3INPA

2.05 angstrom resolution crystal structure of d-ribulose-phosphate 3-epimerase from francisella tularensis.
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
220
structure length
218
Chain Sequence
HIQINPSILSADLARLGDDVKAVLAAGADNIHFDVMDNHYVPNLTFGPMVLKALRDYGITAGMDVHLMVKPVDALIESFAKAGATSIVFHPEASEHIDRSLQLIKSFGIQAGLALNPATGIDCLKYVESNIDRVLIMSVNPGFQKFIPAMLDKAKEISKWISSTDRDILLEIDGGVNPYNIAEIAVCGVNAFVAGSAIFNSDSYKQTIDKMRDELNKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title 2.05 Angstrom Resolution Crystal Structure of D-ribulose-phosphate 3-epimerase from Francisella tularensis.
rcsb
source organism Francisella tularensis subsp. tularensis
molecule tags Isomerase
molecule keywords D-ribulose-phosphate 3-epimerase
total genus 77
structure length 218
sequence length 220
ec nomenclature ec 5.1.3.1: Ribulose-phosphate 3-epimerase.
pdb deposition date 2009-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00834 Ribul_P_3_epim Ribulose-phosphate 3 epimerase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 3inpA00
3Q58A 4UIOA 3G24A 2NXGA 2GVJA 3UY7A 1WAUA 3IIZA 4JTLA 1TTQA 1I45A 2C19A 3THAA 4FNSA 3FKRA 2GUUA 1GYLA 3TQ0A 3EX1A 5BRBA 2J9XA 5D33A 3M5YA 1W5NA 1X6UA 3C61A 2QJHA 2YFOA 4JIPA 3TH6A 3QJAA 1OJXA 1JUEA 4WUIA 1SZEA 1UASA 1K8ZA 3NQGA 3E02A 1OFPA 4KFNA 1DL3A 3T78A 3WK2A 4JDBA 3TX9A 4WOZA 3W88A 1LRNA 5AYXA 4UCGA 3NDOA 3C4UA 3VE7A 3TW6A 4WXYA 3T44A 4ZQNA 4QSHA 3HMJG 1JCNA 2ZDRA 3W7HA 4O1CA 1WBJA 3R12A 4LC8A 3QMTA 4RR4A 4W9TA 5DCDA 5DXYA 4NXSA 3BG9A 3LERA 1S5VA 3LOTA 1ZJIA 4HNTA 4Z08A 4L4LA 4BWLC 2H8ZA 2Y7GA 2DZWA 5CSSA 5E0KA 3FKKA 2V9DA 1TPFA 4EIVA 2ZTKA 3RFAA 1X1ZA 2BSLA 3HBLA 2A5HA 3S5OA 2YW3A 3TU9A 1A5BA 2V2HA 3IVSA 1TCDA 4IMEA 1HUVA 3UQNA 1Q6OA 1JQXA 1OF6A 3W87A 2WNZA 1H1ZA 1DQWA 3JR2A 2E6FA 3W7MA 3BGGA 4DO4A 3LHTA 4UFKA 1XKYA 3NPXA 3WFAA 3LRMA 1UUMA 1GVQA 3QYQA 2NXHA 3PR2A 1H7OA 2QCCA 1LBMA 2CLFA 1DVJA 4HNUA 2WSRA 3B05A 3BK0A 3KFTA 3R8RA 2QJIA 1BEUA 3FA5A 5K9XA 3OHIA 3DFQA 4NJKA 4ORIA 3PB2A 4HIBA 3WJYA 1FCUA 3G1YA 3L5MA 3PM6A 2Y70A 3LB0A 2E6YA 3QMSA 4WOQA 1OYBA 4M7SA 5IBXA 1TPUA 1R2SA 3C6CA 5AHEA 2X1UA 5I3FA 4ZL1A 3M16A 5K9CA 2Y63A 3MMTA 4H4IA 2HS6A 3HG5A 2YZRA 3WK0A 2PC4A 1QPQA 4DF0A 2NLIA 3IEBA 4A21A 3E96A 3C3NA 4UTHA 4YCOA 2J9YA 3CU2A 3O05A 4UTTA 3W2JA 3DI1A 5HUPA 3VE9A 5AC7A 3NQDA 1E51A 1OK6A 4XKYB 2OT1A 5T26A 2Q8ZA 3PUEA 4KFOA 1VCFA 1FBAA 4OV4A 1Q45A 1QPRA 4LS0A 4JTHA 3W3OA 1YXDA 2NWSA 5D38A 1TPDA 3LI0A 3NQ6A 3HG4A 5HINA 3O6CA 1FDJA 2E5DA 1WOBA 4GUHA 1B3OA 2Y88A 1QOQA 2YW4A 3MHGA 4RKAA 4Y96A 2DZTA 3MYPA 3P5ZA 4N2YA 1KFBA 4MYAA 5FESA 1TTIA 2E68A 1X1OA 3USBA 1WX0A 1LLWA 4JTGA 3LI1A 2EGZA 3W07A 1EP3A 2J6XA 4JD4A 4ADUA 4TO8A 2CLKA 3W73A 5H91A 4ZQRA 3LRLA 4JYDA 4OU1A 3S5ZA 1SSGA 2GVLA 3EB2A 4QITA 3UD6A 4MJZA 1RQHA 3L0GA 2HMCA 5MHBA 1EA0A 7TIMA 4NU7A 1Y0EA 3M44A 3G3DA 3WJWA 4CCDA 4JX5A 5G4EA 1K7EA 3TSBA 5GVJA 4PFMA 1OFEA 1ZCOA 3N73A 3DAQA 3MP3A 5D03A 4GXMA 3PUDA 1PVNA 1MEHA 3PY2A 1KTBA 3LTSA 3JS3A 3NR0A 1I8JA 1MEWA 4NNAA 3HPSA 2A85A 1HTIA 3P8IA 4TMBA 4PTNA 1F5ZA 4O8RA 2Z6JA 3G1SA 5D32A 3RK8A 3GVGA 1GVRA 2CZFA 5D30A 3O63A 4QIUA 1XBYA 2ISSA 2VEPA 5D37A 1JCLA 2VXNA 3BW2A 1VLIA 5FEWA 3CWNA 5C55A 1SFLA 4A3UA 5EKYA 2VC6A 3TQVA 2NV2A 1SR9A 3W83A 4JICA 1W5MA 1JJKA 1K7FA 4I7WA 5AC8A 4UMCA 2H3BA 3NO5A 3EEGA 1ZNNA 4Z1AA 3C2FA 2RDTA 5CG7A 2BXVA 4YCPA 3F03K 5DCEA 3O07A 2HTMA 2VFHA 4M7TA 1YADA 3SIZA 5F4XA 1VHNA 4CQAA 3SGZA 1WV2A 3W71A 1LCOA 3S5YA 1U5JA 3ZWSA 2PRLA 2QCLA 3B06A 5KITA 3QW3A 5HQEA 3VI2A 5LZLA 1C29A 1F7BA 1JRCA 1JQVA 1SU5A 2ABBA 4LT9A 2QUUA 3WJSA 4O4VA 3U2OA 2B7NA 4TX9A 3S0CA 1UUOA 4JYEA 2A6LA 3NPUA 2BTMA 3W70A 4UTJA 4HSNA 4E2BA 3W2NA 2DZUA 1CI1A 1PS9A 3F4WA 2FB3A 2PURA 3BGJA 1SPQA 2Q8LA 3R5EA 4K6AA 4NJIA 1VS1A 2AQWA 2PRMA 3KRZA 3R89A 3S5NA 2PRHA 3S6DA 4LW7A 1RR2A 3FS2A 4H3DA 3QRHA 4IXXA 2C15A 4GUFA 3C56A 1LORA 2CLOA 1PL9A 2G95A 2X1RA 1O5XA 1I2RA 3KVKA 2QR6A 4Z1BA 1Z48A 1H1YA 3UZJA 2ZA2A 1KM2A 2FFCA 1SO6A 4UMBA 3NQ8A 4ZQMA 5DN1A 2YFNA 3DFSA 1KA9F 2B7QA 4AF0B 3HO8A 3TA6A 1ZY9A 5D05A 4MY1A 4R34A 2NXIA 3B0VC 1AW1A 4IXHA 2A7NA 5F1VA 3EX4A 1IF2A 3NYZA 3HQ1A 3BW3A 1W56A 4PL1A 3M7WA 1XBXA 3G3MA 4HPXA 5EYWA 2R14A 4O1BA 2V8ZA 1OHLA 3TSMA 5DCBA 2ZZ2A 3CHVA 4QNEA 2ISVA 4PL2A 3PUOA 3NM3A 1VHCA 1XUUA 3NZRA 1QO5A 3SECA 1SZNA 4E2DA 2E5BA 1DBTA 3STFA 2CU0A 1TPEA 8TIMA 3TIMA 3SW6A 3G1HA 3PG9A 1LRQA 3UY8A 5D2TA 2V5BA 1HG3A 3A5VA 3SI9A 2P10A 3GAKA 3S42A 5CZTA 4QJ1A 3W7DA 5HULA 4BI7A 3RF9A 1RPXA 4N4QA 1TPWA 3W86A 4FXRA 5F2IA 3UPBA 5I3IA 2R94A 3LHZA 3GXTA 3STGA 3UWZA 2DZSA 3P67A 5KZDA 2E6DA 1VRDA 4UFIA 2IQTA 1W31A 3B03A 3V1PA 5KMYA 2X2GA 4JTSA 2QCFA 4NX0A 3DU0A 1FXQA 5DY3A 1IXQA 3W7RA 4O17A 3O6DA 2W79A 3MYOA 3N9RA 1I2OA 2WSYA 4U4MA 5FI8A 2VEMA 1QOPA 1BWLA 2AAMA 4R33A 1P0NA 1UCWA 1RV8A 4AEOA 3QQ1A 3MO7A 2LLEA 1YPFA 1F05A 3A23A 1HO4A 3HB9A 4GFSA 4MUZA 1TJRA 4PCFA 3OVPA 3MBDA 2VFFA 3PBUA 3M5XA 1XDMA 2Z6IA 3HPZA 3G0SA 3GDMA 4JIQA 3W7CA 1NEYA 2TYSA 2ZRUA 4FIQA 2KZHA 3LDVA 4C1LA 3QM3A 4WXZA 3N3MA 4O0ZA 3ATZA 3GAYA 4YMZA 5K4XA 4K8EA 1A53A 1TJPA 2C14A 3IIVA 4XWUA 1W8SA 2Z2UA 1SO4A 1ZAJA 3QZEA 2WPBA 4RXGA 3T4CA 