3INPA

2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
218
Chain Sequence
b'HIQINPSILSADLARLGDDVKAVLAAGADNIHFDVMDNHYVPNLTFGPMVLKALRDYGITAGMDVHLMVKPVDALIESFAKAGATSIVFHPEASEHIDRSLQLIKSFGIQAGLALNPATGIDCLKYVESNIDRVLIMSVNPGFQKFIPAMLDKAKEISKWISSTDRDILLEIDGGVNPYNIAEIAVCGVNAFVAGSAIFNSDSYKQTIDKMRDELNKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords D-ribulose-phosphate 3-epimerase
publication title 2.05 Angstrom Resolution Crystal Structure of D-ribulose-phosphate 3-epimerase from Francisella tularensis.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Isomerase
total genus 77
structure length 218
sequence length 220
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2009-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3inpA00
3TNOA 4A29A 3NQ2A 1GTHA 3B06A 1LDCA 3M7WA 5I3HA 3KX6A 4O8RA 3GDRA 1UUOA 3C2FA 3EWUA 1XBZA 4CNNA 3PM6A 1YDNA 2E6AA 1JCLA 4UR7A 2V9DA 2ABBA 2B7NA 3I7RA 3INPA 4MVAA 4DO6A 3TKFA 1SO4A 4UTMA 4EF8A 2WNNA 1Z44A 1GT8A 1TPEA 2CLKA 3CWOX 3O16A 4ZMGA 1G67A 3W76A 3W2MA 4GC4A 2WNQA 2NLIA 4LY8A 4AWSA 3FFSA 1DHPA 3DHDA 4JN6A 4MLJA 3LCWA 1FWSA 3B0VC 3IEBA 3STEA 1ZALA 1KA9F 1FDZA 3MUXA 3O07A 2NXGA 2VEIA 3BGGA 5AC6A 3UYCA 4IMGA 3IV3A 3F4NA 3DBPA 1QPRA 3QSRA 3HGSA 1EWEA 4MLRA 3CEUA 1LORA 1TV7A 2GPTA 3GK0A 3NPVA 4BI7A 1TQXA 1V5XA 2QF7A 5DY2A 4MPQA 2V2DA 5G4EA 2QCFA 1KTNA 2R94A 1VHNA 4MFEA 2VEPA 5C2XA 3DXIA 1TYGA 1R47A 1G4EA 1EPXA 1U5JA 5F1UA 2YR1A 3Q37A 4E38A 2ZRVA 2FB3A 2OJPA 1K3UA 4RLIA 3TR2A 3NEVA 1IIHA 2PURA 1H7RA 4FNUA 2OMAA 1YDOA 3FIGA 4NT0A 2RDUA 2CLFA 4MZYA 2JBMA 4TMBA 3WJXA 3P80A 3LRMA 3PB2A 1F5ZA 3FA5A 3DH7A 3P84A 4UTWC 4K39A 4N9BA 3W7OA 4EF9A 3I7SA 1R2SA 2Y88A 3ABRA 3TMQA 4K37A 1ZAHA 3MYOA 1NAL1 3HJZA 4N6FA 3W1MA 1OVDA 1XUUA 4DPPA 4UNKA 1F76A 1VCVA 2ABAA 3IRDA 2ZRXA 2NZLA 3NPXA 4YWIA 5BNKA 5LGZA 3CQ0A 4GNJA 3KRZA 3TW7A 1AW2A 3LERA 2Z2UA 3CTLA 4UCGA 3LRLA 3FJ6A 3U2OA 5CPOA 3G24A 1TO3A 3W1UA 1WXJA 2YPIA 3DFOA 4I7VA 1EP1A 1QAPA 3CU2A 1O5KA 1EWDA 2J9XA 2Y61A 1GVQA 1LLWA 2BLEA 2ZZ1A 1GVRA 1SO5A 2ZZ2A 4IXXA 4H6KA 3A21A 1QOQA 2GUUA 2C19A 4NJIA 1QCWA 1PE1A 2JK2A 1W5QA 3P62A 3EWYA 3GR8A 4LC8A 1IXPA 1LBFA 2TMDA 3NQVA 1QPOA 3W72A 2J9YA 1Z41A 1H60A 2CLOA 1JRCA 2A4AA 3DFTA 1O5XA 5GVJA 1B4EA 4CNOA 5KINA 4JTLA 4WY0B 1WV2A 2W6RA 1KFLA 4HN4A 3TSDA 3L66A 3QFEA 1EUNA 1YTKA 3IGXA 3RLUA 2GJNA 4LNYA 3STGA 1MXSA 3NQCA 2R14A 1X8FA 1NF7A 5K7JA 4NX5A 4UTTC 5FEWA 1OFDA 3WK3A 1HFBA 2NV1A 5D04C 2XN1A 3RK8A 3GYEA 3M5VA 2ALDA 4AVFA 1QFEA 5U7SA 1BKSA 3LXAA 3DI1A 5G1YA 3PUEA 3T78A 2WV8A 1W3NA 1XDMA 1PHWA 3NOEA 3R13A 1OJXA 1W1ZA 2ZTKA 2ZZ4A 2JKPA 2X30A 1ME8A 1K03A 1ICSA 3MBDA 1YDVA 4AHQA 2D73A 4RCXA 3FS2A 2VXNA 2FJKA 2GVGA 4I7UA 1SSGA 1W3TA 4R7JA 4LOCA 1X1ZA 4YL2A 3HGRA 3PUDA 1RQEA 3NM1A 1R30A 3G0SA 5F2MA 5KTLA 4HHPA 5LNUA 2Z0IA 2AQWA 1EP2A 4OE7A 3LGEA 5D2VA 2VFEA 4QISA 1H7PA 3KOFA 5H91A 1TV8A 4WD0A 3S5YA 2DZVA 1RV8A 2QUTA 4OT7A 3L5LA 1GG1A 4UTIA 4C1LA 5FF4A 2VC6A 3S5ZA 5G5IA 4JTFA 1LRTA 3BW2A 3D0CA 4BF9A 3W71A 4FNRA 4OV9A 4JICA 4XTIA 3P60A 3I6RA 3UQNA 1XCFA 1VPXA 4MY1A 1LP6A 3DKLA 1WQ5A 2JKEA 4ZZ9A 1Q6OA 3G1DA 2QAFA 5BMWA 1M7OA 3MHUA 2BZNA 3WJYA 4MKNA 4B5NA 1SR9A 3SR7A 1KM2A 3NQFA 2JKAA 5D02A 4HIBA 5FESA 3TCEA 2ZYFA 4DF2A 1KV5A 4NJJA 1DKWA 2PE4A 1OABA 1SQ7A 1IXQA 3E12A 1IXOA 3TA6A 1CW2A 3O06A 4BWLC 1W8SA 1K8ZA 4XKYA 2FPVA 3RFAA 1ZNNA 2A7PA 3TAOA 1W37A 4PTNA 1NF0A 4BFAA 3LCXA 4LS1A 4RX0A 5CZTA 4CQ9A 1RPXA 1DJNA 3C56A 2ZFAA 1FCUA 2R91A 3EWBX 4O16A 4O11A 4ML9A 1JR1A 4Q32A 3RU6A 3PAJA 1SZGA 4DEFA 3LBCA 1GYNA 1O4UA 5L9FA 3QH2A 3BK0A 2ISWA 4FO4A 5EL1A 4GUHA 3HIJA 4HPJA 3R8RA 1TCDA 3A5VA 4AHOA 3S0CA 1HL2A 2VOMA 2Q8LA 2NWSA 3PWAA 2H6RA 4YMZA 3PC0A 2H8ZA 2I1OA 2R8WA 4MIMA 3W6YA 1ICQA 5K9DA 3W23A 1YYAA 4LW7A 2DZUA 3MP4A 1B3OA 2DZPA 3GKFA 1OFAA 2DJLA 2OCZA 2QCLA 4JY8A 1TRDA 1SSDA 5C5YA 4XZ9A 6TIMA 3AJXA 4ORIA 2V8ZA 4ADUA 1TJPA 1ME7A 2V5LA 4UNLA 3TXVA 1N55A 1TPB1 4FIQA 3E02A 1JCMP 5HINA 2V2HA 2YX0A 3W1NA 3UPWA 3YPIA 3NL3A 3HPSA 3OVRA 1QO2A 3S9YA 3NQMA 4AH7A 1FWRA 3I7QA 3OG3A 4LVAA 4W9TA 1VLWA 3PBUA 4UTUA 4JDBA 1OFOA 3LV6A 5BMXA 2C1HA 3W1AA 1I2QA 5DBTA 1Q3NA 3KVLA 5LZLA 1LRNA 3EWXA 4GXMA 2A7RA 3M41A 3W3OA 1DVJA 2ISVA 3NL2A 4O54A 3GR7A 5I3FA 2JGYA 1K7FA 1MEWA 3UD6A 1NVMA 2G95A 3ELFA 3N34A 4O4WA 1THFD 1BWKA 2J27A 4NNAA 1WYIA 2NUXA 1W0MA 3M47A 3O15A 4NZFA 2F7FA 3TSBA 5K4ZA 1MEIA 2PC4A 1ICPA 3B05A 4RK8A 5K3VA 3NQAA 3LM7A 3PSVA 4EVZA 4FNQA 3H53A 4QITA 1QPNA 4MZ8A 3TMLA 4RZ4A 1H7XA 4DPQA 1KM5A 4JDYA 3GXTA 2DZXA 3E96A 2CLHA 4Y90A 5EPDA 2C16A 2RH9A 4S2BA 4XBKA 2QEZA 3PB0A 4JTSA 3LI0A 3RF9A 5HR7A 3P5ZA 1X6UA 4O1AA 1TREA 3M16A 3QJAA 3LXCA 2ZDRA 4CCDA 5CZ0A 3W7PA 3NQEA 4TR9A 4O12A 2WO5A 1KV8A 4IMDA 3N2XA 3C2VA 3A23A 4MOZA 1OYBA 2NWRA 1Z42A 1XFBA 3LXBA 3S6DA 1QNVA 1KFEA 3TSMA 2QUUA 3NPWA 3WJZA 2E68A 2BXVA 5EBUA 3LTSA 4JYEA 2ZCGA 3LLFA 3GNNA 1SW3A 4NUWA 3M0ZA 2JGQA 4ADTA 4FHAA 4ZQOA 2KZHA 4Z0SA 2HS6A 2E5BA 3C2EA 1X7FA 5BW6A 4G1KA 4O28A 3LHUA 1H62A 3Q2DA 1U83A 4HSNA 1GVSA 5AHNA 3KRUA 4ZQCA 5MHBA 3QMSA 3LCFA 3G1HA 2Y70A 1MEHA 3KVKA 4UMAA 3IIVA 5CSSA 3RMJA 3SGUA 4MYAA 2IQTA 1EUAA 4MFDA 