3INBC

Structure of the measles virus hemagglutinin bound to the cd46 receptor
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
126
structure length
126
Chain Sequence
b'CEEPPTFEAMELIGKPKPYYEIGERVDYKCKKGYFYIPPLATHTICDRNHTWLPVSDDACYRETCPYIRDPLNGQAVPANGTYEFGYQMHFICNEGYYLIGEEILYCELKGSVAIWSGKPPICEKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Hemagglutinin glycoprotein
publication title Structure of the measles virus hemagglutinin bound to the CD46 receptor
pubmed doi rcsb
source organism Measles virus strain edmonston
molecule tags Viral protein/immune system
total genus 14
structure length 126
sequence length 126
chains with identical sequence D
ec nomenclature
pdb deposition date 2009-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00084 Sushi Sushi repeat (SCR repeat)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3inbC02
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 3inbC01
3MQLA 2YRAA 3ERBA 3GXEA 2RLQA 4K12A 2O39C 2XRBA 3ZD1A 3TVJA 1SRZA 3NFPI 2CG6A 4C16A 1Q3XA 4DJZA 4JHSA 2UWNA 4AYMA 1VVDA 2A55A 3R62A 1LY2A 4MUCA 3SW0X 2CG7A 1QUBA 4PZ5A 2YBYA 1HFIA 2MCYA 1GKGA 3IX0A 3OP8A 1FBRA 1H2QP 1E5GA 3GOVA 5HZPB 5I0QB 3OEDC 2CKUA 4F4OC 2KRIA 1OJWA 3ZRZA 1MD7A 1E88A 5HYUB 3L89M 2IZ3A 2G7IA 4FXGG 1TPGA 4B2SA 4B2RA 1G4GA 1Z92B 5JPMG 3KZJA 1QGBA 2LOJA 4J38B 1NWVA 4KKDA 3T5OA 3OXUD 4AYIA 2EHFA 2BZMA 3EJHA 1OJVA 1OK9A 1OJYA 2QY0A 4YNXA 1H04P 1G4FA 2RLPA 3ZD2A 2XWJI 1ZJKA 1UOTP 1TPNA 2RKYA 2ERJA 4A5WB 1GKNA 4WJG2 4IGDA 4CSYA 3INBC 2KMSA 1OK1A 2B5ID 2V8EA 1OK3A 1QO6A 2W80A 1H2PP 1O9AA 2WIIC 4ZH1D 1H03P 3M7PA 3RJ3D 5HYPA 5FO8C 2RL0A 4AYDA 1U5MA 2MCZA 2IZ4A 1OK2A 1MD8A 1VVCA 1C1ZA 4AYEA 1TPMA 1GHQB 4LOSA 3CALA 2JGWA 3O8EB 1SS2A 2XQWC 2W81A 1PPQA 3KXVA 2JRAA 1CKLA 2JGXA 2XRDA 1GPZA 1HCCA 1E8BA 2EC3A 2RKZA 4LOTA 4ONTD 1ELVA 3IU3I 5HYTB 2XWBF 1HFHA
chains in the Genus database with same CATH superfamily
