3INPA

2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
218
Chain Sequence
HIQINPSILSADLARLGDDVKAVLAAGADNIHFDVMDNHYVPNLTFGPMVLKALRDYGITAGMDVHLMVKPVDALIESFAKAGATSIVFHPEASEHIDRSLQLIKSFGIQAGLALNPATGIDCLKYVESNIDRVLIMSVNPGFQKFIPAMLDKAKEISKWISSTDRDILLEIDGGVNPYNIAEIAVCGVNAFVAGSAIFNSDSYKQTIDKMRDELNKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ribulose-phosphate 3-epimerase
publication title 2.05 Angstrom Resolution Crystal Structure of D-ribulose-phosphate 3-epimerase from Francisella tularensis.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Isomerase
total genus 77
structure length 218
sequence length 220
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2009-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3inpA00
3QQ0A 4OE7A 4DEFA 3B03A 3FKRA 3STFA 1GEQA 1QPNA 4DELA 2PRLA 4JDBA 1TV5A 3NYZA 2BXVA 5CG7A 3W1LA 4O4WA 1TO3A 3BLFA 3DKJA 3G8RA 2VKZG 3FIGA 2BSLA 2E09A 1XCFA 2X30A 5LNVA 1X6UA 5EA9A 1PL9A 1W0MA 2H6RA 2WJZA 3M6YA 3PSVA 4Z0SA 1S5VA 1JUKA 3KAOA 3KVJA 4BFAA 1Q6QA 3LCGA 1VRDA 3PY2A 3ZWSA 2WSYA 4ZQRA 3PB2A 2RKXA 1VYRA 2Y85A 2PC4A 1ICQA 4AWTA 4LT9A 1UCWA 1DBTA 4UMBA 3E02A 5IBXA 3C3NA 3W2UA 1UJPA 4U28A 5K4XA 2VOMA 4MIMA 4RV8A 3W72A 1TMHA 3O6YX 4IMDA 5C55A 2OX1A 5L9FA 3THAA 1WBJA 3BVJA 4TMCA 4NNCA 5HUOA 3ABQA 1F2JA 3P80A 4DF0A 1YADA 2A7RA 3OVQA 2AQWA 4A21A 2CZFA 2NZLA 3UY7A 4FEZA 4LY8A 4CQ8A 3W7PA 4RLIA 5ABTA 1AW5A 1W5NA 3LLFA 1WX0A 1CW2A 1PCKA 2HTMA 3IIXA 4PCFA 4Z1BA 4UMAA 4TMBA 1K3UA 2C15A 3O15A 4MJZA 1SZFA 4LU0A 3YPIA 3W22A 4WQ6A 2X1TA 4YL2A 3GXPA 2WNQA 1IXNA 1W3TA 4K39A 2QCLA 3C2RA 4LVDA 5LGZA 2YX0A 3TMLA 1VYPX 5EL1A 1ME9A 4RXGA 3W7QA 4O1DA 4NZFA 5AC8A 2ZRZA 4LV9A 4E38A 4JIPA 3M5XA 4Y6GA 2WQPA 3LX9A 4WY0F 1I4NA 3MHFA 2GVLA 1JCNA 3NQEA 2UV8G 4ZQPA 1GYLA 3DZ1A 4A2RA 2NWRA 3NZ1A 4WXYA 5KINA 3UWUA 2VFEA 2Y7DA 3HF3A 3CWNA 2E6DA 4E0CA 4AXKA 1KFCA 3P84A 1SQ7A 2PRHA 3AO0A 4E2BA 1EUAA 3QF0A 3WJXA 4GXMA 2V2DA 1X8FA 5D30A 4LVAA 4GE8A 3SGUA 1GG1A 1QFEA 2Z6IA 2NWSA 2WPBA 1DHPA 4NUWA 4IWWA 2QCMA 3NL5A 2A85A 1FWSA 4LUJA 5MHBA 4UXDA 2NV1A 2B7OA 1M7OA 1GTHA 3W7NA 3LCWA 1QR7A 3JS3A 1AG1O 4HSOA 1WDWA 5HJLA 5HR7A 3LM7A 4AB4A 1JVNA 3B06A 3CEUA 4FNQA 4UTKA 5SWUA 4HHPA 1XBVA 4O12A 3S1UA 1U83A 4BI7A 2Y7FA 4EVZA 1OF6A 5F4XA 5EKYA 1SO6A 1GJPA 3NPWA 2VFGA 2GPTA 4O54A 3UY8A 1ZAJA 3W7HA 4TR9A 1FWTA 3W76A 3LHUA 1LROA 2E68A 1VHNA 2JGQA 3KOFA 1P0NA 3BG5A 4PTNA 4JTSA 4O50A 4AAJA 4M7TA 4O13A 2J6XA 5AN7A 4UFIA 2H90A 3TUUA 1TPB1 1KM0A 5AFDA 4O28A 3QRHA 5D2WA 4BF9A 4UMCA 3W88A 3NXFA 3B04A 2Y7EA 2VEPA 3K30A 1VS1A 4ORMA 2ZZ1A 4MZ8A 3L5MA 4IPJA 1M5WA 4ZZ9A 3LCLA 2FJKA 1OX5A 3GLCA 1KLYA 5DCEA 3MI3A 5HWJA 4JX4A 3I7SA 4NNBA 4O57A 2Q8ZA 3TU9A 4XKYB 3NQMA 3DXIA 1VLWA 3MYOA 1RR2A 2QCFA 3EX1A 2QJHA 3TC6A 3VI2A 3MWAA 3L21A 1H63A 2OZ0A 4OV4A 1LRNA 3H55A 3LCFA 1A50A 2A6LA 5G2WA 5U7SA 4HNTA 5IBXC 3VKJA 3W1AA 4NVTA 6TIMA 5CPMA 3W75A 3GDKA 2ISVA 1H7PA 3SI9A 1YTEA 1MXSA 3VCRA 1Q6LA 5AHLA 1QO5A 1HO4A 4GRSA 2J9XA 3SZ8A 5GVJA 4R53A 3IRDA 3W7OA 4HNUA 3UQNA 1OABA 3MW7A 5HUPA 5G4WA 5CSSA 4DF2A 3LOTA 1K02A 3N2MA 3CPRA 1HUVA 3G3MA 4S2BA 3EWXA 4OV9A 2CLHA 1AW1A 2JGYA 3TXVA 2QCCA 1G4TA 3PUOA 3W1NA 3CHVA 1C9DA 3LHZA 1XDLA 3L0NA 1PVNA 1SSDA 2OT0A 3IVTA 4AF0B 5D33A 3C2VA 1OFOA 4JICA 4MJMA 3S1XA 4O17A 4Z1AA 3SFKA 5I3HA 1T0OA 1X1OA 1GVOA 3W1UA 1MEWA 2JK2A 3NM1A 3UWZA 1EP1A 4FO4A 5AYYA 3RLVA 3I7RA 4W9TA 1H60A 5DLCA 1H61A 4NNAA 3W7CA 3O63A 1BWKA 3U2OA 1F76A 2CLKA 4O52A 3PUEA 4LRTA 4NQ1A 2ISWA 3EX6A 3L2IA 5AHMA 5FEWA 1HG3A 4X2RA 4EOUA 4OQVA 2R8WA 3M7WA 4UTLA 4Z1DA 4FIQA 3T44A 1GZGA 3T55A 1P4CA 2YYUA 1W3IA 4LNYA 1V5XA 1WA3A 3UWVA 4WY0B 4RCXA 1TPDA 1KFLA 3CTLA 1RQBA 5D09A 3DFQA 4LOCA 3GXTA 3UZ5A 3W2MA 3U8GA 1JR1A 4QISA 3NQ8A 4X22A 4S1FA 1HTIA 1JCJA 4H3DA 3TQKA 1LRTA 3W85A 2ABBA 1FWWA 3KXQA 3HGRA 4K8EA 3M5YA 3WJYA 3VE9A 4FX7A 3FYPA 4JS3A 2QR6A 2QCGA 2VXNA 1H7OA 2QCDB 4QNWA 3S1VA 1TB3A 3DI0A 1P0KA 1PCWA 2WNNA 3HPSA 4CNOA 1SR9A 1Q45A 1FXQA 3L9CA 1XL9A 3P82A 1OFPA 1G67A 2ATMA 1L2UA 3QPYA 4I7WA 4O19A 2JKEA 3HPXA 4M6QA 3PF3A 1WXJA 1XUZA 4UTIA 3GXNA 1M7PA 1IXOA 4WXZA 3HG5A 2Z1BA 3FJ6A 4PEKA 3INPA 3ANYA 1YTKA 1GVSA 4O11A 1FXPA 1XM3A 1XBZA 2FIQA 2VEIA 1FDZA 2FB2A 2H8XA 1L6YA 2FB3A 4JY9A 2ZRUA 3G0UA 4N9BA 4ADSA 2C3ZA 2OT1A 1KM2A 3O05A 3UWQA 1I2OA 5C6MA 4DPQA 1LLWA 3I68A 5AC7A 3GR8A 3LTPA 4YXGA 3LXCA 2EKCA 2NLIA 4OGZA 4BWLC 3S5YA 2E6YA 1FDJA 1QNVA 3KRZA 3NR0A 4DBEA 1JCMP 2C14A 4DF1A 3M16A 3NO5A 3LI1A 4AHPA 1QCWA 4UR7A 8TIMA 5FF0A 4ZVJA 1DL3A 3QC3A 3LTYA 2ZRXA 3C0JA 2O7QA 4EF9A 1LOQA 3P61A 2VENA 4ONVA 3UYCA 3EWYA 2ISSA 3F4NA 2YR1A 3HPZA 3MYPA 5KITA 2RDWA 4IMCA 3W23A 2NXIA 1LBLA 3TH6A 1PHQA 2YYTA 3G0SA 4UFJA 4CQ9A 3NQ7A 4AMAA 1GPWA 2PRMA 4E2DA 5D32A 3W7EA 1DVJA 3N14A 1I8JA 1PV8A 3N3MA 2V9DA 3JR2A 1JCYA 2FTPA 1SO4A 3LRKA 1IF2A 2A2IA 1A53A 3MI6A 4WOQA 6ALDA 4IQLA 4UUIA 2WNZA 2TMDA 1CX9A 1H50A 5BMWA 1W5OA 1JJKA 3ABRA 3MP3A 1KM5A 3TE9A 3IIZA 5HQEA 3QFEA 2CLLA 3MHGA 3W7RA 3GIYA 4GUFA 2B0MA 1Q6RA 1FWRA 2P10A 1AL8A 4Q33A 5KSWA 1O5KA 3MJYA 1H1YA 3GR7A 4KFPA 1LZOA 3USBA 1Q6OA 1ZENA 3PG9A 2ZDRA 4KWWA 5FF4A 3CIWA 4GUGA 1W31A 