3OVQA 4JR5A 4IPJA 3JR2A 2W79A 3VE9A 4S2CA 4ZQRA 4JY9A 4WZHA 2VFGA 1AG1O 2Y7EA 4I7WA 1PL9A 2EPHA 4O19A 3MW7A 1B4KA 1ZY9A 1T0OA 2YCEA 3ABQA 1UJPA 4RKAA 4KWWA 3P7YA 4JD4A 1VYSX 1LROA 3LX9A 1ZJIA 3QC3A 5F4XA 5CKSA 3W2NA 1ADOA 1JVNA 4K38A 3CC1A 1W5PA 3DFQA 4PL1A 1OX4A 2CW6A 5HWJA 3MJYA 2CZEA 2EHHA 4GRSA 4JYDA 2H3DA 1OHLA 7TIMA 3W7MA 4LT9A 5T26A 4AWUA 3W85A 2CLLA 2FDSA 3LTYA 3WJSA 1I2NA 1VH7A 3W7KA 3NYZA 3CB8A 3QQ0A 5K9XA 1S5WA 1MO0A 2QCDB 3LRKA 3BW4A 3LCHA 1A5CA 2ZZ7A 4ZVJA 3NO5A 3S1VA 2AAMA 2E6FA 2VKZG 4NXSA 3M44A 3N19B 4HNNA 1JRBA 4A22A 1M7PA 1VYPX 1SUXA 3IVTA 4JTUA 1A50A 5DELA 3L68A 4IOTA 3EX1A 3CEPA 3IIOA 1EB3A 3U6WA 2QCMA 3EX4A 4JTTA 3GZ3A 4N9DA 3M43A 5FEZA 1B57A 1TB3A 3NM3A 1A53A 3FYOA 4EOUA 3MHGA 1L6YA 5AN7A 4QNWA 3C6CA 3N9SA 3W1LA 1IXNA 1FXQA 1I2PA 1EX5A 4E2BA 4AAJA 5I3GA 1LOQA 1TPC1 4M6QA 3UPBA 3TDFA 2V5BA 3NGJA 1TJRA 2Y85A 3C3NA 2VFDA 2WSRA 3BARA 4UXDA 1KLZA 1FDJA 2CLMA 2FIQA 5F4SA 4M6PA 1JCYA 3T4CA 1FY6A 1PCWA 2DZTA 4XBSA 1O94A 3CIXA 3O6DA 1LZOA 3L0KA 1NFBA 4ZQNA 1F73A 5C6MA 3TX9A 2EKCA 1IGSA 1ML1A 1TTIA 1P1XA 1IIGA 3W7IA 3BO9A 1SU5A 4AEOA 1JJKA 1T8XA 3QZEA 3STFA 1OFEA 4IPIA 5IBXA 2RKXA 2XN2A 4X9SA 4P2VA 1AK5A 4K36A 1X1OA 3IVSA 2DZWA 2RDWA 3PS7A 4O13A 2YYTA 2P0OA 1RZMA 3H55A 4WY0F 5EY5A 4YCPA 1XC4A 3QPZA 1RD5A 2H3BA 2OT1A 1JQVA 1PVNA 3DGRA 3HMJG 4BK9A 5HWNA 4O15A 1P0NA 3C52A 4AXKA 3B04A 1LOSA 3B03A 4GUIA 3PUOA 4GJ1A 2NUWA 4DO4A 3L65A 3G1VA 3VCRA 3BV4A 3W1PA 3LI1A 4Z1AA 2RFGA 1H63A 2W0UA 4ALDA 4AWTA 3NR0A 3EKZA 5DLCA 1P4CA 1XI3A 2TRSA 2A5HA 4Z1CA 3W86A 2YYUA 1I2RA 3GDMA 3QPYA 3W83A 2WJZA 4Y96A 1DL3A 4WQ6A 1HTIA 3QMRA 2P10A 4JTJA 3HG2A 4DBDA 3JRKA 2NX1A 4JTIA 4JGDA 3TIMA 2V30A 1A5AA 3FLUA 1BWLA 1SZFA 5E0KA 2WSQA 3S42A 3L0GA 3LHYA 1KFJA 1Q6RA 2ZRWA 2TYSA 4O0ZA 4XUGA 4IX2A 1YTDA 4DXVA 1YADA 3L9CA 4MJZA 3W1QA 2QDHA 3N9RA 1R46A 1CI1A 5DCEA 1JUKA 3LOTA 2HS8A 4K7VA 4UFMA 1NEYA 2QJHA 2Y63A 3FKKA 4RXGA 3W2JA 3W75A 1ZCOA 3IIXA 2YFNA 1AMKA 1QDSA 1LCOA 3O05A 2QJGA 4WOQA 3OHIA 3C2RA 2GQAA 3S1UA 3BG5A 1KTBA 4RZ5A 3PY2A 5G2HA 1G69A 4EWND 4UTKA 1JUBA 2PCQA 3F1QA 3QYQA 3G18A 1VC4A 4DF0A 1J2WA 2VEKA 4BI5A 5FEXA 1S3HA 4LVGA 4O0KA 4IGHA 1TPDA 2X16A 3W84A 1SFLA 4QIUA 2E77A 3DKJA 3LCIA 1EA0A 3P67A 1ME9A 4UFJA 5L6UA 3NAVA 3LCGA 2QJIA 3FKRA 3Q94A 1VR6A 1RQBA 2CWNA 3W70A 3NL6A 2NX3A 2RDTA 2ZTJA 1GTEA 3NNTA 4UUIA 1F74A 5DBUA 1SO3A 1VYRA 3M5ZA 3PBYA 3R89A 4RXFA 3TC6A 3OEXA 3FEMA 4N2YA 4TMCA 3VE7A 5I3IA 1YXDA 2A7NA 1KM1A 4OWGA 2PRMA 4FIRA 2NUYA 4MUZA 5D05A 5HUPA 1I4NA 2CZDA 3R5EA 4NZJA 4K7YA 1DQWA 1A5SA 3KXQA 2QCHA 4AF0B 5EYWA 3ZR4A 4LRSA 4O18A 4M19A 1ALDA 4A21A 3W7GA 2C0AA 4TX9A 1OFBA 3E9AA 2X1RA 5LKYA 3SY5A 4OV4A 2YW3A 4DBEA 1OYAA 1TTQA 3W7NA 4LU0A 4ICNA 3IIPA 3CHVA 4JTKA 4FB7A 3M1ZA 3NZ1A 3NDOA 1VS1A 3O1NA 1GPWA 1G6CA 3IGSA 4HNTA 3TROA 3I68A 4LV4A 3M5XA 4JTHA 4FF7A 5CPMA 2A6NA 2Y6ZA 3G1SA 3SW6A 1AL7A 4C1KA 5HUOA 5FF0A 2DORA 4YLWA 5D37A 2Y62A 4UTLA 3UWZA 1FWTA 1K8XA 3R12A 1KTCA 1F6KA 2VEMA 4CNPA 3C4UA 3Q58A 4CCEA 1W31A 3LLDA 2ZA2A 5IBXC 1GOXA 2RHGA 3W87A 1UASA 1HO1A 3C2OA 4QSHA 2J6XA 4X3ZA 1VGAA 3DAQA 3H54A 1VQTA 4NNBA 1XKYA 1Y0EA 4FNTA 3TJLA 2A21A 1XBYA 2VFFA 3QM3A 3BG3A 1OX5A 4IWWA 3PR2A 5F2GA 3NXFA 3S5OA 1OFPA 3UNDA 3ZWTA 2VFIA 3MYPA 5HWMA 4KWVA 1QO5A 5KITA 5E93A 3QQ1A 3MMTA 4R53A 2WSYA 1P5BA 1SPQA 3OVPA 3C61A 3W2UA 3TQ0A 3LDVA 2HTMA 3G3MA 1W5MA 5D2WA 2WPBA 1G4SA 2J24A 4NJKA 2B0MA 3C0JA 2QKFA 4UR8A 1YXYA 4FEZA 3W7LA 3OBKA 1RQHA 5C54A 5LHFA 1P0KA 3M9YA 2VFHA 4O1BA 4HSOA 3GAKA 3T55A 1MSSA 4LS2A 5BRBA 3UXDA 1WA3A 3I65A 3TXZA 3VFLA 3GLCA 2B7QA 5LNSA 3HBLA 2Y89A 1W3IA 4UTJA 4XQ6A 1SFJA 2E5DA 4TO8A 5KZEA 3EB2A 4RZ6A 2X1TA 4OQVA 5I3JA 5D2XA 2QCNA 5FF3A 3EXSA 3ZS4A 1OFQA 3HGJA 3L2IA 4UC5A 1TQJA 2ZZ6A 5CG7A 3MI3A 3E0IA 5EKYA 3EX6A 3BLEA 1GWJA 1VCGA 4M7SA 3L5MA 4O50A 3GKAA 3A9IA 5AHIA 5D33A 1GJPA 4X2RA 3TE9A 1XXXA 3W7DA 3MP3A 4LVBA 3QRHA 4O14A 3THQA 5BOOA 1FCVA 1DJQA 2CLIA 4IMFA 5AYXA 5D2TA 5E1QA 4RJEA 3KVJA 2V2CA 3GXNA 4Q4KA 4NNCA 2DU2A 4H3DA 1F2JA 3GDKA 1LYXA 3UY8A 1JCNA 1FDYA 4Y8FA 1RR2A 1C8VA 3QW3A 5AHEA 4ZQMA 4EIVA 2EAWA 4NQ1A 4E0CA 4MY8A 1LBMA 2NXHA 3W88A 4A3UA 3LCLA 2QR6A 1OYCA 3TU9A 4MYXA 3LV5A 1TSIA 3LBMA 1TTPA 5DCBA 4IUOA 3NQ6A 1LOLA 3G1FA 1YXCA 3HOJA 5H2ZA 1WBHA 5D38A 3E49A 4JIQA 4Y6GA 2A85A 3L21A 3ABOA 4AMAA 3BLIA 2FPYA 1O95A 5DXYA 4ORMA 2PRLA 1JCJA 1YLVA 1XDLA 4UTHA 1FX6A 1GZGA 3HPXA 3N73A 3U8GA 5DN1A 3RLVA 1VLIA 2ATSA 3CT7A 1WBJA 3G0UA 1S5VA 5HQEA 1TPUA 1XBVA 1Q6QA 5KZDA 1FCBA 3GDTA 2UV8G 2B7PA 2CZFA 3LB0A 2DP3A 4PEKA 4NJGA 1HG3A 4FXRA 2NV2A 1LTDA 2B7OA 3F4WA 3K30A 4UMCA 3V75A 1H51A 2V82A 3KHJA 4DELA 1T99A 4L4LA 5AHFA 3WK1A 2QCEA 2ZA1A 3W7JA 1F7BA 5DCDA 3EXTA 3PF3A 4JNMA 1XM3A 2FQIA 3GIYA 2ZQ0A 2Z1BA 2C15A 3P8JA 1OF6A 4GBUA 2FLIA 5F2IA 4JS3A 1W56A 4DO5A 4QJ1A 4PH6A 1FCQA 1TV5A 4KFNA 3P82A 5FEPA 4GUGA 4UFIA 8TIMA 3P5YA 4QNEA 2E6YA 4LWWA 3BPWA 5G1TA 4JTGA 3GB6A 4UFKA 5G4WA 3TFXA 3TQVA 1N8FA 4N6EA 5AYZA 1ZHAA 5LGXA 1J5TA 2ZRUA 4HNVA 4WY0A 3N3MA 2FTPA 3DENA 4AB4A 3DHFA 4CQAA 3QF0A 2QUVA 2ATMA 4JIPA 2YDAA 3EX2A 5HJLA 3SECA 5AHLA 3WK0A 4PC8A 5KMYA 3A22A 3P8IA 1UBSA 2C3ZA 4NX0A 