3INYA

Crystal structure of human purine nucleoside phosphorylase in complex with 7-deazaguanine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
b'ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal structure and molecular dynamics studies of human purine nucleoside phosphorylase complexed with 7-deazaguanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3inyA00
5CCEA 5F78A 1PWYE 4X24A 1ODLA 1U1DA 1Q1GA 3EUFA 5DK6A 5F76A 4DA0A 3NM6B 4OJTA 1XE3A 4DAEA 1Z39A 1Y1QA 2OC9A 1TCVA 1JDUA 2Q7OE 1JE0A 4WKOA 1YQUA 1V3QE 1A9RA 4F1WA 4D98A 2OECA 3KHSA 3OF3A 2A8YA 3EMVA 3KVYA 1NC3A 2ISCA 3OOEA 1T8YA 1I80A 1Z36A 4MARA 2RJ3A 1G2OA 4M1EA 1RFGE 1Z37A 3F8WA 1M73E 4KN5A 3P0FA 5CCDA 4L0MA 5F7ZA 4DABA 2AI3A 1U1FA 4TXMA 3MMSA 4D8XA 3INYA 5FAKA 1B8NA 4GKAA 3OCCA 1Y1SA 5B7QA 4QARA 4DANA 3OZBA 1OTYA 3T94A 1ULBA 1RXUA 1Z5OA 2PGAA 2HWUA 1JP7A 1A9PA 4F3CA 3UAVA 1OV6A 1JE1A 1SD2A 1V4NA 4DARA 3FAZA 4D8YA 1OVGA 1JPVA 1ODKA 2OC4A 1U1GA 3OZDA 4OGLA 1T8WA 1ZL2A 1T0UA 1K3FA 4LKRA 1RXCA 1PR5A 4QEZA 4U2KA 4WKPA 4F2WA 1OUMA 3NM5A 4TXHA 4P54A 5ETJA 4TS9A 1TD1A 4R31A 1JYSA 3DP9A 1A69A 5CXSA 3IOMA 2H8GA 4TXNA 1PR0A 1RT9A 4R2WA 1A9OA 1PR1A 4OGKA 2A0YA 1PK7A 2HSWA 1RXSA 5C80A 3EUEA 3UT6A 1YQQA 2I4TA 1N3IA 1B8OA 3LGSA 2BSXA 5IFKA 4NY1A 4UC0A 4OF4A 3MB8A 1VMKA 4OEHA 4G89A 4WKBA 3E0QA 2GUWA 4LNAA 2XRFA 3FOWA 4DAOA 3UAXA 1WTAA 5EFOA 1A9QA 5CXQA 1LVUA 4MCHA 4WKNA 4RJ2A 3OPVA 1PBNA 1T8RA 3K8OE 2A0WA 1U1CA 5IU6A 3OZCA 3FB1A 5EPUA 4DA7A 5CYFA 5F7OA 2B94A 4R2XA 3BL6A 1ZOSA 5B7NA 3NM4A 3LBAA 3PHBE 3OOHA 1VFNA 4OY3A 1A9SA 4NSNA 5F77A 5EUBA 5F7JA 1V48A 4LZWA 4H1TA 3PNPA 4D9HA 4PNPA 1PF7E 1PK9A 1QE5A 4NS1A 3E9RA 1Z5NA 3FWPA 4WKCA 5I3CA 2IQ5A 1LV8A 4TTJA 4TTIA 4FFSA 3UAZA 3U40A 1PR6A 2HRDA 1LX7A 1SQ6A 5CYGA 4YO8A 3KVRA 1Y6RA 5B7PA 1JDVA 1K27A 5B7GA 2QPLA 4BMXA 1RXYA 1ODJA 1TCUA 1JDSA 3ENZA 4QFBA 3O6VA 1ECPA 1RYZA 1Z38A 4BMZA 3BGSA 3SCZA 1FXUA 1U1EA 3OZEA 4JP5A 4QATA 4MCIA 1C3XA 1OU4A 1A9TA 1VHJA 3KU4A 4DA6A 3KVVA 1NC1A 4I2VA 4PR3A 4L5CA 4E1VA 4JWTA 1PW7A 1YR3A 2OXFA 1YRYE 1TGVA 5K1ZA 1TGYA 4YMLA 3DDOA 4JOSA 3BSFA 1Y1RA 3PHCA 3IEXA 3EEIA 1VHWA 3NBQA 5KB3A 5F7XA 3KUKA 1V45E 2QDKA 4EARA 1Z35A 2AC7A 3QPBA 3UAWA 3TL6A 4TTAA 4EB8A 1PR4A 3E9ZA 4GLFA 3UAYA 4L6IA 4QASA 1V2HE 4TXJA 3DPSA 1K9SA 4F2PA 3DJFA 1NW4A 4IP0A 4D8VA 3GGSA 4BMYA 5F73A 4BN0A 4LNHA 1JDZA 3D1VA 2AI1A 2ON6A 4TS3A 4YJKA 4G41A 3ONVA 4TYMA 1CG6A 1CB0A 1SD1A 2AI2A 3BJEA 4L5YA 4DA8A 5JPCA 1RSZA 2P4SA 4L5AA 4TXLA 2QSUA 2QTTA 1Y1TA 2A0XA 1Y6QA 3C74A 3ODGA 1T8SA 4M3NA 3PNSA 3GB9A 1Z5PA 4M7WA 4K6OA 1OTXA 3DF9A 1SJ9A 4G8JA 2I8AA 4GMHA 1V41E 1Z33A 4GLJA 3FNQA 4LDNA 2QTGA 3FUCA 2HN9A 3P0EA 1JDTA 1RCTE 1Z34A 1PR2A 4ECEA 4QAQA 1RR6A 1ULAA 3O4VA 4YNBA 3K8QA 4F3KA 1PKEA 3LA8A 1YBFA 1ODIA
chains in the Genus database with same CATH superfamily
4YMHA 1ODCA 3A9WA 1YBAA 3BK1A 4G1BA 4CM9A 3CRZA 2WQZA 1OHHD 3NHFA 4HDNB 5H70A 4IIXA 5IC5A 2Y1LA 3OZGA 1UMKA 1YK0A 3VR0A 5I9NA 4KO8A 1GILA 1ODLA 4GPD1 4YI3A 1DEXA 4ABTA 1TZBA 1U6KA 2P9HA 3DUFA 6YASA 3E5NA 4OGFA 2A14A 1OC4A 4LZJA 4MUIA 2PKWA 5IJAA 1VL6A 4HDRA 3LAWA 2F90A 2GEFA 3LLVA 2BBWA 2RKWA 3UWSA 2Z3ZA 1EE9A 3NM6B 1O9GA 1V26A 4Q3BA 4F9GA 3EFEA 5HF9A 1Q21A 1EJBA 3ZWMA 4CETA 1QQTA 2D5AA 1TVCA 1FDSA 3IP9A 1RLJA 3UJ3X 2QR5A 2HJHA 4F8EA 1GJRA 5DLEA 1XHLA 1WW3A 5JS6A 1RPTA 4L6AA 5HF8A 3PF9A 4ZQEA 3QFHA 3WLIA 2OBBA 2B8NA 4Q4JB 4OI1A 4PZCA 5G0VA 5CEEA 