5G1TA 5K9CA 2ATSA 2BLEA 1SUXA 1TV8A 3QMTA 3W1XA 3G1HA 4HPJA 1N8FA 3PVFA 3LI0A 1AK5A 2ZRYA 1TPC1 2Y7GA 4L4MA 3W87A 4HT3A 2VELA 3S6DA 1EA0A 1LOSA 4JR5A 3PM6A 4UFMA 3EXSA 3NVTA 2A21A 4WD0A 4WOZA 2C1HA 4MOZA 2YCEA 4O53A 1KFEA 4A22A 3QH2A 4UTTC 3O06A 2ZYFA 3G24A 4PODA 4IX0A 4WX2A 3W73A 5G2IA 1GVQA 1JUEA 3S8HA 4BI5A 1R2RA 3TX9A 3HBLA 3GKFA 1XUUA 2V8ZA 3MMTA 4JTEA 3QW4B 3BLIA 4K6AA 5C54A 2XFWA 4Y96A 5D2TA 3UXDA 4JN6A 1RQEA 1I2PA 1ZFJA 2C0AA 4UCGA 1QPQA 1VH7A 4JTIA 3TSBA 1Y0EA 1RPXA 3W7GA 1VZWA 3F1QA 3SSJA 2R94A 3FA5A 1FCQA 3BGJA 3MI2A 3W2LA 3W7KA 4MY9A 2FDSA 3S5OA 5AYZA 1FCUA 4QJ1A 4KWVA 1DV7A 4CNPA 1OX4A 3M5ZA 3TW7A 3NL3A 1DJNA 4M7SA 3T4CA 4BI6A 1KA9F 2GQ9A 2R14A 3BARA 2A5HA 4S2CA 1D9EA 1O60A 3W1PA 4JEQA 3EWBX 3GNNA 4NXKA 4IMEA 4HNVA 2V5BA 2Y6ZA 2YW3A 4Y90A 2TRSA 4JTTA 1R30A 3NDOA 1NVMA 3DH7A 1LCOA 2NX3A 3FJLA 2BTMA 3PR2A 2DZWA 2FLIA 3F03K 3O6DA 3V75A 3OIXA 1W3NA 1DJQA 2YPIA 1Z42A 5K9XA 4RKAA 4RJEA 3C8FA 1ZALA 3NQFA 3GKAA 5D38A 5DELA 3UD6A 3R2GA 2R91A 2X2GA 2Z6JA 1EX5A 3G18A 3B8DA 3GB6A 4X3ZA 1KFKA 3LHYA 4RXFA 3EB2A 2GOUA 4OWGA 4MZYA 1H7WA 2Z0IA 1JULA 1G4PA 3FKKA 4O4VA 3NQAA 3OEXA 1OYAA 1L6WA 2CLMA 2ZCGA 2DZXA 4QM1A 2E77A 3BO9A 3KVKA 4UTUA 1KM3A 4OHQA 1VCFA 3SR7A 3LHTA 3HO8A 2PURA 2NUYA 1MO0A 3C52A 3NEVA 3EX3A 1XBYA 5D02A 1ICSA 3PAJA 5G5IA 1RQHA 2DP3A 3VE7A 3CM4A 4NXSA 2ZZ5A 4DQWA 2J9ZA 3ZFHA 1FCVA 3EXRA 4Q4KA 5EMUA 1FUYA 5BMXA 4GJ1A 3BK0A 4H6KA 4PC8A 3L0KA 5DCBA 1OFEA 5I3KA 1BEUA 1VQTA 4UIOA 1VLIA 5DCDA 2QCHA 3EWUA 3KRUA 1K8XA 2FPTA 2RDTA 4KKXA 3SW6A 3W84A 3W9ZA 1OYCA 2O7SA 3PBUA 4R33A 2ZZ3A 3QJAA 1FCBA 1D3GA 2V2HA 3ZWTA 1GVRA 5BOOA 3DFPA 1GTEA 3C6CA 3IEBA 2A1YA 2WSQA 3TW6A 4LC6A 3CIXA 4FB7A 1OFBA 4MKNA 3LERA 2GVGA 1N7KA 2HSAA 1HL2A 5I3IA 1QWGA 3RMJA 3I6RA 4MZ1A 1Q3NA 1T8XA 4XQ6A 4PH6A 5T26A 3W7LA 3BW2A 1ZNNA 4GUJA 4O1BA 3GDTA 3LCXA 1YPFA 3O1NA 3P62A 3P5ZA 4C1LA 1QMLA 2P0OA 1UASA 3EWZA 5L6UA 4BWLA 4GC4A 4R7JA 1ZJIA 2A4AA 2NX1A 3B0UX 1LTDA 4LS2A 3CU2A 2QCEA 4ORIA 3DFOA 1C8VA 4AEOA 1PS9A 2X1UA 2Y89A 2C16A 3B0VC 1VC4A 4EIVA 2QAPA 4O0KA 2NXHA 4IOTA 2ZFAA 2C19A 1ICPA 4O8RA 4YCPA 1SW7A 5HWNA 3B05A 3LHVA 3TR2A 1H7NA 1DKWA 5D37A 2QF7A 1K8YA 2DORA 3C2OA 3HGJA 4O0ZA 1P1XA 1LBMA 3VNDA 3F4WA 2FPVA 4KFNA 2V82A 4A2SA 4UTMA 1XXXA 4AHQA 2GQ8A 2YZRA 1GT8A 5LSMA 4POCA 4DO4A 3G1YA 2ABAA 2QKFA 4M5PA 2DZSA 4XZ9A 5EPDA 4N6EA 1B4KA 5AHEA 1SZEA 2Y61A 1LYXA 3MO7A 3I7QA 5AHNA 2RDUA 2AGKA 2W0UA 3I65A 3A5VA 2PE4A 4FF7A 1ML1A 2NXGA 2YFNA 2TPSA 4M6PA 3R89A 4Z1CA 1TV7A 4CCCA 3GDMA 2Z2UA 1QDSA 4UFLA 4MFDA 1TPWA 5DBUA 3Q37A 2G97A 5LNRA 3BLEA 1LDCA 4NJJA 3WK1A 4LVGA 5DBTA 3HJZA 3M0ZA 4IMGA 5A5WA 4YLWA 2QUUA 1FQ0A 5HNRA 1OFQA 3GAKA 3HG4A 1NAL1 3DKLA 2TSYA 3W86A 2G96A 3NQGA 4ZMGA 1WQ5A 1GOXA 1YPIA 3MP4A 5K9DA 3HG2A 4IUOA 2CLIA 4L4LA 3DBPA 1I45A 3M5VA 4TO8A 3SY5A 5F2LA 1R47A 4FX6M 1W5PA 4ZQCA 3Q2DA 5D04C 3LB0A 4CCDA 5AC6A 1QAPA 1PHWA 5D2XA 3S0CA 4N2YA 5LHFA 4K38A 4QAIA 2QUVA 3DGRA 3MHUA 4JTHA 4Z0JA 5FF2A 2HS6A 1ALDA 4UTTA 1OHLA 2VEKA 3FS2A 5AB3A 4JGDA 4JTFA 5LHEA 2Y62A 2E6AA 4K36A 3PS7A 1XFBA 5I3GA 3M47A 1B4EA 4RZ5A 2QCNA 3MUXA 1WYIA 2ZZ6A 3A21A 3KRSA 5DY3A 1XC4A 1FDYA 3ZR4A 3P8JA 1J4EA 3VFLA 3P60A 3KVMA 1K03A 4P61A 4QIUA 3Q94A 4QSHA 2ZBTA 2E1DA 1TTQA 1VR6A 5F2IA 3QZEA 3L68A 3ZS4A 4ML9A 4DO5A 3TQ0A 1H7XA 1RV8A 3GK0A 2H3BA 4K7VA 1FBAA 1EPXA 3C4UA 4H4IA 4TIMA 4LW7A 1H62A 1O4UA 4WZHA 1EB3A 2EPHA 3QEZA 4O15A 5K7JA 3LBMA 1UBSA 1WOBA 4I7VA 3S42A 4XTIA 3T40A 2B7NA 2I14A 1TPFA 4XBSA 3TDFA 4UTHA 3OA3A 3W83A 1W8SA 1LP6A 1RVGA 3CLMA 2P1FA 2ZZ4A 4WJEA 4AF0A 3TSMA 1QPRA 2E6FA 3C2FA 4ADTA 4RX0A 4MYAA 4LRSA 5EYWA 4BR1A 3CB8A 1PIIA 3TNOA 3EKLA 3GZ3A 1GYNA 4R34A 3P81A 2CLOA 3H54A 3UWWA 3QM3A 1W5QA 3RFAA 1K8ZA 2Y88A 1I2RA 4D2JA 4QITA 5CGQA 1Z48A 2Y63A 5AHIA 1A5AA 5H2ZA 3LV5A 1PE1A 4GWEA 1NSJA 4MY8A 3BW4A 1OF8A 3DHDA 2NX9A 3BG3A 3IVSA 1DORA 4JX6A 4IXXA 1WBHA 1EWEA 1YDNA 3EKZA 3CWOX 4GNJA 3W2NA 2LLEA 1SFLA 3TQVA 1F05A 4K37A 5HULA 3FEMA 2GJLA 3RF9A 3TMQA 5FI8A 2A7PA 1TPVA 3MP5A 1G69A 2VC6A 3A9IA 1SW0A 3G3DA 3STGA 1QOQA 2F7FA 1J5TA 3LBCA 5FEZA 3N9SA 3S1WA 1SU5A 3UZJA 2OMAA 4GUIA 2H3DA 1R2TA 3PG8A 2CZ5A 4M6VA 4U4MA 1L6SA 3TK7A 4IPIA 3W1QA 3G1DA 3NQCA 1ZHAA 3KHJA 1A5BA 3THQA 1OX6A 2WV8A 4HKPA 3IGUA 4MLRA 5CKSA 5G4EA 4Q32A 4NJKA 3W7DA 1OK4A 2CU0A 3ABSA 1QO2A 4YMZA 4RR4A 2NUWA 1YXYA 2GJNA 4BK9A 1DQXA 1TIMA 4NJGA 3OVPA 4OT7A 2B7PA 1OX4B 2YFOA 1YXCA 1L9WA 2ZA1A 4AWUA 3GVGA 1YXDA 1F7BA 3IIOA 3TC7A 3W74A 2Q3OA 3W7JA 1VPXA 2X1SA 2ZTKA 3C61A 2YSWA 1OFAA 4NJIA 5KTLA 5LGXA 4JX5A 5TBOA 4FXRA 3W07A 4IGHA 5KZDA 1GVFA 3P74A 4UTWC 2FQIA 3S9YA 3JRKA 3C56A 4N6FA 5H91A 5EBUA 3PB0A 1R2SA 3G22A 1NFBA 3OHIA 2QAFA 4LS0A 4HIBA 2DZTA 3RK8A 1MZHA 1B9BA 1G4EA 3TJXA 2CZEA 3ATZA 1WOAA 3E9AA 1EIXA 1SW3A 4RZ4A 1GG0A 2ZQ0A 4ALDA 1TQXA 1N55A 4DPPA 3DAQA 4AHOA 1UUMA 3A22A 3KFTA 1G6CA 3C2EA 1BTMA 1IGSA 2NUXA 2WO5A 1JCXA 1T99A 2J27A 4JIQA 1IXQA 3M41A 4OBTA 3V1PA 5CZTA 3CC1A 3N2XA 4FHAA 3S5NA 2NV2A 1LRQA 3LRMA 1MSSA 3DHFA 2YW4A 4PA8A 4JTJA 4YWIA 3N19B 1IIHA 3HG3A 3WK0A 1JRCA 4MFEA 1H1ZA 1VGAA 2HMCA 3IV3A 4O10A 3NQVA 1BWLA 1KFBA 3EEGA 1ZAHA 1ME7A 5F4WA 2HS8A 