4KKXA 1AW1A 3LTPA 3T40A 1T96A 1H1ZA 5CZSA 5DXXA 1UB3A 3ZFHA 5J5DA 1WOBA 3SJ3A 1L2UA 1YPIA 1V7YA 3W7QA 3CWNA 3MI2A 2A0NA 2BTMA 2OZ0A 3CPRA 4N4PA 3QMTA 1FUYA 5FF2A 1EEPA 4ZQPA 2NXIA 3F03K 4FNSA 5AC8A 1G4PA 1TTJA 4IXHA 3WJWA 3ZWSA 4RV8A 1SZEA 5LHEA 4O17A 4Z1DA 1H5YA 2E1DA 3L0NA 5K9CA 1EIXA 2OT0A 1K7EA 5EMUA 1QMLA 3W7CA 2Y7FA 3EKLA 4CLMA 1D9EA 4X22A 4WXZA 3W73A 2EGZA 4LVDA 5D32A 3NL5A 1SZNA 4TU1A 4LUJA 4O1DA 2H8XA 3UWUA 2Z6JA 2C6QA 1PCKA 3A5FA 4BWLA 3C8FA 1FBAA 3EWZA 3DI0A 3THAA 2E5CA 2XFWA 4DF1A 3T7VA 1TPWA 3HF3A 3EWWA 4JX5A 4ZL1A 1TPH1 1H1YA 1OFRA 3G0XA 1S5TA 4GUFA 5AC7A 1WX0A 4FXSA 5HULA 2V81A 2ZZ3A 3NA8A 1QPQA 3UWWA 4OBTA 2YGYA 1JULA 3HG4A 2I14A 4YCOA 2HSAA 1LLZA 2G96A 2ISSA 4LC6A 1OK6A 4AF0A 4UFHA 1L6SA 3FJLA 3NQ7A 4JX4A 2WNZA 2FFCA 4IMCA 4R33A 1KM0A 4N4QA 1JQXA 3G22A 3L67A 3SIZA 3EX3A 2I9EA 4WX2A 3PBWA 1PIIA 3G3DA 3BW3A 3PBVA 4IQLA 1N7KA 4LVFA 4D2JA 2VENA 5D03A 1M5WA 3QW4B 2OX1A 3BVJA 3PULA 3TH6A 4PODA 4POCA 3HQ1A 3LHTA 1IF2A 4LUIA 3TW6A 1OX4B 3MI6A 3UZ5A 2GVLA 3O8AA 4A2RA 4FX6M 1OG0A 3SZ8A 4H4IA 3WK2A 1DV7A 3W9ZA 5LNRA 4TIMA 4FNPA 2FB2A 4IMEA 1KBJA 3DU0A 1FWWA 2CU0A 1AL8A 3MHFA 1TPFA 1H7WA 3BG9A 4Q33A 1VZWA 3ABSA 3CM4A 3GNDA 1F05A 4M5PA 4LTSA 3V1PA 4YXGA 3A24A 2O7QA 2GQ9A 1EP3A 4J9JA 1W5NA 4N9EA 3HB9A 3NG3A 4OGZA 1B9BA 3BLFA 3KFTA 1KFCA 1LM1A 3GDLA 4WXYA 4LV9A 2H90A 4A2SA 3EXRA 1PV8A 4QM1A 2WOQA 2B4GA 3W7RA 3LHZA 3HPZA 4R34A 2X1UA 3ANYA 3P74A 1XUZA 5CPNA 2P1FA 5HNRA 2J88A 2FPTA 3P81A 2EF9A 1VHCA 5C55A 1RVGA 3W7EA 5AHMA 4Z08A 2CFFA 4S1FA 1KM3A 3QEZA 5AB3A 5K4XA 3QSTA 1HO4A 4M6VA 3SSJA 1JCXA 1WAUA 1W54A 2TPSA 3MWAA 1FQ0A 1GG0A 1H50A 3NQ8A 1PS9A 1Z48A 2Z6IA 3TUUA 4NVTA 3P61A 1TIMA 3O6YX 2O7SA 4K6AA 4WOZA 3W2KA 3W1TA 3T44A 4WUIA 5LNWA 5CZJA 3G1YA 5TBOA 1ZAJA 3PVFA 3NZRA 1PHQA 3B8DA 1E51A 3BGJA 2WQPA 3VI2A 5F1VA 2YZRA 3S1XA 3S5NA 1UCWA 3W74A 3DFPA 4KFOA 4MJMA 5K2ZA 3LHWA 3L5AA 3SGZA 4N02A 1R2RA 3GX9A 1F6PA 2ZA3A 3MBFA 3CLMA 5IM51 3UXAA 5ABTA 2WKJA 4Y9AA 5KSWA 3GAYA 1KM6A 5AFDA 1QWGA 3N14A 4QQ3A 3KRSA 2XN0A 3IIZA 4JX6A 1SW7A 3G8EA 1K02A 3TFCA 1K8YA 1YPFA 2GQ8A 1AW5A 1I2OA 4GE8A 2CZ5A 4I9AA 4WJEA 5D30A 2YSWA 3TQKA 3LHVA 5CGQA 3HGOA 4O1CA 3RNDA 3AO0A 2PRHA 3OA3A 2YFOA 4U28A 3ATYA 4NU7A 4DQWA 5AOUA 1JUEA 1GVFA 3EEGA 3UWQA 4U4MA 4XWUA 1O60A 1ONRA 4MY9A 1ZFJA 5DY3A 4GUJA 4HNUA 3HG3A 2BX7A 3W7HA 1MZHA 4OU1A 3TAKA 1KBIA 2Q8ZA 1ZENA 3G1XA 2C14A 2E09A 4PCFA 2C13A 1FXPA 4K8HA 3HG5A 2E6DA 2G5WA 1DQXA 2X2GA 3W1RA 4JEQA 3GXPA 3NVTA 4K8EA 1TPVA 3B0UX 2ZZ5A 5G2WA 1OK4A 1NSJA 1GVOA 4JTEA 3UWYA 1C9DA 3FYPA 4O10A 2J9ZA 1G4TA 2HMCA 5A8GA 1C29A 3B0PA 4Z1BA 4PA8A 3TJXA 6ALDA 3STCA 4HKPA 3UY7A 1LRQA 4HPXA 3G8RA 3W2LA 1XBXA 5KZMA 2F84A 3W1XA 1KW1A 1W5OA 2YW4A 5I3KA 3MO7A 2LLEA 2CLEA 4PFMA 1FWNA 5A5WA 4E2DA 1QR7A 1ZAIA 4MZ1A 5CSRA 1XL9A 3JS3A 1I45A 5CPLA 4CCCA 4CQ8A 1OX6A 3KVMA 4LS0A 3VKJA 2C18A 3DFSA 2QAPA 3ATZA 1BEUA 4L4MA 4UFLA 3B4UA 1G7VA 3O6CA 4JYFA 2Y7DA 2QCDA 4UTWA 2DJXA 5D09A 1KLYA 1CX9A 1Q6LA 1YTEA 4RR4A 5F2LA 5EA9A 3PG8A 1G7UA 1VJIA 5G2IA 4QAIA 2A2IA 3UWVA 3OIXA 1H7NA 2G97A 4O57A 5U4NA 2GVJA 4LRTA 1I8JA 2V0TA 1DBTA 4NXKA 4ADSA 1TMHA 3GVGA 2BSLA 3R2GA 3NPUA 3W07A 2Q3RA 2DZSA 4HT3A 3M5YA 3DFNA 4GFSA 3FOKA 3KAOA 5TIMA 1R2TA 3HO8A 1L6WA 3NQGA 3CIWA 4XKYB 4OHQA 1UUMA 5FF7A 5F4WA 2TSYA 4N9CA 3M6YA 3DZ1A 3S8HA 3UZJA 2NX9A 1D3HA 2QCGA 2ZRZA 2QCCA 1DORA 4IJBA 4BR1A 1VRDA 1OF8A 4O4VA 5HMSA 1GQNA 2VELA 4FX7A 4XTDA 2A6LA 3N2MA 4UIOA 3W22A 3TV8A 3WFAA 5D2YA 2X1SA 1KFBA 1Q45A 4Z0JA 3IGUA 3IVUA 5HR6A 5LSMA 1L9WA 2GJLA 4PL2A 3SFKA 3VNDA 2ZBTA 1SO6A 2Q3OA 3MP5A 1H61A 1K7XA 2AGKA 3PSWA 4ONVA 2BWGA 3G1AA 2YXGA 3SI9A 4M7TA 3PG9A 5AYYA 2QDGA 1SW0A 1KM4A 4UMBA 4KFPA 4O53A 4AHPA 5SWUA 1WDWA 2Y7GA 4IX0A 1DOSA 4JXCA 1BTMA 5J5RA 3TK7A 5FI8A 3O63A 1TRIA 4UTTA 1GYLA 1QOPA 3TC7A 1H7OA 1KFKA 1M6JA 1LBLA 3NQDA 2ZRYA 4NJHA 1HUVA 4P61A 1WOAA 5LNVA 2A1YA 4GWEA 1D3GA 1VCFA 1J4EA 4BI6A 2GOUA 5TQLA 1A5BA 4O52A 3USBA 4FX8A 3S1WA 1GEQA
chains in the Genus database with same CATH superfamily
1EGMA 4A29A 5J8LA 3TVAA 3B06A 3PZMA 2V68A 3WL0A 4O8RA 3POCA 2DVTA 3RM9A 3C2FA 4KMQA 4YPJA 3PM6A 3UR2A 2E6AA 4UR7A 3I7RA 1XHGA 4JKKA 3EOSA 4MVAA 4DO6A 4UTMA 5JIWA 1FWHC 2WNNA 2CERA 4E5TA 1KGUA 4DNMA 4W8AA 4LY8A 2EQDA 4GZJA 2I9UA 1NOWA 4PMRA 4MLJA 3WF3A 2VDHA 3STEA 1ZALA 1KA9F 3GHSA 1FDZA 3O07A 1XRVA 2NXGA 2VEIA 4U5KA 5AC6A 2OTDA 3QSRA 3HGSA 1CB2A 1OB0A 3C2YA 3CEUA 4KQNA 3NPVA 3UJ2A 2QF7A 4MPQA 2QCFA 2E1WA 1VHNA 3HZ3A 1JXKA 2VEPA 2XH2A 1QU4A 3FDKA 3P93A 3BAYA 3LSCA 1U5JA 5F1UA 2YR1A 3Q37A 4WVXA 4LCSA 2ZRVA 1DIDA 2VOTA 1SJDA 4RLIA 3NEVA 2PURA 4FNUA 2BXZA 3H7RA 1X6LA 2EPLX 2RDUA 2BS9A 3V4BA 4MZYA 3WJXA 1UD5A 2O9TA 1F5ZA 4PUUA 4HJWA 1R2SA 4PBGA 3R6IA 3MYOA 1NAL1 3HJZA 4LYQA 3UCDA 4F0KA 4M8UA 2C79A 3WQDA 1J2BA 1QHPA 3AROA 1E4MM 1F76A 4CD7A 3P0WA 1O5QA 1LL6A 3SUTA 1EZ2A 3KRZA 2GUBA 3UGVA 4WSJA 3GNXA 3T9PA 1PTDA 3LERA 1O1HA 3CZJA 2GK1B 3EA1A 1NTHA 4UQAA 1XF0A 1HJXA 3G24A 1TO3A 2VJXA 1ZP3A 1WXJA 3DFOA 4R88A 2QMKA 4I7VA 4DAIA 1MW3A 1GOOA 3CU2A 1EWDA 1OC5A 1RP9A 2Y61A 1GVQA 2ZUSA 1TZ7A 2Z1VA 4W87A 1UKSA 2BLEA 4B4HA 1EPVA 1GVRA 4IGNA 