3UXAA 1G4EA 3P74A 4E38A 1M6JA 1S5WA 1TV5A 5K4ZA 1KM1A 3NQEA 4AWSA 4MZ8A 5D2WA 3CEPA 1OFQA 3C8FA 1TPC1 4MFEA 1PCKA 5HMSA 3QSTA 4DF2A 3QFEA 3GYEA 3DH7A 3B04A 3CWOX 4WD0A 2ZCGA 3KRSA 1W3TA 1ADOA 4O16A 4UTWA 2A1YA 1VGAA 2GJLA 3PSVA 4JX6A 3AJXA 1FCVA 5A5WA 5LNVA 3IVTA 1IIGA 1YDNA 3FFSA 5LNSA 3WJZA 3N2XA 3O8AA 5DY2A 4LVAA 5FF4A 1P0KA 2QCGA 4HPJA 1F73A 3DFPA 5G2WA 3S1WA 2X16A 5F4SA 1JR1A 4AVFA 1TQJA 1W5PA 5C54A 2AGKA 2FLIA 3YPIA 2BLEA 4RZ4A 5CPMA 2H8XA 1QNVA 3CTLA 4IX0A 1AMKA 5A8GA 1ALDA 1YDVA 1FQ0A 5AHFA 2ZRZA 1TV7A 2WNQA 3HIJA 1W3IA 3BARA 4FNRA 3TUUA 2V5LA 3Q2DA 1U83A 4N6FA 5K9DA 1KTCA 2D73A 1F6KA 2E09A 2QJGA 2C13A 1Q6RA 3N2MA 3GDRA 3LCFA 4UFMA 4ZZ9A 4DBEA 2FJKA 5C5YA 1JCMP 4JTJA 4GNJA 1JCJA 3NA8A 2JKPA 2CWNA 2V2CA 3A9IA 4HT3A 1K7XA 2XN2A 1OFDA 3EWWA 4MJMA 4UTUA 3H53A 3GNDA 4Y9AA 1IIHA 2DP3A 3LBCA 2JKAA 1H7NA 3A22A 2P1FA 3G1VA 3U8GA 3LV5A 5D2XA 3L68A 3TSDA 2Y89A 2GPTA 1FWWA 4FNPA 5HJLA 3C52A 1ZENA 3NNTA 4AWUA 3OG3A 5I3GA 1JCXA 3P7YA 4AHQA 2F84A 1B4KA 3PWAA 2NX3A 1M7OA 3UWQA 1LYXA 3W7EA 2EAWA 1LP6A 3L5AA 1L6WA 3W7JA 1Q6QA 3S9YA 1DORA 3L66A 4FX7A 2WNNA 3ABOA 5FF2A 3LLDA 3L65A 4AB4A 1IGSA 1KBJA 3GDTA 1P5BA 3W6YA 4QAIA 5CPLA 4Y90A 1XC4A 4LVFA 3DFNA 4M19A 4Z1DA 5J5DA 2XN1A 3CT7A 3UWYA 3GX9A 3MP5A 1VH7A 3BG5A 1KM0A 1XI3A 4MPQA 4CNOA 2JK2A 3MI6A 3E9AA 1GPWA 2ATMA 2QCDA 2ZBTA 1ICQA 5DXXA 2PE4A 3LTYA 4UNLA 3TAOA 4FO4A 5FF0A 5U7SA 4RZ6A 4DXVA 1XDLA 3CEUA 5CKSA 3E49A 1KLYA 1NVMA 3DFOA 3GDKA 4NJHA 1DJQA 3GDLA 3LHVA 5D2YA 1JCYA 1W54A 3W1QA 4ZQPA 2ZA3A 1MSSA 3FYOA 4XUGA 3UWVA 2ISWA 2CZDA 1D3GA 1MO0A 3W2UA 3P60A 3QPYA 4LVGA 1YXCA 1G7UA 4NVTA 1UB3A 3BG3A 1P4CA 2QDHA 3P62A 4ZQOA 4AF0A 5AB3A 1ZALA 4FNTA 2E6AA 2WV8A 2FPTA 4A22A 3FLUA 3W1PA 3UPWA 2QCMA 4LS1A 2Z0IA 3B0UX 1G7VA 2YX0A 3NL2A 2OZ0A 4GUJA 4UTLA 1MXSA 2WOQA 3THQA 4O50A 5HR7A 4DQWA 4ONVA 3W85A 1XBVA 2Y7FA 3L0NA 1TPVA 3GKAA 1K8XA 4AHPA 2EF9A 4ML9A 1W1ZA 3CQ0A 3IRDA 2VFGA 1DV7A 5I3HA 3IV3A 3NQAA 4JS3A 4AH7A 1FDZA 3ABSA 4N02A 3W22A 3W72A 3O16A 2VKZG 4GUIA 2P0OA 2OCZA 3OVQA 1OF8A 4GBUA 2RDWA 4IMGA 4Z1CA 3EX3A 4AXKA 1M5WA 1W3NA 3W7PA 3T40A 2O7QA 1L6YA 1LM1A 3KRUA 3H54A 3SY5A 1YDOA 4UMAA 4K7YA 1J2WA 2J88A 3TROA 1F6PA 1OK4A 2VEKA 1KFKA 2DU2A 2HSAA 5AHMA 3L5LA 3TFXA 4DELA 1EUAA 3TJLA 3OIXA 3W23A 1OX4A 4YLWA 3ABQA 1VC4A 1NFBA 3CM4A 2UV8G 5TIMA 2V2DA 2RKXA 4LOCA 3EWYA 1VCGA 1AL8A 4JYFA 1O4UA 3NM1A 4M6PA 5G1YA 1ZFJA 1QCWA 3STEA 3NZ1A 3M47A 4K38A 4GWEA 1ZAIA 3W1AA 1C9DA 1KV8A 1SFJA 3NAVA 5EBUA 4MZYA 3N19B 1HFBA 1M7PA 5G1TA 1GOXA 1ML1A 3CIXA 3PULA 3DKJA 3NL3A 4MFDA 4FEZA 3PC0A 5DELA 5DBTA 1GZGA 4UFLA 2ZRWA 3TC6A 4XZ9A 2ZZ6A 3IGUA 3A24A 3EXSA 3BW4A 4ICNA 5E1QA 1FWTA 4HHPA 1GEQA 4Y8FA 4RJEA 5HUOA 3NOEA 1OFAA 1SO5A 1H7WA 4CQ9A 2ZQ0A 4CNNA 4QM1A 1KBIA 4ADTA 2EHHA 3VCRA 2QF7A 1YTEA 1IXNA 1VQTA 4RCXA 5TQLA 4MLRA 4XBSA 4BK9A 1H61A 2GJNA 2DJXA 3LXBA 2WJZA 1FWSA 4JTKA 4LV4A 3DHDA 1XBZA 3O15A 1TV8A 2V81A 1GJPA 3EWUA 3NQVA 4N9CA 1OYCA 2ZZ4A 4YWIA 4NT0A 4M5PA 3W84A 5LNWA 2A7PA 2I14A 4JTIA 4LS2A 1Z42A 2C0AA 1YTKA 4UUIA 3WK1A 3OEXA 5LHEA 1FDYA 4Q32A 3A5FA 1KM3A 3TR2A 2QUVA 4LY8A 4ALDA 3N9SA 1H63A 2R91A 4O19A 3W7QA 3KXQA 4MKNA 4K7VA 4IX2A 3W2LA 4UTKA 2FIQA 1LOLA 2GOUA 4NNBA 1OX6A 3W7OA 4N9EA 5D02A 1EIXA 2YYUA 1XCFA 4LVDA 3P8JA 1OFRA 2YR1A 4LV9A 4NQ1A 3HPXA 3CIWA 2Q3OA 3W74A 4JTEA 1DHPA 4DPPA 4UR8A 4QQ3A 5HR6A 2FDSA 4DO5A 4L4MA 1G4PA 2Y85A 3DENA 1K3UA 2Z1BA 4NZJA 1JUKA 2FPVA 3L2IA 3UNDA 5CPNA 1JUBA 1J4EA 5F2LA 2A7RA 2R8WA 3ABRA 2FPYA 2VELA 1EX5A 3DFTA 4I7VA 3I68A 1F2JA 3W1LA 3EWZA 1NSJA 5F4WA 3I7QA 4O53A 3ANYA 4JGDA 5LNUA 4O1DA 4RK8A 5BNKA 4MVAA 4KWVA 4HNNA 2ZA1A 1GG0A 4BI5A 1WDWA 4LWWA 1LLZA 3NL6A 3NQ7A 5KZMA 1TPB1 3TAKA 2OMAA 3H55A 3LCWA 4JY9A 1SUXA 4EF8A 2OT0A 3LHYA 3EWXA 1CX9A 3B8DA 2JBMA 1Q3NA 1LOQA 3CB8A 4BWLA 5C6MA 4K8HA 1FXPA 4UFHA 5FF3A 1L9WA 3MWAA 1TRIA 4G1KA 4PEKA 3L67A 3KOFA 4UR7A 2C18A 1QPNA 1DJNA 1R2RA 1QFEA 1TO3A 4S2BA 1H7XA 1TRDA 2I1OA 1SZFA 3TNOA 5LKYA 4LUIA 4O1AA 4LUJA 3TXZA 3MHFA 4OE7A 1H7RA 4EF9A 2C1HA 1G4TA 3PF3A 3KVJA 3RNDA 4X22A 3ATYA 4O12A 4AHOA 3DKLA 4IOTA 2NUXA 2V0TA 3G8EA 2GQ9A 3F1QA 4GE8A 4PC8A 2WO5A 5CPOA 1G69A 5F2GA 1RZMA 3LXAA 4P2VA 3EX2A 4JTUA 3PVFA 1W5QA 1K8YA 3P82A 4IPIA 4FX6M 2XN0A 2ZRVA 1EUNA 1K03A 5J5RA 3BO9A 5BW6A 1AW2A 1I2QA 2VFDA 2RFGA 1KM6A 1KTNA 3M0ZA 2ZFAA 2WQPA 4MZ1A 3FIGA 4FNUA 4CCCA 4JTTA 1TTJA 1TREA 3NPVA 5DLCA 1SZGA 2E5CA 4KFPA 4NJGA 1TPH1 3BLIA 3LV6A 5AHLA 4XTIA 4XTDA 3TQKA 4FB7A 3GK0A 3W76A 1YPIA 5L6UA 3G1AA 5G2HA 4Q33A 4O18A 3U6WA 1KFEA 3DHFA 3HGRA 1QWGA 4JXCA 2X1SA 2V82A 3RLVA 1Z41A 1TIMA 5KSWA 2ZZ1A 3M1ZA 1OX4B 4IQLA 2DORA 1EWEA 2DZPA 2NUYA 1NAL1 2RH9A 4IGHA 3K30A 2QDGA 3NQCA 4R53A 2ZTJA 3IGXA 5D09A 3ZFHA 1FCQA 2NX9A 4UTWC 3PG8A 3MI2A 2F7FA 3G8RA 4KWWA 5LSMA 2ZRXA 1GG1A 5EA9A 1AL7A 1OX5A 4CNPA 4O11A 2ZRYA 2C3ZA 4LRSA 3GZ3A 3OBKA 5EL1A 2TMDA 3IVUA 4O57A 4UC5A 1OFOA 3O06A 3GIYA 4N6EA 1FX6A 5L9FA 3MW7A 1TTPA 4DEFA 2VFEA 3B0PA 3TKFA 2A21A 3WK3A 2BZNA 4Z0SA 3LCGA 3QEZA 3HG3A 3FJ6A 3OVRA 1L6SA 3STCA 4ZVJA 1X7FA 3W7IA 1ZAHA 1WBHA 3MP4A 3V75A 4PODA 4FX8A 3G1DA 5CZ0A 1EWDA 1IXOA 1N55A 1T8XA 2J27A 3L0KA 2OJPA 3IIPA 1O95A 3NG3A 1XL9A 2Y62A 