1VJIA 1KM1A 1TPH1 3SIZA 5K3VA 2V2CA 4FNTA 3U6WA 4MYXA 1A5SA 3NQ2A 1MEHA 3A23A 5DXXA 2BWGA 2C6QA 2IQTA 3W70A 3E0IA 4CNNA 1JCLA 3ELFA 2DZVA 1W5MA 4J9JA 1K7FA 4XUGA 3W2JA 3HGSA 3R8RA 1X1ZA 4IX2A 1I2NA 1H7RA 1P5BA 3TA6A 3B4UA 1TPUA 3Q58A 2ZRWA 4AWSA 2FFCA 2EGZA 1DQWA 5J5RA 5CZ0A 1UB3A 4LWWA 1AW2A 4WUIA 1K7XA 3TIMA 2WSRA 1TCDA 2J24A 4UFHA 1TYGA 5KZMA 1FWNA 3TKFA 4FNRA 4JY8A 2ZZ2A 3DI1A 1I2QA 4OU1A 2I1OA 5D03A 2CLFA 3L5AA 1LLZA 4O1AA 1NEYA 3SECA 5HWMA 2QJIA 3LV6A 5K4ZA 4IMFA 4N02A 4DXVA 4LC8A 4PFMA 3PBWA 5FESA 5FF3A 5LNSA 3M44A 5BW6A 3NL6A 3DFSA 2QEZA 7TIMA 3H53A 4NZJA 2XN1A 3UXAA 1TQJA 5G1YA 1KFJA 3WJSA 3HMJG 1FX6A 3T7VA 1JQVA 3LRLA 2WKJA 4CCEA 1ME8A 5C2XA 1JQXA 5AOUA 5KZEA 3RU6A 4A3UA 1IXPA 2E5DA 2G5WA 1S3HA 1LM1A 1SZNA 1B3OA 3O16A 3G1VA 4ZQOA 5F1VA 5EY5A 1KM6A 3QQ1A 1KW1A 3CQ0A 3GX9A 4QQ3A 3TXZA 3IIPA 3TFCA 2QDHA 2Q8LA 4LS1A 3WK2A 1JUBA 1TREA 4XBKA 3IGSA 3OVRA 1SFJA 4N9DA 3DENA 1W37A 1THFD 5KMYA 3TAOA 5HR6A 5HMSA 2V0TA 1TPEA 2RFGA 3KX6A 3TFXA 2QJGA 1AMKA 3SJ3A 5C5YA 3HOJA 1KBJA 1KTNA 1G7UA 3N9RA 1TSIA 1SSGA 3R5EA 4Z08A 3QSRA 3W2KA 1YLVA 3BV4A 1R46A 4RZ6A 4NT0A 2QDGA 5DN1A 1SO3A 3GNDA 3PC0A 4UC5A 5D2YA 3O6CA 1KM4A 2BX7A 1XBXA 3L0GA 1LOLA 2ZA3A 4LUIA 4XTDA 1V7YA 3LLDA 5AYXA 5IM51 3SGZA 3HB9A 3EWWA 4JTGA 3ABOA 3UPWA 1JRBA 1QOPA 1TJRA 3BW3A 3N73A 1NF0A 2I9EA 4IJBA 3L66A 4M19A 3IGXA 3STCA 4XWUA 3RNDA 2DJXA 2W6RA 1QPOA 4B5NA 5FF7A 3M1ZA 4O14A 1D3HA 3GDRA 5U4NA 1GWJA 1S5WA 1S5TA 4LV4A 2VFDA 1SZGA 1O5XA 3M43A 3MBFA 2RH9A 4FNPA 1XI3A 2X16A 3B0PA 5LNUA 1G4SA 1VYSX 2AAMA 3GYEA 1SPQA 3S5ZA 2XN0A 4Y9AA 3TV8A 4JNMA 4MUZA 3NPXA 4ZL1A 1TTIA 4DO6A 1F74A 5F4SA 3QYQA 4MLJA 2PCQA 1OYBA 1TRIA 1VCGA 1C29A 3W3OA 2ZRVA 3NGJA 4FNUA 5D05A 3W7IA 4ZQMA 4AH7A 1Z44A 2VEMA 3NG3A 3LCHA 4IXHA 1Z41A 2JBMA 4JTKA 3BG9A 5F2GA 3QSTA 4PL1A 5AHFA 4I7UA 4O16A 2JKPA 1SO5A 1OFRA 1VCVA 4TU1A 2W79A 1TTJA 2ALDA 4HNNA 5BRBA 5FEPA 3NA8A 4FIRA 4JD4A 2H8ZA 3M9YA 2D73A 1W56A 4FNSA 3OG3A 2E5BA 1YDOA 2DZPA 2X1RA 1KTBA 2A7NA 1KLZA 3LCIA 1HO1A 3HIJA 1YYAA 3UPBA 4A29A 4UTWA 2F84A 3O07A 3LGEA 2OJPA 1H51A 3EX4A 3DU0A 2V81A 2VFHA 1LBFA 1W1ZA 3P8IA 4UR8A 3W7MA 5BNKA 3T78A 4JYEA 3N34A 3RLUA 3W1TA 5K2ZA 3NM3A 2GQAA 4JXCA 3QW3A 1K7EA 4YCOA 3LDVA 3LXAA 3G1XA 5I3JA 3TCEA 2ZA2A 1LORA 2CLEA 4O1CA 1M6JA 3NPVA 1ZCOA 1XKYA 5LZLA 3WK3A 1ZY9A 3PBVA 3FYOA 1X7FA 1AL7A 3ATYA 3P7YA 5E1QA 4NU7A 3A5FA 1YTDA 1BKSA 4LVBA 4EWND 3TSDA 2J88A 4HN4A 4XKYA 1KBIA 5TIMA 2JKAA 1O95A 1FY6A 4RK8A 2KZHA 4C1KA 1KV8A 3LXBA 4MY1A 4CQAA 2V30A 5DY2A 4QNEA 3UWYA 1B57A 1F6KA 4FXSA 4UNLA 2CZDA 4P2VA 4K7YA 3G1SA 4K8HA 3WJWA 5HINA 3G8EA 3BGGA 5LKYA 2EAWA 1TTPA 2C13A 5J5DA 2ZZ7A 1F73A 1EUNA 2B7QA 3MBDA 3NQDA 4N9EA 3TROA 3W71A 3LTSA 2BZNA 3TAKA 2VFIA 3GAYA 3IVUA 3UNDA 2ZTJA 4NX0A 2J9YA 4NJHA 2DZUA 2GVJA 1VHCA 3DFTA 5E93A 3E12A 4JYDA 2CW6A 4CLMA 4ZQNA 3NZRA 4FX8A 1OK6A 1MEIA 4MVAA 5D2VA 4GBUA 4TX9A 1O94A 4GFSA 3EX2A 3NAVA 5TQLA 1EEPA 3QMSA 5CZSA 3R13A 3QMRA 2CFFA 5CPNA 1KTCA 1NF7A 2DU2A 2YGYA 4HPXA 2XN2A 1HFBA 1F6PA 2VFFA 3NL2A 3TJLA 3IIVA 4GUHA 3WFAA 4KFOA 2EF9A 1OJXA 3WJZA 2B4GA 3HGOA 3NOEA 2YXGA 1OVDA 4X9SA 4DBDA 2OCZA 1E51A 1ONRA 4PL2A 1EP3A 1WV2A 3PSWA 2E5CA 3O8AA 3L67A 1OG0A 1KV5A 1CI1A 1IIGA 1EWDA 3FOKA 5CZJA 2YDAA 1U5JA 3L5LA 2V5LA 4WY0A 5CPLA 4AVFA 4MPQA 4N9CA 5F1UA 4ADUA 3PWAA 1J2WA 3G0XA 3QPZA 5A8GA 1T96A 2A0NA 3HQ1A 3NNTA 5CPOA 3LHWA 3R12A 2FPYA 4JDYA 3PBYA 4LTSA 3BPWA 1G7VA 3P67A 4N4QA 4I9AA 2QUTA 4JYFA 1UUOA 5DXYA 1F5ZA 4UTJA 3D0CA 3G1AA 3NQ6A 4HSNA 3GDLA 3CEPA 2DJLA 3E49A 2Q3RA 3OBKA 5CSRA 3W1RA 3W6YA 1RZMA 2Y70A 5F2MA 2A6NA 1TJPA 2GUUA 2WOQA 3EXTA 1ZAIA 1RD5A 1YDVA 2CWNA 1ADOA 3STEA 4O18A 3PULA 5E0KA 1A5CA 2QCDA 3G1FA 3A24A 4EF8A 2G95A 1W54A 3PUDA 2EHHA 3DFNA 3W1MA 5LNWA 1XDMA 3KVLA 4JTLA 3E96A 5G2HA 4LVFA 3CT7A 2RHGA 1GQNA 3NPUA 1TRDA 4UFKA 3FFSA 1EP2A 1DOSA 4G1KA 4JTUA 4UNKA 2C18A 4Y8FA 3AJXA 1OFDA 1H5YA 5I3FA 3P5YA 4NX5A 3FLUA 3L65A 1WAUA 4N4PA 5FEXA 2TYSA 4ICNA
chains in the Genus database with same CATH superfamily
1QJWA 2XGZA 3QQ0A 1KCKA 3B03A 4OZOA 1FWAC 3KL5A 2GUBA 4B92A 4L4PA 4D8LA 1W2PA 1Q2SA 4KGJA 4O4WA 3M4HA 2OWXA 4L7ZA 1HL9A 3G8RA 4FK9A 3BMVA 5A1AA 4HD5A 4Q8NA 3GH7A 2X30A 1X6UA 5EA9A 2VGBA 2H6RA 3CZ8A 3PSVA 4J27A 4P8UA 1TJ2A 3KAOA 4H7ZA 4Y7EA 1EC9A 3SCWA 1UA3A 5C0QA 4C6IA 1J0JA 1VBJA 4AWTA 1GUVA 1YNPA 4LT9A 1QBBA 2VX5A 1UQYA 4OVXA 4PMUA 1EF2A 2CPUA 2VC9A 2VOMA 3UCQA 4MIMA 2OU4A 1P1MA 3O6YX 4IMDA 5C55A 4IL2A 1RA0A 3BVJA 2C7FA 5HUOA 3WFZA 3ABQA 2WCAA 3P80A 3OVQA 3O9NA 3LPOA 5I03A 4LCSA 3QZ6A 4CQ8A 3GFYA 5HATA 2YL8A 4IIBA 4RDVA 1BHGA 3HU7A 1WX0A 4MJ2A 1J01A 4C6KA 3OBEA 4UMAA 4TMBA 4PMZA 3O15A 4MJZA 4MNKA 1EBHA 1KR0A 3NJ3A 3YPIA 3V5OA 3W22A 4HPHA 4YL2A 4XUYA 4H00A 2AMXA 1IXNA 3DN5A 1W3TA 4K39A 1WXYA 2C1IA 3TMLA 3G5EA 4RXGA 4DLMA 4NZFA 3H2AA 2ZRZA 4LV9A 4JIPA 5B7ZA 4QR6A 2GVLA 3CS2A 1GYLA 1OGSA 4TTUA 3UWUA 1C8XA 3CWNA 3KTSA 4AXKA 3E1F1 1HXJA 3WJXA 4GXMA 5JH2A 1UH4A 4WSJA 2J13A 3MV11 3WMSA 2ZC1A 4NRSA 1GG1A 5I2UA 1MQRA 1QFEA 2CZVA 1P6CA 5DMMA 5LIKX 1XIDA 5HANA 1F07A 2BY1A 2X40A 1HT6A 1TV2A 1OD0A 3VM5A 1SFSA 3VMOA 1U22A 3W7NA 3HZ3A 3ZT7A 