3USZA 4ZA0A 3EWDA 2GUUA 4EE9A 4NJIA 3NO1A 3CL7A 4V1XA 1ZS2A 3V16A 3KLLA 1HX0A 1QPOA 3H6OA 4F2TA 4X2PA 1Z41A 4UR9A 2A4AA 1B4EA 5KINA 4WY0B 1UD8A 1WV2A 2OKOA 1KFLA 4HN4A 3TSDA 3L66A 2DDXA 2FH6A 4TVUA 4I8DA 3WQGA 1EUNA 3IGXA 4GA8A 4G1NA 1ZJAA 3AIWA 2WMIB 2IW0A 1XFCA 3NQCA 2R14A 4UZSA 3NUKA 5FEWA 4X60A 5CSYA 2QPXA 2VCCA 2NV1A 5D04C 3M5VA 2OQLA 1UWQA 3VD3A 3ARRA 1QFEA 1BAGA 5BXRA 4QDPA 2WV8A 3O6AA 1CDGA 3PBMA 3ZYZA 1LG1A 1K03A 3MBDA 1YDVA 2D73A 4Q8TA 1REQB 1OCBA 4IISA 2J7BA 2VGBA 2GVGA 1VFUA 4AIOA 4I7UA 3PZIA 2NVCA 1PWMA 2WJFA 2BV9A 4I90A 4YL2A 1MQQA 1XYFA 1F3WA 3QYSA 1V6TA 2I16A 4F8XA 1Q8AA 3DFHA 5LNUA 4GIRA 5AYIA 1W3KA 2J47A 4OE7A 5D2VA 1H7PA 3KOFA 4R5EA 4AU0A 1EJSC 4WD0A 3FA4A 1E1CA 1NU5A 4OT7A 1FWBC 4PB4A 3CYJA 1GG1A 1E6NA 2VRQA 2DVXA 3GD6A 3PPHA 4C1LA 3GS6A 1XG4A 2VC6A 1VFFA 5FF4A 3S5ZA 1KWKA 2D0FA 1XIGA 3G6LA 1GOMA 4S3FA 3BSGA 4OV9A 1TMLA 3ARUA 3P60A 4IH3A 3T4WA 4MY1A 1EBHA 2JKEA 3ZZ1A 1Q6OA 3M0KA 2Y5JA 3TW9A 2QAFA 5BMWA 3CHEA 2QGHA 3E2VA 3W02A 5A8QA 4KH2A 2BVWA 4UCFA 3SR7A 4MWAE 5DT7A 2JKAA 5FESA 4QQUA 3RMEA 3FYYA 4MWAA 1DIKA 3TCSA 3ICJA 4NJJA 4B92A 3RHGA 3BMVA 2P88A 2PDMA 1IXOA 1CW2A 2XISA 3LQGA 4F0HA 4JIIX 2VUYA 1ISZA 1K8ZA 2FH8A 5TNVA 3JVAA 3M0VA 7ODCA 2F6UA 1W37A 4PTNA 4PSPA 4Q8QA 3QPEA 3LCXA 3B8VA 5CZTA 3WQOA 1A49A 3GE7A 3M4HA 4E4PA 2R91A 1JYVA 4O11A 4Q7BA 1EJ7L 1JR1A 4L56A 3PAJA 3LUTA 4CUCA 1S2VA 3VZZA 3W26A 3U0HA 3MZ2A 2YCLB 1O4UA 3EPOA 5I78A 5L9FA 5A6BD 4F0MA 4A3HA 3WH8A 4JKLA 5IDIA 3IK4A 1DIOA 2VP8A 3B8TA 5GPRA 4MPKA 2Q8LA 2J77A 2PDCA 1ICQA 1AUSL 2ZX9A 1LQ2A 3VXGA 4GINA 4ICCX 2ZWYA 1OFAA 2OCZA 2QCLA 6TIMA 3AJXA 4DJEA 4MNJA 4ADUA 1ME7A 4AEEA 1TPB1 3E02A 2YLAA 2WMHA 1JCMP 2WKLA 3HFYA 3W1NA 1M65A 3HPSA 1TJ2A 1QO2A 3VKBA 4YVVA 3M0MA 3PBUA 1Q4WA 4B5TA 1OFOA 2DIKA 2XIBA 3HA1A 5BMXA 4AD3A 1AFSA 2YL8A 4ZBCA 1Q3NA 4PUDA 2QV5A 4C7FA 3NL2A 5I3FA 4GH3A 3G77A 1K7FA 1P0DA 3N34A 3WDJA 3THCA 2Y2WA 3TSBA 5K4ZA 4R7OA 1XLMA 1XRTA 3LM7A 3PSVA 1GHRA 4EVZA 4O8AA 1H1NA 1L6GA 1W1VA 2VWTA 4MZ8A 2XHYA 1M3UA 2PDPA 3GR4A 2VL4A 3PZTA 1KM5A 4Y90A 1EGZA 2GJXB 4S2BA 4XBKA 2QEZA 1UC4A 4O1AA 3M16A 1AVAA 4U3AA 5C9XA 5CPTA 1UR0A 2VZVA 3TYBA 1JZ2A 1ITUA 1OIMA 3NDYA 4MOZA 3SUSA 2PDYA 3D5HA 2NQ5A 2REQB 3ITOA 5E6ZA 2HQAA 3S6DA 2XSAA 4E4FA 3EOEA 2V5CA 3GNNA 3M0ZA 4M0XA 5CSUA 4ADTA 4AC1X 1MYRA 4FSAA 1WAWA 4TX6A 2E5BA 1O7AA 4ZTXA 5HNUA 6REQA 1E15A 5BW6A 4A6GA 1GVSA 2WPGA 1MEHA 3KVKA 2PTYA 3IIVA 4M82A 1CLXA 1DXIA 1EUAA 3QZ6A 1FHDA 2ZX6A 5HXMA 4JCLA 4D6JA 3JR2A 1WXYA 2O55A 3NQBA 5A6KA 4JY9A 2VFGA 2EPKX 3RJXA 4H9VA 3V1HA 5BROA 4WHBA 3VTRA 2YBVA 1EH9A 1QHOA 2NSXA 1LROA 2PD5A 3LX9A 1ZJIA 2HE5A 4H9ZA 1ADOA 4DIAA 4TUFA 3CC1A 3CHCA 1E0VA 3WBAA 3MA8A 3E0VA 3T05A 3U2CA 2UWFA 2CZEA 2EHHA 3MO4A 4HNLA 3W7MA 4C90A 1DJYA 1MUWA 1EIBA 2FDSA 3LTYA 1FWDC 3B8WA 1I2NA 2C1IA 1WP6A 3AOFA 3REQB 2OELA 3CB8A 2J8TA 1UR1A 4XAPA 2QCDB 4TQTA 4ZVJA 2XVNA 2PWGA 2QDDA 3IVTA 4GVIA 1A50A 1EJWC 3WZ0E 1DWHM 3BXWA 3DIPA 3PJWA 1CXIA 1KD0A 1OCQA 3GVWA 4B5XA 1YW1A 1L8PA 3U2EA 1RA5A 4H7CA 1Z6KA 3NM3A 1XLHA 3DYPA 1QI3A 1W1IE 1FXQA 1I2PA 1EX5A 1K77A 2V3EA 3TDFA 2V5BA 1TJRA 1OZMA 1TR1A 2VFDA 3WQ6A 3PJUA 1XS2A 1FDJA 1US0A 1TE1A 3DG7A 3IS4A 3BZJA 3T4CA 1QOXA 4XBSA 5M17A 3L0KA 1I1XA 3TLLA 2V5JA 3GBEA 4BA0A 4JFWA 4EPDC 1H2JA 4FR6A 4H6QA 3G2GA 2D0GA 4CD5A 2YLLA 3M0YA 3H2FA 2RKXA 2XN2A 4X9SA 4P2VA 4PRWA 4C60A 5EFFA 1XD0A 3BZGA 3B97A 1X1OA 2RDWA 4IT1A 3PS7A 4L6OA 1EGVA 4GYPC 1JCTA 3H55A 5EY5A 4DJDD 5CPSA 4J1OA 1RD5A 4QEHA 4BK9A 4P5UA 1P0NA 1LOSA 1W8GA 2E9LA 3B03A 4GJJA 4GJ1A 1NOUA 1GW9A 3L65A 4H2HA 4ZO8A 1C8QA 3W1PA 3WLLA 3S2MA 5FJOA 4AWTA 3W00A 1P4CA 2A5HA 3ITTA 4PCNA 3S6OA 3W01A 2EBNA 3AXXA 4WQ6A 1HTIA 3A12A 1FH7A 3QMRA 3N4FA 1M53A 5JBDA 1HZYA 5CC7A 4U33A 3K5XA 4ENLA 2PDFA 1R85A 3TIMA 4AYGA 2WZHA 1A5AA 4DB7A 3AYTA 3DERA 1RBOB 3IPWA 2CWXA 3S42A 1RJQA 3L0GA 2OOFA 1QI4A 1KFJA 1Q6RA 3W24A 4R7WA 1XIEA 1MNSA 4NRSA 4IUGA 1VF8A 2O4QA 5I5RA 4D6FA 1UKQA 1CI1A 1FA2A 3SO7A 3MKKA 4DM1A 1JUKA 3H7VA 2V69A 2QJHA 3W2JA 1ZCOA 3IIXA 3DX5A 2YFNA 3KL3A 1UR8A 4WOQA 1L8NA 4KGJA 1U2YA 3S1UA 5T8GA 1KTBA 4RZ5A 1GOIA 4C6CA 5G2HA 1UH3A 4NZ1A 5CC6A 2PCQA 4C91A 4XAZA 1X1NA 5LIUX 4DF0A 1J2WA 3GG8A 1CENA 4LVGA 4O0KA 4N0RA 1YBQB 2A3AA 4GVHA 1V0KA 2W3ZA 4QIUA 3UXKA 3LCIA 1M04A 1OC6A 2WQDA 3DFYA 3KOZA 2PGFA 4UFJA 4OBRA 3NAVA 3LCGA 4JQ4A 3H2AA 3FKRA 2JFEX 1VR6A 3W70A 2VCBA 1GTEA 4UUIA 1F74A 1VYRA 3M5ZA 4RXFA 3TC6A 3BH4A 4N2YA 1R38A 1YXDA 2A7NA 2PS2A 1NFPA 5HUPA 3ARZA 2CZDA 4FLRA 3VYLA 4K7YA 4I9MA 1S1PA 4I9TA 4PEEA 2OSXA 4AF0B 1AZ1A 3MWCA 4W4QA 1BWVA 3ANUA 4LRSA 4A21A 4KESA 1OFBA 2RAGA 1H0GA 5DQPA 3QY8A 4OV4A 2YW3A 1OIFA 4FAMA 4ICNA 1O12A 4Q8MA 3IIPA 3UCQA 2NVDA 3M1ZA 3LU2A 3NZ1A 3NDOA 1VS1A 1VFSA 3O1NA 4M29A 3I68A 1D8CA 3SW6A 1BYCA 4YTTA 2DORA 1F8IA 4A8IA 2GOKA 3F5JA 3UWZA 1K8XA 1KTCA 4JIEA 1F6KA 3CXOA 2WAGA 3Q58A 1W31A 5I06A 1V79A 3LLDA 4DLFA 2P3ZA 5IBXC 2VR4A 4MKSA 1NOFA 2XFFA 1UASA 3VDBA 5HJYA 2J6XA 1WZAA 3DAQA 1O68A 5A8MA 1FOBA 4FNTA 3L2MA 2VFFA 1FWEC 3QM3A 3SCWA 4IWWA 3PR2A 4XD6A 2WVVA 1Y7VA 3K46A 3S5OA 3UNDA 3B9EA 3ZWTA 4KWVA 1QO5A 5E93A 2BOFX 3WLRA 3QQ1A 1XLLA 4GZEA 