3SFKA 1FUYA 1GVSA 1BKSA 4AMAA 3SSJA 3PSWA 1H50A 3TW7A 1KM5A 3M43A 3W1MA 2CZ5A 4HNVA 1ME8A 1WQ5A 4Q4KA 4TU1A 3PBVA 4IJBA 4R7JA 2ZYFA 4MOZA 4IMCA 4KKXA 3W1UA 3LBMA 3TV8A 3MBFA 1PCWA 3KHJA 4YL2A 3LRKA 4LU0A 3VFLA 5H2ZA 2NUWA 1GTHA 3W7GA 3SR7A 1I2PA 3CPRA 3MI3A 1S5TA 3LCXA 3C2EA 2ABAA 3PB0A 4M6VA 1QR7A 3LCIA 3NVTA 4TR9A 4QNWA 5FEZA 1WXJA 1G4SA 4B5NA 5HWJA 1QMLA 4YXGA 1VYRA 2C6QA 2QCNA 4O14A 6ALDA 4O54A 3INPA 2ZZ7A 2WSQA 3KAOA 3C2OA 3W7NA 2NWRA 1LDCA 6TIMA 1GT8A 4HKPA 3EKZA 1KW1A 3M5ZA 5CSRA 1OABA 5KINA 3CLMA 2HS8A 1NF0A 3P61A 3L9CA 3PBWA 5G2IA 4CQ8A 2B7PA 2DZVA 5K2ZA 1Z44A 1VR6A 4UTTC 4LRTA 4J9JA 2QAFA 2CLHA 3P81A 4DO6A 5FF7A 2OX1A 3UZ5A 2Y7EA 1H51A 4O10A 1WA3A 5AHIA 1SW7A 4O52A 1V7YA 1FY6A 5FEPA 2TPSA 4JEQA 5G5IA 1W5OA 2JKEA 2WKJA 3LGEA 4OV9A 3BV4A 3KVLA 5IBXC 1PHWA 4DBDA 3QH2A 4RV8A 1FCBA 1LZOA 1A5SA 4JR5A 1KV5A 5AYZA 4ORMA 4FHAA 1PE1A 3NGJA 4M6QA 3IGSA 1VLWA 4NXKA 1GTEA 2QKFA 2VEIA 1CW2A 3E0IA 1W0MA 5BMWA 4OGZA 3W7LA 1H5YA 3F4NA 4HSOA 4A2RA 4A2SA 1XFBA 4C1KA 3S1VA 2B0MA 2Y6ZA 3SGUA 2ALDA 1D9EA 5EMUA 3BLEA 1KFCA 3LM7A 2X1TA 3W75A 2B4GA 3UXDA 4HN4A 4U28A 3C2VA 3T55A 2CLIA 4N4PA 1R2TA 1YYAA 2CLEA 2TRSA 3GXPA 1R47A 1IXPA 3QF0A 4X3ZA 3G22A 2A4AA 3EXRA 4MY9A 3GB6A 3NQFA 3Q37A 3C0JA 4BI6A 4DPQA 1ONRA 3W9ZA 2TSYA 4K36A 3O6YX 1RVGA 3KVMA 1KM4A 3G0UA 4TMCA 3P84A 4UTMA 2YGYA 1AW5A 2PCQA 2GVGA 3UYCA 1AK5A 4D2JA 4AAJA 3BVJA 1C8VA 5SWUA 3JRKA 3SJ3A 3GKFA 3NQMA 2O7SA 1YLVA 3EXTA 1T96A 1DOSA 2J24A 3QW4B 4N9DA 5KTLA 1RD5A 1VJIA 4MY8A 4UNKA 1ICSA 1VZWA 3RU6A 4GJ1A 3EKLA 3DI0A 5DBUA 2X30A 2YCEA 4LTSA 1R46A 1TSIA 3CC1A 3M9YA 2CFFA 2YSWA 4BFAA 3NEVA 1FWNA 2A0NA 5IM51 4EOUA 4RZ5A 2I9EA 4DF1A 3UWWA 2BWGA 1GVFA 3EX6A 1FWRA 2GQ8A 1JVNA 5EY5A 1ME9A 4GC4A 1LOSA 1F74A 3LHUA 1R30A 4JY8A 3G1FA 1F76A 3DGRA 1H7PA 1KLZA 3MUXA 1GVOA 4X9SA 2H6RA 3QQ0A 1D3HA 1OYAA 4I7UA 4WY0B 1EB3A 5CZJA 4NJJA 1BTMA 1THFD 1O5KA 2CW6A 2RDUA 3PAJA 1K02A 3NPWA 3S1XA 3E12A 1A5AA 1G6CA 2CZEA 3Q94A 5D2VA 4E0CA 1OFBA 4Y6GA 1UJPA 1A5CA 1QPOA 4UTIA 1TB3A 5AFDA 3G18A 2Y7DA 1TQXA 1NF7A 1XM3A 3W1TA 2ATSA 4JX4A 3L21A 5FEXA 4QISA 3T7VA 2QCDB 3HGJA 1SQ7A 2FQIA 1P1XA 2BX7A 2G96A 3GXNA 4CCEA 3ZWTA 5AN7A 3R2GA 1SO3A 2Y61A 4BF9A 4MLJA 3LLFA 3OA3A 1GYNA 1T0OA 3WJXA 3RLUA 4IMDA 3S8HA 3FEMA 2H90A 4TIMA 1AG1O 3LX9A 1B4EA 3G0XA 2V30A 5F2MA 3DXIA 5BOOA 3I7SA 4O15A 3M5VA 4NUWA 5HNRA 2DZXA 4IMFA 1O60A 1H62A 1X8FA 4PH6A 4OWGA 1SW3A 1O94A 2E77A 2QEZA 1OG0A 2EPHA 4PA8A 5I3JA 1I2NA 5F1UA 2QUTA 3QC3A 1GWJA 3ELFA 4WJEA 4NX5A 1MEIA 3R13A 5TBOA 4EWND 2QCEA 3HGSA 3G1XA 4JN6A 1JRBA 3TE9A 5D04C 2B7OA 2EKCA 3ZS4A 5K7JA 3FOKA 4XQ6A 1A50A 4FNQA 1ME7A 4O4WA 3AO0A 3N34A 2JGQA 5KZEA 3MJYA 4ZMGA 5U4NA 1PHQA 3M6YA 3KX6A 4OQVA 3I65A 1ZHAA 4OT7A 2Q3RA 5AC6A 1B57A 3HGOA 3TMQA 1W37A 4ZQCA 1MZHA 3UWUA 1UBSA 4UFJA 4JDYA 4I9AA 4S2CA 4WX2A 3B4UA 2VOMA 1G67A 2FTPA 1VPXA 3TXVA 2G97A 1RQEA 3O1NA 1QAPA 1EP2A 2C16A 3NL5A 1SSDA 4NNCA 1QDSA 2ZZ3A 4RLIA 4O13A 2YYTA 3PBYA 3IIOA 1DQXA 3N14A 4WZHA 5BMXA 3P80A 3I7RA 4CLMA 1RQBA 1XUZA 5CGQA 2XFWA 1J5TA 3QPZA 4XKYA 1JULA 2YDAA 3RMJA 4FF7A 5EPDA 2QAPA 3I6RA 4IUOA 1WYIA 4RX0A 4H6KA 2W0UA 4NZFA 2CLLA 4P61A 2CLMA 3NQ2A 1V5XA 3LCHA 5E93A 5AHNA 1KFJA 4IWWA 4ADSA 5C2XA 1QO2A 1EPXA 4S1FA 3LCLA 4GRSA 4LC6A 1GQNA 2RHGA 2NZLA 1LBLA 3TK7A 1WOAA 1VCVA 3HJZA 3FJLA 4LNYA 3LHWA 4MIMA 1TMHA 1T99A 4JNMA 2E1DA 3W1XA 3IIXA 5G4WA 2GQAA 1HL2A 4OHQA 3LTPA 3W2MA 2YPIA 1TYGA 5I3KA 1LRTA 3M41A 2NX1A 3EWBX 2DJLA 4OBTA 1SW0A 3TMLA 3BPWA 4IPJA 1S3HA 3HG2A 1N8FA 3TCEA 3W2KA 1DKWA 4MYXA 4O28A 3TDFA 2VENA 1YTDA 3VKJA 5LHFA 3BLFA 5CZSA 1L2UA 1ICPA 5ABTA 3TC7A 1HO1A 1YXYA 3QSRA 3VNDA 1KFLA 1N7KA 2QCHA 1VYPX 4K37A 3NXFA 1Q6LA 3GR7A 4EVZA 1EEPA 2YXGA 4A29A 3W7KA 3A21A 3TJXA 4X2RA 3DBPA 5AYYA 2G5WA 2NV1A 1H60A 5K3VA 4WQ6A 3HOJA 3QMRA 2J9ZA 2A6NA 2FB2A 4RXFA 1VYSX 2A2IA 3GLCA 2H3DA 4AWTA 1OVDA 1BWKA 4LVBA 4WY0F 3TFCA 1LBFA 3W1NA 5HWMA 3S1UA 3ZR4A 4BR1A 3W1RA 4O0KA 4JTFA 3DZ1A 2ZZ5A 3SZ8A 3HF3A 1LTDA 4XBKA 1XXXA 1I4NA 3FYPA 5LNRA 4FIRA 5LGZA 1LROA 2VFIA 3GR8A 5AOUA 3P5YA 4GUGA 3PS7A 3D0CA 3LXCA 4WY0A 4K39A 4FXSA 1PV8A 4N9BA 2W6RA 3GNNA 2JGYA 5HWNA 4UXDA 1PIIA 1EP1A 1B9BA 3MHUA 3C2RA 5LGXA 4POCA 4Z0JA
chains in the Genus database with same CATH superfamily
3Q58A 2XIJA 4UIOA 1E43A 2HJPA 2NXGA 3UY7A 5BRQA 4XZWA 4IZGA 4JTLA 1TTQA 5FL1A 1JD7A 2C19A 1S1PA 2GUUA 3NFUA 4GQRA 4QXIA 4HTBA 4DIAA 1S2CA 5EU9A 3FEQA 4DWDA 2J9XA 1X6UA 2ZXBA 3WD1A 3S6OA 1OIMA 4DI8A 4YVVA 1UPMB 2PAJA 2CYGA 1JUEA 4HA4A 3BCDA 3OLGA 1OFPA 4B5UA 2J66A 2NQLA 3T78A 5T9BG 3B40A 1BHGA 3W88A 1QT1A 1LRNA 3VUPA 2ZUVA 2PDPA 2X1IA 3FDGA 4W89A 1S2TA 3BLLA 1WE5A 3OW1A 1OIFA 4E4FA 4EPEC 3W28A 4G56A 3T44A 3TJIA 3N2OA 4QSHA 3PJUA 2ZICA 3CGTA 3AS0A 4O1CA 3L4ZA 3QMTA 3L4UA 2PTZA 4ES4A 3AIVA 4WKAA 2VHLA 1JL8A 1UG6A 1FRBA 2DZWA 1G01A 1PJ9A 1J2BA 5REQB 1RK6A 4NAEA 3ARWA 4EIVA 1BF2A 1SJAA 3RFAA 4H6EA 1GUVA 5PTDA 2ZVIA 1HP5A 1BVWA 3S5OA 1A5BA 2V2HA 3A6OA 4IGNA 3QXBA 4AIBA 1TCDA 3KLKA 3B8UA 1HUVA 1JZ7A 1JQXA 2BXZA 1HT6A 3W87A 4J7RA 3GNOA 2WNZA 3DHPA 3WBEA 4G7EB 3TEVA 3WH8A 3QY8A 3LM3A 3QYSA 4AVOA 2PZ0A 2ZX8A 3LHTA 4UFKA 1PKYA 3NPXA 2JIWA 1HXJA 1W9VA 3B9NA 4P8UA 