1LT7A 4Z2HA 1C91A 1PKMA 1DIDA 3JS3A 5D8ZA 5FIPA 4F9JA 3UT0A 5HJLA 1GPFA 4BCEA 1JVNA 3B06A 1LWIA 4FNQA 4JQAA 4GY0A 3LMYA 3BZGA 1U1JA 1BXNA 1AH4A 4Q6JA 3WD1A 3DOPA 3RJXA 1V03A 4EE9A 3F5JA 3NPWA 3CL7A 3VNIA 2GJPA 4U2ZA 4XAFA 4S3DA 4O54A 4B5VA 1FWTA 3W76A 1LROA 1QW7A 2E68A 3RX2A 1VHNA 4LPCA 3MUIA 5M17A 2PGEA 4O50A 4MJ4A 2EG7A 4ICMA 2J6XA 1XYMA 5TD4A 5J8LA 2H90A 1I0DA 3TUUA 2G50A 4RZBA 1V77A 3WQWA 3QRHA 5D2WA 4BF9A 4UMCA 2IPGA 1H4PA 1QNSA 1T8QA 1VEOA 2Y7EA 3KCJA 4YS1A 5A6BA 1VS1A 3GNOA 4Q4OA 2P3EA 1RPKA 3L5MA 3T42A 1UKTA 1HF6A 4RE0A 1OX5A 2WM0A 5DCEA 3A3WA 3FAXA 5HWJA 4NNBA 2PDMA 1VLWA 3MYOA 3EX1A 3TC6A 4O8AA 3MWAA 3L21A 2OZ0A 4OV4A 3LCFA 3RITA 3FGCB 3PTMA 4JIIX 4PB4A 2BVDA 2OX4A 5IBXC 2PDBA 6TIMA 2GL5A 2VR4A 5DO8A 3W75A 2VQTA 5AC4A 5ECVA 1ZPTA 2QLYA 3SZ8A 2J9XA 3VD7A 1DWFM 4CVUA 2PDUA 5JVLA 2XIIA 4E4FA 2EG6A 1OABA 2YB4A 1BYCA 3KOZA 4DF2A 2J7GA 1HNYA 4JNYA 1HUVA 4S2BA 2ZWYA 3NFUA 4V27A 4AZCA 2QCCA 4W7VA 4KIRA 3RX3A 1C9DA 5LA2A 4BJHA 2OT0A 3IVTA 3DECA 2D2OA 1E5JA 3S1XA 2R1PA 4WDXA 5I3HA 1T0OA 1EDGA 4EXAA 1GVOA 5CGMA 1YE6A 1PB0A 4FO4A 3WLSA 5C9WA 3PK7A 2ZICA 4WGXA 3II1A 1REQA 3W7CA 2J4GA 3VX1A 1FKWA 3MMUA 3PPHA 4LRTA 1K8CA 4J35A 3M7WA 4UTLA 1CNVA 2F38A 1YKWA 5E9XA 3MZ2A 3SDOA 1P4CA 4REQA 1W3IA 1B9ZA 4ZO6A 4WY0B 4HA3A 4RCXA 3CMGA 1ADSA 1RQBA 3DFQA 1BWVA 3UZ5A 1EEXA 3W2MA 5I79A 1Q6DA 1LRTA 2FDMA 3WF0A 4QDWA 4DWSB 3M0YA 5E0CA 2X09A 1P43A 3RMEA 1X6NA 4BQ5A 3HFTA 3FYPA 2W61A 3MVIA 3GM8A 2QCDB 1GQLA 3DI0A 3SCRA 3PNUA 3CMFA 3OLDA 1VFOA 1Z69A 1FXQA 3L9CA 2PC8A 2ATMA 1L2UA 4RL3A 4I7WA 1RP8A 2J79A 4H7CA 1VPYA 5C9RA 1VFMA 2J7FA 1X96A 2VCCA 1WXJA 4UTIA 1M7PA 1IXOA 4WXZA 1BF2A 3FK4A 4J3ZA 3FJ6A 5DF0A 1YTKA 2ZUNA 3RX4A 1XBZA 3EPNA 2FIQA 2FB2A 3VGFA 3KWSA 2ZRUA 4C6FA 4V33A 3MWCA 4Z2JA 3KBMA 1BQGA 3UWQA 3W29A 2W4XA 1TCMA 3CO4A 3GR8A 3WD4A 3MMDA 1ONWA 4HGXA 2WHMA 2XM1A 1PKYA 1GJUA 4BWLC 1MW0A 3NR0A 4Q8MA 2C14A 5A6LA 3M16A 3ZIZA 4AHPA 3VNKA 1QCWA 4UR7A 3DHUA 3KHDA 1Q8AA 4P7RA 8TIMA 5I3DA 1DL3A 3LTYA 2QIWA 3C0JA 1JZ4A 3ONCA 4JKMA 4O0QA 2XUCA 2VENA 3P61A 1EHNA 4W88A 1JD9A 3EWYA 1H49A 2IKIA 3JUGA 2OO0A 2YR1A 3HPZA 2RDWA 1EO7A 2IUZA 3M0KA 3TH6A 3BJFA 1GQIA 2PS2A 4OECA 2PRMA 2WZMA 1DVJA 1I8JA 1PV8A 3VIOA 3LPPA 3N3MA 4XZIA 3UCCA 1JCYA 3LRKA 2OELA 2OB3A 5A2BA 3MI6A 1ISYA 2BY3A 4V1YA 5IFPA 1ONEA 2MNRA 3E3HA 4FAMA 2WNZA 3CUHA 1CX9A 2VCBA 5BMWA 3WDIA 4RNIA 5BRPA 3SO7A 3GXFA 5HQEA 4GG9A 2B0MA 3C0SA 1FWRA 3KWXA 3WZ0E 4UB9A 1GYMA 1ZJAA 1O5KA 1UG6A 3DHPA 3MZNA 3LD5A 1MW3A 1H1YA 3PG9A 1BF6A 5FF4A 3LM3A 5XIMA 3GTHA 1AZ1A 3OOQA 2BLEA 3AXHA 1SUXA 4AYSA 3W1XA 1UWIA 4Z17A 3LI0A 4A3QA 1AK5A 2ZRYA 1TPC1 2Y7GA 3EB4A 1JAEA 4L4MA 1UKQA 3W87A 3FY1A 4JR5A 2A21A 3K1GA 4MOZA 4O53A 1W3HA 4Q7BA 3A4WA 3G24A 1AQMA 4PODA 4WX2A 3POHA 4X2PA 4S3KA 1FWDC 2WHLA 3L4UA 4WSHA 4BI5A 2WVSA 3KZSA 4HOZA 3FHAA 2OFJA 1E4LA 4DYKA 4DI8A 2XFWA 3UXDA 3PPCA 3WH7A 1RQEA 2VX7A 4NYUA 4B3ZA 1QPQA 3ARWA 4E4PA 3MDUA 4HTYA 3GG1A 1FCQA 3PBGA 4AZIA 4HU0A 3GBEA 3GFZA 3W7KA 1GW9A 2OZ8A 5AYZA 1FCUA 3OZOA 2ZUUA 4K3ZA 1S2VA 2WKLA 1OX4A 3M5ZA 3TW7A 1RJQA 3QKZA 4QLJA 3T4CA 2Z2AA 1KA9F 4C6NA 2A5HA 1D9EA 2YXXA 3W1PA 4JEQA 2ZUTA 1WDRA 3VGDA 2TRSA 3NDOA 1MFUA 1NVMA 3V7PA 5C7HA 3K8KA 3FJLA 2DZWA 4NIRA 1PXGA 1EJUC 1Z42A 5K9XA 2OQYA 1CCWB 2DH3A 2O9OA 3B0YA 5T8GA 3TTQA 2IXVA 1V6UA 2OLAA 1TZ9A 3B8DA 4X3ZA 3N29A 4H9XA 5A6SA 3EB2A 2GOUA 3NO1A 1A5NC 4DJEC 4DUWA 3B8VA 1JULA 4JN8A 3NQAA 4JQ3A 1ZP3A 3IJ7A 5J04A 2CLMA 2ZCGA 2PDGA 1NQ6A 2DZXA 4UTUA 1JGIA 4HZMA 3S46A 3TLLA 3LHTA 4S3EA 1XLBA 1XBYA 2QJNA 5D02A 3VE7A 4PGLA 1EZ2A 3VNZA 3VD3A 4DQWA 3B8SA 3OZYA 1NM9A 4AZCB 3H23A 4IGMA 2WZIA 3FNDA 1R87A 1UYQA 5IFTA 4V28A 4HHMA 4CD8A 5IHRA 1K8XA 4DZIA 2RDTA 4IMAA 5A8PA 2O7SA 2WXDM 3SFWA 2OEJA 2BHYA 3UG5A 3QBUA 3BOFA 3W25A 5A2CA 3QJAA 1D3GA 1W1YA 4ZO7A 1GVRA 5BOOA 3HA1A 1XLMA 1XLAA 3IV8A 1EO5A 3CIXA 4FB7A 3ORWA 4P7NA 1BPLB 2HSAA 1HL2A 3I6RA 4MZ1A 4OUIA 3WLRA 4PH6A 5T26A 1REQB 1XQKA 3BW2A 4GUJA 3SAZA 3E0VA 3GR4A 3EDFA 5LXEA 1QMLA 2P0OA 1R86A 3WBYA 1AJ0A 3VA8A 2A4AA 4GIRA 2NX1A 1S2AA 3B0UX 4REQB 4XZWA 5CC3A 4PR4A 1DIOA 1M03A 2QCEA 3DFOA 2I7GA 2D20A 2Y89A 2GWGA 4H8VA 5BCAA 2NXHA 5E6ZA 4B5SA 2ACSA 1SW7A 4LH8A 4DM1A 4PBEA 3B05A 3AIWA 4BS0A 4RPQA 3GW0A 2CKRA 4J3XA 4GZJA 3C2OA 2AMGA 5GJPA 1TKKA 3HGJA 4O0ZA 1LBMA 1EC7A 2W5FA 4A2SA 2XH7A 4PUMA 2YZRA 1GT8A 3FXGA 3NCOA 4L5ZA 3RR1A 4A05A 2DZSA 5EPDA 3WDRA 1B4KA 1L6GA 3MO7A 4MAVA 3PJXA 1B0IA 4M6PA 3R89A 3RM9A 4GY1A 3WUGA 4A3RA 3ZOAA 4CCCA 1DEDA 3GDMA 4LAKA 1B90A 4MFDA 5JMUA 1Q13A 3Q37A 1B5TA 1M68A 3IPWA 4L6DA 1UR1A 2XU2A 4NJJA 1E6PA 3CO8A 4NZ5A 1MUMA 3WL1A 1GOOA 4YLWA 2HXTA 1NAL1 1NWRA 1Q65A 1W1IE 2G4FA 3W86A 5FKYA 1WQ5A 1GOXA 3W81A 3HG2A 3UZWA 1HKMA 2ZOXA 3S4TA 3FEQA 3GUGA 3DBPA 7TAAA 3PBMA 2QHAA 4PZVA 4FX6M 4H04A 3B97A 5D04C 3LB0A 3VIGA 1MXGA 1PHWA 2X0YA 3ABZA 4N2YA 1D3CA 4K38A 2BP1A 2QUVA 3CUFA 1LQAA 1W3KA 1E3ZA 3MHUA 4JTHA 2I17A 1ALDA 1VD6A 2ACQA 3WENA 2ACUA 5H1WA 4WJXA 4C6EA 1FA2A 4JN7A 3AFBA 3T08A 1M7XA 2D2JA 5I3GA 3N17A 1E0VA 3AALA 1A5UA 5DRIA 4CN6A 4KEVA 4TXEA 3MUXA 2VZSA 4NY2A 5DY3A 3ARPA 4AYGA 1JZ2A 2OODA 5CAKA 2WANA 3KVMA 4YHGA 