4L64A 1HKKA 3ZJKA 1UKOA 4GACA 3LDVA 3QR3A 3UPMA 1G4SA 4RW5A 3C0JA 4F3HA 2DH2A 1YXYA 2BB0A 3QV7A 4FEZA 2OZTA 4HZ7A 1S2UA 3IJ7A 3WDRA 2VCAA 2PTXA 1XICA 2D3LA 5I02A 3M07A 1P0KA 3VAVA 3H21A 4LX4A 1UH4A 4NP7A 1MSSA 1J18A 4H9YA 1Q6CA 5BRBA 3VFLA 3GLCA 2B7QA 4REQA 2ZE3A 1W3IA 3IAPA 4TO8A 4ZXOA 5KZEA 4QLJA 4RZ6A 4IJCA 4YU1A 4MTVA 5I3JA 2WCSA 1KXVA 1UZDA 1XLFA 2CNCA 3RXZA 1E1CB 1V3LA 3HGJA 4PB5A 3V3WA 1XIDA 4Z2LA 4ZB0A 3CPUA 3TYZA 4PRRA 1GWJA 4M7SA 3CQJA 1ODUA 5BXTA 3VOGA 4MJ4A 2IKIA 1XXXA 4AIBA 4LVBA 4O14A 4CU7A 5BOOA 4H2CA 5E1QA 1TJ1A 2ZC8A 3VINA 3DN5A 2DU2A 1R9XA 3SCUA 1K1DA 5JQ9A 3UY8A 4MWAB 3R0DA 4W86A 5CH9A 4K3ZA 3OO2A 3W27A 3L4TA 4MY8A 5A95A 1GJWA 2NXHA 3K1GA 2YIHA 4H9UA 1OYCA 1W9PA 2PCEA 1TSIA 3LBMA 5B7YA 1POJA 1UH2A 5H2ZA 4PMDA 1WBHA 3E49A 5EGRA 4Y6GA 3L21A 3MDUA 3MV11 1E9YB 2QVNA 4AMAA 5DXYA 1JCJA 3ZVHA 3HPXA 3KTXA 3CZEA 1VLIA 1QTWA 1MZRA 1BLIA 1TA3A 1S5VA 1QPKA 3MZNA 3LPOA 4ZB2A 3GDTA 2UV8G 1VJZA 2OLHA 4UB9A 4NJGA 3GRIA 4NASA 3KW3A 3BJTA 1CYGA 2DGAA 3TWAA 4HZ8A 1UR2A 1T99A 4L4LA 4CKQA 2HZGA 5DMYA 1DEDA 1JDCA 2WZIA 5AHFA 4HN8A 5A2CA 1BTCA 3SCPA 2FVMA 3H23A 1WUEA 3W7JA 1F7BA 5I7GA 2GZXA 1XLDA 2A3CA 2OLAA 1JPMA 1XM3A 2FQIA 5CEWA 4PTXA 3B8UA 4GBUA 4EAYA 5F2IA 4JS3A 3AIEA 4DO5A 1XH2A 3S2JA 2XIJA 1TV5A 3NEHA 4GUGA 8TIMA 3P5YA 3I3BA 3DUGA 5M03A 3ITXA 3BPWA 3EMZA 4UFKA 1EDTA 3TQVA 5H8MA 4TVDA 5A1AA 3VIKA 5LGXA 3RYSA 2PWUA 3UXIA 1UWIA 1R87A 3T6CA 2QUVA 2YDAA 1IEXA 2XFRA 1MRAA 3A22A 3P8IA 4I8YA 4XBJA 3T0AA 2C3ZA 4UZUA 1AW1A 4DUOA 5DXXA 3WYZA 2I56A 1CTNA 3SJ3A 1UBPC 3HQPA 3RO8A 2BTMA 4N4PA 5HMDA 2WVUA 4KPLA 3DDMA 2BDQA 5FF2A 3AMCA 3F03K 4FNSA 4J5NA 4OFCA 2EG7A 2AKMA 4RV8A 5LHEA 1TKKA 4Z1DA 2AOSA 4JTAA 4JN7A 3IAQA 3VNKA 2GDVA 4CLMA 2MANA 2X0YA 4J28A 1XH1A 4LVDA 2OQYA 4U10A 1SZNA 2I57A 2VRKA 2H8XA 3UWUA 2Z6JA 4JBRA 8RUCA 1R9ZA 1E9ZB 3VIIA 3A5FA 3R7MA 1FBAA 3DI0A 2E5CA 4DF1A 4S39A 4LSBA 4AD2A 3EWWA 1IZCA 4JX5A 3P3BA 1VBRA 2OB3A 4LXFA 4JQ2A 1OFRA 3G0XA 4GUFA 4CU8A 1IV8A 3N15A 2ZZ3A 1ZTVA 1IT7A 2GWNA 2DT1A 2P50A 3F7JA 1QPQA 4OBTA 3PK7A 3PPGA 1JULA 4LPCA 1ZGDA 5FCZA 4I5XA 4YCOA 1LLZA 4LC6A 2J7DA 1PTGA 1OK6A 4UFHA 4ZSUA 4JX4A 3V5OA 1NWSA 2D2OA 3IACA 2WLZA 3ZIZA 3SIZA 3NCOA 3G1RA 2AQOA 1PIIA 4ROQA 4LVFA 4D2JA 4G56A 3H12A 1M5WA 3PBGA 1Y65A 2OX1A 4RZBA 4S38A 2QW5A 3TW6A 1PX8A 1Q63A 3FSTA 2CHNA 4QTGA 1GJUA 2PD9A 5ECUA 3O8AA 4FX6M 3SZ8A 2UZ9A 3AU2A 3FA3A 4PUJA 5LNRA 1OM0A 5EMKA 1KR0A 5D8ZA 4IMEA 1QUMA 2PWHA 1TPFA 4I6VA 1E6PA 1V3JA 3GNDA 4M5PA 3GH4A 2WZEA 1IWBA 2GQ9A 1PSCA 2FHFA 4GY1A 4PBFA 2QUNA 4G7EA 1ZJBA 5LXXA 4E2VA 1Q7MA 4US5D 3O3RA 4H41A 1D7FA 4LAOA 4A2SA 4F0SA 3EXRA 1PV8A 4UQDA 3CIVA 3HPZA 2BVDA 1BYAA 5CPNA 1J12A 1RVGA 2OYKA 4E8GA 1TFVA 4US6A 4S1FA 1G94A 3OU8A 2ACUA 5K4XA 4GBDA 2HPMA 2V6AA 4DWSD 3GG0A 3VIGA 4GY0A 4NY2A 2VM8A 1Z8AA 4GVFA 3NQ8A 3S47A 1J8VA 5HPOA 2Z6IA 3T8LA 3WN6A 3P61A 3O6YX 3R94A 3ZLFA 3N18A 5CZKA 1GNXA 3W2KA 3AYVA 3T44A 1K9FA 2B31A 5LNWA 4Q8PA 1TWZA 3G1YA 3SSZA 3A9BA 1PHQA 1EYEA 1E51A 2QPUA 3EOOA 3KP1A 4NRRA 3VI2A 4C7DA 2CCRA 4F0RA 3W74A 3DFPA 1C93A 5K2ZA 1GONA 3GX9A 5D4YA 3MBFA 3GNPA 4JL1A 5IM51 2VGGA 5ABTA 1WZLA 2DFAA 1FWGC 4KCVA 4S3BA 4Q8NA 1QRQA 4DI9A 4K1WA 3SUUA 1V03A 3IIZA 4B5SA 3CYVA 1DP0A 3H2CA 3APTA 3MUCA 4QDWA 4WJEA 5D30A 3TQKA 1FWIC 5CGQA 3HGOA 3HMCA 3AO0A 3H22A 1XLEA 4KEUA 3OA3A 1GQJA 4W8BA 4NU7A 3SY1A 3DC8A 5AOUA 1HKWA 1JUEA 1Q66A 3EEGA 2G3JA 1O60A 4LNCA 4MY9A 1XJBA 3M0LA 3W7HA 1KBIA 1XLBA 3G1XA 2WHMA 2E09A 2WKGA 1TG7A 1B90A 1JGMA 1ZSXA 2BOEX 4L9YA 1V3IA 4J3TA 3W1RA 4PUEA 4K8EA 3F2BA 2ASHA 3BGAA 1NSJA 3SGGA 4JTEA 2VQUA 3H7UA 1RJPA 2J9ZA 2HMCA 2UY4A 4QFUA 2PLCA 2YA0A 1UIOA 1ZUAX 3GHUA 4FXJA 4KCWA 1C29A 4RNJA 3HU7A 3VZYA 3B0PA 1E6RA 1I1WA 1A0EA 4XZBA 4HVXA 3STCA 3UY7A 1LRQA 3LD5A 3G8RA 5KZMA 2F84A 1V93A 5I09A 2YW4A 4H8UA 3CBWA 2LLEA 5A5WA 1QR7A 1R86A 1ZAIA 1XL9A 3WBYA 5CPLA 4CCCA 2BASA 3UJRA 3PJTA 4E8CA 1MFVA 1F07A 3U7VA 2FHBA 1OX6A 3ARVA 1BF6A 4LS0A 3D47A 1C8XA 4DZHA 2QAPA 3SRDA 4NKCA 1BEUA 4L4MA 4ML4A 1HN1A 4UFLA 1G7VA 3O6CA 3EA2A 2W92A 4UTWA 3EDJA 4YTSA 1CX9A 3BCJA 3OQEA 1VJIA 5G2IA 3TN3A 2FFIA 4O57A 2G97A 1QATA 5U4NA 4FP1A 2V0TA 1DBTA 2Y5SA 4NXKA 4ADSA 2G41A 1XR2A 4BEQA 2DH3A 1YDYA 1CGXA 2Z7GA 3HV9A 3M5YA 3WLNA 4DWDA 3FOKA 5TIMA 1CXLA 3CV7A 3GUWA 4XKYB 1PPIA 1ZPTA 3OB8A 1B3VA 5F4WA 3BMXA 3VD4A 3GU1A 4WRHA 3UZJA 1B9ZA 2QCCA 4BR1A 3EPMA 3WX7A 2J79A 4O4VA 1XYMA 4FX7A 3ZT5A 3N2MA 4UIOA 1IYXA 2CETA 3TV8A 4PMUA 2X1IA 1O1ZA 4B5VA 5HR6A 5LSMA 1L9WA 2FZ8A 3RIKA 3L4ZA 4JIRA 4PL2A 4HHHA 4GZIA 2WVVB 5M3WA 2XUCA 3TYCA 1ZU8A 2AGKA 4CVUA 3FX4A 3PSWA 2BWGA 1R3QA 2YXGA 3KDOA 3RAOA 3EDEA 3IJLA 4JN8A 3PG9A 1DTNA 3LBOA 3T2PA 1OD0A 1SW0A 1KM4A 2BXYA 4O53A 1UROA 4AHPA 1EJXC 1XH0A 1A0DA 4CVWA 4GCXA 2NQ9A 1E3ZA 4F40A 4JXCA 2IPJA 1BTMA 3TK7A 4X9YA 3WUFA 4Q7NA 3BURA 4UTTA 1GYLA 3GU2A 4DVOA 3HPFA 3TC7A 1M6JA 3NQDA 4HHMA 4NJHA 2O9OA 2VX4A 1J4EA 4BI6A 5FKYA 2CEQA 4O52A 4XSLA 4Y9NA 2Z25A 3EKGA 3UW6A 1LDCA 5I3HA 1KO0A 3KX6A 3GDRA 3BV7A 1UPMB 1DWGM 4IIBA 1UUOA 2ZXDA 3EWUA 1XBZA 3WMSA 4EACA 2QIWA 2ABBA 4IFRA 4R85A 3INPA 5DF0A 5C9RA 4M80A 4BZYA 5ECVA 3TKFA 1WDQA 4EF8A 5H8UA 