3MQLA 2YRAA 3ERBA 3GXEA 2RLQA 4K12A 2O39C 2XRBA 3ZD1A 3TVJA 1SRZA 3NFPI 2CG6A 4C16A 1Q3XA 4DJZA 4JHSA 2UWNA 2X2ZA 4AYMA 1VVDA 2A55A 3R62A 5DN4A 1LY2A 2ZYCA 4MUCA 3SW0X 2CG7A 1QUBA 4PZ5A 2YBYA 1HFIA 2MCYA 1GKGA 3IX0A 3OP8A 1FBRA 1H2QP 1E5GA 3GOVA 3WSYA 4BWCA 5HZPB 5I0QB 3OEDC 2CKUA 4F4OC 2KRIA 4PO7A 3FGRA 1OJWA 3ZRZA 1MD7A 1E88A 5HYUB 3L89M 2IZ3A 2G7IA 4N7EA 4FXGG 1TPGA 4MSLA 3ZLEA 4B2SA 4B2RA 1G4GA 1Z92B 5JPMG 3KZJA 1QGBA 2LOJA 4J38B 1NWVA 4KKDA 3T5OA 3OXUD 4AYIA 2EHFA 2BZMA 3EJHA 1OJVA 1OK9A 1OJYA 2QY0A 3CI0J 4YNXA 3K3TA 1H04P 1G4FA 2RLPA 3ZD2A 2XWJI 1ZJKA 3NJAA 1UOTP 1TPNA 2RKYA 2ERJA 4A5WB 3VWOA 1GKNA 4WJG2 4IGDA 4CSYA 1RLHA 3INBC 2KMSA 2Y8SA 1OK1A 2B5ID 2V8EA 1OK3A 1QO6A 2W80A 1H2PP 1O9AA 2WIIC 4YIZA 4ZH1D 1H03P 3M7PA 3RJ3D 5HYPA 5FO8C 2RL0A 2I2LA 4AYDA 1U5MA 2MCZA 2IZ4A 5DN5A 1OK2A 1MD8A 1VVCA 1C1ZA 4AYEA 1TPMA 1GHQB 3FGTA 4LOSA 3WSXA 3CALA 4APLA 2Y8TA 2JGWA 3O8EB 1SS2A 2XQWC 3ZLDA 2W81A 1PPQA 3KXVA 2JRAA 1CKLA 2JGXA 2XRDA 1GPZA 1HCCA 3F6KA 1E8BA 2EC3A 2RKZA 4LOTA 4ONTD 1ELVA 3IU3I 2Y8RA 5HYTB 2XWBF 1HFHA
chains in the Genus database with same CATH topology
3MQLA 2YRAA 3ERBA 3GXEA 2RLQA 4K12A 2O39C 2XRBA 3ZD1A 3TVJA 1SRZA 3NFPI 2CG6A 4C16A 1Q3XA 4DJZA 4JHSA 2UWNA 4AYMA 1VVDA 2A55A 3R62A 1LY2A 4MUCA 3SW0X 2CG7A 1QUBA 4PZ5A 2YBYA 1HFIA 2MCYA 1GKGA 3IX0A 3OP8A 1FBRA 1H2QP 1E5GA 3GOVA 5HZPB 5I0QB 3OEDC 2CKUA 4F4OC 2KRIA 1OJWA 3ZRZA 1MD7A 1E88A 5HYUB 3L89M 2IZ3A 2G7IA 4FXGG 1TPGA 4B2SA 4B2RA 1G4GA 1Z92B 5JPMG 3KZJA 1QGBA 2LOJA 4J38B 1NWVA 4KKDA 3T5OA 3OXUD 4AYIA 2EHFA 2BZMA 3EJHA 1OJVA 1OK9A 1OJYA 2QY0A 4YNXA 1H04P 1G4FA 2RLPA 3ZD2A 2XWJI 1ZJKA 1UOTP 1TPNA 2RKYA 2ERJA 4A5WB 1GKNA 4WJG2 4IGDA 4CSYA 3INBC 2KMSA 1OK1A 2B5ID 2V8EA 1OK3A 1QO6A 2W80A 1H2PP 1O9AA 2WIIC 4ZH1D 1H03P 3M7PA 3RJ3D 5HYPA 5FO8C 2RL0A 4AYDA 1U5MA 2MCZA 2IZ4A 1OK2A 1MD8A 1VVCA 1C1ZA 4AYEA 1TPMA 1GHQB 4LOSA 3CALA 2JGWA 3O8EB 1SS2A 2XQWC 2W81A 1PPQA 3KXVA 2JRAA 1CKLA 2JGXA 2XRDA 1GPZA 1HCCA 1E8BA 2EC3A 2RKZA 4LOTA 4ONTD 1ELVA 3IU3I 5HYTB 2XWBF 1HFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MQL A;  2YRA A;  3ERB A;  3GXE A;  2RLQ A;  4K12 A;  2O39 C;  2XRB A;  3ZD1 A;  3TVJ A;  1SRZ A;  3NFP I;  2CG6 A;  4C16 A;  1Q3X A;  4DJZ A;  4JHS A;  2UWN A;  4AYM A;  1VVD A;  2A55 A;  3R62 A;  1LY2 A;  4MUC A;  3SW0 X;  2CG7 A;  