3QM1A 4IG9A 3PGJA 4QFMA 4B79A 2LDBA 1M0EA 2CLEB 1JECA 2ZRFA 4WEQA 1UMBB 1UZMA 1SMKA 3PCRB 2RIRA 5I48A 1TX4B 4ZMSA 1J7JA 5C37A 5JTUA 4JUFA 1NBME 4E1AA 1FVXA 1LFAA 4F1WA 1V0JA 4A7PA 1EE1A 3IIJA 4YP0A 3RAGA 1BOOA 5HOEA 4FQ7A 4EX7A 1OE0A 2X23A 1DB3A 1XKLA 3EY9A 5IEBA 2P9QA 1VIAA 3CX6A 3HR8A 3ROPA 3T3OA 1O9HA 1QH1A 2NO0A 2J87A 2PMBA 3EMVA 1DPFA 5DHAA 3WADA 3TPFA 5FPQA 3RUPA 1E3QA 1M1XB 4L1KA 4UREA 4PSCA 4Z0PA 1LPPA 1ZR4A 2XZDA 4FQ5A 5KX5F 2BEUB 3OOEA 2J45A 4FIZA 1QYDA 2ZQ5A 3A70A 4GX2A 4RW0A 4TM7A 1A7UA 3L8DA 4TMVA 5L7WA 4DUYB 1RWNA 4GYKA 4NBSA 2DMRA 1FDWA 2Z1DA 4X6XA 4KXLA 2OBXA 4Y98A 4MVJG 2H1OA 1I2DA 2K87A 4DQKA 1QDLB 3KZKA 4BBAA 1Q92A 1PUIA 2FFQA 3EOBI 2GLXA 3KUCA 5CW2A 2V65A 1R8QA 2I4IA 3ETLA 3I2HA 3TZCA 1U8EA 1ZVMA 3UV3A 1AS3A 3U1VA 4KCGA 4CVNA 5ES4B 4N0PA 4K9OA 5ALNA 4B0PA 4ZZIA 3C14C 5JLJA 1YA8A 2G07A 2QMZA 2E82A 4CCAA 1XZEA 1C1HA 1KYQA 1NF2A 4HDRB 1BWSA 2GPTA 5CIYA 2QVYX 3K2IA 3INRA 3ZHRA 1CERA 1AUPA 3PHHA 4GYYA 2XLBA 1AS0A 1R5JA 2ECOA 3PQ5A 2VJPA 3ZWWA 2ZOSA 3FCYA 5MN4A 1CU1A 2C3OA 4Y30A 4EUEA 1FVOA 4HT3B 2WT9A 4EUHA 2RGNA 3X0DA 2JJ2A 2G40A 1SNYA 2A5LA 4UHBA 3X2FA 5JSZA 3R3XA 4RANA 3AOEA 1SB8A 4NU0A 4QTXA 5CDYA 1QIGA 2P7IA 3EODA 3LC7O 7GPBA 4URYR 1ZWLA 2Y1WA 4C0WA 4GUAA 4I1YA 4O33A 2OSBA 1B8PA 1Z6PA 2FQXA 2ZTVA 1PEAA 3R6TA 3WY9A 3H8WA 3LXRA 1E98A 4IG4A 2W6IA 5J23A 4MUNA 2BFDA 4G0ZA 3L6EA 3ON5A 4CR7A 2IYSA 4KHZA 1IG3A 2X3UA 2JRCA 1G9SA 2A9OA 1WBJB 2V74B 3C6XA 4QYWA 2TMKA 3OJOA 4YB8A 1QH1B 2I1LA 1KK2A 2O0KA 1W1WA 2HTEA 3OSUA 4INAA 3LHSA 4RSGA 4DNFA 2OC4A 4EJ6A 1OJ7A 4PE5B 3OZDA 5AFSA 3ZS8A 2C2ZA 4Z4FA 5KTPA 3A1SA 3KZXA 3D7LA 1M75A 3KKMA 3KSBC 3BGWA 4JB3A 3SC4A 1PGOA 1KDVA 3RI3A 5K8JB 1R4ZA 3NETA 1IN7A 1EPUA 1T3ZA 1UBUS 1CQZA 3TUIC 4DQVA 2BYTA 1SELA 3IAEA 2GSWA 3IE2A 1JYSA 1RMTA 3DDWA 4R8SA 4TSFA 2EEZA 3E3MA 2ZRNA 2GXSA 1LPOA 2FPOA 5E6SA 4EW6A 1CCWA 3NBAA 1RI1A 3DXYA 3ZI7A 5IAGA 1XQYA 3AERA 3FGPA 1LLUA 1IVYA 3V3TA 4EDFA 3DHVA 5IKEA 4YCLA 3H5VA 1YC2A 2F3SA 2HQOA 4KQGA 3C8MA 4XVCA 3KCQA 3PKIA 3IR5A 4JUIA 1UOPA 1I5OA 2A58A 4URFA 5ILQA 3RJ5A 2WIFA 5GJCA 2Q9CA 2ZIGA 4X93A 5JS7A 3O91A 2IXEA 1COZA 1WLYA 5TARA 3OWOA 3MJDA 2IRWA 1N1MA 5FDFA 2YWRA 5H3CA 1CUZA 3NTLA 2ZBEA 1HG1A 4KXVA 1M1NA 2WVHA 4Y6PA 3VGJA 2XEDA 1EG2A 5IJZA 2BKXA 3I83A 1B8OA 2OV4A 4FDMA 4G4SP 4QOEA 4JVOA 3TZHA 3N0WA 4HMOA 1WSBA 2UZ1A 3RYHA 4N01A 4B6RA 4MWGA 4P7FA 1WBDA 3AHHA 4OJQA 1XMPA 1E9AA 4QELA 4ZU6X 3SS7X 1DC4A 1JHDA 1CIJA 3AINA 1FX0A 3I2JA 2RHLA 1NULA 1DV2A 2HWWA 2BFDB 2Q5HA 2V58A 2B2CA 2V45A 3FMGA 5J5VA 3VNRA 2HL6A 4OU4A 4GH5A 3LWZA 3W5BA 2MOKA 4QXQA 1ULZA 4GGPA 4DR4B 3F47A 2XQFA 1ADBA 3C7AA 3WK7A 1S2OA 1TQDA 3U3XA 1AK1A 2RAFA 1E2DA 3PK0A 3DTVA 1A9QA 1ZD9A 4U8HA 1CNMA 3S6JA 1DCMA 1H4VB 3N39C 1N6RA 3E4DA 2FEWB 1ZC3A 4QGGA 5CXQA 5KNCA 1UWLA 2YWXA 5H7XA 3DZ8A 2K7FA 3UBTA 3QX8A 4LZLA 3TVYA 3AEUB 3SDZA 2QRZA 2P2DA 2AT1A 1L6IA 4Q9HA 3OPVA 3AVUA 1MLDA 4WDQA 3PLAE 3KALA 2HHAA 3RARA 2C4VA 3SLGA 4L8YA 3BXGA 3O73A 2QROA 5AJUA 4YMWA 1P1JA 5E1DA 5DTRA 5HRAA 5IHPA 1J2TA 3E5MA 5CYFA 5E6SB 1VPVA 4II7A 1KFEB 5AW1A 2Q3BA 5TGZA 4RYLA 2ZCUA 3AERB 2PVSA 1D0SA 4G1EB 5TY0A 1VE6A 2GN6A 3LRTA 3COZA 3Q9NA 4FXOA 4EVQA 4PYJA 2QPTA 1JEYA 3OM8A 4TMWA 2X4DA 3KTFA 3RIMA 3I4LA 3OU6A 4J16A 4UNRA 1WPQA 3MJHA 4ZQBA 4DEYA 4ZCQA 1BHSA 2DQSA 2XMBA 1JQEA 4P7GA 4MJ3A 5KI6A 2GBLA 2R8RA 3GHYA 3ZI0A 1ZSVA 1VM6A 3FCAA 1R66A 3LKDA 3W34A 5FEUA 1M1NB 2VOEA 5BWMA 