A;  2XRB A;  2B5I D;  3FGT A;  3WSY A;  1LY2 A;  5DN4 A;  1QUB A;  1CKL A;  1E8B A;  1HFH A;  4LOS A;  5HYP A;  2Y8T A;  2MCZ A;  1H04 P;  4KKD A;  3T5O A;  3ZLE A;  1ZJK A;  1E5G A;  1PPQ A;  2A55 A;  4YNX A;  1FBR A;  3ZD1 A;  2IZ4 A;  2KRI A;  3IX0 A;  2QY0 A;  2XWB F;  3TVJ A;  2CG7 A;  5HZP B;  2EC3 A;  1SRZ A;  1OJY A;  2BZM A;  2IZ3 A; 
#chains in the Genus database with same CATH homology
 2G7I A;  4A5W B;  2JGX A;  4DJZ A;  4C16 A;  4WJG 2;  4ZH1 D;  1H2P P;  2UWN A;  3IU3 I;  2MCY A;  2YBY A;  1E88 A;  1OK9 A;  3CAL A;  5HYU B;  2RLP A;  1TPM A;  1SS2 A;  4B2S A;  1GPZ A;  3R62 A;  5FO8 C;  2YRA A;  3SW0 X;  5I0Q B;  1MD7 A;  3INB C;  5HYT B;  4MUC A;  1OJW A;  1OK3 A;  3KXV A;  3KZJ A;  4LOT A;  1O9A A;  4FXG G;  3OED C;  2EHF A;  2CKU A;  2LOJ A;  1H03 P;  3M7P A;  1OK2 A;  2W80 A;  2KMS A;  2JRA A;  1G4F A;  2XRD A;  1U5M A;  1GKG A;  2XQW C;  1VVD A;  3ZD2 A;  1QO6 A;  1MD8 A;  2CG6 A;  1Z92 B;  1TPN A;  4J38 B;  1H2Q P;  4F4O C;  3RJ3 D;  4CSY A;  4JHS A;  1VVC A;  4IGD A;  1OK1 A;  4K12 A;  2RKZ A;  4AYI A;  5JPM G;  2JGW A;  1C1Z A;  1OJV A;  4B2R A;  4AYE A;  3ERB A;  3GOV A;  2ERJ A;  3EJH A;  1GHQ B;  1Q3X A;  2RKY A;  1ELV A;  3GXE A;  1TPG A;  4PZ5 A;  1HCC A;  2W81 A;  4AYD A;  1QGB A;  2RL0 A;  2XWJ I;  4AYM A;  3NFP I;  4ONT D;  2V8E A;  2WII C;  1HFI A;  1NWV A;  3OXU D;  3MQL A;  3OP8 A;  3O8E B;  2O39 C;  2RLQ A;  3ZRZ A;  1GKN A;  3L89 M;  1UOT P;  1G4G A;  2XRB A;  2B5I D;  1LY2 A;  1QUB A;  1CKL A;  1E8B A;  1HFH A;  4LOS A;  5HYP A;  2MCZ A;  1H04 P;  4KKD A;  3T5O A;  1ZJK A;  1E5G A;  1PPQ A;  2A55 A;  4YNX A;  1FBR A;  3ZD1 A;  2IZ4 A;  2KRI A;  3IX0 A;  2QY0 A;  2XWB F;  3TVJ A;  2CG7 A;  5HZP B;  2EC3 A;  1SRZ A;  1OJY A;  2BZM A;  2IZ3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...