1QUB A;  4PZ5 A;  2YBY A;  1HFI A;  2MCY A;  1GKG A;  3IX0 A;  3OP8 A;  1FBR A;  1H2Q P;  1E5G A;  3GOV A;  5HZP B;  5I0Q B;  3OED C;  2CKU A;  4F4O C;  2KRI A;  1OJW A;  3ZRZ A;  1MD7 A;  1E88 A;  5HYU B;  3L89 M;  2IZ3 A;  2G7I A;  4FXG G;  1TPG A;  4B2S A;  4B2R A;  1G4G A;  1Z92 B;  5JPM G;  3KZJ A;  1QGB A;  2LOJ A;  4J38 B;  1NWV A;  4KKD A;  3T5O A;  3OXU D;  4AYI A;  2EHF A;  2BZM A;  3EJH A;  1OJV A;  1OK9 A;  1OJY A;  2QY0 A;  4YNX A;  1H04 P;  1G4F A;  2RLP A;  3ZD2 A;  2XWJ I;  1ZJK A;  1UOT P;  1TPN A;  2RKY A;  2ERJ A;  4A5W B;  1GKN A;  4WJG 2;  4IGD A;  4CSY A;  3INB C;  2KMS A;  1OK1 A;  2B5I D;  2V8E A;  1OK3 A;  1QO6 A;  2W80 A;  1H2P P;  1O9A A;  2WII C;  4ZH1 D;  1H03 P;  3M7P A;  3RJ3 D;  5HYP A;  5FO8 C;  2RL0 A;  4AYD A;  1U5M A;  2MCZ A;  2IZ4 A;  1OK2 A;  1MD8 A;  1VVC A;  1C1Z A;  4AYE A;  1TPM A;  1GHQ B;  4LOS A;  3CAL A;  2JGW A;  3O8E B;  1SS2 A;  2XQW C;  2W81 A;  1PPQ A;  3KXV A;  2JRA A;  1CKL A;  2JGX A;  2XRD A;  1GPZ A;  1HCC A;  1E8B A;  2EC3 A;  2RKZ A;  4LOT A;  4ONT D;  1ELV A;  3IU3 I;  5HYT B;  2XWB F;  1HFH A; 
#chains in the Genus database with same CATH topology
 3MQL A;  2YRA A;  3ERB A;  3GXE A;  2RLQ A;  4K12 A;  2O39 C;  2XRB A;  3ZD1 A;  3TVJ A;  1SRZ A;  3NFP I;  2CG6 A;  4C16 A;  1Q3X A;  4DJZ A;  4JHS A;  2UWN A;  2X2Z A;  4AYM A;  1VVD A;  2A55 A;  3R62 A;  5DN4 A;  1LY2 A;  2ZYC A;  4MUC A;  3SW0 X;  2CG7 A;  1QUB A;  4PZ5 A;  2YBY A;  1HFI A;  2MCY A;  1GKG A;  3IX0 A;  3OP8 A;  1FBR A;  1H2Q P;  1E5G A;  3GOV A;  3WSY A;  4BWC A;  5HZP B;  5I0Q B;  3OED C;  2CKU A;  4F4O C;  2KRI A;  4PO7 A;  3FGR A;  1OJW A;  3ZRZ A;  1MD7 A;  1E88 A;  5HYU B;  3L89 M;  2IZ3 A;  2G7I A;  4N7E A;  4FXG G;  1TPG A;  4MSL A;  3ZLE A;  4B2S A;  4B2R A;  1G4G A;  1Z92 B;  5JPM G;  3KZJ A;  1QGB A;  2LOJ A;  4J38 B;  1NWV A;  4KKD A;  3T5O A;  3OXU D;  4AYI A;  2EHF A;  2BZM A;  3EJH A;  1OJV A;  1OK9 A;  1OJY A;  2QY0 A;  3CI0 J;  4YNX A;  3K3T A;  1H04 P;  1G4F A;  2RLP A;  3ZD2 A;  2XWJ I;  1ZJK A;  3NJA A;  1UOT P;  1TPN A;  2RKY A;  2ERJ A;  4A5W B;  3VWO A;  