4ZKEA 4BO5A 1VL5A 1U90A 3G82C 3HV0A 4LWPA 4TQAA 2JLCA 5CDUA 3R6WA 4RTPA 4E03A 2UZ1B 3RYHB 2GJAA 3I32A 4DV6B 4REQA 1YDEA 2FMUA 4L3OA 3TLZA 5M2QA 5J1TB 3DFIA 4RC9A 5JANA 1FX0B 1BHJA 3GT3A 1RBMA 3C41J 2OCPA 2P3SA 1PU2A 1HL7A 1YGPA 3A1EA 1IN8A 1PF7E 2B5VA 3ZUGA 3HB5X 5H16A 1TUBA 1T5IA 2IXFA 1U0TA 1B8VA 1CVIA 1WPGA 5EJ4A 3D7SA 4R8MA 4PZ9A 2WVGA 4PVDA 3DTVB 1T4DA 1F20A 4ZI5A 1LV8A 4D3YA 2B4YA 5DLDA 1OBVA 1SKUA 4YASA 1XL0A 2ZT6A 5EZQA 4DJ5X 1U9YA 1KZGB 1LDMA 1GG8A 1NUHA 3TLCA 1OZAA 1QYRA 3DL7A 3G9QA 5JSFA 1RM0A 4FHDA 4WY2A 1VDMA 4GPEA 3R44A 2WKWA 3UAZA 1OIWA 3DB2A 4DJAA 3WAGA 4TYNA 1BDBA 2PL5A 3NHLA 2E5LB 4ER5A 4AZ3A 4YAUA 1LX7A 1ZMXA 4UQOA 1SQGA 5ARCA 5CYGA 1TMKA 1Q1NA 2Q50A 4N47A 1KEUA 3ZGNA 5C7YA 2Z9DA 4ACAA 3QW2A 2NVBA 2OP1A 1COWA 3AESA 3BDIA 3WGGA 4EY5A 3KEQA 4KMSA 5SY6A 4RFSA 1ZEJA 2WHYA 1QP0A 5E7IA 3AM1A 3TKYA 1AH2A 2ZTHA 4QPCA 4I6GA 4RGYA 1RYBA 4M1TA 4RS4A 2J5BA 5DULA 2ZUUA 3C16C 3EULA 2X7HA 4BB6A 4ZTUB 3QHQA 2XNHA 2ZFUA 3HA7A 5BW4A 3LY7A 1EM8A 2QV7A 1H3FA 1QTNA 3C70A 3OMXA 3WMWA 4D42A 1N2CA 4N41A 4Y2SA 4X8HA 2CN1A 1P1RA 1GWNA 2AC2A 5H3LA 2YVLA 3G9UA 4MRMA 5ADHA 2XXAA 3AFIA 3FKSA 5DX1A 4QDZA 2I29A 2TRSB 4QHYA 5JYEA 5ADUS 4JBLA 1VRWA 3RYIA 1ZLYA 3DMTA 1SH7A 1UFQA 3HO8A 3B5JA 4W63A 3HRKA 3IERA 2OXIA 3BF8A 5A0TA 3TRIA 4RTMA 5EE1A 3SQOA 3DQZA 4GGOA 1T5OA 3OT1A 4KVZA 4Y6GB 4P3YA 4REQB 4DNOA 3QYFA 3EVBA 1YCHA 4KPGA 5DCUA 5BSMA 3RJMA 4HAVA 2C4HA 4CG2A 4OU5A 4WK6A 3UHOA 1IN5A 1E2IA 3IX7A 3HADA 3WDLA 4QBTA 1ZD1A 3L8YA 2F1OA 2XTAA 3ZH9B 4PR3A 1TUBB 4PAMA 2CNDA 2Y92A 3TNLA 1M6YA 4WBXC 1V1MB 1BXGA 2IZ0A 3P2OA 4BX9A 2I5PO 3IXLA 2IIPA 2XTJA 2GN9A 2YS7A 3IIIA 3ZE2B 4BTEA 4ZYVA 4GKJB 1XZAA 2BSAA 3L6UA 4ZQCB 4DKXA 2ZBDA 1NLZA 2Z56A 2ST1A 2YW2A 2QLFA 3KOYA 4PRZA 2R8ZA 1I3CA 1ZMBA 3IEXA 3RJZA 2P67A 3F5QA 5DNYB 1TF2A 2H2IA 1VHWA 2J09A 4RDIA 4FHEA 4IWXA 3QOXA 5DTJA 3TFWA 2VO1A 3URMA 3VKFA 4AZ3B 4LI3X 3PRYA 3BE5A 3AZQA 1NKTA 3GO4A 1T9BA 3A10A 3A3PA 4Q3OA 4PNZA 3ZV7A 1AHHA 3FR8A 3D64A 3AESB 4KQKA 1ZS9A 2VK1A 2GD6A 2I76A 1GQ2A 1I1QB 1NI3A 2PT6A 3GOHA 4RFSB 4B3FX 3CVVA 2PUFA 5A0VA 3V6MA 4AY6A 2VCYA 3EXFA 3NHKA 1GY8A 2KM1A 2GHTA 2Y1EA 2O8VA 3GN1A 5ESDA 1EM8B 4BP8A 2XAUA 3PPYA 1KFKB 1N2CB 2HMTA 3GVPA 3B6ZA 1Q5PA 5DI3A 1HURA 1GRNA 1QX4A 1IHDA 1VCMA 4MRMB 2DETA 1IY2A 1N8KA 2Q6IA 3PC4A 1V6AA 4ER3A 1I4DD 4Y2RA 3RYIB 4K9RA 5IG2A 4V38A 5ALQA 2UZ4A 2WWTA 1GL3A 2DTDA 1A9YA 1AKUA 1H0SA 1F7VA 3RLIA 2WTNA 4ZOCA 3HP4A 3MGGA 3SVTA 2CKDA 5TB5A 3MUFA 1VG9B 1YR1A 1IB0A 2IF2A 4KUGA 5LWQA 1LLFA 3OQIA 3R3HA 4YJKA 3OT1B 2G77B 4M1YA 4XD2A 1ZI6A 3ZY4A 4DIEA 2PRIA 8AT1A 2FPRA 2OV3A 3M6UA 3V9PA 3HCPA 4OQNA 1U2TA 2ZAYA 3N5KA 1JNXX 3KZVA 4BLWA 4EK9A 4PHTA 1DIAA 4F3RA 1EDBA 1MC1A 3G2LA 5FPSA 3E58A 3VO9A 1E2HA 3FCUB 2QXTA 3RABA 3A1WA 3WI7A 1HE4A 2WWFA 1FNCA 2ZR9A 1BXGB 5SY4A 1E9RA 1BU5A 1KFBB 2RIPA 2ATCA 2ZVQX 4R2LA 4RZQA 3W79A 1X15A 2GD1O 4DZRA 1TUGA 3E7XA 2H3EA 3C98A 1G1MA 3PUIA 2EG5A 4ID3A 4NCKA 2A0XA 4QBHA 3RQSA 4FFVA 1Z16A 4I4LA 5C18A 2ZVPX 4CXMA 4KJZA 1NI5A 2AHOA 4ITUA 5A4JA 1QFMA 1RPZA 1UXJA 2W6OA 4MOWA 4YP5A 3UT0A 3IO5A 4G0VA 5DW3A 2YMMA 4ZU1X 4Q1DA 1TTPB 2DTXA 3OIUA 3CR8A 1K06A 2RGWA 2RDMA 3Q3VA 3F6PA 3QLUA 4L78A 3TG2A 1EK1A 3AR7A 1D4AA 2CNWA 3EZXA 2C4WA 3L40A 3QLTA 4G8JA 4HQNA 4OXYA 4TQUS 2HJGA 4QLBA 4ZCRA 4I1PA 2ASVA 3C1OA 1L5NA 2QE7D 4OMDA 1E1NA 1Z0DA 1NMSA 4OQDA 2DFNA 1QHSA 1OFVA 3P8ZA 3GVCA 1GUYA 4RGQA 4AB1A 3GFFA 1CZUA 