3MJMA 2ZVRA 3Q94A 4QSHA 1A4LA 1TTQA 1VR6A 3QZEA 1O66A 4GBDA 4I6KA 3HMCA 4FXJA 5M3WA 4ML9A 5BU6A 4DO5A 2GJXA 1Q8JA 2O9PA 4L80A 4FR6A 3SCOA 3WBWA 4IF2A 4H4IA 4GGHA 4D8AA 3JZEA 3VDBA 3BQ6A 1BKHA 3M64A 1E9IA 4WKFA 4CU6A 3T40A 3H2OA 2I14A 2GFTA 3OA3A 5FSDC 2FGZA 2YDSA 4AF0A 3C2FA 4ADTA 4RX0A 2D0FA 5EYWA 1OC6A 3CB8A 3EOOA 3RM4A 3I3BA 4PMDA 4KPLA 2POZA 1EF3A 4MB4A 2VD8A 5C9ZA 1PZ1A 3WQOA 2PP0A 1NSJA 3CZJA 4XKMA 3BW4A 3N2CA 3QXBA 4Y9OA 1OF8A 1OM0A 3L4XA 4KCUA 2PDIA 1ODZA 2VDGA 3IVSA 4JX6A 1Z3NA 4IXXA 1OD8A 3WMLA 5BXSA 3CWOX 3BLPX 1F05A 4K37A 5GPRA 1XF0A 4IZGA 1OC5A 1WPCA 4NF7A 5T9BG 1SU5A 3PG8A 4IPIA 3W1QA 3G1DA 3BOLA 3CAVA 4D6CA 3TTYA 1ZHAA 1TZ7A 4D6IA 3MTWA 4HN8A 2AGTA 3TYEA 1F61A 1TMLA 4KS0A 3SIMA 1E4IA 3WUFA 4Q32A 3RPMA 1K6WA 2CU0A 3GC5A 2NUWA 1X38A 3ZQ9A 4AISA 2VWSA 4MB3A 2DVTA 3H24A 3OVPA 2OEKA 1OX4B 4XB3A 4JIRA 2G3JA 3KRBA 3PZQA 3IIOA 2GQ3A 1VPXA 2X1SA 4WLCA 3TLQA 2YSWA 3KLLA 5LGXA 2PEVA 4JX5A 4ZFMA 4IGHA 3WUEA 3P74A 1JZ3A 3S9YA 5H91A 2PLJA 1A5MC 2JF6A 3AISA 3GXDA 4GQGA 3G22A 4HBKA 2QAFA 1G0CA 3WD0A 3O7UA 1MZHA 2Z25A 1B9BA 4U31A 3TC3A 3ATZA 1WOAA 1JPDX 3CQIA 3NSMA 1GG0A 2CHNA 2PWDA 4ALDA 1TQXA 1QWKA 3KFTA 3VVGA 3C2EA 4IUGA 2WW5A 3QV7A 3APTA 1T99A 2J27A 4P8VA 2PTXA 4L6HA 3M41A 2GDUA 4LBUA 3V1PA 3CC1A 2YBVA 5T9CE 3WNLA 1MSSA 3PZMA 1XIHA 3GTFA 3N19B 2DZAA 5JXQA 4NI8A 3W01A 4JTAA 4GO9A 1H1ZA 5A8NA 3IV3A 3NQVA 1BWLA 2W62A 2WSKA 4I6VA 1ME7A 4C5ZA 3QR3A 1O1HA 2HS8A 2X8RA 1CGVA 5K3VA 2GSHA 3NQ2A 5DXXA 2BWGA 2D0HA 4PEEA 7CGTA 4UOQA 4LF2A 2C6QA 3WQ6A 4IL0A 2J7DA 3R4IA 4F2BA 2Z7GA 3HGSA 3R8RA 4IX2A 1P5BA 2ZRWA 1PZ0A 3W28A 5FJTA 3UR2A 1J0KA 3N4EA 4ZOAA 1CGWA 2PDHA 1D2KA 4LWWA 3UU0A 1K7XA 2DV0A 1NDWA 1FWHC 1VRXA 2J24A 4UFHA 3TKFA 5I7GA 5D03A 2CLFA 4O1AA 5AC5A 1FHDA 5HWMA 4DWDA 2HBXA 3TYBA 1XIMA 4GPNA 1Q7QA 4XD3A 3U48A 3WLIA 2VDHA 3N18A 2GGIA 5FESA 3DYOA 4GNVA 1BG9A 5FF3A 3M44A 3NL6A 3K2GA 7TIMA 1DWAM 3NO3A 4N0RA 4UQDA 1KFJA 3C0QA 2PTYA 1FX6A 1XLLA 3R1ZA 3RU6A 1SJAA 2PWHA 2DVUA 2G5WA 1LM1A 3CH0A 2ISFA 3IJDA 2CXGA 4G8TA 4ZQOA 1BFNA 2OYKA 1KW1A 3GX9A 3VC6A 4EAMA 2QDHA 4LS1A 3WK2A 1JUBA 3AHVA 4XAZA 1TREA 2WQDA 2Z1XA 3SEPA 3OVRA 3M0XA 4HJWA 1JYWA 1W37A 1GW1A 4GVGA 5HMSA 3P3BA 4PCPA 2J7EA 2RFGA 2EKGA 1E71M 4JFUA 3WQ4A 1UZ1A 4MUPA 3N9RA 2Z2BA 4HQVA 1YLVA 4JCMA 3BV4A 1NDZA 2WSPA 5DN1A 4L65A 1V6XA 2X0SA 3FW6A 1Z9AA 1ZJHA 3H22A 3ARSA 3ZJKA 1XBXA 2OQLA 4XTDA 3WO8A 1V7YA 4QCEA 3SGZA 3CUGA 3EWWA 3ABOA 3VKKA 3UPWA 1HW6A 1KBBA 2IPWA 9RUBA 3WL0A 3N73A 3R25A 1V3KA 2I9EA 6CGTA 4IJBA 3K4WA 4X0VA 4BEQA 1YBQA 1QPOA 3FJ4A 5FF7A 5GQBA 2VC5A 5GNZA 1SZGA 2OO6A 3F2CA 3RPDA 2RAGA 1V79A 5LNUA 1G4SA 2YZ5A 3GS6A 3SCTA 1MMFA 4Y9AA 3TV8A 4JNMA 1XIIA 1TTIA 2WCSA 2IW0A 1UIPA 3I6EA 3ZVIA 3S9ZA 3QYQA 2HDJA 4MLJA 1TVNA 3BMWA 2PCQA 3GH5A 1OYBA 1TRIA 1DIKA 4LAOA 3KCLA 3W3OA 4QTGA 2ZRVA 5G4HC 3NGJA 3W7IA 3KDNA 4DJFA 3NG3A 3VKAA 2FVMA 3OW1A 1PWLA 5F2GA 4NAFA 3ZJ8A 3CAQA 3N6HA 1FP8A 3RU8X 4O16A 1Z32X 4A8RA 3VUPA 1WZKA 2GJXB 1VENA 4AVOA 2PGWA 1VCVA 2W79A 3WQDA 1E6QM 1WKEA 4JD4A 2Y0FA 2D73A 1NWUA 1W56A 4PMOA 3OG3A 2E5BA 1YDOA 2X1RA 3LCIA 1HO1A 3HIJA 3HPFA 3CZGA 4KETA 3LGEA 1H51A 1W3JA 2VFHA 1XLHA 2ICSA 3UXIA 3P8IA 4QE5A 4JYEA 4JXCA 4OKDA 4WJ8A 1JZ5A 1JG9A 4YCOA 2VWTA 3LDVA 3AYRA 2FKPA 5E09A 3THDA 4O1CA 3NPVA 1ZCOA 3QVQA 1XKYA 4E4UA 4UBPC 1X7FA 4ZOEA 3W27A 4NU7A 4PRTA 2QVNA 3A5FA 4HOWA 1QXLA 4DNHA 5CBBA 4XKYA 4IT1A 3PP7A 5TIMA 1A5OC 2DUXA 1D8CA 1QHOA 2V30A 2DW7A 1B57A 1F6KA 4FXSA 4UNLA 2AOSA 4K7YA 3VKCA 2BXZA 5HINA 3PZ9A 1R7OA 5C8BB 2ZX5A 2IMRA 1TTPA 2ZZ7A 1DWHM 2E4TA 3KL0A 1P7TA 4N9EA 3BSHA 5I6SA 1ITXA 4LBSA 2PFHA 4W8LA 3UA4A 1HJQA 3LTSA 4PUJA 2KX9A 3TAKA 4Q4RA 2VFIA 3GAYA 1B54A 3UNDA 4QCFA 2J9YA 4IP7A 3IANA 5BXPA 4GK8A 2GVJA 3CHCA 3E12A 1F3WA 4CLMA 3H7RA 4GD0A 4HK6A 4TX9A 3MUCA 5D9MA 4H9TA 1O94A 1VFLA 1S1PA 3QMSA 1W91A 1A0CA 3BANA 2CFFA 3WLOA 1NF7A 4LFYA 4M56A 2XN2A 3VOJA 4HA0A 3MSRA 4GUHA 3DERA 4YN5A 4KFOA 3TN5A 1BQCA 3HGOA 1NFPA 2QF8A 3QYSA 2HQAA 3RRXA 4S23A 4X9SA 2VM8A 4DYJA 3CZKA 4DBDA 4BQ3A 2OCZA 1E51A 5JBEA 4U2YA 3LENA 1WV2A 3PSWA 3L67A 3AHYA 1IIGA 2WZHA 4Q4QA 1XGDA 2WVTA 1K9EA 3NIYA 4M80A 3WEOA 2BASA 4QG8A 1U5JA 3ICJA 5F1UA 3GDBA 4UQBA 5A8GA 3IJIA 1T96A 3HQ1A 3L4WA 3R12A 2FPYA 4XZBA 2A3HA 3PBYA 3V18A 1RK6A 3T0BA 4I9AA 4UTJA 3G1AA 4HSNA 3GDLA 3N04A 4EACA 3A12A 1CYGA 3QHMA 3T2QA 1TJPA 3WLNA 1ADOA 3PULA 5E0KA 2FZ9A 2G95A 2E9LA 2RGMA 2XPKA 1O12A 1JYXA 3DFNA 3W1MA 2VC7A 5G2HA 3M0MA 2QDDA 5HA7A 4FXFA 4J28A 1GKRA 1J5SA 2VNCA 2V3FA 5CPQA 2XG9A 4X61A 3VNJA 2F6KA 4Y8FA 2C18A 2BGSA 3AS0A 3FLUA 2I16A 4N4PA 5E0FA 4MKSA 3UJRA 5KZ6A 3EYPA 2J8GA 2TYSA 1UOZA 4QS5A 3U4AA 3FKRA 1W1A1 4H2HA 4DELA 3EDJA 4CGTA 2VDIA 2PWFA 1E9LA 1V02A 3H2MA 3UR7A 4DZ5A 3AIEA 3KZPA 1TO3A 1YNYA 2BY2A 5HNTA 5ABHA 2VKZG 2PZ0A 1R0MA 2BSLA 1QNPA 2W63A 4JFTA 3OB8A 4RUBA 3AMDA 4G7FA 2IPFA 1JUKA 2HPMA 3KVJA 5EMLA 1YMYA 3ZWSA 2ISDA 5LYRA 2BGQA 2PC4A 3V16A 2JEPA 2RJHA 1EGZA 1DBTA 4UMBA 4O1FA 4JQ2A 3BH4A 5HMEA 3W2UA 1XCXA 3L4YA 3TCSA 4JTQA 5K4XA 2VMFA 4ATDA 4RV8A 1U30A 5L9FA 3BAKA 2WNWA 1B3ZA 1POKA 3N2OA 1BGAA 5F7UA 1YADA 2A7RA 2AQWA 4A21A 2QULA 2V69A 