1A49A 3PR2A 3SEPA 3UZWA 4XBJA 2QCCA 3VD3A 2EPNA 3UFYA 4DLMA 3S4TA 2X8RA 3FA5A 5K9XA 5E6ZA 1SFSA 1B90A 3DFQA 2VOTA 4ORIA 1U1JA 2Z7GA 3NTYA 4HIBA 4YVPA 3WJYA 1LWIA 4UZUA 1FCUA 4DO7A 1HJWA 2D22A 2AQOA 2E6YA 5AC5A 4WOQA 4DBUA 1OYBA 2OQHA 5IBXA 5BZAA 1KB3A 1ZLPA 1R2SA 2AOSA 5I3FA 3UJEA 1DJZA 2QIWA 5K9CA 4W5ZA 2Y63A 3XISA 1VFSA 2EO7A 2HS6A 3ZR5A 2PC4A 4HCHA 4DF0A 3QV8A 4HPHA 3E96A 3MZNA 2RJGA 4B15A 4B9ZA 1PYFA 3CU2A 5HUPA 4IIEA 1ENUA 1RCOB 1W9UA 5DEZA 1E51A 4XKYB 2OT1A 4U31A 4OV4A 1QPRA 1JG9A 2O9TA 4Q8PA 5D38A 3LI0A 2ZUNA 2L5HA 4GUHA 2Y88A 3FJ4A 4KGLA 3RCNA 2DZTA 3MYPA 3P5ZA 3LUTA 4MYAA 1WDPA 3T08A 1W1A1 3L7RA 2EGZA 1E4IA 1A5KC 1EP3A 2J6XA 1E9YB 4DZIA 3LRLA 3WL0A 5H8UA 4PR4A 5A6BD 3EB2A 3DERA 3UD6A 2Z28A 4D1JA 3L0GA 9XIMA 1FH7A 3E3HA 4ASTA 4JX5A 4DJEA 5G4EA 3UWEA 3FDKA 1B2YA 4K3ZA 4NI3A 3N73A 1IGWA 3XIMA 4OUIA 3AHVA 3WY1A 1F8IA 2E9MA 1XIEA 2W66A 4M51A 4DBSA 3NR0A 2PZNA 5AKQA 3P8IA 1HTIA 2VEGA 1R9XA 1F5ZA 4PTNA 4O8RA 1GJUA 3G1SA 3MUZ1 3ARXA 1ISYA 2R24A 2ZX5A 3IK4A 2CZFA 2F6XA 4HNCA 1J10A 1XBYA 1V0LA 1BGGA 2WC3A 1CBGA 5D37A 5C9UA 3BW2A 4WR3A 1VLIA 2GOKA 5A6JA 5EMJA 5C55A 9RUBA 4A3UA 4L7ZA 3S6TA 5LIYX 3TQVA 2VC6A 1JDCA 2RDXA 4HZMA 1K9EA 1NOFA 1SR9A 3BH4A 3W83A 2VEFA 4W8LA 1XCXA 1D7KA 3ITGA 1Y8BA 3EEGA 3QGAC 3C2FA 5C2CA 5FJUA 5CG7A 2FHFA 2QV4A 3O07A 4PUDA 4DN1A 4IMAA 1VHNA 1SVDA 3CMFA 1WV2A 1LCOA 1UZ1A 1XIIA 2R82A 1YQ2A 1KGUA 3CL6A 3T1GA 2NV9A 3T4WA 1DE5A 1CGVA 3EB4A 1QI4A 1FHDA 4C60A 2WBGA 2OYKA 1UUOA 2HZGA 1V7AA 3ICJA 4GVGA 2X40A 4IGMA 2W27A 3W2NA 3F4WA 2AKMA 2FB3A 1FWAC 3TNBA 1UR1A 5MKGB 3S6DA 1R87A 4IXXA 2VGBA 5BXSA 2VUNA 1Z8AA 3OJGA 1FWHC 1E0XA 1EOMA 4RUBA 3HA1A 3PZUA 1NDWA 1SMAA 3L4XA 2O55A 5CLTA 4UMBA 5DN1A 3DFSA 3BGAA 1P0EA 5A2CA 4IF2A 4AF0B 3NYDA 4MY1A 2WLZA 3MSRA 3AHXA 3D6NA 4IXHA 4YHEA 2VMFA 5F1VA 4A8LA 3NYZA 4XISA 3TTYA 4IL0A 3LZ5A 1HZYA 1BG9A 1MXDA 3EKGA 2POZA 1XBXA 4QDPA 2R14A 2V8ZA 3QY6A 3CHVA 4QNEA 3NM3A 1E6XM 4B2DA 3KDOA 1X6LA 1DBTA 3PFRA 3SW6A 3CH0A 3PG9A 5I24A 4CN4A 4PMXA 1HG3A 3R0DA 3SI9A 3CMJA 5CZTA 3W7DA 3UVIA 4IQDA 2J7FA 4BI7A 1Q8AA 3A3WA 4WF7A 3W86A 3WH5A 3CUGA 1RLDA 4F2UA 3E1F1 4NRSA 3WQEA 2DZSA 2O4MA 3WN6A 3P67A 5KZDA 1D2KA 4MB1A 3TWBA 3B03A 3B8WA 1CCWB 5KMYA 2QCFA 5DY3A 3DU0A 1FXQA 4AD5A 2PDJA 2PODA 3FCPA 4D6GA 4IL2A 1EJXC 3KW3A 2W79A 3MYOA 3N9RA 3SBFA 2WSYA 5CSUA 1TFVA 5BOEA 1AQ0A 3BAIA 4R33A 1P0NA 5AY7A 1XIDA 3VOFA 3CUIA 4ICMA 1CLKA 4U5IA 3HB9A 1HO4A 4TV5A 4MUZA 2VX6A 4OOUA 1TJRA 1PX8A 2VFFA 2GYIA 3PBUA 2UBPC 3KBSA 4YVXA 1XDMA 4J3WA 4JIQA 5FAGA 1BD0A 3W7CA 4FIQA 3AUOA 3N3MA 2HQAA 3SCRA 3N04A 1TJPA 3BANA 4GY1A 3O7UA 2Z2UA 1HKMA 1D7FA 1GKRA 3WF1A 3UXAA 1G4EA 4E38A 3ZLFA 1TV5A 2WMKA 3MUCA 2O4QA 5AVHA 3W53A 3ZVHB 5KEZA 1E70M 4MZ8A 4MWAC 3CEPA 3AALA 2PD9A 4AG0A 4IFOA 1E56A 4F9JA 1VFTA 4B92A 1W3TA 4PTXA 1XH0A 1IZJA 2A1YA 1M3UA 4DXKA 3S9IA 1DPMA 4GIEA 2BG5A 3IVTA 1YDNA 3OBEA 3RIKA 4LVAA 5FF4A 5G2WA 3DFPA 3LU2A 4P7QA 4RE3A 1MI3A 3VGEA 2V5JA 1OM0A 1VBHA 4KCWA 4RZ4A 5CPMA 1QNVA 4GYFA 4PRTA 4IX0A 3EWCA 1ALDA 3VABA 1DQUA 1FQ0A 2ZRZA 5AHFA 4E4UA 2E40A 1MUCA 4H19A 4GQBA 3OZYA 4U3AA 2CKRA 4P5UA 1JYNA 1F6YA 1MW0A 1W3LA 5D9NA 3TJ4A 5I0DA 1Q6RA 3N2MA 1QATA 2YCKX 3W82A 3UERA 1V6WA 1XSJA 1JCMP 2I16A 3ZT5A 1OCJA 1IE7C 3F2BA 4MJMA 3UJRA 3VXGA 3GNDA 3A22A 3G1VA 3ARYA 2Y89A 1EBHA 3VIKA 3TZNA 2GPTA 1EQCA 2CBIA 3FGCB 4FNPA 3KCLA 5HJLA 3UGVA 2QT3A 3K8KA 1PDYA 2DGAA 3QVQA 4B4FA 4AHQA 1UP2A 5GNXA 4G1NA 3UGRA 4H9UA 3W7JA 1VBJA 1XYMA 1Q6FA 3LLDA 4AB4A 1IGSA 1EL3A 1KBJA 2DIKA 2XZ7A 5M1TA 4Y90A 4H01A 1IQ8A 1XYZA 4Z1DA 3KOZA 5I23A 4QCEA 5T91A 2UWFA 3PBMA 4ZTYA 2HBVA 3TLQA 4XD5A 1NH6A 1REQA 4CNOA 3MI6A 3E9AA 4G9PA 1OC5A 1GPWA 1MRAA 2GGIA 2ATMA 2QCDA 1ICQA 2PE4A 3LTYA 4I9JA 1ISVA 3TAOA 3FVDA 1XDLA 1GZ1A 3DHUA 3L2LA 4BF5A 1Y5XA 1KLYA 3DFOA 4RW5A 2VNCA 3LHVA 3G1RA 1EFZA 3SIMA 4EANA 3FYOA 4M1BA 2DH3A 4KEMA 2ISWA 2CZDA 3O0FA 1D3GA 1MO0A 1VB9A 3W2UA 3QPYA 1YXCA 4NVTA 3FAWA 1RUSA 3VIIA 4HYWA 2B81A 4X63A 3BG3A 2VO5A 1P4CA 3E38A 1KC7A 3UVAA 4AF0A 3GFXA 5AB3A 2INEA 2FPTA 3FLUA 1NDZA 3ID7A 3UPWA 2GFTA 2QCMA 1TX0A 2VGIA 3NL2A 2RUSA 4LGXA 1KRAC 4NL1A 3VDBA 1E5JA 4MADA 3SCWA 1C7TA 2X7VA 3H22A 3E0FA 1JNEA 2Y7FA 2BNJA 4ML9A 1JZ3A 2VFGA 5I3HA 2X42A 2WJFA 1XQKA 4WGHA 1EZ2A 1FDZA 3H2NA 1FWJC 3W72A 3OVGA 4JHOA 4D8AA 2BHYA 3PZNA 2WQDA 3EX3A 4JTCA 1W3NA 2O0TA 2O7QA 3WH6A 1UP0A 3VOJA 3SY5A 4QJ4B 1J2WA 1UKOA 2J88A 1F6PA 3UCDA 1KFKA 2DFAA 3KCOA 3VPLA 4W86A 3JW7A 8CGTA 3AMLA 1R3QA 4YLWA 1LJYA 1JI1A 3PPHA 2PDIA 2VD8A 3G5EA 1EX1A 2OEJA 2WHLA 1O4UA 4M6PA 1ZS2A 4JIIX 1QCWA 2GQ3A 1Q2RA 3VZYA 1ZAIA 4H7CA 1C9DA 5EBUA 1HFBA 1M7PA 5JBDA 3NL3A 1FH8A 4FEZA 5HK4A 3MMWA 4ZOEA 4IH3A 1W3JA 3IGUA 3A24A 1JXJA 2J78A 5E1QA 1GEQA 3GY1A 1UOKA 3ENLA 2EHHA 3VM5A 1CB7B 4U10A 4KRZA 4RCXA 3MDUA 3WF4A 3SSZA 4A4AA 2GJNA 1EBGA 4JTKA 3GFYA 3CZGA 1TV8A 4WHBA 2Y8KA 5DT7A 4H9MA 1UA3A 3OZPA 4LBSA 3KTXA 1GJPA 1UIOA 1HJSA 2C91A 3EWUA 3POHA 1U5HA 3NQVA 1XLMA 2ZZ4A 4NT0A 2A7PA 2P53A 2I14A 3N3TA 4JTIA 2GDVA 1Z7AA 4JKMA 2C0AA 4U2ZA 4UUIA 1JZ5A 2J13A 3HJEA 4PFHA 1XSIA 1S5MA 5HXMA 4F8XA 3A5FA 3TR2A 4LY8A 4A35A 4W87A 5A8NA 2R91A 3W7QA 3NJ3A 3S2LA 1LLOA 3E0LA 3ZO9A 2GOUA 