3P0EA 2EP7A 3OZ7A 1PR2A 4KFRA 3RU7A 4W4TA 1ZGAA 3MMPA 3LGXA 4MHSA 4XTRA 4KACA 5CFZA 5DI3B 5DN6D 3Q10A 3NC0C 1KK1A 3FPAA 5JWRA 5AXCA 1PN3A 3C3DA 4KV7A 4YQEA 1AN0A 2CNKA 2FQWA 1JGTA 3UQYS 4HNTA 4KQCA 2FY8A 3GJ4A 3WYFA 1TK9A 1Q1GA 3SSAA 1TA4A 4R54A 2RGDA 1YS2X 1H9CA 5AW2A 4L8GA 4NK5A 3OQIB 1OXSC 4L5IA 4IGIA 4OO3A 3A9SA 3UJAA 5C8YF 1YZYA 3TLBA 4ALIA 2IXDA 5BVHB 1K6MA 5K9ZA 3CFYA 1B0UA 1YQ9A 1B4DA 3HEBA 2ZKIA 4H3KB 4K81B 4WI1A 1W7AA 3B13B 1KMIY 4F4DA 3UK2A 5H1YA 5M7EA 4S1PA 4AJOA 3QP9A 3ANXA 2YDYA 1NG1A 1E2KA 1F2TA 4P5EA 4BO1A 4XOIA 2JW5A 4BVEA 1QGAA 4R68A 1DJLA 4BX0A 3GJ5A 1EP1B 4Q3NA 1DAMA 1Q7BA 5AKEA 5ALEA 2GK6A 2EFCB 1T2VA 5AW8A 3UHAA 7REQA 4AN0A 1KO8A 2WHQA 3LW7A 4RTNA 5JQWA 2XECA 3G1UA 2PUDA 3SLRA 1RYFA 2WB4A 3FNEA 4IUDS 4ENQA 5JR3A 2GCNA 4OKNA 3CBQA 4Q3AA 5J4LA 4DV7B 4Y9UA 1BE0A 3C3KA 1E62A 1JYFA 5C8DA 1DX4A 1SKMA 1NN0A 4C7KA 1OZHA 2BHNA 5EP4A 4YP7A 4WCVA 5CB6A 2SCUA 2Y99A 3NWPA 3RS2A 1WETA 2AG0A 4LSZA 2JF0A 1CUEA 2C84A 1GKKA 1RHUA 4EKGA 1S96A 5FTKA 5MFPA 4ZAFA 1GNLA 4CMEC 1UK8A 1L0BA 3ZLTA 3AVYA 3A31A 5JTTA 4TMFA 1M1YE 1VP3A 4Q9JA 5FYDA 3WL8A 1SK8A 4L57A 2OBFA 5AVRA 3DKPA 1OH6A 3B6KA 4J1TC 1J9ZA 4OQZA 2C82A 5EFZA 3AF1A 4D7AA 2DJIA 3JQ7A 1M76A 4QZVA 3IKJA 5FPHA 1VMDA 1OV4A 3M89A 1JL3A 4J0HA 5CPFA 3ICEA 1ZLXA 2AN9A 1H2YA 1ECCA 1KP2A 2IPLA 5FPPA 5KPDA 4WH0A 4P86A 1G98A 2AVDA 3VKHA 2I6XA 5GGXA 2GAOA 3L41A 4NF2A 4PSDA 4TMXA 3H3JA 2JCSA 3B1XA 4YUZA 1NFFA 3KLMX 1EQ2A 3T0GA 4WHMA 1YU9A 1Y0BA 5HZHA 2BR5A 5ALGA 1D2NA 5FI3A 1T10A 4LSMA 3T1NA 2NWQA 3TQHA 1ZA2A 1SU6A 2H00A 4MVCA 5BSTA 1PFQA 2F3QA 3L1KA 3MMSA 1QNLA 5TQ0A 2GR9A 3K70B 2ZZNA 1JQLB 1C8VB 2PKQO 3REQA 2HEIA 2UZ3A 4K46A 5HR5A 2ZI5A 3PEVA 3NWBA 1F2TB 2WTBA 3PL1A 1P74A 5BN4A 5H3HA 5J4YA 3LUCA 1U5CA 3S7TA 1M67A 4IL5A 3H83A 1OU0A 4NCXA 1TT5A 4RTLA 2FW0A 7REQB 2V9PA 4TWAA 3ZDXB 2NU6A 4PGAA 3HZOA 3JVUA 3DEFA 3I9KA 4DRYA 4IXMA 3VC3A 4LF8B 1RYNA 3BREA 3T4PA 2VYVA 2ETXA 1NYQA 3PT5A 4X97A 3W5IA 1JR3E 2ZG6A 1KOLA 4ALLA 2BGJA 3WLLA 2RAUA 2RHTA 2SCUB 3CLUC 4UJ3A 4BNFA 2E4AA 2WLTA 1DRVA 4Y8VA 1R16A 1UADA 4NARA 3V5NA 3TKLA 3IEMA 1E9EA 1OVGA 4LV6A 4RV5A 1W581 1DOAA 4ENRA 1JBQA 2OV2A 3WGIA 1RABA 3FW1A 1T8UA 1YFKA 1ODKA 3BXXA 4C1BA 1DXQA 3JVVA 2R5NA 3K31A 3DLHA 5HHTA 4MV3A 2OE2A 2VUHB 3B3QA 2O9JA 4POOA 1K3FA 4DJDC 2AL7A 2BMWA 2PX0A 3JQ7B 1O89A 3MTAA 1XPJA 2GWRA 3F7OA 2Y1XA 3CHYA 3TMAA 4F1JA 4D3SA 3U37A 4UDNA 3TTUA 1I3OA 3M2PA 2QLMA 3ZCRA 1K2WA 1OWPA 3ROKA 3E5RA 4U2BA 1WTCA 5JSUA 3V9AA 3F7MA 1U8ZA 4DVJA 2EJBA 5CXSA 1LS1A 1P73A 1Z0SA 5KTOA 2R3SA 1G9XA 1A82A 4K9MA 4XDGA 4NEGA 2H8GA 1YS1X 4HBZA 1P2BA 1SXJE 3R0VA 1NQWA 1CSEE 1MFZA 4FTWA 3REQB 2Y8EA 1A9OA 2C07A 3WZLA 2F3UA 3EF0A 3CT4A 2VDOB 3P32A 3KHTA 5BN4B 3L0BA 4HB0A 1LK5A 2A0YA 4RZUA 3UXYA 1L1EA 3ZU3A 1ZN2A 3BA6A 3FFTA 1OT3A 1TT5B 1L7RA 2YJTD 3B9RA 5L4SA 4A36A 2QK4A 3C5CA 5C80A 3RBAA 3HACA 2NU6B 3F2IA 2I1WA 4Y9DA 5EHGA 3WLQA 1XFDA 4D3DA 5JWHA 1R6DA 1PTJC 1C7QA 2D00A 5FUWA 4DRXA 1C3JA 1GEGA 3U13A 4C6TA 5AVXA 5IFKA 5K3EA 3RUCA 4IYRA 4V3BA 3SPXA 2VAMA 3N8HA 1ZJYA 4JP2A 3LSTA 5DX8A 3VYTB 1I7NA 4MQ6A 4ISCA 1DZ3A 1FMCA 3EMKA 2RH5A 2HNAA 2IYAA 1A2BA 3O21A 2Z8YM 4LZNA 5COAA 3ZJ4A 4G26A 2Z8ZA 4OHFA 4FWBA 1XDZA 4MHTA 1UFRA 1JJAA 1XK7A 4H7JA 3CLHA 1L4UA 4QPJC 3IP1A 1A97A 3E5HA 3MILA 2PANA 3DTYA 1P9LA 4Y2UA 4TZTA 2HU8A 1WU8A 3QQ5A 4N3GA 4P1ZA 1YBMA 1AV6A 1KJNA 2Z4RA 2XOKA 4KK3A 1QDEA 1JWLA 2BGKA 2AHRA 2G88A 