1MDRA 2P88A 3CT2A 3LEPA 4PRRA 3A9BA 3MA8A 4W8AA 4FEZA 1GVYA 3D3FA 1Q6GA 4RLIA 1MNZA 5AYIA 2E8ZA 2GDQA 4MB1A 3LLFA 2QGYA 1K4HA 2X05A 1X98A 1K3UA 2C15A 1SZFA 8XIAA 4LU0A 5EMJA 2WNQA 1UR8A 3A4AA 2Z4GA 3VZZA 3HQPA 2YX0A 3W6LA 4Q7NA 5EL1A 1ME9A 4O1DA 5EMKA 1W9VA 3W02A 1O5QA 5BWAA 1DJZA 2YDRA 3LX9A 1I4NA 1RAKA 3MHFA 4P8XA 2E28A 4AZHA 1YBQB 4A2RA 2NWRA 1W2VA 3E74A 3NZ1A 6REQA 2OYLA 1B3VA 3RG6A 1V08A 2Y7DA 3HF3A 3P84A 4NKCA 3AO0A 4E2BA 1FWEC 3E2VA 1E1EA 4QDPA 4ENLA 1X8FA 5D30A 4LVAA 1V3MA 3S6OA 1GQJA 3T07A 5FJIA 4A8IA 7PTDA 4IWWA 2QCMA 3LGGA 2JF7A 4LUJA 4UXDA 3TR9A 1XLEA 4PMXA 3LCWA 1QR7A 2AQOA 4NAFB 2FVKA 3LSBA 1WKYA 4UOJA 4O12A 3DIPA 4DJDC 4GQ0A 3R58A 1EXPA 3MC5A 4WHBA 1OF6A 3UF9A 2VJXA 5D4YA 4R85A 1GJPA 1G94A 3BWWA 4A6GA 3B3DA 3UY8A 4YTSA 5JQ9A 4HU8A 1ISZA 1KRAC 3W7HA 4TR9A 5I78A 3KOFA 1P0NA 2OSWA 1NARA 4AAJA 4M7TA 2A3BA 5DMLA 1PTAA 3PTKA 3G77A 1TPB1 1KM0A 1AQ0A 4CU8A 2HEJA 4YTRA 1EH9A 4WR3A 3KE0A 3S2LA 3R0UA 3GIPA 4OIFA 2VEPA 2PDYA 4MF4A 5E70A 3EPMA 4ORMA 2ZZ1A 3FV9A 3AHXA 4US5D 5A8QA 4ZZ9A 2VGFA 4K1WA 4EXBA 2Y1HA 3R79A 2FJKA 1KLYA 1WB0A 3MI3A 1C8QA 3I7SA 4XKYB 3NQMA 2BV9A 4R88A 1RR2A 4W84A 2QJHA 3VI2A 5HJXA 3WN6A 2FHFA 1X6LA 1E0WA 4QEHA 2OWCA 1Y5XA 1H63A 4PULA 3SRHA 1NU5A 3WD3A 1LRNA 3H55A 3LZ3A 3I3DA 2A6LA 2R1MA 5HQMA 4QQUA 3V4BA 5G2WA 5U7SA 1FHLA 4K2SA 3VKJA 3W1AA 1E6XM 2V5JA 5CPMA 1V6TA 3GDKA 2ISVA 1AD1A 1P7TB 3SI9A 1YTEA 1JNDA 1MXSA 5AHLA 4GRSA 3EOSA 5GVJA 3WF4A 4XVEA 3F5KA 3W7OA 1NP0A 2O92A 4PCTA 3GG0A 3FN9A 5KEZA 2OTDA 4Q8PA 3PFMA 4RE4A 5HUPA 1DJGA 5G1MA 1K02A 4Q6XA 4AIBA 3EWXA 2CLHA 1AW1A 2JGYA 3TXVA 4L61A 3QY6A 1G4TA 1CXHA 3LHZA 1XDLA 1X7IA 1XKJA 1SSDA 1K9TA 5D33A 3C86A 4JICA 4MJMA 4BHYA 3WLMA 3H12A 4HCHA 2Q6ZA 1GGOA 2JK2A 4KEMA 3NM1A 2OGYA 4LAZA 3I7RA 4B9ZA 1H61A 3OQ8A 1UMYA 3RAOA 1BWKA 4AW7A 3USZA 3WQCA 3OP2A 3LNMA 4NQ1A 7REQA 3QKEA 1HG3A 4OQVA 3AZRA 4K1GA 2VRQA 1Q85A 2D69A 1YDYA 2VCAA 3T44A 3T55A 2YYUA 4IH3A 4QG9A 3WBAA 2ESCA 1V5XA 4UQAA 3SN4A 1WA3A 3UWVA 2BNJA 1DWJM 4LOCA 2VD9A 4Y9MA 4P7QA 3GXTA 1JR1A 3FVDA 4F0RA 5B80A 1C93A 3TQKA 3BICA 1S3TC 2E9BA 3B8IA 1IR2A 2ABBA 1FWWA 4H9YA 4K8EA 5FSEC 3VE9A 4I9MA 1LWJA 2Q8XA 3N11A 2W67A 2PWEA 3BOXA 4JS3A 2WAGA 3OLIA 1C90A 4MWAA 4QNWA 1DWGM 1TB3A 1P0KA 1MQPA 2BOFX 2WNNA 1G5AA 1W3LA 3HPSA 3TN4A 4CNOA 4R27A 4KEZA 1PZ2A 4Q8UA 2IQDA 2E7FA 2JKEA 4M6QA 3SUUA 1HKIA 1XUZA 4HMEA 1DXFA 4CN1A 4J3VA 3INPA 1BTCA 1N2VA 4YVPA 4H9VA 2NQLA 1FXPA 2HPIA 2PLMA 4AD1A 3UA3A 1IEVA 4XZHA 4F9DA 4L56A 1L6YA 1V0MA 3F7JA 4DM2A 3CZLA 2C3ZA 1UZHA 2OT1A 2VVSA 3O05A 1B2YA 1AQHA 1I2OA 5C6MA 4DPQA 4MTVA 5I77A 4W5UA 5RUBA 1F8MA 1UOKA 1A47A 5AC7A 1A3HA 4FOJA 3UERA 2NLIA 1DE6A 1OINA 2DT3A 2E6YA 2V68A 1R85A 1FDJA 1QNVA 3KRZA 4DBEA 4DF1A 5DMNA 5HPOA 1XHGA 1WDQA 4BF5A 4HPGA 5ECUA 4ZVJA 3EOEA 1DWIM 3AS3A 2O7QA 3LG3A 3QGVA 3VGBA 1J96A 4EF9A 1LOQA 2BVWA 1QHZA 3NGFA 3NQBA 1TIWA 2ISSA 3T0TA 1E72M 3F4NA 4L64A 3UEQA 4XSMA 1AH3A 1XISA 2NXIA 1LBLA 3ES8A 1XP3A 3GW3A 1YE4A 3G0SA 4UFJA 5CPSA 4CQ9A 4FS9A 3WQPA 3AHZA 4KT2A 3WDQA 3UG4A 4E2DA 3I4EA 5D32A 3W7EA 3N14A 1V4YA 3HTWA 5I5RA 2E8YA 3GO2A 2V9DA 3JR2A 5I00A 2D3NA 2FTPA 2A2IA 1KGWA 3SCSA 6ALDA 4IQLA 4QS6A 1H50A 1MQQA 1W5OA 3ABRA 1KM5A 1SMDA 4F66A 3MHGA 2OVLA 3GIYA 4GUFA 4QBXA 1HIZA 4GIAA 5JIWA 1AL8A 4ZOCA 2ANUA 4GXWA 1NY1A 4W8BA 3MSYA 1W8GA 4NZ3A 4WK9A 1MI3A 4B2DA 3A64A 2ZKMX 3RLGA 6REQB 5G1TA 3DG6A 5K9CA 2ATSA 4B4HA 4C6CA 4TV6A 4IM4A 5CLTA 2ZIDA 1N8FA 2G41A 4YVXA 4LYKA 1VP5A 3OQEA 1EA0A 1LOSA 3T81A 2HK0A 4WOZA 3LK6A 4A22A 3QH2A 4UTTC 1U33A 4ECLA 3TWBA 4HSHA 5G2IA 4B3LA 2D22A 2DEPA 3TX9A 1XRFA 5MKGA 1XUUA 4JL1A 2V8ZA 4JTEA 4ATLA 2CNCA 3QW4B 3BLIA 4K6AA 1UC4A 4UCGA 4BZYA 2I5GA 4IQDA 2FZ8A 2ODOA 3OJGA 1Y0EA 3W7GA 1RXOB 3F1QA 3M0IA 4ZTYA 1EGMA 1GEHA 3Q4DA 3MI2A 3S1GA 3S5OA 4F4RA 2PSNA 4KWVA 1DV7A 3UJ2A 1FP9A 5I0DA 2RDXA 1DJNA 4DYEA 4J1OA 4S2CA 1O60A 4AX7A 1PX8A 3NZPA 2V5BA 2Y6ZA 1BG4A 7A3HA 3BZJA 3AWOA 4JTTA 4OOUA 3ARVA 2Q71A 5DQPA 1H0IA 1LCOA 3TYAA 3UXLA 3IUIA 3PR2A 2JFEX 3OIXA 4JBRA 4H2CA 1UKOA 1S5MA 1UD2A 2YPIA 3IJQA 3WUBA 2ZUWA 4RKAA 2JE8A 4HA1A 5D38A 5DELA 4GCAA 1E73M 4F40A 3EWDA 3AJ7A 1HVQA 2VGGA 3G18A 3W24A 3GB6A 1PBGA 1KFKA 4RXFA 2Z1SA 5JIPA 1EL3A 3B9DA 4S3CA 2UWFA 1GKQA 1JPKA 3FKKA 1WP6A 4ZGYA 1MDLA 3N2TA 1OYAA 2Z1WA 4PE8A 5DRCA 1KRCC 4E6MA 1MFVA 1R3QA 4GHRA 5FOOA 1CPUA 2NUYA 1MO0A 3C52A 1RP9A 4D6DA 3RHGA 1EQCA 5G5IA 1E40A 1TWZA 1OT2A 4RE3A 4JHMA 5HNNA 1VJSA 3EXRA 1JDAA 1FUYA 1XPGA 3CV2A 4LAMA 4LUSA 4DY1A 1NP2A 1JZ7A 3W0KA 1CGYA 2CITA 1P0EA 2QCHA 2XWEA 2FPTA 3RR4A 1OYCA 4A4AA 1UUQA 5IDZA 4R33A 1E43A 2ZZ3A 3FAWA 3T09A 2V2HA 3ZWTA 2GZXA 4F0LA 4PN2A 4A3HA 1GTEA 3C6CA 2GVYA 4CKQA 2VZVA 2A1YA 2G0WA 4LYPA 3VCNA 2WVUA 2GVGA 5A8MA 3RMJA 1IWPA 1Q3NA 1T8XA 2W91A 1UR2A 3W7LA 4GZ7A 9CGTA 1XYZA 4O1BA 3O1NA 3P62A 3VIHA 3P5ZA 4C1LA 7REQB 1EOKA 4J5NA 3VX0A 4BWLA 4GC4A 5FD0A 3M07A 4FMVA 1U1HA 4ORIA 1C8VA 4AEOA 4Q4MA 1PS9A 2VR5A 2C16A 4O0KA 4IOTA 2ZFAA 1ICPA 1UWTA 1HJXA 3CQJA 5HWNA 3UYIA 2NQJA 2DORA 3CHDA 1J0ZA 2VUNA 1CLVA 2HXUA 3VNDA 3NZQA 1L8NA 3GHTA 1IWBA 3QGKC 4KFNA 2HBVA 1HKWA 1J0YA 4M29A 4AHQA 3U0HA 2CERA 4L6OA 5LSMA 