1OX6A 3M4HA 3W7OA 1GVYA 4IJRA 4KEUA 3WBXA 2XIIA 2YR1A 4LSBA 3ZVHA 1QI5A 1JPIA 1UD6A 3W74A 3HU7A 1XLLA 4LAMA 4QQ3A 4DO5A 3BJSA 1RP8A 3DENA 1JUKA 2FPVA 5CC6A 3ZMRA 5CPNA 1JUBA 1RSCA 5F2LA 4M80A 1NWUA 2VELA 3OG2A 2QW5A 3WO8A 1KRBC 3MT1A 3EWZA 3R43A 5F4WA 2J62A 3THCA 2REQB 2E7FA 3ANYA 1EPVA 5LNUA 4O1DA 1W91A 2OQLA 3FA4A 3N29A 3OGRA 4F0MA 4DWSC 2AKZA 3AICA 4LWWA 1LLZA 5BYWA 3TAKA 1SUXA 3KZSA 3QV7A 2OG9A 4IQEA 2OT0A 2VJXA 2QPUA 3FN9A 2BGNE 1Z3NA 4BWLA 3ZT7A 4UFHA 1A4MA 4Z2KA 5CC7A 1DYSA 1DJNA 2CITA 4DX3A 1JZ6A 1R2RA 3K1DA 1TRDA 3R0KA 2I1OA 1SZFA 5LKYA 3QN3A 4ENLA 1KR0A 2HE8A 4HGXA 2RGMA 4QG8A 4RNFA 3NWRA 3PF3A 1BYCA 1BVNP 1R3RA 3RNDA 1H5VA 4B9YA 2KX9A 4PC8A 2FVMA 5CPOA 5F2GA 3N17A 1JYXA 3PVFA 4JAWA 3P82A 4IPIA 2WZTA 4P8XA 3L4WA 5C7HA 3MQTA 2VFDA 1JCTA 2RFGA 3GDBA 1HJVA 2ZFAA 1AD4A 4MZ1A 4H9TA 2O56A 3F5JA 4CCCA 4JTTA 3EZ4A 4HBKA 3NPVA 2QLYA 1P7TA 3V16A 5FOOA 2QPSA 4GIAA 1XLBA 4XTIA 5DMYA 1DJHA 4LEFA 4I9MA 5G2HA 4MF4A 3U6WA 3UEQA 1R3YA 3DHFA 4JXCA 1ZZMA 1CPUA 2FMOA 1Z41A 5CBJA 5KSWA 1B0IA 5FA5A 1OX4B 1DE6A 4IQLA 3FK4A 3P6LA 3GR4A 3T05A 4US5A 1KQYA 3ARUA 4BEQA 3E2QA 1CXLA 4ZA0A 1EXBA 4UTWC 3TC3A 3CHCA 3WH7A 3G8RA 5LSMA 1REQB 1ZJAA 1GG1A 5EA9A 1AL7A 4Y9PA 1OX5A 2Y5EA 4O11A 1Q6CA 1R8LA 4QLLA 3AYVA 4LRSA 2TMDA 4S39A 2D24A 1OFOA 4UC5A 5EB8A 4N6EA 5L9FA 2AL2A 3LYEA 4NKCA 3B0PA 3WK3A 1O12A 3OVRA 1QW9A 3UG5A 5A6SA 4V1XA 3W7IA 3IUDA 1ZAHA 4JBRA 2VTFA 3MP4A 3V75A 3TYEA 1UKSA 1EWDA 1N55A 4A3RA 2J27A 2V5CA 3L0KA 1OGBA 3GIPA 1NFPA 5C9WA 1CGUA 4I8DA 3NG3A 3P14A 1FUYA 1BKSA 1TZ9A 3GO2A 3SSJA 4X9YA 4DLFA 3PSWA 4DBWA 1YHTA 1OY0A 2PBOA 4PB4A 4ZBCA 3TW7A 3M43A 4K2SA 3F5LA 1TWSA 1ME8A 3EOOA 1WQ5A 4Q4MA 4DJEC 4PULA 4IJBA 4R7JA 3WQGA 3LBMA 3MBFA 4ZB0A 3KHJA 3LRKA 3UZZA 4Q22A 3VFLA 5H2ZA 3GE7A 4DJDA 1GTHA 2C79A 3SR7A 4D6IA 1KGWA 3C8NA 3B8SA 3AYSA 3UYIA 4I8YA 1DP0A 4M6VA 1LUCA 3KL5A 5HPOA 4DZ5A 4QNWA 3MSYA 3TP4A 3WDQA 4LB3A 5HWJA 2VT0A 1J0HA 6ALDA 1CLXA 4CKQA 4O54A 3PN8A 4IHCA 3KAOA 2HRWA 2DUXA 1MXGA 3SN1A 3C2OA 1LDCA 3N2TA 6TIMA 1GT8A 1RAKA 4HKPA 5CSRA 2HS8A 5D4YA 3UXKA 2DZVA 5K2ZA 3HTWA 3V0UA 5G4HC 2WB5A 5BXPA 4EXAA 3LY0A 4O8AA 4CQBA 5JIWA 1QWKA 1AD1A 4D6JA 1UD2A 1WA3A 1EQPA 4O52A 1KXQA 2TPSA 4JEQA 4F79A 3GVWA 2DQWA 4MAZA 2JKEA 3LGEA 9XIAA 4UTFA 5IBXC 5CZKA 1PYMA 3AMKA 1FCBA 3IAQA 2GGJA 4B3LA 2GJXA 4ORMA 2Q01A 1PE1A 2FZ9A 3S9ZA 2VEIA 5BMWA 4HU3A 3FJNA 1FKWA 3E2VA 2UY2A 3EB3A 3QKEA 1XFBA 2B0MA 1CDGA 1J6PA 3BURA 2EXOA 4BF7A 2PP3A 2ALDA 1Q6GA 1MQRA 4DUVA 2X1TA 3CV6A 4LBUA 4IFKB 4HN4A 1A5LC 4U28A 3T55A 1WKDA 3V5CA 1R47A 1IXPA 2GWNA 3QF0A 4X3ZA 2NQZA 2IPJA 3GB6A 4PCTA 1LL4A 3PTKA 3AYRA 3W9ZA 2ZOXA 3W37A 1QI2A 1H4PA 4QR6A 4XZNX 4TMCA 1J9YA 2YGYA 2ZX6A 1MNSA 3EOUA 1JZ2A 3AFBA 2AMXA 4CQCA 3U2CA 1MWOA 5A2BA 2E9LA 2KAUC 3JZUA 4J3VA 1R38A 3JRKA 3GKFA 1OD8A 4J2PA 1T96A 1DOSA 2ONEA 3U5YA 1ICSA 1UZ4A 1TE1A 1H3GA 4QCFA 2OO0A 4PMRA 2PTDA 4URIA 2X30A 3H2MA 1TSIA 5I2UA 3I3EA 4L80A 4C6MA 3CC1A 4BQ4A 1JF5A 3C0SA 5IM51 3PZGA 1Z9AA 1JXKA 3NO1A 2J77A 4EPBC 2BWGA 2PDQA 1GVFA 3DEQA 2GQ8A 1JVNA 4GC4A 1LOSA 1VFFA 2J7CA 4AVNA 3LK6A 3G1FA 4UOZA 1KLZA 3MUXA 1VPYA 4H8VA 1VBRA 5CZJA 3PZOA 4D8LA 2QGHA 4PMZA 3DG3A 1A5AA 4E0CA 4GQ0A 1QPOA 5AFDA 1QNQA 4JFUA 1NF7A 1PZ2A 3RRAA 5FACA 2XM1A 3RPDA 2D0GA 3HGJA 2VQTA 4CCEA 3GXNA 3GHTA 2BOGX 5AN7A 1SO3A 4HK5A 3H24A 3CPUA 1MDRA 3LLFA 3OA3A 1GYNA 4IMDA 5I79A 1VENA 5MKGA 4W7UA 3G0XA 3I7SA 4MG4A 4RPQA 5HNRA 4IMFA 1H62A 3OLEA 2CC0A 3MZ2A 4PH6A 4YS1A 1O94A 2EPHA 1I2NA 5F1UA 2QUTA 3F4CA 2D69A 1GWJA 3N2CA 4C5ZA 4NX5A 3HGSA 3G1XA 4BQ3A 3EPMA 1W1TA 5D04C 1EHNA 2PLMA 3LBOA 3FOKA 1ADSA 1GOKA 3CHDA 3ARTA 1XPGA 1LF1A 2W9MA 5DT5A 2IPWA 4O4WA 3CV7A 4AY1A 4ZMGA 2HPMA 1PZ0A 1CENA 2PDCA 4M1RA 1EOKA 1PTAA 3HGOA 3SUVA 4REQB 3LMZA 1NM9A 3CQKA 1MZHA 3S83A 4JDYA 3SCSA 3VNIA 3MCOA 1G67A 4H9ZA 3O1NA 1QAPA 1EP2A 2C16A 4HU8A 1DWIM 1QDSA 3L4YA 2ZZ3A 5E70A 3PZTA 3ZVIA 3PBYA 4D71A 1DQXA 3L12A 4HJWA 3ZJ8A 4PTVA 1BQGA 1PX4A 2YDAA 1W9DM 4ZXLA 4FF7A 2WMGA 3IUIA 3GU9A 5EPDA 1GOMA 1JNDA 5HMEA 1OWQA 3GG8A 1X7IA 2W0UA 2CLLA 1LG2A 1KCXA 3DIPA 4GY7A 4R9XA 5E09A 4HMEA 3QFWA 1KFJA 4ADSA 1QRQA 5C2XA 3APGA 3VCNA 1L6FA 2VZUA 4HNOA 1E72M 1WOAA 1VCVA 3HJZA 4LNYA 2E8YA 3RR4A 4TQTA 1T99A 3U48A 2E1DA 3W1XA 3W00A 5G4WA 2GQAA 1HGWA 1EDGA 2NX1A 3M41A 3NGFA 1SW0A 3TMLA 1S3HA 4K1GA 2BY1A 3N18A 1N8FA 3TCEA 1DKWA 1TG7A 2BVYA 3UG3A 5LHFA 4HP5A 1E4MM 3BLFA 1YNYA 1ICPA 1NWRA 3GTIA 4CD8A 1YXYA 3VNDA 2ZC8A 1KFLA 2QCHA 4GZ7A 4EVZA 2YXGA 3W7KA 4X2RA 1A5UA 1LG1A 3F4DA 3G6MA 1ZBCA 3A12A 3RHGA 3WMBA 1WKYA 3R6IA 3W1NA 4EXBA 3DZ1A 2ZZ5A 3SZ8A 2R1NA 3S5SA 3P0XA 4ZTXA 1I4NA 2ZUWA 3FYPA 5LNRA 1LROA 2AGTA 1AQHA 3D0CA 2PWFA 4K39A 3N25A 4UQCA 5C8BB 3GNNA 4EK7A 2OZ8A 3EDEA 2YL8A 2JGYA 3CHEA 1B9BA 3BOXA 4GFIA 4XAGA 3T0AA 3G24A 3OLDA 5M17A 2BY0A 2G50A 4RDYA 3FKRA 3VO0A 4EPDC 1DJGA 2J25A 3EX1A 3VDGA 3RPTA 3FVMA 1XGDA 5D33A 3M5YA 1W5NA 1BVZA 3RX4A 4U3CA 1X39A 3KOYA 4JIPA 3TH6A 3PFMA 3QJAA 3LEPA 3NQGA 4QJ3B 4J40A 1DL3A 1KCKA 3R94A 3TX9A 3QLDA 2OO6A 4S3KA 2INZA 1S2VA 4UCGA 3NDOA 3C4UA 1QNRA 3EPNA 3MKKA 3ARSA 4B90A 3GYCA 1WBJA 3R12A 5LXEA 4LC8A 5DCDA 3BG9A 4Q8WA 5I00A 4HNTA 4KMQA 4W7WA 4Z08A 3QTGA 