1Z44A 1GT8A 2Z1WA 3O7UA 2PZ0A 3O16A 3ZVIA 3ENLA 2PU0A 1ZBWA 2NLIA 2DUAA 5A6AA 4AWSA 3QGKC 3QLLA 3QBUA 3FFSA 3B0VC 3MUIA 3AICA 4GCAA 1EHNA 3MUXA 4IQDA 3BGGA 1YKWA 3DBPA 5CCZA 1EWEA 2YJQA 1LORA 2GPTA 2E8YA 4GJIA 1TQXA 5DY2A 2V2DA 2R94A 4D6DA 5C2XA 3DXIA 7ENLA 1G4EA 1TZZA 4GX9A 5D9OA 2FB3A 3IARA 4W93A 1AH3A 4BQ3A 1M01A 1H7RA 2G3MA 3N2OA 1E0XA 1E9LA 4GLEA 1A5OC 1E56A 2ZX5A 4Q6JA 1X8CA 2JBMA 4TMBA 4DYKA 3OLEA 3KUMA 3PB2A 3FA5A 4D72A 3P84A 4EF9A 3VMNA 3ABRA 3NZQA 4K37A 3AWNA 3CTTA 1J01A 3AMLA 3ZVHB 3GO2A 1OVDA 5IOBA 4DPPA 3TN4A 1K4HA 1VCVA 2ABAA 5JBEA 3IRDA 4JTDA 1JPHA 3NPXA 2WC3A 1J6PA 4V1YA 4GNJA 3TW7A 1SMAA 1DYSA 4HJFA 4L65A 3FJ6A 5HMFA 2HVMA 4GQQA 2GWGA 5CPOA 3WEMA 1MW1A 2J74A 2C8NA 1JNDA 2YPIA 3H2NA 3PPCA 1UD3A 4WGHA 2J9XA 3NURA 1NH6A 2WZMA 3TLQA 1W3HA 4Q6XA 1XCXA 3B4YA 2QV4A 1K8CA 2ZZ1A 3BLKA 2RJHA 4IXXA 3VD9A 3ORWA 4LUTA 1PE1A 4A8RA 4QE5A 4K8GA 3EWYA 3K13A 3NQVA 3W72A 5IFPA 1IEVA 2CLOA 3WEZA 3DESA 2CKSA 1XGZA 3MVIA 3Q4DA 4CNOA 1TUXA 2W6RA 1UUQA 1JNEA 3SN0A 2JEPA 1NELA 4W7UA 4MB3A 1MXSA 4PRTA 4IFKA 1NF7A 2OZ3A 4IZGA 3HM7A 5D9MA 5ENLA 2XN1A 1WKDA 3GYEA 3MCNA 3FK4A 2XINA 1RBLA 1I75A 3DI1A 1X96A 3LXAA 5HOSA 3T78A 1W3NA 1XDMA 1OJXA 2X30A 3PZQA 5DX7A 2JKPA 2Z1SA 2WXDM 1ICSA 4AHQA 1QK2A 4AD5A 2ZUNA 1Z9AA 3TR9A 1YMYA 2OO0A 3SRHA 3WQCA 2YCIX 3NM1A 4CU6A 3G0SA 2WHKA 4W7WA 5KTLA 4ZR8A 2E28A 4L1WA 2AQWA 4L5ZA 4C6QA 4H9MA 4I5UA 1A3WA 1XD1A 3KOWA 3PWGA 3S5YA 5LXEA 2QUTA 3ZXWA 3ONCA 2WWDA 4JTFA 5LIWX 3BW2A 3XIMA 3ONBA 3KBNA 3D0CA 4BF9A 4FNRA 1A4LA 4JICA 4Z42C 4D8AA 1VPXA 1Z69A 1YPXA 4UQ9A 3QFWA 5C0QA 3CQKA 3ZM8A 2BZNA 3BC9A 3GH5A 4KT2A 1DTUA 4HIBA 3T1GA 1XRSA 3TCEA 1CT5A 1WKFA 4ATDA 3SCOA 1KV5A 4Z1YA 1DKWA 1OABA 1SQ7A 1IXQA 2D23A 4C6IA 3THDA 3VO0A 3BLPX 2FPVA 3VD7A 4H01A 3UU0A 3QGVA 1EXPA 4RNHA 4ZOBA 1RPXA 1DJNA 4H1ZA 4ZFCA 2GSEA 2Z00A 3WD4A 3C56A 3WELA 2ZFAA 3EWBX 4ML9A 4Q32A 3RU6A 2FZ9A 3ARPA 4DEFA 1FWJC 1UKTA 4DJDA 4QEEA 3QH2A 4LYRA 2ISWA 2OYLA 4INFA 1TCDA 3F2CA 4Y9OA 4LCRA 3S0CA 2PEVA 2VOMA 3SM0A 3PC0A 2H8ZA 2I1OA 1HKIA 1XLKA 3W23A 4KIRA 1XLIA 1Q4NX 3HPAA 1SJBA 4G7EB 1B3OA 5JU6A 3GKFA 4ZODA 4JY8A 5CLWA 2ACSA 4ORIA 4PTDA 1TJPA 1N55A 4FIQA 7A3HA 5ABFA 3E3HA 4MG4A 3UPWA 1XQKA 4WDUA 3QR1A 1F6YA 3ANVA 3S9YA 4XZLX 4AH7A 1FWRA 3U4FA 3OG3A 4P8WA 5I23A 3A3XA 4JDBA 4QE4A 2C1HA 5DBTA 2XDFA 1YHTA 2CHOA 1RVKA 5LZLA 1LRNA 2WNWA 5E0FA 3M41A 2INZA 1DVJA 1CIUA 3N13A 3RM4A 2JGYA 1MEWA 3DEQA 3ELFA 1THFD 2NUXA 3M47A 2F7FA 4ZB5A 2V3FA 4MHBA 2PC4A 3GXMA 1U5VA 4RK8A 5K3VA 3NQAA 2XIOA 1F3XA 2DW6A 4CNTA 4B3LA 3R58A 1BQCA 5A2BA 4C6BA 1W6TA 3UXLA 5AECA 4P7LA 4FLSA 3TOPA 4C6FA 4XD4A 2RH9A 5E70A 4QRNA 4L61A 4C6LA 3LI0A 2QNEA 2WMKA 3P5ZA 1X6UA 4KS0A 3QJAA 2EKGA 3LXCA 4ZSTA 2WJDA 1XPYA 2ZDRA 5CZ0A 1A5KC 2BVYA 4O12A 1GVIA 1OY0A 4GO8A 4XB3A 4W5UA 1W9XA 1H49A 4BEUA 5M5DA 3IJDA 4GX8A 3HJEA 2HROA 5J04A 3RU8X 1DJZA 1Q6DA 1QNVA 3TSMA 2E68A 3CNYA 4QE1A 4JYEA 2ZCGA 3LLFA 1SYTA 1EF3A 2KZHA 5I24A 1NIUA 3WIJA 1AQFA 4IP7A 3N2TA 5E9AA 4HSNA 4ZQCA 2PU1A 3DG3A 4MWAC 3WLQA 3GC4A 3QMSA 2Y70A 5CSSA 5A6SA 4KIEA 2CESA 4IPJA 5FACA 1VENA 3RPMA 4J3UA 1UQYA 4ZQRA 4WZHA 1AG1O 4AIEA 2EPHA 3WH9A 4HCHA 2JALA 4Q7IA 2RDXA 2YCEA 3ABQA 3QTPA 4WJ8A 4MMWA 5LIYX 4UBPC 1W9VA 2Y8UA 3KBSA 1BRLB 5CKSA 4G9PA 4H7VA 1HJQA 1JVNA 1PYMA 3WH5A 2XU2A 4PL1A 2XJ7A 3U57A 3XINA 4HMEA 3WQ4A 4MB1A 1E55A 3I6EA 1VB9A 2CLLA 1FKWA 4N42A 3VOFA 6ENLA 4CD6A 3W7KA 4B90A 2X42A 4A05A 1JD7A 1RY8A 1N8IA 2FYMA 4LEQA 4XVEA 4S3JA 1VBHA 3VILA 2Y1HA 3AZRA 4MJ2A 1ZBCA 3M44A 1PWLA 2WMIA 4D71A 1M7PA 1VYPX 4DJEC 4IOTA 3EX1A 4S3GA 2OVLA 5CC5A 1RPKA 1XLGA 1XDJA 1YIXA 1EB3A 4AYSA 1OD8A 4PSRA 2BODX 4B4FA 2Q6ZA 4QXIA 4H6RA 1BYDA 3GZ3A 2W4XA 3KTCA 3ID7A 5FEZA 1F3TA 1TB3A 4ZENA 3FYOA 2C91A 2D1ZA 3PANA 2AKZA 5DMLA 5I3GA 1LOQA 3CK5A 1EJVC 4F2BA 2FZNA 1TPC1 2F2HA 3UPBA 4DBWA 2HDJA 4MSSA 3L4XA 4M6UA 5BCAA 2IUZA 1KLZA 2FIQA 2XPKA 4Q8OA 1FY6A 1T40A 2HPIA 2PSNA 2DZTA 1A5LC 4LBRA 1G9HA 1TV2A 3CIXA 3O6DA 3TC3A 4EPEC 3IV8A 4ZQNA 1F73A 4GI6A 3TX9A 2EKCA 1IGSA 4AX6A 4YN5A 1XSIA 1E0TA 1W9DM 1P1XA 1IIGA 4LUSB 4I6KA 3NTYA 5REQB 1PAMA 3BO9A 1OFEA 1GCYA 2P53A 1MVYA 4K36A 3ALFA 5AZ1A 4O13A 2P0OA 4WY0F 3RN6A 4YCPA 4ZFMA 4PTVA 1JQVA 1NDVA 3HMJG 2D69A 4ERIA 1UP0A 2J7FA 2X40A 3C52A 1V3HA 5BRQA 4GUIA 3PNUA 1QHZA 2NUWA 1KRAC 1J0ZA 3BV4A 3EOUA 1QNRA 3LI1A 1ONEA 4Z1AA 3XISA 2W0UA 4ALDA 5CQ1A 1JZ4A 1CECA 1W32A 4RE2A 1XI3A 4Z1CA 3GW3A 3W83A 1ELSA 4AEFA 4V28A 3C86A 1HKJA 3HG2A 4DBDA 4QGCA 4RUBA 2NX1A 1PO9A 2NT1A 2DUXA 5LA2A 3FLUA 2VZOA 1QJWA 3GTXA 2BY2A 4IQJA 3K4AA 4IGSA 2QZRA 2ZRWA 2TYSA 4M1BA 4YVPA 2QJMA 4DXVA 2V3DA 1PKMA 3W1QA 2QDHA 3FAWA 3N9RA 1R46A 2XSXA 4Q8WA 3R79A 4W8LA 3TNBA 1J96A 5BXSA 1XISA 1FHLA 3EA3A 3PTMA 4ES4A 2YB1A 1PUDA 4AD4A 4LYKA 2Z27A 4RXGA 3QHOA 1TVLA 4EAMA 4IPNB 1QDSA 4NZ4A 3O05A 1AODA 3OHIA 1PKYA 2EPNA 2GQAA 4DXXA 1G69A 1PZ0A 4AZ5A 3QKEA 2CYGA 4MNKA 3SADA 4GMEA 3F1QA 3QYQA 3G18A 1VC4A 2VEKA 5FEXA 2VT0A 1XCWA 3MSYA 2X16A 2ALRA 1SFLA 2IKGA 5L6UA 3WNNA 4Q3MA 4C65A 3Q94A 4H83A 3NL6A 2ZTJA 2V63A 1KWGA 5A6JA 3NNTA 5DBUA 1SO3A 3PBYA 3FEMA 1UJQA 2ZXQA 1B3XA 3AMGA 5CBJA 5GJPA 4OWGA 4DUXA 