4POCA 2QKFA 4M5PA 2WK2A 3WQ5A 4N6EA 5AHEA 2Y61A 3I7QA 5AHNA 2RDUA 2W0UA 4M81A 3ZR5A 5HPCA 1R3VA 4AD0A 4INFA 3A5VA 2PE4A 4FF7A 1ML1A 2TPSA 1DHKA 1X1NA 1V93A 3IAPA 1TPWA 4KWOA 1W9PA 5DBUA 2G97A 2AKMA 3FYYA 1VFHA 3NEHA 4LVGA 5DBTA 3HJZA 3RIKA 5CJNA 1CGTA 3DKLA 2GYIA 2TSYA 5FJOA 3NQGA 4IPNB 4ZMGA 2QMJA 1YPIA 4YU1A 4IUOA 1BLIA 3KS6A 4AY7A 3SJNA 3APGA 5F2LA 1R47A 3F4CA 1W5PA 4ZQCA 3Q2DA 4CCDA 4W5ZA 4DRSA 2WWDA 2PD9A 1J93A 1SYTA 3QOMA 3MUY1 4AEFA 2W9MA 1J11A 4I5XA 3VGGA 4JIEA 1RCOB 4XAYA 5BOFA 3H6OA 4YYCA 1ZUAX 5AB3A 2G3NA 2INFA 1MYRA 3K8MA 4EPKA 2Y62A 3PS7A 1AMYA 1XFBA 1KCXA 1B4EA 4RZ5A 2QCNA 1XX1A 3QPEA 2ZZ6A 3TEVA 3ZM8A 5EFFA 4P61A 4EKJA 1UD6A 2E1DA 4GQQA 4NZCA 1PKLA 1GOMA 2VOTA 5E9AA 1RV8A 2WMKA 3GK0A 4KCTA 1OSEA 4K7VA 1FBAA 3CAWA 4CNTA 1XGZA 3C4UA 1CLXA 3SY8A 3IRSA 1H62A 4WZHA 4P7OA 4W7WA 4O15A 3WLQA 4CEXC 4I7VA 3S42A 4IIDA 3DESA 2GLKA 2B7NA 4XBSA 4UTHA 4PMRA 3W83A 4AD3A 1LP6A 4WJEA 4K68A 3PHAA 2QZRA 4LRSA 1PIIA 4DB7A 5A8OA 1GYNA 3QLLA 3P81A 2CLOA 3DC8A 1MRQA 1ELSA 3RDKA 2FMNA 1J0IA 3AAMA 2Y88A 3XISA 4A35A 1I2RA 4QITA 1Q4NX 1VJZA 4GWEA 4MY8A 1IWAA 4LANA 3QTGA 4QEEA 2NX9A 4Q22A 1DORA 3A47A 1UR4A 1EWEA 3R10A 2CXEA 3W2NA 3TQVA 5H8MA 2VHLA 5FI8A 2A7PA 1TPVA 1G69A 3A9IA 4MDPA 1SW0A 3G3DA 1QOQA 1ZRQA 3LBCA 5FEZA 3AIUA 3SQMA 4TQTA 1JNEA 2BGNE 4GUIA 5MKGB 5D8WA 3TK7A 1PYMA 4DAIA 2WM1A 1RALA 3SM0A 4JZ5A 1XFCA 2DIJA 3C5QA 2OOFA 1OX6A 4W4QA 1MVYA 3AU6A 3SSZA 3MCOA 4MLRA 5G4EA 1A80A 4AZGA 4NJKA 2Z7KA 3L23A 1K6AA 4DVOA 1NOUA 1QO2A 4YMZA 4DJED 1RHCA 5C7VA 3VNYA 4BK9A 3W53A 2B7PA 4KF1A 2QPUA 3SCVA 2D3LA 3GVGA 4LUTA 3TC7A 4NAEA 4L1XA 2EXOA 4W93A 5E5CA 2Z29A 3C61A 3EA3A 4NJIA 3U7BA 5EU9A 4PUKA 5TBOA 1BSIA 4UTWC 4E2OA 5HMFA 3JRKA 4N6FA 5EBUA 2QV5A 1R2SA 2QVHA 4KESA 2I9UA 3OHIA 1XSIA 2YA2A 4KWUA 2FZNA 1G4EA 1FVPA 3E9AA 1SW3A 4B91A 4H1ZA 3DAQA 4AHOA 1CIUA 3JVAA 4C91A 2HWGA 1BTMA 1IGSA 4Q7IA 2ZX9A 1WDPA 1ZB5A 3CLWA 3FCPA 4YTTA 1RH9A 1S39A 4JIQA 4OBTA 3WH5A 1EJXC 3N2XA 1YX1A 1UWSA 3FXYA 3OVGA 3ZT5A 3VIMA 2CEQA 4PA8A 2C1GA 2VP8A 1ZLPA 3I3EA 4S3BA 2QT3A 3WNOA 4NASA 3OZPA 3EGJA 3OTRA 1W6TA 3GHSA 1PSCA 3GQYA 4ASTA 1NJJA 3EBVA 3WK0A 4R9OA 4JNZA 1JRCA 1VGAA 2HMCA 4LUSB 3QV9A 1S2UA 1ZAHA 4ZTXA 1VJIA 2Y8KA 4X60A 1TPH1 2WZEA 4FNTA 4MYXA 2VZUA 5CH9A 4TX6A 5XIAA 3E0IA 2WLYA 3AS1A 3CPUA 3FA3A 3ZSSA 2BHZA 1X1ZA 2NT0A 2Q02A 5LA1A 3BUVA 1I2NA 2G37A 3TA6A 1DXIA 4DUXA 1V7AA 4ERAA 3MB9A 1DQWA 1GVIA 3VM7A 2UY3A 1UB3A 4G5DA 1H11A 3UZYA 3BAXA 3BL3A 5CBJA 2ZX7A 1AW2A 4WUIA 1QRQA 1GOQA 3BDKA 3TIMA 2YCIX 1JPMA 5KZMA 1FFQA 4HZ7A 1I2QA 1LLOA 1L8PA 3AHTA 1NEYA 2CBIA 2EBNA 3S2MA 3UZXA 3ITCA 2D1ZA 4IMFA 3V36A 4PRWA 3K5XA 2FTYA 4N02A 4AUBA 4PFMA 2QNEA 4A3YA 3WG6A 2Y4SA 2QEZA 4ML4A 3MU7A 4RW3A 4E8DA 3CXOA 4ZO8A 3RO8A 4NZJA 1T7LA 5BROA 1N8IA 4F48A 3TJ4A 1QNQA 3T7VA 3VIIA 4RNHA 3LRLA 1M65A 3IS4A 5AOUA 5KZEA 1IXPA 1FWFC 2E5DA 5AZ0A 4XISA 3BAJA 1SZNA 4QXIA 3RO6A 5BU9A 5F1VA 3APYA 4QQ3A 4W7UA 2Q8LA 4CUCA 4D9PA 1HKKA 3PZTA 2Y2WA 2PWGA 1ZP4A 3IK2A 1Q7MA 4E8CA 2WBKA 4C6JA 3TFXA 1AMKA 3SJ3A 5C5YA 3HOJA 1KTNA 4B5WA 3R5EA 1RVKA 4GJIA 4RZ6A 5C9UA 4E8GA 2DIEA 3THUA 1SO3A 1XLDA 3PC0A 3WH9A 5D2YA 1JGMA 3O6CA 1KM4A 2BX7A 2J7BA 2PWUA 4JTDA 3GNPA 4XZLX 3WLJA 1QOPA 3UGRA 2CKSA 4M19A 1WDDA 1ENUA 4RDZA 3F4DA 1E0TA 2G3MA 3K4AA 2W6RA 1AFSA 3O2LA 4B5NA 4O14A 1D3HA 3GDRA 1MUCA 1S5WA 4LV4A 3CHFA 2VFDA 3ITXA 1O5XA 3M43A 3MBFA 2X16A 1ZBWA 3B9AA 3F2BA 3T4WA 4C6MA 4ZL1A 3PJTA 4DO6A 5F4SA 3E0LA 4QAWA 4F0KA 1VCGA 3PZOA 4PB3A 1H41A 2C0HA 4FNUA 5D05A 4PMNA 1B3WA 5DANA 4ZQMA 3LCHA 5CXPA 4E3TA 2JBMA 4JTKA 4C7GA 1LQ0A 2GK1A 1QATA 1IT8A 3NA8A 5BXTA 4B3KA 2H8ZA 1OIFA 4I3GA 2ASHA 2TAAA 4MADA 2DZPA 2FGBA 1TV3A 3CQHA 1KTBA 2A7NA 1IR1A 3H21A 1RJPA 1YYAA 2C91A 2BY0A 3UPBA 4U3AA 1PTGA 2YCJA 2HNEA 3GYCA 3WNMA 2OJPA 1XCWA 4MM1A 3H4XA 1GOKA 1C92A 2QYGA 5K2ZA 3WMBA 4WDUA 3WLLA 4HNOA 2UZ9A 1W1PA 3AOFA 4CQDA 1LORA 2Z00A 1ZY9A 3GU2A 4YPJA 1TVPA 5A2AA 3ATYA 1TJ0A 3P7YA 3N25A 5E1QA 4ZFCA 3CMJA 5I06A 1BKSA 2J88A 4EX4A 3TA9A 4HN4A 3BAIA 4C1KA 4RK8A 4CQAA 4MY1A 1YNQA 1IHIA 3WY1A 3QV6A 4P2VA 4EPBC 3G1SA 3VIPA 5DMYA 3G8EA 4H7VA 3DX5A 2XWDA 1UA7A 3VDGA 4WGHA 5J5DA 4B5XA 1F73A 1EUNA 3MBDA 3TROA 2BOGX 2ZUMA 3N9KA 3W71A 2JALA 3QY7A 3P0WA 2FTWA 3GVVA 2ZTJA 2R24A 1XLGA 1GHRA 4JYDA 1I0BA 4FX8A 1OK6A 4MVAA 5D2VA 4GBUA 2RUSA 3B4YA 3NAVA 1RBOB 2GGGA 4LUTB 4NAEB 4UQ9A 2PP1A 1TMQA 3EWCA 1EEPA 4KCVA 4JCLA 2XH4A 3L7RA 3QMRA 3DC0A 4X63A 3TZNA 1KTCA 2PLCA 5IXEA 3GZAA 4W87A 1TX2A 3WFAA 1S46A 4UQEA 1GQKA 2FZBA 1EJ7L 3NOEA 2YXGA 3SB0A 1HL8A 1LQ2A 1ONRA 2V3GA 5JU6A 3ZO9A 2WBGA 3I6TA 1KXVA 1EWDA 3MKKA 3WF2A 3KOYA 5CZJA 1FKXA 3KM8A 3UZZA 3L5LA 2V5LA 1XV8A 4MPQA 4N9CA 4ADUA 3G0XA 1EX1A 3NNTA 5CPOA 3LHWA 1XW8A 2XGIA 5XINA 3BPWA 1S1RA 4N4QA 3EDDA 1F5ZA 1ZZMA 3D0CA 3NQ6A 4AZ7A 1R3WA 2ZE3A 4HYWA 1IGWA 3CK5A 5F2MA 2GUUA 3TN3A 3QLDA 4MG4A 2BDQA 1YDVA 2CWNA 4P5UA 2VYOA 4EPDC 4ICCX 4EF8A 4TVUA 2QQ6A 5LNWA 2NW0A 3KVLA 3TYCA 3HQNA 2RHGA 1EOMA 1GQNA 5FACA 1TRDA 2V5CA 4UFKA 3OBAA 1U1UA 5IDIA 4G1KA 3P14A 3AJXA 1H5YA 5I3FA 1WAUA 5IOBA 1ZBCA 1QOXA 1WNOA 5FEXA 2GUYA 4ICNA 4DO7A 2B81A 1OZMA 1UWRA 5LIWX 