5E0KA 5A8MA 1R0MA 3FKKA 1VBGA 4HU4A 1TV3A 4IJCA 1TPFA 1IV8A 3ITXA 1FH9A 1A5MC 2BSLA 1CXHA 4E8DA 2A5HA 2FZBA 5ABEA 3TU9A 3IVSA 2XGZA 3U7VA 3QZAA 4IMEA 3UQNA 4WLCA 3H21A 2JF6A 5H1WA 1DIOA 1XICA 4YN5A 2XHYA 4XD4A 5DMMA 1UR4A 1AQFA 2E6FA 1D8WA 1F07A 3VKDA 1DWJM 3PP7A 4GMEA 3WFAA 1YNPA 3LRMA 4DWSB 2J7EA 2JEQA 3CZKA 2NXHA 4HA0A 1LBMA 2CLFA 1DVJA 1UD3A 1GZJA 3HV9A 2XH4A 3SDOA 2NQ9A 1E4NA 1K9TA 3NIYA 2PDKA 2D3NA 2FYMA 3G1YA 6REQA 3PM6A 1RP9A 1HKJA 4H9XA 1QPKA 1TPUA 2ZXDA 2P5NA 1KXTA 5AHEA 2X1UA 3BMXA 3H70A 3AHYA 1MW1A 3M16A 4WDTA 4FXJA 3P0WA 3MMTA 5ABHA 2E1WA 4CU7A 1QPQA 1RA0A 3CO4A 3SRFA 4UTHA 4YCOA 2WMIA 4DJFA 2EG8A 3O05A 4UTTA 3VE9A 1XCWA 3P2VA 1LWJA 3RM4A 3AROA 2I57A 3NQDA 3E0WA 1OK6A 2XH2A 2Q8ZA 3PUEA 5D9OA 4KFOA 5FKYA 1FBAA 3AJ7A 3WDRA 1YXDA 2NWSA 3H4XA 5CAKA 3NQ6A 3HG4A 3N4EA 2YL9A 1FFRA 3OYXA 2CWXA 1BXCA 3GNRA 4PMOA 2J7DA 2E5DA 1WOBA 4NSBA 5JH2A 2YW4A 1JDAA 3SFWA 3WQ8A 1PWLA 4N2YA 4Y9NA 1UHVA 4EKJA 1OADA 1R9ZA 1V08A 2I5QA 3RMEA 1LLWA 5BWAA 1G0CA 4JD4A 3BL3A 4H2HA 2CLKA 3C5QA 3MCMA 4J3UA 3M0KA 4XZIA 4ZQRA 1JDFA 4JIEA 2GVLA 3RILA 1RQHA 2HMCA 4GI8A 3KCJA 3G3DA 3WJWA 1E15A 4H7VA 2D2HA 5GJMA 4QG6A 1MQQA 2NW0A 3PY2A 3HPSA 3UJ2A 2YB1A 4TMBA 2Z6JA 1WCGA 1V0KA 3U7BA 3GVGA 2HV5A 4QIUA 2G3MA 2ISSA 2VEPA 3PWGA 4G8TA 3VMPA 5A6AA 4UBPC 4NZ4A 2GJPA 4JQ4A 3K4WA 2UY5A 3N6HA 3AIEA 4RDWA 2ZE0A 3KM8A 1XIGA 4W8AA 1W5MA 1K7FA 4I7WA 3VOHA 5AC8A 4INFA 2ACRA 5JUVA 3VIOA 1ZNNA 2YA0A 4JFWA 3OPSA 3BV7A 5DCEA 1UOZA 1YADA 4P8WA 5F4XA 2ZDSA 2WWDA 1W1PA 4HB7A 3AUJA 3A13A 4GYJA 2QCLA 3PWIA 3UG8A 3ITLA 5LZLA 1C29A 3WIJA 3WLLA 1JRCA 1RBAA 2ABBA 1Q65A 1TA3A 1Y5WA 4LT9A 2DSUA 1EJSC 2QUUA 3IGHX 6XIMA 4KGJA 3NZGA 3UESA 1CXEA 3GZAA 1JYWA 1T7LA 4OZOA 1LL6A 1ODZA 1DIKA 1GJWA 4PB5A 3GHUA 4HSNA 4E2BA 1J01A 3GG0A 4E6MA 2WYSA 2DZUA 3ABXA 2PURA 1SPQA 1KBKA 2D1ZA 3R5EA 4K6AA 3LD5A 1VS1A 2PRMA 4KCVA 5CH9A 2PWGA 2J7BA 5C71A 1I1XA 2R1KA 2A3HA 4H3DA 1LORA 4GJIA 1PL9A 2G95A 4YTTA 3NZPA 1PZ1A 1I2RA 3KVKA 4Z1BA 1Z48A 2ZA2A 3F4VA 3NQ8A 1H2JA 2B7QA 3A3XA 2AMGA 2ZUTA 2EG7A 1J79A 3HO8A 3TA6A 1ZY9A 1AW1A 1YDYA 1G1YA 3EX4A 4KCTA 1IF2A 1IT0A 1JDDA 3BW3A 5BXRA 3M7WA 2G3IA 5DQPA 5EYWA 3VGBA 4O1BA 4M81A 4B4HA 1OHLA 4KS0A 3GWQA 5JU6A 4R7OA 3PUOA 4HU0A 3MTWA 1VHCA 1P1MA 3NZRA 1QO5A 1SZNA 2ANUA 1F3EA 2GJRA 3STFA 4S3AA 8TIMA 3WQ5A 2GDUA 1OEPA 3UY8A 5D2TA 3GU1A 3LGGA 3UBPC 3IK2A 1T8QA 3DOPA 6ENLA 4G6CA 1C92A 3XINA 3O0KA 4NG3A 1GQKA 2UY4A 1Q5MA 1VFMA 3H2FA 2F8QA 3LHZA 3GXTA 3STGA 2YL5A 3UR2A 1N2VA 2PGEA 3QC0A 1IEIA 1W31A 4FLQA 4NX0A 4WSHA 1W17A 1V8EA 4FMVA 1VIWA 4O17A 4FR6A 4Z1YA 3UCCA 4U4MA 5FI8A 4GLEA 1WKEA 1OC7A 2VEMA 3TTOA 1QOPA 2AAMA 4C6OA 3DGBA 4AEOA 1R5YA 3QQ1A 4IP7A 1YPFA 2EJAA 1GOIA 4AY8A 3GM8A 3OVPA 4F66A 4XAFA 1TIWA 5EGRA 3M5XA 1TMQA 3HPZA 3GDMA 1ELSA 2TYSA 3K46A 1FA2A 4MNKA 3LDVA 3QM3A 4S3JA 4H9VA 4O0ZA 3ATZA 3BAJA 3A9BA 1AJ2A 3L23A 1A53A 2EEXA 3IIVA 4L4PA 1OGGA 1A0CA 4XWUA 5EMMA 3KTCA 4A8IA 3RM8A 3KBMA 1ZAJA 2VDHA 3KL0A 3T4CA 4C6FA 1XLIA 1K6WA 4S3EA 4N7QA 3AIUA 3IANA 4Q4SA 4HVXA 1S46A 4C6NA 4XO7A 3BJFA 1ZJHA 1TPC1 4MFEA 2PDWA 5HMSA 4Y9MA 5LXXA 3GYEA 1TR1A 5FJJA 1SFTA 2ZCGA 1MUWA 1ADOA 4RZBA 3WFZA 4CD7A 1VGAA 3RAOA 2EPMX 3ARZA 4F0RA 1P0BA 2OZTA 5LNVA 3RLGA 3N2XA 5K4ZA 2QCGA 8XIAA 4GNVA 3S1WA 1KKRA 4LAUA 4F0SA 4AVFA 4ECLA 3NOYA 1W5PA 2AGKA 2G4JA 3YPIA 2BLEA 1WUEA 5A8GA 1YDVA 1Z6KA 2XG9A 5FIPA 3M0MA 1HGYA 4M0XA 1W3IA 4FNRA 2V5LA 3Q2DA 5H8PA 1MUMA 7A3HA 2OSXA 1GOOA 4QLJA 1AVAA 1MMFA 3BOFA 3GHRA 1XC6A 1SJCA 1DXIA 3RGTA 1CEOA 3OP2A 1ZB5A 3N15A 2GDQA 4NAFA 4GNJA 4LUSB 2PMQA 2CWNA 2V2CA 3A9IA 4F40A 2XN2A 3EWWA 5I6SA 4UTUA 2O92A 3VCCA 2V3FA 3U8GA 4L5ZA 4AX6A 3LQGA 4G5DA 3KE0A 4ROQA 3COTA 5HATA 4GI6A 5M03A 4W5UA 3SUWA 3NNTA 3WF2A 3OG3A 4LQ1A 1NQKA 3UZYA 1NELA 4ICCX 4ZOAA 4XZHA 5GNYA 2NX3A 1LQ2A 4L61A 3GQYA 3VD7A 3W7EA 4J35A 2P50A 1L6WA 2ACQA 4HYRA 1UR8A 3H8AA 4OOZA 4R9OA 3ABOA 3L65A 1H49A 3SUSA 4L64A 2J4GA 1P5BA 5J04A 2DT2A 3CT7A 2HK0A 3QZ6A 2PF0A 4GYPC 3CB3A 7PTDA 4BQ5A 1WXZA 1A0DA 1E55A 2ZBTA 5DXXA 2WPGA 1RJRA 1IEXA 3H2OA 2E9BA 4FO4A 5U7SA 4RZ6A 4CU6A 4P7OA 3GNXA 5FJIA 3CEUA 3TW9A 4NJHA 2OXNA 1EEXA 4GKTA 1XRSA 2YJQA 2VCAA 4HSHA 1MSSA 1AJZA 4F4RA 2WCSA 2DZAA 1E6ZA 1G7UA 2BY3A 4GG9A 4FS9A 4PBGA 5CC5A 4ZQOA 1V6UA 5DRIA 4MKVA 2E6AA 4A22A 4KEZA 4V2XA 4RDVA 4B3KA 3B0UX 1G7VA 2OZ0A 1FOBA 4GUJA 1RBLA 2WOQA 3THQA 3LNMA 3WNKA 2Z4GA 3I6EA 3ES8A 3GFZA 1JGIA 4I90A 2BMBA 1U30A 3W85A 4KIRA 5CSYA 2Z1XA 1JF6A 3KDNA 1K8XA 1RXOB 4AHPA 2V38A 3TOYA 1CLVA 1W1ZA 3T0CA 4QQUA 3IRDA 3GTHA 3MB9A 3KP1A 3NUKA 4GCXA 4HMDA 2P0IA 3B4YA 3NURA 4JS3A 2QNEA 3FHQA 5G1MA 2OLHA 3ABSA 3W22A 3O16A 4PUWA 1J0ZA 1OF8A 4LY4A 2RDWA 2XINA 4IMGA 4Z1CA 4AXKA 7CGTA 4LUTA 1Q63A 3T40A 3WSUA 3KRUA 2IKHA 3VKBA 4K7YA 4C7GA 4HNLA 3TROA 2VEKA 3KOWA 5AHMA 3L5LA 1RCQA 1EC8A 3C0QA 4ZOBA 4DELA 1EUAA 3MPGA 1J18A 3TJLA 1HF6A 1DTNA 3OIXA 1OX4A 3VTRA 4YTRA 4KBXA 4HA1A 1NFBA 3R79A 1SM9A 1R9YA 3M0IA 3EWYA 3WLHA 5ECUA 3NM1A 4H04A 3HN3A 4KWSA 1M7JA 3M47A 4K38A 4GWEA 1KV8A 2RGLA 1SFJA 2BOEX 3N19B 4QS6A 1GOXA 2X7WA 4MPKA 2I5IA 3PC0A 1UIPA 2IW0A 3UT0A 1CXIA 2ZRWA 3WLRA 1VFHA 2FHCA 4GC3A 5HPCA 5LIUX 2GUBA 1FHUA 1FWTA 3GUWA 5C9XA 