2QYTA 2CLOB 3O26A 3ZY6A 5HZMA 4DV4B 5A3JA 2BLLA 2ODEA 2WYIA 3ESYA 1Q7GA 4L4SA 3CM0A 5BYJA 3TBFA 3GRUA 3BSYA 3DP7A 3DZJA 3LZCA 4TYPA 4DSTA 2DBVO 3E2MA 3EZGA 3OLQA 4FYPA 1QGOA 1WSWA 1RRVA 4ZC1A 4NX2A 3UJ7A 4ZJYA 3K8ZA 1KHHA 2JAUA 3WOHA 4UBKA 4D5GA 1JEAA 3NTUA 4PYNA 1C1DA 1EXMA 2OOKA 4TL8A 4LE2A 3RG2A 3VPFA 2R6DA 5B7NA 3GLFE 2XDWA 3PTZA 4IX1A 1UKZA 3WHPA 3OAAA 1W0JD 2HGSA 2VEDA 1A7JA 2ZJ6A 4EUKA 3NDJA 5JAQA 4YRTA 4FB5A 1R0CA 4YP6A 4OY3A 1A9SA 1IHOA 2QGFA 2AZMA 1MOSA 3PIIA 2XCIA 2Y67A 5KVCA 1M3SA 5ED4A 3VJRA 4FX2A 2WU1A 3FYTA 4G2NA 1ZXXA 4CM9D 4EMBA 1PNQA 3BPSA 3HTXA 2Q5IA 5F35A 2HA6A 3ETNA 1OZ0A 4P3OA 3DHNA 3BDAA 4ILKA 2ISQA 4AYWA 4R1LA 3IVRA 4DRXB 1U2SA 4YCMA 3WGNA 4IWNA 3EGXA 2DFVA 4C6TB 3FVWA 3QFFA 2FFHA 2PH3A 4RVDA 1I10A 2A9KA 1QYIA 1NMEA 1Z3IX 3KDSE 2V03A 1R88A 3T1YB 3HWWA 1MV5A 3CXRA 2G4LA 3KOUA 4TLLB 5DGIA 4YT5A 3UJPA 1YDWA 3A25A 4W82A 2D0IA 4RHCA 2NZ8A 4YCBA 1E64A 4A6DA 4D4JA 5AIBA 1R9JA 2CXPA 4MGYR 4HY3A 1WOYA 4UBMA 1JA1A 4QXRA 1T1GA 2JAPA 1P2DA 2Z2YA 3EGOA 3SX4A 2GM4A 2VHVA 3FYCA 3QMMA 4RL4A 4YEDA 4DMGA 4AX4A 2H7VA 4PPQA 2Q41A 5JW6A 4QULA 2HA7A 5GJVC 3T9FA 2DSTA 1ATZA 5INTA 1Z7WA 5HDQA 1V7PC 5CEFA 5IVKA 4QDXA 1HGXA 2MSWA 5HBRA 1O95A 1KYZA 3UICA 1ABBA 2GASA 2XJ9A 2PVPA 1M2WA 3AG5A 4N5HX 4PG6A 4EBFA 1MQ8B 5AOAA 4C87A 3EA0A 3QOYA 3W4IA 5KYGA 4NOMA 1GZ4A 1JALA 5KYTA 1I6LA 1IAQA 4JZYA 1NVVQ 4YLGA 4AMUA 3O83A 2Q1TA 1C1DB 3RYTC 2BMDA 4BNDA 4MROA 4YY3B 4K2HA 2BM9A 1NM5C 3N8KA 3MHTA 3ASVA 2HY7A 4N3AA 5DCWA 7AT1A 4RS3A 4W6ZA 3L8FA 2G1UA 1NFQA 3STTA 5JWOA 5T57A 4KHPB 3UJCA 1LFDB 2J0SA 2NO5A 3QZUA 1AHPA 4X7MA 5JJ5A 4F96A 1QRSA 3DE6X 4DQ0A 1RKUA 1ZD4A 4QAJA 2FEXA 3ITDA 3EW7A 3EXEA 1WOMA 4UVEA 1E5VA 1H0KA 2SNIE 3EAQA 2EFHB 3QELA 2QN1A 4R2MA 1NLYA 2Q62A 4X7RA 3QVJA 3K3PA 4X3CA 4C7OA 4IMJB 1PR3A 1SU8A 1G21A 2QQEA 2Z58A 4H3HB 4JEUA 3EGXB 5EOVA 5C3MA 3LDFA 3RVMA 3RJ9A 3UMSA 1SR8A 3VUFA 1U7TA 5A71A 4J9VA 4AG6A 3FPFA 4DBZA 5BW5A 3UY4A 4G5FA 4C7XA 5BR4A 2XCLA 3FZYA 1IHXA 1EUDA 4LXYA 1PLJA 2G1JA 4I5FA 2WNHA 3P2MA 2V0NA 3FTDA 3CH6A 3KHKA 1J0BA 1UZAA 3PC8A 3R7DA 3CVUA 4IIDA 1ZMRA 1SUPA 3NBMA 4F2DA 3KKKA 3OWXA 2JJ2D 1TGVA 4UVIA 1KO1A 5T8KA 4LXHA 1V1JA 1WSDA 4G1CA 2QNRA 4XPIA 4QRDA 1DAGA 1X6VA 3ONNA 1Z4JA 1Y8RA 3L0OA 2ZRGA 2XBUA 5TT1A 4WZAE 2A1UA 4YRIA 4PYMA 3KUKA 1A8HA 4Q05A 4YPOA 1ORVA 3U1BA 4H6PA 2PSJA 4XD7A 5DZSA 2DG2A 4EEKA 2W6ID 4CL2A 4WNCA 4IDNA 4J29A 1SC3A 3R0IA 1Z0JA 3PFFA 4E51A 1IN6A 4EA7A 3W8RA 1AQYA 3LBNA 3AR8A 4PAWA 4J3JA 5DM2A 3RVDA 1OH7A 1U7DA 3CT6A 4BNDB 2BTEA 5EE5B 4TXJA 2VJOA 2DHCA 5DBEX 5GGYA 5B3KA 4KR2A 4RJJA 1T0BA 1F14A 2QMOA 1N5MA 4EGJA 5IMSA 1KA9H 4RM2A 2DQZA 4OHWA 1C30A 4PO1A 3U3OA 1FNBA 4AKIA 4IP0A 3UQZA 3A6EA 4MKXA 4YONB 4F3NA 1NMYA 2XH8A 3JQPA 1ECJA 3L0ZA 4GG1A 5EKSA 3ROGA 3CLRD 3ZU4A 4EHDA 2H1HA 1SUCA 3AXSA 3DCYA 3WLKX 4F46A 1QU3A 2J59A 1SVUA 2NUBA 3O3MB 3EXEB 3RANA 4JH0A 1YL5A 1BNCA 3C39A 2GRJA 3QELB 4WMLA 1K08A 3K5IA 2BHLA 3B1VA 2IEBA 4C7OB 1G21B 2IZ6A 4C0KA 1THGA 5HG0A 5J2TA 3OESA 4PZUA 4C5CA 2XZTA 4Q19A 2NAPA 4R40A 3REGA 1AK9A 3BA1A 3PCXA 1YI0A 1DKNA 5F33A 1FYDA 5EVCA 2YKGA 1EUDB 1ESDA 2WIJA 4KU4A 4DT1A 4AXXA 1W4BA 5JPCA 5K4AA 1UC4B 5ERYA 3UH0A 2CHEA 3PX7A 3MQ4A 1HEIA 2X6QA 3CLSD 4I0WB 1ACLA 4ZT6A 2BZ0A 2QTTA 3GWGA 2QX6A 4UOQA 4WZ6A 4B84A 5T64A 1EVIA 1DWOA 1GL6A 2FZ5A 1L9KA 2G09A 3QKTA 2GZHA 4WINA 1RAEA 4Q7LA 5E1OA 4E5MA 4PVCA 1Q1EA 2ORWA 2HQBA 1C8LA 4XPIB 4H6VA 1Y8RB 