3VGHA 4FIRA 3IUIA 4HA3A 1US2A 1I4NA 4ACYA 2ICSA 1A5SA 3R11A 4DJFA 1RY0A 1LQ0A 3UVAA 1UA3A 4LB4A 4HNCA 1KRBC 3IK2A 2WCAA 4O18A 4EPKA 1ALDA 2C0AA 1TWSA 4KW2A 4U2YA 2X1RA 4YYCA 1H5VA 5LKYA 3THUA 4RPPA 1OYAA 1TTQA 3ARXA 1P6CA 3A13A 3HFTA 2HWGA 3CHVA 4MF4A 5AY7A 1GPWA 1G6CA 3IGSA 1JDFA 3TROA 3G1SA 5DFAA 4JIHA 1AL7A 2GDQA 4UTLA 4HTYA 1FWTA 4YWSA 4CN6A 3WQEA 4NF7A 4GQ0A 3C4UA 4JOMA 4PR4A 1GOXA 4Z2KA 5HNNA 3WBWA 2ZIDA 4D9PA 1ISXA 3GNRA 4X3ZA 2Q8XA 3MMUA 3QHMA 3T0TA 1LF1A 5A8NA 3S46A 1OX5A 4AG0A 1RD6A 5F2GA 4K1GA 3MCOA 3QKZA 2YBTA 4IFKB 1T5AA 4YVXA 1HW6A 1QW8A 3T2OA 5HWMA 4EXQA 5C9WA 1M03A 3EWCA 2WSYA 2ZX8A 2DT0A 4CN1A 3UZZA 4PCTA 2W91A 2PAJA 3G3MA 3MKCA 3AWOA 3U2ZA 2VX5A 4UR8A 3UZXA 3KLKA 4B9ZA 3OBKA 5C54A 5LHFA 4PGLA 2Z2AA 2ZUUA 2VGIA 2J7EA 3FW6A 4ZE4A 5IXEA 1PBGA 3I65A 4C6DA 3EB3A 1OC7A 3NFUA 2Y89A 4UTJA 4XQ6A 5C71A 1Z32X 4FLOA 4H8VA 3EB2A 2X1TA 4OQVA 1EO5A 4AZ6A 1FP9A 3GTFA 1SZRA 3S1GA 5FF3A 1DIEA 1B54A 2QF8A 1OFQA 3UETA 4HU0A 4D8ZA 4WDTA 1TQJA 3O2LA 1KCZA 5CG7A 4OOUA 1PYFA 1Q7ZA 3EX6A 3REQA 4UOQA 3BLEA 1FHUA 2J25A 2J75A 4S3DA 1FFQA 1GJPA 3TE9A 2Q09A 3QRHA 1DJQA 4IMFA 1NQKA 5D2TA 2BNJA 1R8LA 3GXNA 2GVYA 4NNCA 3S83A 2YCKX 3RUBL 1F2JA 4HCDA 1JAEA 3GDKA 5CC3A 1JCNA 3BICA 2WBGA 5AHEA 3QW3A 3ZSSA 4ZQMA 4EIVA 2A3HA 2EAWA 4NQ1A 4E0CA 1S5MA 4WK9A 1Q2SA 4A3UA 4XO6A 2VDGA 1VFMA 2UY3A 1EL3A 4KWOA 4TVCA 1TTPA 5DCBA 1UWRA 2PDUA 3VM5A 1LOLA 3HN3A 1YXCA 3CL8A 2V38A 4L1GA 3VIFA 2HE8A 2CXGA 4JIQA 1TX2A 3BLIA 1NP2A 2GJPA 3KE0A 1DWFM 2TAAA 1XDLA 4UTHA 2PWEA 5H6HA 3U8GA 5DN1A 4WF7A 1FH9A 3V0TA 5HQEA 5CGTA 3PZNA 1FCBA 1R3SA 1V0NA 2B7PA 4NHVA 2IXUA 4TX8A 4PEKA 1BKHA 4C6OA 3I10A 3EMCA 2CLPA 1L2QA 4MGGA 2B7OA 3K30A 4JTRA 4UMCA 4CGTA 4R27A 3CUXA 1H51A 4PMOA 3OBAA 2FHCA 1FRBA 4HBKA 1MQPA 3GFXA 3QV8A 4PE8A 1CLVA 2QCEA 4QG8A 2A3BA 5T9CE 3EXTA 4AX7A 2QQ6A 3BJFA 2ZQ0A 2Z1BA 3B9AA 4TTUA 4YHGA 4NAFB 1FCQA 3P82A 1WE5A 5FEPA 4DUVA 3WD1A 4QNEA 1SFSA 5HATA 1QI5A 3T0BA 5G1TA 4JTGA 1DE5A 3WBXA 1RHCA 3VGBA 4N6EA 3VIOA 1J0YA 2ZRUA 3VKAA 4AB4A 3DHFA 2ATMA 4JIPA 3DHPA 4J40A 4FLQA 4HK5A 4W89A 3L7RA 2FMNA 4KKXA 4WSHA 3ZQ9A 1TELA 3LTPA 5FOOA 1T96A 1UB3A 1C7SA 3WLPA 3GHRA 3WCZA 4D6IA 3AU6A 3NZPA 2AL2A 3EDDA 1L2UA 4B3KA 1V7YA 3W7QA 3CWNA 3NJ3A 3AHYA 3MI2A 3LGGA 3RG6A 4AZGA 4ZQPA 2NXIA 5AC8A 3V0SA 3EDFA 1G0CA 5T9BG 4A4AA 5K9CA 4XZWA 2CIPA 5BU6A 4MWAD 4GGHA 1K7EA 1HVQA 1YBQA 3W7CA 3EKLA 1MXGA 2G3NA 3ES7A 1D9EA 1MDRA 1U1JA 3BOFA 3UYIA 2FKPA 3GC2A 5D32A 4HPNA 3HQOA 4GIEA 2R82A 3TWBA 4TU1A 2EEXA 4O1DA 3N6HA 2OR2A 5AKQA 1PCKA 2BY3A 3C8FA 1E5JA 2Z28A 1TPWA 1UHVA 3VIHA 3L2LA 1IR2A 4WCJA 1JFHA 2C0HA 3GBDA 1AJ0A 3AMKA 1BVZA 2V81A 5JVLA 3EOLA 2BFGA 1HL9A 1T8QA 3AHXA 1DHKA 1K6WA 1IEQA 1VP5A 4AF0A 3LENA 1I6NA 4A8LA 4BF7A 3BWWA 3URQA 1EKOA 4HMCA 3WNMA 3KS6A 1KM0A 4N4QA 1JQXA 5DRCA 2YDQA 2I9EA 1V0MA 1DJIA 3PBWA 3E6EA 3G3DA 3BW3A 3PBVA 3ZJ6A 1OQFA 4QBXA 4DJED 3T08A 1PDYA 5JXQA 3PULA 3HQ1A 1Y5VA 5XINA 4R3UA 3MI6A 4DUWA 2GGJA 5CPQA 3GU9A 2GVLA 2D2JA 1LL4A 3WK2A 3OHMB 3B9DA 3HV8A 4TIMA 3U5UA 2PDLA 4Z2GA 3ITYA 4XSMA 4J4KA 2FB2A 5DRIA 4D1IA 1UIPA 1V51A 3GIQA 1KBJA 1AL8A 3MHFA 4D8LA 5FL0A 1H7WA 3P0XA 4Q33A 5IHRA 3QOKA 3ABSA 1F3EA 2F8QA 5CJNA 2PFHA 3EEZA 4GI9A 4LTSA 1JPDX 1YRRA 1H09A 3UG4A 5EU9A 4J9JA 4BQ4A 1OBAA 1W5NA 3ZMRA 5IFTA 4OGZA 1B9BA 2AAAA 1X7IA 1KFCA 4TXEA 2YDSA 2VD9A 4HA4A 2B4GA 3LHZA 4ZE5A 4R34A 2X1UA 4HHLA 3WNLA 3TTSA 5HNRA 1CXEA 3P81A 2EF9A 3LS9A 2YA1A 2OXNA 2CFFA 2Q02A 3QEZA 4L80A 3QSTA 3OPSA 4YTUA 3GG1A 3SSJA 4H7ZA 2TPSA 3WNOA 4DX3A 4Q22A 1H50A 1IWAA 4JL2A 4G8TA 1Z48A 5LIKX 3MUAA 1PXGA 4WOZA 2X05A 4EKJA 5AVHA 3W1TA 1PTAA 3SDOA 2OO6A 1V7AA 4HGXA 1B31A 1E73M 1TUFA 1XLJA 1ZAJA 3PVFA 2PWDA 3NZRA 3NIYA 3B8DA 2PMQA 3BGJA 5F1VA 3S1XA 1UCWA 4NILA 3ZLHA 2Z2BA 3LHWA 3L5AA 3SBFA 1IQ8A 1R2RA 3UG8A 1F6PA 1XLAA 4IL0A 3CLMA 3CAKA 2X7VA 2NQJA 4ATWA 3GAYA 4HU4A 1QWGA 3N14A 1ONXA 4P7RA 3G8EA 1K02A 3TFCA 3FDGA 2PWVA 2YSWA 3RNDA 2E0PA 3O0FA 3ATYA 1WXZA 1KQYA 1YE4A 3TZFA 3CO8A 4XWUA 3GVRA 1ONRA 5BRPA 2FGZA 4HNUA 3HG3A 2BX7A 2IS7A 4OU1A 4NG3A 2VMFA 2VQTA 2Q8ZA 4MB5A 5MKGA 1SGJA 5E5CA 4J3VA 2X0SA 3OGSA 1BGAA 1GYMA 2I7GA 3GDBA 4JEQA 3GXPA 1V6XA 5G2WA 1A5MC 3FYPA 3N04A 4AFYA 1GHSA 3ITCA 3H4WA 4Z1BA 4M56A 2GUYA 3TJXA 3SCVA 4NIRA 1Q2RA 1RP8A 3R8GA 1HIZA 3W2LA 4P7OA 3W1XA 1W5OA 4OKDA 1D8WA 4JKMA 2PTWA 7REQA 3RGTA 3W53A 4M81A 4HOZA 5CSRA 1J0IA 3JS3A 1I45A 1IHIA 4HA0A 1E71M 4PN2A 3M7SA 1QVBA 5BWFA 2X0HA 3ATZA 4JHOA 2NVAA 3VGEA 3UVIA 4Z17A 2XGZA 2VWSA 4URIA 4GC3A 5D09A 2VO5A 1YTEA 3I3DA 3PZVA 4V2XA 2OYMA 2GGHA 4QAIA 2A2IA 4R9OA 1H7NA 3TN5A 4B5WA 2WYSA 4LRTA 1R0MA 2FZMA 2RUSA 2DUZA 1E6SM 1EF2A 3KAOA 1R2TA 4FZIA 2E67A 2ZXBA 2PPGA 3NQGA 3CIWA 4B9YA 3UP8A 4OHQA 2XSBA 1E0WA 5FF7A 3FHAA 3CJPA 3VKDA 3M6YA 1QW7A 2NX9A 1D3HA 2ZRZA 1QT1A 3NSNA 1UP3A 1TJ0A 2R1PA 4PCPA 1OF8A 5HANA 1GQNA 4D1JA 4XTDA 3O9NA 1E43A 2QVHA 2VGFA 1KFBA 4MDPA 2BOGX 2ZUWA 2AMGA 1Q65A 2ZE0A 4DHGA 2GJLA 1LUCB 4PMQA 6XIAA 3VNDA 1SO6A 3LSBA 3ECQA 1LQAA 1FH8A 2WLYA 3SY8A 3POHA 3G1AA 3BLDA 2QDGA 3LMYA 2J62A 5SWUA 4IG2B 3RRAA 3GM8A 4IX0A 5C9ZA 1DOSA 1C91A 2ODOA 2VVNA 5C9UA 4EP8C 2BHYA 1LBLA 