1GKN A;  4WJG 2;  4IGD A;  4CSY A;  1RLH A;  3INB C;  2KMS A;  2Y8S A;  1OK1 A;  2B5I D;  2V8E A;  1OK3 A;  1QO6 A;  2W80 A;  1H2P P;  1O9A A;  2WII C;  4YIZ A;  4ZH1 D;  1H03 P;  3M7P A;  3RJ3 D;  5HYP A;  5FO8 C;  2RL0 A;  2I2L A;  4AYD A;  1U5M A;  2MCZ A;  2IZ4 A;  5DN5 A;  1OK2 A;  1MD8 A;  1VVC A;  1C1Z A;  4AYE A;  1TPM A;  1GHQ B;  3FGT A;  4LOS A;  3WSX A;  3CAL A;  4APL A;  2Y8T A;  2JGW A;  3O8E B;  1SS2 A;  2XQW C;  3ZLD A;  2W81 A;  1PPQ A;  3KXV A;  2JRA A;  1CKL A;  2JGX A;  2XRD A;  1GPZ A;  1HCC A;  3F6K A;  1E8B A;  2EC3 A;  2RKZ A;  4LOT A;  4ONT D;  1ELV A;  3IU3 I;  2Y8R A;  5HYT B;  2XWB F;  1HFH A; 
#chains in the Genus database with same CATH homology
 3MQL A;  2YRA A;  3ERB A;  3GXE A;  2RLQ A;  4K12 A;  2O39 C;  2XRB A;  3ZD1 A;  3TVJ A;  1SRZ A;  3NFP I;  2CG6 A;  4C16 A;  1Q3X A;  4DJZ A;  4JHS A;  2UWN A;  4AYM A;  1VVD A;  2A55 A;  3R62 A;  1LY2 A;  4MUC A;  3SW0 X;  2CG7 A;  1QUB A;  4PZ5 A;  2YBY A;  1HFI A;  2MCY A;  1GKG A;  3IX0 A;  3OP8 A;  1FBR A;  1H2Q P;  1E5G A;  3GOV A;  5HZP B;  5I0Q B;  3OED C;  2CKU A;  4F4O C;  2KRI A;  1OJW A;  3ZRZ A;  1MD7 A;  1E88 A;  5HYU B;  3L89 M;  2IZ3 A;  2G7I A;  4FXG G;  1TPG A;  4B2S A;  4B2R A;  1G4G A;  1Z92 B;  5JPM G;  3KZJ A;  1QGB A;  2LOJ A;  4J38 B;  1NWV A;  4KKD A;  3T5O A;  3OXU D;  4AYI A;  2EHF A;  2BZM A;  3EJH A;  1OJV A;  1OK9 A;  1OJY A;  2QY0 A;  4YNX A;  1H04 P;  1G4F A;  2RLP A;  3ZD2 A;  2XWJ I;  1ZJK A;  1UOT P;  1TPN A;  2RKY A;  2ERJ A;  4A5W B;  1GKN A;  4WJG 2;  4IGD A;  4CSY A;  3INB C;  2KMS A;  1OK1 A;  2B5I D;  2V8E A;  1OK3 A;  1QO6 A;  2W80 A;  1H2P P;  1O9A A;  2WII C;  4ZH1 D;  1H03 P;  3M7P A;  3RJ3 D;  5HYP A;  5FO8 C;  2RL0 A;  4AYD A;  1U5M A;  2MCZ A;  2IZ4 A;  1OK2 A;  1MD8 A;  1VVC A;  1C1Z A;  4AYE A;  1TPM A;  1GHQ B;  4LOS A;  3CAL A;  2JGW A;  3O8E B;  1SS2 A;  2XQW C;  2W81 A;  1PPQ A;  3KXV A;  2JRA A;  1CKL A;  2JGX A;  2XRD A;  1GPZ A;  1HCC A;  1E8B A;  2EC3 A;  2RKZ A;  4LOT A;  4ONT D;  1ELV A;  3IU3 I;  5HYT B;  2XWB F;  1HFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...