4LDQA 2HA4A 3T5PA 1GZSA 1KYWA 2ZBFA 4B7CA 2A1UB 3G8DA 1VYTA 1O0CA 1XCMA 3WMGA 4B6EA 5LR6A 4FDAA 4KQFA 5BV2P 1CYEA 3LCMA 1KGDA 1MH9A 2ZTLA 4BC1A 1QHYA 1OB2A 2DKNA 5JAZA 3SJUA 2ZUWA 3BWVA 5ECGC 5HIIA 1IYZA 2HIGA 1PDOA 1C7JA 2Q9UA 1T35A 3FDZA 2RKBA 4L9AA 2QUHA 3HGMA 4R2HA 3GBPA 2A0UA 4WOPA 2WABA 4MI3A 5EPEA 1YHZA 2QTGA 2F4NA 2WUFA 4GI5A 1N6KA 1POWA 4P4TA 1ZZGA 3DTVD 3GA0A 4UE6A 3M5WA 2Y0BA 1FP4A 4IV8A 4F4CA 4L4RA 2AN3A 1UBHS 3K92A 3RC9A 1C30B 1L4YA 2Z4TA 3NI2A 3NJ8A 4AS1A 2IW3A 4LJYA 4B3XA 4EYEA 1FNDA 1WXHA 3EJWA 5AW4A 3ZHSA 5LVAA 4ZZ2A 3U4IA 3ZZ1A 4CKBA 5LP6F 2FSGA 2VN8A 1HBJA 3B9BA 5A2GA 3E3OA 1YTLA 1XRNA 1YBFA 3AU9A 3FMPB 3OC0A 1SZJG 2DWCA 2I6SA 4G0NA 4L8LA 1E20A 5DHTA 5J58A 5FBWB 5F78A 1EFCA 1RPJA 2FW7A 1DAFA 2IC5A 1ZESA 3GRPA 4UEQA 1FMLA 1GOTA 4CG1A 2ZB2A 3TPCA 5GTDA 1O57A 4ND8A 5JZSA 1B73A 5J2TB 2ZRDA 2XUZA 5IXJA 4JV5B 1LSUA 5JD3A 4LCEA 3LPAA 4P4GA 4MVJF 3HMKA 1EB8A 3I42A 1U8XX 4D97A 2GEDA 3CGGA 4J03A 5E2BA 1W0CA 3ZDQA 2F8MA 1XDDA 4BPRA 4Y9SA 1ULTA 1BFKA 2XUQA 2PO7A 5ICSA 3HYSA 2JGAA 2LR0A 1RQLA 3OU7A 3D5QA 5AH0A 3CO5A 1WXDA 5K0CA 4BTVA 2J9GA 1SCNE 1W4CA 1DX9A 2PLWA 2JI7A 4UM8B 4YVFA 3U5TA 4O0LA 1T0HB 4RFVA 1Y9DA 1AGNA 2GZMA 1J39A 3OQHA 3OQPA 4POAA 2CMKA 3RS7A 5LWHA 3RSHA 5LMCA 4WFIA 1P4HA 3OETA 4QYXA 3H6KA 4CKEA 2W5UA 3GCDA 5AI6A 4H2DA 3VNSA 4WSOA 1PSDA 1Z7EA 1XYYA 4A1OA 4B43A 5EEGA 1USVA 2A0KA 3IILA 4JITA 3FDZB 2WU3A 2XCRB 3KSAC 1NU6A 3TSZA 5BV1A 1AXEA 2HBRA 4E4RA 1CY6A 2C9OA 4MVJM 1ZVQA 5U9CA 3CH7A 3WFJA 1L5OA 3ZDBA 4ZKDA 2ZE8A 4AL4A 1U5AA 3KIPA 3FSGA 2O2YA 1FP4B 4RV9A 4WCFA 4C0QC 3FTCA 2GYWA 4KH0A 5I8PA 1VPWA 1NC3A 2Q0XA 4TL9A 3TX6A 4HNGA 1I4OA 4OMCA 2F43A 2AUMA 1A1SA 4IEIA 3QFTA 1YE5A 1Z36A 4LHWA 4IHKA 1EBFA 2QRLA 4LYEA 5FBQB 4CKBB 4ETNA 2BHRA 3VR5A 5I4CA 3G0CA 4YO7A 4RF2A 4BQQA 4URXR 2JLZA 5C1BA 1J8YF 2ZSIA 3T5CA 2GBPA 1QC5A 4HQOA 4E22A 2YVUA 3HCDA 3ROEA 1OXMA 2VYCA 2I33A 3TLXA 5LLTA 4F9TA 1NUAA 3DV0A 1MIHA 3ZBPA 1M8KA 1CZOA 1COWD 1YI1A 4X45A 1I4LD 1H2WA 2ZE6A 3LY5A 4ND8B 4R1TA 3DZKA 2NXJA 3FWNA 4I1OA 3CSSA 5JZ9A 3QFRA 4H15A 5F51A 2R47A 2KHZA 2IV2X 3OLZA 3GDGA 3VR4H 5JI2E 5B58C 1RZUA 3KKLA 4ON9A 1DFHA 2XV1A 3IDQA 3WQQA 3IT3A 5B7QA 2FR0A 2G76A 1YIAA 1NXOA 2XT6A 3FKSD 4ZRMA 3A1NA 4FGUA 3ZD9A 4EFMA 1N8TA 3O47A 2FPXA 1U63A 4A82A 1THMA 2X7JA 3BUSA 4U9IS 3URKA 3QOFA 4BUCA 1E3IA 1YGYA 1RHKA 2Z2IA 4G0QA 3HMQA 2WIGA 2O8NA 3ISVA 3FSEA 4ILEA 5IARA 5E38A 5JRJA 1CQIA 1HV8A 2PS9A 3JQEA 5JYBA 4J7XA 3TLKA 1TW3A 1ECLA 3P45A 4HX9A 1QZTA 4XGKA 4CKEB 2PSFA 3KQSA 5CVUA 2MSCB 4RH1A 3U3MA 4BLUA 1J8DA 4QG7A 2W43A 3KYIB 4PLYA 3KQVA 4XZ3A 4DCVA 4DARA 2GB4A 2CF5A 3FBGA 1LS6A 1GQFA 1R0ZA 3IEPA 1PJBA 2PA3A 3EGVA 1WB5A 5ECWA 5B3JA 4E21A 1DEOA 1JHPA 5I7SA 4QUIA 1T4GA 1KU0A 1CFJA 1RM3A 3WRXA 3FDIA 2XVMA 2VAXA 2M1ZA 4GWGA 3UM9A 2XBLA 4WCFB 4LRUA 1OOEA 3R9KA 1EWTA 5DYTA 3EVFA 3K5PA 3HWX1 4YYZA 5D3ZA 5EKTA 1C7RA 2F43B 5AHRA 4LQCA 1W8IA 1DL5A 3L06A 3A4NA 4CG0A 3H2BA 1SWVA 3B1WA 3ADPA 3D8NA 5TJHA 4IFTA 5FTNA 1XLWA 1QC5B 3BMXA 2RBEA 4MA5A 4YJ2F 1AGXA 3BD7A 3DV0B 3KWJA 1F3LA 3C4VA 8OHMA 4DR3B 4MWTA 1YB4A 1HT2E 1XAGA 4RD0A 2DZDA 2E85A 3K4HA 5ICGA 4NU5A 1I9CA 4I99A 3E9YA 2ZSHA 4Q37A 1EWQA 2WI8A 4UBLA 2LBPA 5JDCA 4Z7OB 4ZO6A 5AKZA 4X71A 2JFWA 5K3OA 2JCXA 2JEOA 4N8EA 1OASA 2NT4A 1OXBB 3AVQA 3CPHA 3ESXA 1TYCA 3VTFA 3WDKA 5JV5A 4RTKA 1W5BA 1HEUA 1N8SA 4BZZA 4OYYA 5FTLA 5GIPE 2OCAA 1ZXBA 3V7UA 2C54A 1PZXA 1JR2A 1PK7A 