2WVTA 5HUOA 1GCYA 1CXFA 3LPPA 4MDPA 3QGKC 2BFGA 5HOSA 3D3AA 4ADTA 1ECQA 1EJRC 1H1NA 3O3RA 3UR7A 1XD1A 2YIHA 3VFCA 4FOKA 4L9ZA 5I7GA 4M56A 1F3TA 4MLRA 1XYLA 1LQ0A 1VBUA 4BK9A 3DX5A 4HYVA 1EGZA 4JEJA 2PDLA 2OX4A 1BXBA 3OU8A 4GK8A 4LV4A 4XIAA 3DHDA 2QJJA 2WW5A 2PDGA 2PP1A 4E3VA 4B5SA 1GW9A 3VKAA 1EYEA 2I7GA 1I0BA 3W84A 3WZ0E 1CB2A 4LS2A 1YTKA 3WUFA 3WK1A 3WQDA 2BBFA 5LHEA 1FDYA 3E2RA 3M7SA 5BCAA 1KM3A 1E1FA 1OG6A 2QUVA 3OGSA 5JIPA 1H63A 2VC7A 3AIRA 1AUSL 4K7VA 1NTHA 1TZ7A 4IX2A 5CC3A 3SB0A 5KETA 2FIQA 1CGXA 4N9EA 3PZMA 1EIXA 1CECA 3RR1A 1XCFA 4LVDA 4LV9A 4NQ1A 2VR4A 2GGGA 4PSRA 2DZBA 4Z2HA 2Q3OA 1Y65A 2QULA 4UR8A 1IT7A 2FDSA 1R3WA 4L4MA 1XLFA 3A4WA 1V79A 2D0HA 1G4PA 4PMJA 1V6TA 3EDFA 3KBNA 2Z1BA 2X05A 2R8WA 1UWQA 1XJBA 2FPYA 2NSXA 2JQXA 3DFTA 3M0YA 3W1LA 4FP1A 2X0YA 4O1EA 1IWBA 2BXYA 3I7QA 4O53A 4JGDA 2XTKA 4RK8A 1P48A 4HNNA 1UD4A 1GG0A 4AQLA 1ITCA 2F2KA 2PDFA 1ZUAX 3LSCA 1WDWA 1P6WA 3NL6A 5KZMA 1TPB1 2QXWA 3CUZA 3V5FA 5IRPA 2SFPA 3BZJA 2DPEA 1MFVA 5F7UA 3B8DA 1W6TA 1Q3NA 1BRLB 2P88A 3N6QA 4ZB2A 2GUYA 3LQLA 3H26A 4K8HA 1FXPA 4LNCA 2ISDA 4EAMA 1OINA 1QXLA 3KOFA 4Q8OA 2C18A 3OOQA 3WUEA 1QFEA 2WZIA 2VGGA 1DWHM 4ZFCA 1NIUA 3S46A 4LUIA 4C7DA 1AH0A 4ZSTA 4O1AA 2QYGA 4NRRA 4EF9A 1G4TA 1E6PA 2DW7A 4IPNB 4X22A 4GQQA 4O12A 1QNOA 4AHOA 1GQIA 1S3TC 3DKLA 4IOTA 2HK1A 2GQ9A 3F1QA 3HQNA 2WO5A 4GHRA 3LXAA 3EX2A 2JF7A 1Z89A 1A3WA 5D9MA 3GH7A 3OYZA 1PAMA 3W6LA 4XSMA 5J5RA 3BO9A 2GSHA 1AW2A 1HL8A 3M0ZA 1QHOA 3FIGA 4FNUA 1VPQA 1XYAA 3SN0A 1TTJA 4JFVA 1TPH1 2GZXA 5AHLA 1XLDA 2W63A 2J7HA 3GK0A 3R7MA 2XM2A 4PRRA 3QV6A 1O66A 4EAYA 5D9PA 2VWTA 1KFEA 3A3HA 3HGRA 1RPKA 2Q71A 4UB9A 2IQ0A 4JCMA 2ZZ1A 3M1ZA 3AIWA 2DORA 1US0A 1N8IA 2VVSA 3CWHA 2JFEX 4R53A 3CO8A 1AJ0A 1OCBA 3ORWA 4Z2GA 3ZFHA 2NX9A 1RVKA 4TX6A 2CZVA 4KWWA 8RUCA 3O9NA 4L56A 3NEHA 4NAFB 2ZRYA 1UWUA 4L9YA 4O57A 1J93A 2OLAA 3S1GA 4CVUA 2VDGA 4YYFA 2V5KA 3E74A 3LCGA 2VI0A 3FAXA 4HOXA 3QV9A 1RJQA 1WBHA 4FX8A 3G1DA 3DC8A 4GX9A 3U4AA 3RO8A 2WCGA 4X0NA 3ALFA 2XFRA 1O95A 4AD3A 3WNNA 2VYOA 2Y62A 4J5NA 1BYAA 3Q45A 4AIUA 1MZRA 5E0FA 3W1MA 3IRSA 1HKIA 7ENLA 4Q4KA 3PBVA 3ZM8A 4X60A 3WH9A 2ZYFA 4MOZA 4US5D 3CH9A 3TV8A 4GI9A 4PMQA 1VAHA 3CPRA 3SRHA 1EKOA 2OWXA 1J0IA 3W81A 3PB0A 4QE1A 1QR7A 4PTDA 2OWWA 4HHLA 4O1FA 3WG6A 1WXJA 1G4SA 1O6IA 4PUJA 1QMLA 2WVSA 1YPXA 1VYRA 4DUXA 3INPA 1SGJA 3T81A 4TTGA 1AQMA 1KR1A 1WZLA 4IIGA 4MB3A 3KS6A 1OABA 2C8NA 1F4HA 2I9UA 3CLMA 4C6EA 5G2IA 2B7PA 4M8UA 1PXGA 1LL7A 1VR6A 4LRTA 3RITA 3E2SA 2CLHA 3P81A 5FF7A 1BSIA 4PTMA 2Y7EA 2HISA 3RXZA 2IMRA 1MDLA 1JZ8A 1FY6A 5M5DA 4XIMA 3WEZA 3VGHA 3NSXA 3ALGA 4PBEA 1I6NA 4OV9A 1UUQA 3KVLA 2XVGA 3QH2A 2ZXAA 3PK7A 1LZOA 4AMCA 2XIOA 1KV5A 1RLCL 1UJQA 4FHAA 3AWNA 1X98A 3NGJA 4M6QA 1Q6DA 4NXKA 2Y1HA 1EHAA 3E0IA 4GXPA 3W7LA 4A2SA 3FV9A 1LT8A 3MSGA 4EACA 3N2BA 2PS2A 4PUEA 1NDVA 3W75A 5CBBA 2V3EA 3C2VA 4N4PA 1YYAA 2JE8A 5FAJA 4UR9A 2QJNA 3G22A 3IJ7A 3EXRA 2VC9A 3Q37A 2DUAA 3UPMA 3B9EA 4NP7A 2PI6A 3O6YX 1RVGA 1KM4A 1RH9A 3P84A 4L4OA 4RDZA 3GXMA 4UTMA 1AW5A 5M2FX 3SM0A 1BRLA 5LIWX 1AK5A 3V4BA 1IZKA 4D2JA 5IDZA 3APYA 3BVJA 5SWUA 3NQMA 2O7SA 4DXXA 3QW4B 2V67A 2J24A 4AWEA 1VJIA 2VRKA 1FKXA 4AC7C 1VZWA 2GLKA 1S5NA 1UMLA 4WK9A 2C1IA 3UCQA 2WKLA 4LB4A 3M9YA 2CFFA 4TVUA 3MMDA 2Z1KA 4BFAA 1PKNA 4EOUA 1XLCA 2I9EA 4GPNA 1SR0A 4HPGA 4CVWA 3EX6A 1ITUA 2D20A 2J8GA 1YNQA 3GC2A 1A3HA 1IYXA 2PP0A 5TAOA 3B97A 4JY8A 3DGRA 3VOIA 1GVOA 1D3HA 4I7UA 3VDHA 4C6KA 1JPHA 1O5KA 2CW6A 2RDUA 3PAJA 3OQ8A 4IQJA 2XWDA 4RNIA 2CZEA 5LA2A 4AEEA 1M68A 1UJPA 1GHSA 1YMYA 4B91A 2XFYA 3KHDA 4WJ8A 4HZ7A 4PGLA 2YCLA 4JZ5A 2ZX9A 2ATSA 3L21A 1SQ7A 1C90A 3VILA 2BX7A 5E5CA 2OEMA 3R2GA 3AS1A 3M0VA 4BF9A 2XVLA 4BCEA 3GG1A 4PEEA 3MKCA 1B4EA 4RNHA 3BJTA 7XIMA 2V30A 3DG6A 4O15A 2XZ9A 4UNIA 3M5VA 2PLJA 2CETA 1SZRA 4C91A 1SW3A 4V28A 1TMLA 2QEZA 1K8CA 4PA8A 4C6IA 4A6GA 1QK2A 3QC3A 3EDDA 4WJEA 2CHNA 3K5XA 1MEIA 3JZEA 4M6UA 4JN6A 1JRBA 3DESA 3TE9A 4MWAA 3SCVA 3E5BA 2XJ7A 4XQ6A 1ISZA 3GXIA 2CLPA 3B3DA 4FNQA 4S23A 3ME3A 2OKOA 1ME7A 2JGQA 3C2YA 2FZDA 5U4NA 3KX6A 3H23A 3I65A 4BKNA 4LUSA 3VZXA 4ZFMA 5AC6A 2YCJA 3S2CA 3VNKA 4WJXA 4KCUA 2VZOA 4ZQCA 4A8NA 1OCNA 3UWUA 4AZGA 4UFJA 3CUJA 3RLHA 5JXQA 1DJXA 2BODX 1XLAA 3NL5A 4RLIA 2YYTA 3WLOA 3AZRA 4GOAA 2CPUA 1YEYA 4WZHA 3PTQA 3UG4A 1EO7A 3GW0A 1XSKA 2WWCA 5BMXA 3P80A 3I7RA 1XUZA 5CGQA 2XFWA 3QPZA 4IUGA 4XKYA 3A4JA 4XUYA 2XPKA 1F9CA 3DN5A 4DAFA 1BXNA 4RX0A 2HBXA 3W29A 4P61A 1V93A 2W92A 4NY2A 5E93A 4JIHA 4L65A 2PCEA 2J6VA 4IWWA 2OQYA 1QO2A 1EPXA 3CUXA 3LCLA 2V6AA 2UZ9A 4LC6A 1GQNA 2E8ZA 1W1B1 3IJ9A 3TK7A 2GJXB 3LHWA 1ZBVA 2YDSA 4MIMA 4JNMA 3IIXA 3HURA 4IIDA 1HL2A 1WXYA 1J0YA 3W2MA 2YPIA 1TYGA 5I3KA 5HQLA 1LRTA 3R11A 4M82A 4GYPA 4OBTA 2UY3A 3BPWA 1WDRA 3NDZA 3WLJA 3TDFA 1YTDA 3VKJA 1QHZA 4PUUA 5ABTA 1XHGA 4Q8UA 1KD0A 3U0HA 4AXNA 1GKQA 2FGZA 1OQFA 1UP3A 2PSNA 3GR7A 5DFAA 4IT1A 1QK0A 2Z1WA 5AYYA 5B7YA 3VU2A 1HL9A 1DWAM 5K3VA 2Y24A 1BQCA 1VYSX 2A2IA 2VURA 3GLCA 2H3DA 4AWTA 3O2LA 4NAEB 4L9XA 3TFCA 3VINA 4E8GA 5HWMA 4GGHA 2FH8A 3IAPA 1HQTA 3MJMA 2YKKA 5A6KA 2XIBA 4G2DA 1Q4WA 3KL3A 3GBEA 3P5YA 4GUGA 3PS7A 4WY0A 4FXSA 4N9BA 2P3EA 4ZE4A 3TYBA 