1ZBKA 5LNVA 2PGEA 4GWEA 4LEFA 1VCFA 5I03A 3MCMA 1JF6A 3S3GA 1A5BA 3USBA 1WZMA 3RX4A 3S1WA 3ISIX 5MHBA 3NQ2A 2C7FA 1V08A 2DSUA 2Z24A 3M7WA 1NFGA 3RCYA 4D6EA 4HYVA 4CNNA 1YDNA 1JCLA 2V9DA 4MAVA 1JZ5A 2VR2A 1Q6FA 2I5GA 5TD4A 1SO4A 2C1GA 2RGMA 4Y2WA 1UPPA 1TPEA 3WSUA 4ZMGA 4DZAA 3KHDA 2BP1A 3AHTA 3DHDA 1AA1B 4JN6A 2IPWA 3LCWA 4B3ZA 5HMEA 3TTYA 3IV3A 3F4NA 4KERA 4QX4A 1QPRA 1HJWA 4MLRA 2DIEA 3M0HA 1R7OA 1V5XA 3MTWA 4NZ5A 3WLSA 3OYXA 5T91A 1TYGA 3TJ4A 4E38A 2AMXA 4DWSB 3CMGA 2BMBA 1K3UA 4C6JA 2R1LA 4ROPA 3SRFA 1YDOA 1QI0A 2O92A 3J7HA 1Y5XA 3DH7A 4UTWC 2L5HA 3N17A 4K39A 4N9BA 3FVMA 3EZ4A 3I7SA 2ISFA 2Y88A 3VZXA 2GJRA 3TMQA 3UESA 1ZLPA 1UA7A 3W1MA 1OZQA 1WB0A 3MUY1 4UNKA 1HJVA 1U1UA 1UKPA 5E09A 2WZTA 4XUYA 4HU8A 2P3EA 3KWXA 2TODA 4L6DA 1MWOA 1RCXB 1IT8A 4UCGA 1WZKA 3PTQA 3OQ8A 3GWQA 3KP0A 3U2OA 4LYPA 4BQ5A 3H70A 4F79A 4WKFA 4HPHA 1OGBA 3K4WA 1V3KA 2Y8VA 1QBAA 2FMOA 2CHRA 1LLWA 2F2KA 4H04A 3VA8A 1SO5A 1K9EA 4H6KA 5CLTA 2DT3A 1QOQA 3TJIA 2VZTA 2C19A 1QCWA 3P6LA 2JK2A 3P62A 4GI8A 1DE6A 2UBPC 3OLGA 3GR8A 4LC8A 2O0TA 3AALA 4QR6A 2TMDA 4GHRA 2D24A 5I00A 2YKKA 5LA0A 1JRCA 3F4DA 3V36A 2OU4A 3EAUA 3T42A 3BE7A 3TTEA 4CN4A 3DFTA 4ECLA 1O5XA 3CWHA 1R9YA 3QFEA 1YTKA 4WGXA 3RLUA 1ZZMA 2GJNA 3W81A 4LNYA 2P0IA 5HA7A 2YL5A 4U2ZA 5K7JA 4UTTC 1LLOA 3WK3A 2IPGA 1L0PA 3RK8A 2J7GA 4L9XA 4AVFA 2AL2B 3AXIA 3RJYA 5G1YA 3AHVA 1W1ZA 2ZTKA 1ME8A 2WC7A 2OZ8A 3LMZA 4ICMA 3KBJA 1DJWA 2WSPA 4RCXA 2VXNA 4R7JA 4LOCA 3T8QA 4HU3A 4JHZA 3PUDA 3W6MA 3RR4A 1ZP4A 1TCMA 3S2NA 4UTFA 1R30A 2Z0IA 3CPGA 1HF6A 1EP2A 5FA5A 3MVTA 1JIBA 2G37A 4QISA 5H91A 1RV8A 1JYXA 3Q65A 3L5LA 1B30A 2XYLA 3TONA 1B3YA 1FKXA 3KWSA 2FVLA 5G5IA 2PUZA 1LRTA 4GOAA 3W71A 1HKMA 2AGTA 1JZ3A 1SFTA 4XTIA 1Q6GA 3FCPA 1XCFA 3DKLA 3IGHX 3RCMA 4PUMA 2D2GA 1M7OA 3WUGA 4MDOA 3MHUA 4MKNA 4HZ6A 1E4IA 3RILA 2J8GA 1XIBA 3JZUA 1KM2A 3NQFA 3KL5A 1W1TA 2KAUC 5D02A 4GFIA 2CBJA 4ASTA 4DF2A 3GYCA 2XZ7A 3DECA 4A3YA 4LY4A 1W8SA 3VDHA 4XKYA 3ZT6A 1B5TA 1ZNNA 2NQLA 4LS1A 4GH1A 4GKLA 6TAAA 2GSHA 4XIAA 3FHQA 4O16A 2NW0A 1PDZA 2DPEA 4QS5A 1S2CA 3HURA 3A4JA 4F4RA 2QLYA 2HBVA 5CJ5A 3AZTA 4IIGA 4J35A 3VDCA 3V5FA 4V33A 5KZ6A 3BK0A 3CL6A 4YJ5A 4GUHA 3HIJA 3R8RA 4FXFA 2X41A 3A5VA 4AHOA 5C7VA 1HT6A 4ATLA 3M46A 3CB3A 4YMZA 2H6RA 2ZADA 4MIMA 3H2MA 4LFYA 1YYAA 4YNGA 2HISA 3U7BA 1NJJA 2OG9A 4AC7C 2DZUA 4W7VA 2OKTA 3W28A 1BFNA 5BZAA 1C90A 1XIFA 1TRDA 2BVTA 1SSDA 5IHSA 1AH0A 3K8MA 4UNLA 3MU7A 3WY1A 5HPCA 2CPUA 1OG6A 4RE3A 4D6GA 3YPIA 4HYRA 4JFUA 3OVRA 2DSVA 2VRJA 1GK8A 1UW9A 3I7QA 5JUVA 5A6LA 1VLWA 1F4HA 4UTUA 1UMLA 3LV6A 3W1AA 1P48A 3KVLA 3EWXA 3E38A 4JTCA 3W3OA 2ISVA 4O54A 2Y5EA 1WDDA 4RDZA 5A8PA 4S3AA 3ES8A 4GISA 1NVMA 4O4WA 3C5QA 1J11A 4QSFA 2J27A 1WYIA 1J0KA 1MEIA 1ICPA 2R24A 4D6CA 2P5NA 5HDRA 3UA4A 1EDGA 4ACZA 4FNQA 1KNWA 3C0SA 4QITA 1QPNA 2ISDA 3B8SA 1B1YA 1EOMA 5ABHA 2RGLA 4DPQA 3GXTA 2DZXA 3PTKA 3E96A 3R0UA 5EPDA 2QJNA 2C16A 2X2YA 3PB0A 4X0VA 4JNYA 3RF9A 3TOYA 1E1EA 3DHUA 1TREA 1CNVA 5DMMA 3W7PA 2PWFA 4IMDA 3C2VA 3A23A 1ZL1A 2G8ZA 1JYNA 1X39A 1JZ7A 3K8LA 2QHAA 2NWRA 2OX4A 2QUUA 3NPWA 3N2BA 3WJZA 4F48A 2R1MA 2PDXA 1V6VA 5EBUA 5JBFA 4NI3A 1EQPA 1JDEA 2VC7A 1SW3A 5BU9A 3NXLA 3GIPA 1W9UA 2NQZA 4FOKA 2FTWA 4AQLA 4NZCA 1GW1A 3RO6A 4KEZA 2HVNA 2XH4A 1UD6A 5MKGB 4G1KA 1M1BA 3LHUA 4PULA 1U83A 4PMJA 4YHEA 4UMAA 2OGJA 3S6TA 4MYAA 4YYFA 1UR4A 2HVOA 4JR5A 4FS9A 3VE9A 4S2CA 3AIUA 2ZICA 2VZUA 3MW7A 1ZY9A 1UJPA 3MKVA 4KWWA 3P7YA 3SUWA 2OEMA 4YTRA 4JD4A 1NARA 2VX7A 4B2DA 2OODA 4DJDC 2W27A 3DFQA 7REQB 1GKPA 5HWJA 4RDYA 4GRSA 4JYDA 1PJ9A 1Q7QA 1YEYA 2H3DA 7TIMA 4LT9A 4H9TA 4AWUA 3JW7A 1GGOA 1VH7A 1OWQA 1QBBA 4D6HA 1ADSA 4CD4A 5K9XA 2OOGA 1MO0A 3LRKA 3BW4A 5FAJA 3NO5A 4LAZA 2AAMA 3N11A 1S38A 1OCJA 3VCNA 3N19B 4HNNA 1JRBA 3VGGA 1CPUA 3CEPA 4FA3A 6PTDA 1PZ3A 3U48A 1B3ZA 1CEOA 4J7RA 1FFRA 3F2DA 1GEHA 5EMMA 3KCLA 3EX4A 1CXFA 1XYBA 1MFUA 5CJMA 3M43A 4IP5A 3MHGA 1U5HA 5AN7A 4QNWA 3C6CA 3N9SA 4ZO6A 4CD8A 2ACRA 4GYJA 4LAMA 4E2BA 2Y85A 4MUPA 2WSRA 3BARA 1BSLA 4UXDA 3ZO9A 3AUJA 2PF0A 5F4SA 1PCWA 2VX6A 1LZOA 4IFOA 3MJMA 3VIPA 1NFBA 1J6OA 3KTSA 5C6MA 1FP8A 4XX6A 2PP0A 3WL1A 4HYWA 1CGVA 1TTIA 2CC0A 5IRPA 3W7IA 1JDDA 3E2SA 1SU5A 1PIFA 1JJKA 4DO7A 1XINA 1T8XA 3VNLA 3IJ9A 1H0IA 3AYRA 2PDBA 4BCEA 3IVSA 4FK9A 1PIGA 5A2AA 4Q4PA 4HA1A 1XC4A 2OT1A 1PVNA 4KWUA 1XQLA 5HWNA 1KBBA 4AXKA 4F2UA 3E0WA 3B04A 4NYYA 3WQWA 3VCRA 5E6YA 1N82A 2RFGA 1J0JA 2E40A 3EKZA 3RM8A 3OZOA 5CBBA 3W86A 2YYUA 3SIMA 3QPYA 4TV6A 2WJZA 1W91A 4Y96A 1C8YA 1GZJA 4QG6A 3SRKA 1FTXA 3N9KA 1SVDA 2E7FA 1W2PA 2NSOA 4KRTA 3I6TA 4JGDA 1BQGA 1BWLA 4GYKA 1R7AA 4EWJA 2I5QA 3LHYA 1AMYA 4O1FA 1EJUC 3L4YA 4XUGA 1YTDA 3UT0A 1YADA 1MW2A 3P14A 1U1HA 1RLDA 3LA4A 4V27A 5B80A 1CWYA 2XGBA 2HS8A 1EFZA 4K7VA 1A4MA 2XVKA 3V0UA 4UFMA 1NEYA 3AIRA 2XIMA 1UMYA 2Y63A 3T07A 4AY7A 1W9BM 4JTQA 3W75A 1LCOA 3AIQA 1M41A 3C2RA 3GFYA 3WLJA 3VC5A 3GZAA 3WQ8A 4HZMA 4EWND 1UWAA 1BVWA 3NWRA 4UTKA 1JUBA 5MF5A 3WF2A 1BHGA 1R3YA 1ZBVA 4Y9PA 3WD3A 3BAWA 1XYLA 5HBFA 1MRQA 3B40A 3PZUA 1TPDA 3WBEA 3UR8A 3DKJA 3CUGA 1NY1A 1U22A 4E8DA 4H8NA 2QT3A 4F0LA 2BGNE 3GW0A 2GGEA 2QJIA 1RQBA 2RDTA