2HMWA 2XQGA 4DIKA 2Q46A 3DWEX 3MWJA 4FKMA 4IDGA 3SKVA 4C6SA 1OY1A 4CIBA 4XVRA 2HJSA 3EUAA 2HSJA 4LUCA 5JSHA 4WECA 5KC9A 4HDMA 1CQIB 3T5MA 1U0SY 4S0XA 1U3DA 2CVQA 4BRZA 4HS9A 5HS4A 1NR7A 4MXDA 1I1OA 1UKVY 3DMPA 3W9SA 3A4YA 2C20A 3FHJA 5KYWA 3PUHA 5A62A 5BN1A 2EX0A 4WZZA 4AYTA 5CJJA 2O5CA 3OPMA 1YSCA 3M81A 2O48X 1DV1A 1FNMA 3ZHOA 1XP5A 4MVJH 4MUMA 4OFWA 3WGYA 2M6RA 4MKZA 3LHKA 3E0QA 1YQWA 4ITRC 5KDLA 4BGVA 2EDAA 1X13A 1BGXT 4B31A 1KR2A 3ISTA 3DDZX 2AKYA 1P1CA 3GG2A 4KQWA 1OFTA 1NNSA 3KSDO 3OUUA 3EFHA 3R6GA 4MS4A 1OXKB 2H2FA 2JFHA 4QEDA 2H1LA 3TE7A 4B6QA 4X95A 2AMLA 4LMPA 2G80A 3L92A 1IVSA 3LBFA 1NR5A 3PWTA 5SICE 2GZ3A 4R8LA 2ZREA 4MMYB 4ATNA 8GPBA 3FPSA 4S0ZA 3N0TA 2BGTA 4OHKA 1AGRA 5EJFA 2CNNA 2D5BA 2P5SA 2V8BA 4IQ8A 3FZGA 3S68A 3W5HA 3EPJA 4WBNA 2C4KA 2XUDA 3V46A 3SIPA 3IMCA 3VDXA 1DUVG 1USKA 3RF6A 3V1MA 4TN5A 4FR2A 4UCFA 1FVFA 1R1DA 1RRFA 2ZGVA 1QTQA 1A9ZA 4FINA 1ZI9A 3OE4A 1I2AA 1L1FA 2WHRA 3E9EA 2J7KA 1PFKA 3P2EA 1M9NA 2RGNC 4EGAA 2C1EA 1UFVA 3UMCA 1IJEA 3LBAA 4ARBA 3UHJA 2JKYA 4FQ8A 5IANA 4Q12A 5EUCA 2JLUA 1G41A 1X92A 1U7WA 4K03A 4Q7QA 4IRUB 2EXXA 3CZPA 2AOVA 3HJHA 1LK7A 3U4QA 1IQPA 3A9CA 2OYRA 3H2GA 4QOHA 2QX8A 1PWHA 1AT1A 1FFEA 1UWCA 3K0FA 1J8FA 1Y4DE 5F77A 5IAEA 4HDMB 3NJRA 1JEYB 1VKRA 4EKDA 3TW4A 2P9TA 2ID4A 1YBHA 2JHFA 1GKUB 3K0AA 3H87A 5KYWB 2IKQA 2JPDA 5HMMA 1CRPA 3PWKA 2BI7A 4L7VA 5JDIA 2BV3A 3P9PA 2ZSJA 1R0KA 1I4TD 3SZLA 1KKMA 3VPGA 4B2PA 2NTEA 2C8JA 2ADOA 2P4HX 4BFCA 1ISFA 1IZ9A 2BMVA 4MWBA 1A76A 1KYYA 3I52A 3S28A 3V55A 4PNPA 2X1VA 2CLMB 1FMTA 4IDQA 4DA9A 4DY4A 4EB3A 5IKPA 3CPJB 3S5UA 2QRPA 3SOZA 1E2MA 1J90A 4HB2A 3G0GA 4WE3A 2GCEA 4JGGA 2QT1A 4LNUA 1E5DA 4TS4A 4US1R 4Z8YA 2SECE 1RWBA 1H6BA 3SNHA 4MSUA 4PFJA 5B4UA 4FYHA 4TTJA 1FZTA 2C00A 3OQBA 3DW1X 1XVUA 1F6BA 4MS4B 1NOKA 2Y93A 4GKBA 2R11A 1GNQA 1Z4PX 2IHZA 3WO0A 2XZLA 2O05A 1NASA 2QTHA 2WWRA 3F98A 1LKZA 4DDHA 1LQ2A 4MP3A 1OWMA 2CWWA 2H1RA 3S3TA 3QGMA 1V8PA 5GV8A 4F04A 5BWNA 2R44A 1UBFA 4NZMA 4DCPA 2Q3CA 3UNXA 4YRAA 1UP4A 2Y6VA 1FS6A 1JQKA 5B37A 3GVHA 2J3EA 1VE9A 2VAVA 3KPJA 2KB0A 1ZM7A 3M5PA 4KI7A 4OXNA 5IULC 3EPHA 3U80A 5FTMA 3HP1A 4Q1BA 4B9EA 4MLCA 3OURA 2ROQA 1ISJA 5EESA 3PSHA 2IEZA 3AI2A 3DCJA 3H65A 3H1TA 1SRQA 4BMXA 3A2MA 5DRYA 2K5UA 2Q3JA 2F1IA 4K05A 4EO7A 5KJ1A 1E7WA 3RUEA 2XCUA 1DQNA 1ZM4A 2ZTUA 3GJXC 4DYVA 4O2BA 5IBRA 4E94A 3ME5A 2Q27A 4U6NA 4LGYA 5LBIA 4XSGA 4M9CA 5JCOA 2IEYA 3U4QB 5COQA 1ZO8A 2I2WA 1XRJA 2XCTB 2R0QC 3PC7A 2W2TA 3K0FB 4QODA 4W99A 4WZBE 5B6JA 1B26A 4WQMA 3TDNA 1KZ7B 3LP5A 3K0AB 4FD3A 4JP5A 1OW3B 3KKPA 3QWIA 4HK4A 3AR6A 2I8CA 4RVHA 4XXHA 3OD5A 3RU9A 1C80A 1U2DC 1UDBA 1USIA 2ERXA 3I6QA 1SHLA 4GMGA 2FPLA 3FFXA 4LRTB 4C0JA 3NNSA 1N5DA 4HGPA 4HX2A 3JR7A 5EYPA 1XMSA 4BNTA 3BFKA 1Z7BA 2BKAA 2R6GA 2PBLA 5FADA 4PZEA 1U8YA 2WT8A 3C8UA 4W5RA 2MMGA 3Q3IA 2BR3A 3TSYA 1LJ8A 3EPPA 4J0JA 4LNUB 1Q20A 1ZK4A 4C0HA 1CRQA 2PD4A 1IY8A 1T9GR 4FSHA 1PYDA 1QKKA 3P9SA 2Y0PA 1UKAA 3VPCA 3ZTWA 2F48A 2IYYA 2D1RA 3BN3A 4CL0A 4XLLA 4RTRA 3GPLA 4Z3OA 1FDUA 2EDCA 2DPYA 5HRUA 3W4KA 4KFTA 4ZVUA 1K4YA 1XJWA 1DFGA 1NW5A 3D3KA 3FIUA 1P3JA 2VYVD 4I50F 1WKVA 5KAPA 1CJCA 1G4HA 2QTAA 3HSYA 3OHPA 1P80A 3IVXA 4K7JA 2W0MA 4KXNA 4MVXA 5CXXA 3AC0A 1GN8A 2FZCA 3RSQA 3BFXA 2GNPA 4K6HA 1JHAA 4YIKA 3T7KA 3TCXB 2HQ1A 4J16C 2RGEA 2VC2B 4YMVA 4UPEA 1XDWA 2QUIA 3QI7A 1PFUA 1TT7A 1P2SA 4HFJA 2H9YA 4HXYA 4J1NA 2L18A 3CZ5A 4K40A 4BZQA 3FB4A 3QVXA 