3VOGA 2P76A 1V8EA 5CG7A 1TX0A 4ACZA 2Y24A 3A3XA 4QLLA 3BLFA 2W66A 3DKJA 5FA5A 4PCNA 3BLOA 5EBAA 3FIGA 2E09A 1F4HA 3H7VA 1XCFA 4HK7A 5PTDA 5LNVA 3FHQA 1JDCA 2P8BA 1PL9A 2WJZA 3CWHA 2FZDA 4GMEA 3MUAA 4GKLA 2D2HA 4BFAA 3VMPA 3PY2A 3CYJA 1HX0A 2HV5A 2WSYA 4UZUA 4ZQRA 3PB2A 2RKXA 1VYRA 2Y85A 3IJ8A 1ICQA 4R3UA 3E02A 2GGJA 3PTQA 2NSXA 1UJPA 3MSGA 3GNRA 2DGAA 3F5LA 2FH6A 1TMHA 2OX1A 3S9IA 2DPEA 4TMCA 1JI1A 4W86A 1XICA 5AECA 3KL3A 1T5AA 1F2JA 4DF0A 1BYDA 3SN0A 2CZFA 5DX7A 3CH9A 2J77A 1PPIA 3VDCA 4LY8A 4GYPC 2YCLA 5ABTA 1HZYA 4HYVA 1AW5A 1OZQA 3K1DA 1W5NA 1CW2A 6XIAA 4MWAE 4PCFA 4Z1BA 5AVNA 4WQ6A 4HNCA 4NI3A 1HJVA 3CV6A 1C3FA 3C2RA 4LVDA 1N8WA 4EK7A 1FH8A 3W6MA 1QI4A 3BURA 5DEZA 5AC8A 3LBOA 4YNGA 3K13A 4E38A 5I23A 4Y6GA 5CC5A 2WQPA 4WY0F 3CZEA 2UV8G 4IFKA 2V3DA 4ZQPA 2R1LA 2VFEA 2E6DA 1G01A 1OBAA 1SQ7A 1U2YA 2PRHA 2PDPA 2AQVA 4WKHA 1EUAA 4GE8A 4R9XA 1PYFA 1U5HA 4ATWA 3U7VA 2Z6IA 1XRSA 2NWSA 2POTA 5HBFA 3ALFA 1HJSA 1DHPA 1VBGA 1TWSA 2I57A 4S3GA 2CHOA 1FWSA 5MHBA 5I24A 2F2KA 2NV1A 3EMCA 2BB0A 4YYFA 1FWBC 2J8TA 2O9TA 1AG1O 5BYWA 5HR7A 2ZXQA 3DG3A 3LM7A 3CEUA 3IK4A 2J47A 3KTCA 2YLLA 4ROQA 3GWQA 4GX8A 8A3HA 5SWUA 4HHPA 4KCWA 4NRRA 1CWYA 1XBVA 5A6KA 1DIEA 2WJEA 2VRJA 2GK1B 1UP3A 1GZ1A 4BI7A 2Y7FA 4EVZA 1KD0A 5F4XA 5EKYA 1M41A 1SO6A 2VFGA 1OCBA 4ZSTA 1EQPA 4GI6A 5MF5A 1LL6A 4Q8VA 3TVAA 1ZAJA 2WC4A 2WYSA 3VCCA 4GACA 3L12A 2DDXA 5EMYA 4PTNA 4JTSA 4GNKB 4RE2A 2VTFA 5FJJA 4O13A 5AN7A 4UFIA 3V0UA 1B3XA 4O28A 2PPGA 5AFDA 3UR8A 3NXFA 3B04A 1FTXA 1JZ8A 2KAUC 2R9RA 1FFRA 3K30A 4GYJA 3V3WA 2WHJA 2P5NA 4MZ8A 3T2PA 1EIBA 1WE5A 3MS8A 1BSLA 1W17A 3LCLA 9XIMA 3GLCA 2PDWA 4JX4A 2Q8ZA 3TU9A 1SJBA 2QCFA 1JF5A 1XD0A 1PAMA 1UHVA 3GBDA 5JUVA 4XG1A 1CXEA 4PSRA 2WHKA 2D0GA 3R11A 3AIBA 4Q8WA 1UBPC 1Q6LA 3CGTA 1R38A 4DUOA 1HO4A 1YPXA 3IRDA 4G2DA 4DIAA 3WBXA 5HJYA 3UQNA 4MHBA 3MW7A 1S5NA 5G4WA 3TOYA 3AIVA 4M1RA 3N2MA 3CPRA 2YL9A 3G3MA 1DQUA 1LL7A 3KBJA 4I90A 1H09A 2XDFA 3P6LA 3PUOA 1JXJA 4XD5A 3L0NA 2QMKA 2X7WA 3F4VA 3C2VA 1OFOA 2EJ1A 2G3FA 1HP5A 4Z1AA 4S39A 1UZ4A 3SFKA 4WDWA 3R7MA 1UH3A 4D1JA 3W1UA 2VRKA 4O1EA 3CHEA 3CV1A 3RLVA 1NH6A 4N7QA 4C7FA 3RJYA 4L9XA 5GNYA 1IEIA 3OYXA 3ITTA 5DLCA 4PMVA 5A94A 3L4VA 2XFYA 3U2OA 1F76A 2CLKA 4WEVX 1HN1A 3VZXA 4O52A 3PUEA 3GU1A 3TP4A 2ISWA 3EX6A 3L2IA 4X2RA 4IICA 2NQ5A 3B9EA 2VVNA 4DLFA 4LNYA 3LLXA 1MXDA 1KFLA 4GGBA 3CTLA 2XGBA 4YVVA 8XIMA 1XG4A 1UWUA 2QUNA 3U8GA 1PUDA 4X22A 3NQ8A 1HTIA 1JCJA 2YBTA 2NV9A 3ZSTA 3T8LA 1X97A 1BGGA 5ABFA 1KC7A 1Y8BA 2E67A 1X39A 1GVEA 1XD1A 4FX7A 1K9DA 3QTPA 5AZ1A 3PZVA 4KQNA 2QR6A 2VXNA 3K46A 3S1VA 5FJRA 3V0TA 2CIPA 5T91A 3AMKA 1W1B1 4NZ4A 1KO0A 1Z6KA 2HISA 1VBUA 3H4GA 1TFVA 1Q4WA 3L4ZA 3P82A 4XD6A 1G67A 3QPYA 4WVXA 3M0JA 1KB3A 4GABA 1NTHA 3HV9A 4KEUA 3PF3A 1E0XA 1XC6A 4JL2A 1YW1A 3HG5A 1R3YA 3C0LA 2DVXA 4PEKA 4PSPA 3BCJA 1CXLA 1I60A 2WJDA 1NFGA 1V6WA 2VEIA 4ZXLA 5CC6A 2H8XA 2FB3A 4JY9A 4ACZB 4D6FA 5FJPA 1TUXA 7ODCA 4DXKA 4N9BA 4ADSA 2PD5A 1EBGA 3E6EA 1KM2A 3BAYA 5BWFA 4GO8A 1A3XA 2W3ZA 1I6NA 3NWRA 1Q6FA 2XSXA 2W92A 3LXCA 4YXGA 3ES7A 2J7HA 2FH8A 4OGZA 3RCMA 3S5YA 2YA0A 3UBPC 2HK1A 4IIEA 1QU4A 1PWMA 3NO5A 3LI1A 4JQ1A 5D9NA 1SVDA 5FF0A 5FL1A 2ADAA 2QUMA 3QC3A 4PB5A 2ZRXA 4IQEA 1P0BA 1RJRA 4FR1A 4ONVA 2FVLA 4US6A 2F2HA 3UYCA 2OG9A 3CL6A 2XH0A 1GORA 4C6OA 3AYVA 2Z24A 5EFDA 3W23A 3R6IA 5CPTA 5HK4A 2YYTA 2J74A 3WSUA 3NQ7A 4CEUC 4AMAA 1GPWA 2YCLB 2VI0A 3TOPA 3K8LA 3KS5A 1C7TA 2CYGA 4DZAA 2XIMA 3QN3A 1A53A 3ITLA 4WOQA 3SRDA 3ZLGA 1XLFA 2PDNA 4UUIA 4KERA 4L9ZA 4F8XA 4KRZA 3WCZA 4PFHA 5FCZA 3SN1A 3KP1A 3QFEA 2CLLA 4R7OA 4JHZA 1R5YA 2P0IA 4QX4A 4ZOBA 3TNBA 4DWSD 4CQBA 3LMZA 1ONXA 3MJYA 2DUAA 1LZOA 3VDHA 5CAHA 4IFKB 1ZENA 2VX4A 5GJNA 4DJDD 4KWWA 5C2CA 3SRKA 3V1HA 4NP7A 2GOKA 2XIOA 3WQVA 1TV8A 3QMTA 4QRNA 3IGHX 1TELA 3G1HA 4HPJA 3ITOA 2O56A 4AC7C 3WNNA 4NL1A 2PF0A 3BQ5A 4GY7A 3MQTA 3H2EA 1JPIA 2BOEX 1DE5A 1KKRA 4HT3A 2IXUA 3S6DA 4LYQA 4UFMA 3EXSA 4WD0A 4Q8OA 4RNJA 4D8ZA 2WKGA 2ZYFA 4LUYA 1E1CA 4Q3MA 2PI6A 1GVQA 4BF7A 2IS7A 1V3IA 2A3EA 3S8HA 4IG2A 1Q5MA 4QJ5B 4JHOA 4YTQA 2Y8VA 4L9YA 4MAZA 4J40A 5C54A 2WB5A 5D2TA 1P0DA 1O7AA 4JN6A 4MWAC 1I2PA 1ZFJA 2C0AA 1W9XA 1FWJC 3ZLHA 4FLSA 1VH7A 5AVHA 2XFRA 1RPXA 3SURA 3SSJA 4Q8TA 4J2PA 4UZSA 3XIMA 3WNKA 3W2LA 3BMXA 4MY9A 2D2GA 2A3CA 4FALA 3TTSA 3UVIA 3Q67A 1YQ2A 3BJSA 3XINA 4CNPA 5LIYX 4ZBCA 1ESWA 3BARA 2Z28A 4IISA 3PJUA 4GLEA 2OKOA 3EWBX 1DJWA 1R30A 2BHUA 4C7DA 1UD8A 2BTMA 2FLIA 3O6DA 2OKTA 1XPYA 1WZAA 1OY0A 3GVWA 1W3NA 1DJQA 5EB8A 4RJEA 3ERPA 1ZALA 3NQFA 3GE7A 3UD6A 2R91A 2ZUSA 4B16A 1EPVA 2Z6JA 3WDJA 4GZIA 1PZ3A 3PFRA 4DXXA 3BLLA 3BSMA 3LNPA 1QK2A 4MZYA 4YJ5A 3AZSA 2Z0IA 1JI2A 2VT0A 2PP3A 3OEXA 3QHOA 4QM1A 3BO9A 4RPPA 1KM3A 4JQ4A 1VCFA 3SR7A 2WVVA 2R1KA 2PURA 3HQOA 4FZIA 3NEVA 3EX3A 1A3WA 1VF8A 4XVDA 5A6TC 4HNLA 4QG6A 1A5KC 5CJMA 1RQHA 2DP3A 3CM4A 3VNMA 4NXSA 5HOSA 1QI2A 3AXKA 5EMUA 3BK0A 4H6KA 3L0KA 5DCBA 1OFEA 3GTNA 1SJCA 2XHYA 1VQTA 4H9ZA 1KGUA 5DCDA 3EWUA 1NQKA 3KRUA 3KBVA 5LXXA 4KKXA 3SW6A 4IFRA 4OOZA 1FCBA 3T6CA 4V1XA 4D6HA 4GINA 2F9RA 4YHEA 3U2EA 3P2VA 3IEBA 3B8TA 1OFBA 4MKNA 5I3IA 1QWGA 4J3UA 4XQ6A