4UXDA 3MHUA 2R1PA 1JIBA 1BF6A 1ECEA 3OB8A 4ZEPA 2GVJA 2XH7A 1AZ1A 3ARRA 1ZU8A 3IIZA 1M04A 3SADA 1BWVA 3K8MA 3CZJA 3HZ3A 2QJHA 1E4LA 1GVEA 7TAAA 4M29A 1OJXA 4WUIA 1UASA 3GXFA 3PZVA 3WBYA 2VCBA 4V15A 3E02A 1JI2A 4KFNA 5C70A 4GY0A 5BRPA 5REQA 4JDBA 3WLTA 5DMNA 3AC0A 4C6QA 3AQUA 5DX7A 3VE7A 5XIAA 1Q8JA 2Q8XA 3TW6A 2AL1A 2WHJA 4ZQNA 3HMJG 1JCNA 3W7HA 3V35A 1EJ7L 2EQDA 4UOJA 5AYBA 4J3XA 5DXYA 3ZYZA 4NXSA 3LERA 6CGTA 1S5VA 4DZAA 2PTXA 4IIFA 3D3FA 2PBGA 3WQVA 4KWOA 1B30A 4OVXA 2V9DA 2DT3A 5CGMA 2ZTKA 2WVUA 3HBLA 2DVXA 3WENA 2YLAA 1K77A 5E9AA 4H83A 3LS9A 1Q6OA 5CXPA 1KWGA 2HCVA 2DIEA 3B8VA 4S3CA 1SMDA 3BGGA 4XVEA 4HPNA 1WKFA 4DO4A 1C3FA 4JN7A 2CBVA 1KWKA 3MWCA 1H7OA 2DEPA 2WSRA 3B05A 3BK0A 1QVBA 3R8RA 1XFCA 1RCXB 1VP5A 3EDKA 3WLPA 4NJKA 2BASA 3PB2A 1ODUA 3BQ6A 1TV4A 2FVLA 1XR2A 1N8WA 1WB0A 3MDWA 3L5MA 3V0TA 1VFOA 3SRDA 2HNHA 3FSTA 4MDOA 3LB0A 2QVNA 3QMSA 1DWFM 3UR8A 5HJYA 3CQHA 1XIHA 5AVNA 2VGFA 2G3FA 4ZL1A 3C86A 4PE8A 2QMJA 3WK0A 4W8BA 4XVDA 3THUA 3C3UA 4LYRA 2GGHA 3IEBA 4A21A 2J9YA 2PD5A 4WKFA 4LUTB 4DYJA 1JDEA 1IT8A 5EFDA 2ASHA 5T26A 5IFTA 1VCFA 3CTTA 1PUDA 2QMKA 4LS0A 1SYTA 3WQOA 6A3HA 4JTHA 3W3OA 3GH5A 2W3ZA 4TVCA 3AU2A 5HINA 1TR9A 5C9ZA 2D23A 4GACA 1SJDA 1E9ZB 3MHGA 4PMVA 1KFBA 3APTA 2NQJA 4Q6JA 2E68A 1NFGA 1X1OA 3USBA 4JTGA 4AFYA 3LI1A 5A6LA 3W07A 5H91A 4ZB5A 2HVOA 3FHAA 4OU1A 3S5ZA 1UPPA 1SSGA 4FLRA 4QITA 3SN4A 5MHBA 7TIMA 3WLIA 4NU7A 1Y0EA 4OUEA 3M44A 4QP0A 3SCPA 4CCDA 3VGFA 4PFMA 1JGMA 1OFEA 3DAQA 4HZ6A 3MP3A 4NHVA 4GXMA 3WNLA 4ZXOA 3MSDA 2BY2A 1HJUA 1MEHA 5BROA 1KTBA 3V3WA 3JS3A 1RBOB 1I8JA 1MEWA 3BTNA 3QR1A 4NNAA 2A85A 2VDIA 2DT0A 1EF2A 1ZTVA 1O5QA 2D2OA 1VEOA 2EBNA 1V6VA 3RK8A 4FF5A 2WHKA 1TUFA 1GVRA 3HV8A 3A47A 1JCLA 2VXNA 1VRXA 3GH4A 5FEWA 1XLJA 5EKYA 2NV2A 1P7TB 4PCNA 3M07A 4JICA 1JJKA 4M24A 1EYWA 4UMCA 2H3BA 8A3HA 3NO5A 4BEUA 3UA3A 4DJFD 3UZXA 4Z1AA 3AMGA 1GONA 1J0JA 3VMNA 4YCPA 3F03K 1KKOA 1D3CA 2VFHA 3RM9A 3H7VA 3SIZA 4CQAA 3SGZA 3PJXA 1XWYA 3SJNA 2ICSA 3U9IA 5HQEA 3VI2A 1KNWA 2BHUA 3ARQA 3V5OA 4JHMA 2C1GA 3SGGA 2ZC1A 1W1YA 2G8ZA 4HOZA 3M0JA 2PWHA 2EG6A 4O4VA 3U2OA 4Q7BA 3THDA 3PJTA 3UNTA 4JYEA 3LPFA 4MJ2A 2A6LA 3WD4A 1HVQA 3W70A 4UTJA 3RU8X 1Q66A 1CI1A 4GA8A 1PS9A 2WMHA 3BQ5A 3EOLA 3BGJA 2Q8LA 3TTSA 2AL2B 5ABFB 1C8YA 2AQWA 5I06A 3S5NA 2DH2A 3FS2A 4D6EA 3CV2A 2Z2AA 3C56A 2CLOA 1HW6A 2X1RA 1F8MA 1O5XA 1GQJA 5A6BA 2VRJA 2QR6A 2QDDA 1RD6A 3UZJA 1KM2A 3WF0A 1SO6A 1UR2A 2QHAA 3WD0A 2BP1A 5HMDA 1ZBKA 4XB3A 1XGZA 3OIHA 4R34A 2NXIA 3B0VC 2A7NA 2W5FA 3HQ1A 1LUCB 4N0RA 1W56A 2QIIA 2B31A 5EFFA 3GC5A 3QTPA 4NIRA 3CQJA 3G3MA 4HPXA 1X8CA 3RRXA 4GXWA 4JTRA 2R9RA 3TSMA 2ZZ2A 3LA4A 2G3JA 4FXFA 4HCDA 1QBBA 2WM0A 4ZGYA 4MJ4A 3GNPA 2E5BA 2PWEA 4R7WA 2DT1A 3TIMA 2YLLA 3ES7A 2F38A 4WCJA 1A47A 3A5VA 2FMNA 3BE7A 3GAKA 4IIBA 2XISA 4QJ1A 1OZQA 4Y2WA 5HULA 4WIWA 3TR9A 3RF9A 3WDPP 1RPXA 4N4QA 2CEQA 3GHSA 1J5SA 1TPWA 3UPBA 2R94A 4LJ3A 3JVAA 3DUGA 4CNSA 4X0VA 2VR2A 2E6DA 4UFIA 3K13A 1A3XA 2IQTA 5CPSA 3LPGA 1NARA 3V1PA 1B3XA 1OT1A 3KBWA 3T9PA 1RY0A 1YE4A 2XU2A 5DRCA 3O6DA 1TVLA 2DUZA 3WL1A 1H0GA 1W2VA 8XIMA 1BWLA 2WC4A 4HHMA 3PANA 3ANVA 1NQ6A 1RV8A 2GVEA 1E9LA 1UH3A 3MO7A 2LLEA 4GFSA 2E0PA 4PCFA 3MBDA 2BOFX 2DVUA 3BSMA 3CZEA 2ZRUA 3MO4A 3FA3A 3GTXA 2KZHA 1L0PA 3GAYA 1XRFA 3ARPA 5K4XA 3I3BA 3K4AA 4EPKA 4GH3A 1B9ZA 2RJHA 1SO4A 3VMOA 4M3PA 3QZEA 4KW2A 2WPBA 4Q4PA 4ZOCA 1M6JA 4L1XA 3WDIA 1QOXA 4LANA 3NQEA 3JUGA 5A8OA 5D2WA 1QNPA 1OFQA 3C8FA 3WQ6A 4WKHA 1W9XA 2VQUA 2WAGA 2WZMA 1PCKA 4QEEA 2GGEA 4DF2A 1K9DA 3QFEA 3H4WA 5I07A 3B04A 4LALA 4LBRA 1IWPA 3CWOX 1HX0A 1U2YA 1JAEA 3GUGA 2GJLA 2I56A 4JX6A 4YJ5A 2OOFA 2ZUMA 3AJXA 1FCVA 3CQIA 1IIGA 3FFSA 5CAHA 5LNSA 4PBFA 2BVDA 3WJZA 4CD6A 2YXOA 4HPJA 4IISA 2VWSA 4IIHA 5C54A 1RK5A 2H8XA 3CTLA 3WQ4A 1AMKA 2ZVRA 4AISA 3VIFA 3TQPA 1U5VA 4QE4A 1TV7A 3HIJA 3TUUA 2WHMA 4LUYA 5I02A 1XV8A 1U83A 1W1VA 4I5RA 1XW8A 2GSEA 4N6FA 1EJVC 5K9DA 1W8GA 3AMCA 3EMCA 1KTCA 1F6KA 2E09A 2QJGA 2C13A 3NCOA 4UFMA 4ZZ9A 4CD4A 5C5YA 4JTJA 1MYRA 4H2CA 1JCJA 4DJDD 4HT3A 1K7XA 3R25A 1OFDA 4Y9AA 3N12A 2JKAA 2P1FA 3W27A 1U1HA 3LV5A 5D2XA 3L68A 1MVYA 3RUBL 1EO5A 1FWWA 2X41A 3C52A 1ZENA 4AWUA 5I3GA 2WCAA 1JCXA 2HXUA 3P7YA 4FOJA 3MVIA 1B4KA 5EMKA 3PWAA 5DANA 4F9DA 2EAWA 1LP6A 4QROA 1Q6QA 1XG3A 4JIRA 1DORA 3L66A 2WNNA 2X09A 3U57A 1G5AA 4BY3A 1XRTA 2AAAA 3I3DA 3GDTA 3W6YA 3SUUA 4QAIA 5CPLA 3BUVA 1HKVA 4LVFA 3DFNA 5J5DA 2XN1A 4LAOA 4NASA 3GX9A 3MP5A 3BG5A 1BTCA 4MPQA 4TTUA 2NSOA 1L8PA 3ZLHA 4UNLA 5FF0A 1V02A 1IZCA 5CKSA 4Q3MA 3GDKA 3USZA 2WANA 1C8XA 1DJQA 5CJ5A 3GDLA 3VD9A 3ONCA 5D2YA 1JCYA 1W54A 3ZSSA 2ZA3A 4PZVA 4WDWA 4XUGA 4LVGA 2PWVA 4JL2A 1UB3A 2FFIA 2QDHA 3DCPA 3P62A 4YNGA 1T40A 2WMFA 4FNTA 1E0UA 2WV8A 1N82A 3W1PA 4H7ZA 4KF1A 4LS1A 4MB5A 2JIEA 5BOFA 4GABA 4UTLA 1MXSA 3ZJ7A 2PDHA 1D8CA 3WNOA 1E40A 3EMZA 1TKKA 5HR7A 4DQWA 4ONVA 1XBVA 1K6AA 2G3NA 3GKAA 1JEZA 2EF9A 3WBWA 1V6XA 1DV7A 3NQAA 4AH7A 1PIGA 4WRHA 3CAVA 4N02A 3VX0A 1I60A 3EA1A 5B7ZA 1XQLA 2OCZA 3OVQA 1M1BA 3W7PA 1L6YA 1LM1A 3DG7A 3AXHA 3H54A 3OBAA 1BLIA 4J4KA 4YYCA 1LQAA 1OK4A 3RX2A 1NWTA 3TFXA 4CN1A 3PBGA 3H4GA 1X38A 3ABQA 4JQ1A 4AYSA 1A80A 3OO2A 3CM4A 2UV8G