3X1KA 1IULA 3C3XA 4OX9Y 4QA9A 2JIRA 5AVVA 3U49A 4IZOA 2WFLA 3I5YA 4O2BB 3U56A 3AW8A 4N48A 4IVRA 3FKQA 3TJZA 3WG9A 1RLUA 1QWSA 2FOIA 1MAAA 1P91A 1SU7A 4MLDA 4YLEA 5FF9A 4ZEOA 4O59O 2QAGC 4N7MA 3U4MA 5B5SA 4U8GA 4RLSA 5CW1A 1KAEA 1Q15A 4RLQA 4ZV7A 1Z6XA 2D59A 2WJIA 4E15A 3AFHA 4HN2A 5BV8A 2H1VA 4FJ1A 3LDAA 3LXUX 4IQ0A 3OIYA 4PTZA 3OO0A 4UNPA 3U3KA 3V42A 4RZSA 4NNOA 5BR7A 2YFQA 4A15A 1CG6A 1NF9A 1CB0A 421PA 5EYPB 3L7AA 3VYUB 2PX3A 1UPXA 3M5DA 3TE6A 2LP4Y 2AFVA 3AQIA 3QI2A 3BX1A 2PWBA 4KTVE 4C89A 1RSZA 1XZDA 3LBYA 1XX6A 3K16A 3BYZA 2IEIA 3LH5A 2H4WA 2PS3A 1QVAA 5G0SA 2IYLD 2ZDHA 2XA2A 1XWWA 3OPXA 5BYKA 5KNBA 3T7TA 3LNTA 1C41A 1JQJC 1P7PA 3HSKA 1QIEA 1JJVA 3T1TA 3HVKA 3FYSA 2YXPX 4PO9A 4M0MA 3AHJA 5TMPA 4CZ2A 3UWOA 3EXHA 1TB4A 1GT91 1BMFD 1C9MA 1QQ6A 1UT8A 1F1JA 4L07A 4W1RA 2OXTA 4CI0B 2MT9A 3FBWA 8ATCA 2VDVE 4EFNA 3AB7A 1V1RA 3QBDA 4D82A 1Z17A 2OY0A 2PUJA 1BE8A 2QRGA 2X1MA 3RC1A 4GM4A 1MIOA 5H83A 4EKYA 2OGTA 3TQTA 3V4PB 3QY0A 3IGFA 4NMXB 4QIHA 3OD1A 1U2PA 2Q6OA 2QN9A 4U2DA 2BFCA 4Q9KA 2R8XA 2Q1WA 1T2DA 1Z33A 1YZLA 1LBIA 3FOZA 1ULUA 3ZDRA 4JOQA 2AD1A 3E1KA 4QQ8A 1SFRA 2C5EA 2V6JA 1CY2A 1P5JA 2OA0A 2AF3C 2ID9A 1UAYA 3TQFA 3LUHA 3OJFA 4E5DA 1IATA 3CX4A 5BN5A 2A9VA 3GGCA 1JXOA 4PU0A 1EVLA 2FETA 1I3NA 2XODA 1CRZA 1HOTA 2GF2A 3AP2A 3LVBA 4D96A 1RE0A 1BA2A 1K88A 2RI0A 2WFLB 3LC0A 3LFTA 3WRYC 1XV5A 1ONPA 2V4MA 1VBNA 1GPUA 1K7XB 2XOKD 2HFJA 4KK4A 3DZIA 5JAHA 5JAOA 3EZ9A 4PCVA 3BH0A 2IOFK 4XPZA 3U7GA 3IS3A 4A2CA 2RHHA 2G08A 2QE6A 2YY7A 2I2AA 3C3MA 1E6CA 4M8NE 4LOKA 4OI2A 2C9MA 3ETEA 4W5WA 4MWCA 5HS6A 3M34A 5CTAA 3UJ9A 1UBSB 2C5FA 4UMVA 5LMNB 2C3PA 3GUCA 3HO1A 1MXFA 2WJ3A 4X24A 1JG4A 3JZDA 3OQ1A 3TAHA 1E2QA 4FZ5A 4DADA 1WPRA 2C8KA 4JX8A 2ZBPA 1T36A 5L3RA 1JU9A 4M22A 4RIGA 4MDEA 2F9MA 2O3RA 1VYVA 3ZGLA 4C03A 4UUPA 3HKDA 3ETJA 4PBTA 1HM5A 1KDZA 5DK6A 3I2FA 1DADA 4BMSA 1H65A 1UMDA 4QPPA 3JYNA 2OHXA 3E84A 3L07A 3OAAD 3ZWOA 3PRKE 2QR2A 1E96A 5NLLA 2W2OA 4HHEA 1IWPB 5BQFA 4LXGA 4IAOA 3QIVA 4MWOA 4R8KA 4E2FA 3ZD6A 1YXMA 4XLZA 4HJXA 4DAEA 1T5DX 2P30A 2WVAA 5K4GA 5JS1A 1CJSA 1NJ5A 3VU3A 1YNOA 4QU9A 4ARZA 3QFCA 4U0KA 4YAJA 4EG1A 2WWYA 3JQDA 3EXHB 1LEHA 4IGKA 3SF0A 4C76A 3M4XA 4AP9A 3I9NA 2R1TA 4ZEMA 1V1RB 2BMEA 5EP3A 3RHZA 1GAXA 4L51A 3KVNA 3OEWA 5HDBB 2QJOA 1MIOB 3QXGA 4H3VA 3TNDA 5A5VA 2AZ4A 4HGNA 1XZMA 1UAAA 2J48A 2NM0A 3KLOA 2BFCB 5LYJA 5TE9A 5JROA 3E81A 4AMBA 3CA8A 3MIIA 2VJLA 4YUYA 1NQVA 2OCGA 1QP8A 3DUWA 2PQ0A 1MVOA 2H5EA 3RSCA 1DEHA 3DQQA 1CUAA 1JHMA 2JS7A 4TGLA 5BN5B 2SKEA 3WKBA 4MKHA 2A8YA 4HGQA 4GE3A 4YRLA 4L3WA 3PQ3A 1WPXA 3N8IA 1FUUA 1Y82A 2XQKA 1WQ3A 3B78A 3GCZA 4FYVA 4IDCA 2IELA 4O4HF 1OVMA 3I09A 4P80A 3TSCA 3O7MA 1Z2CA 1PTKA 1WCV1 5IZCA 4TSRA 2IXBA 4FDVA 1XEAA 5EMNA 1IPFA 1PJAA 3P9ZA 3QU5A 4CR6A 4BZXA 1ISSA 2UXBB 4G84A 1O95D 2IHTA 3OA2A 4QU0A 2V4ZA 1QXSA 1WDLA 3WNCA 4TL7A 3RROA 4URVR 1LWOA 1HXHA 3NFRA 4NCHA 4YHHB 4NV0A 4OQQA 4TKZA 3EWSA 3AYZB 4L0MA 3D8TA 4QBIA 2CDBA 4XM0A 4EVIA 1ZJZA 1NSFA 1T36B 1ZSYA 2ZVJA 4R83A 1CV2A 1IHPA 5AI5A 5CH8A 3RB8A 2WWGA 3HKDB 3RFVA 4X1KA 1UMDB 3MPUA 4OD0A 4AWXA 3A2NA 1UJCA 1NUUA 1OAOC 4R0VA 3D6HA 4I9GA 2PXHA 4LHSA 3GNSA 4CIYA 3OZBA 4MTCA 1JT9A 1Q17A 3ODPA 5J4KA 5DK4A 1NQAO 2GZ2A 3NTRA 4ARZB 3RIGA 4AQ7A 1ZITA 5AM2A 2BJHA 4NYMQ 3CW9A 4MVJE 3PGXA 4L95C 3TTVA 2H63A 3AY7A 2R1TB 4PYRA 5LQJA 2Q3LA 1F8FA 1SU4A 1Z83A 3BXEA 5L3ZA 5IYZA 4M8SA 4CLEA 4YAKA 4PICA 1W1IA 1KK3A 4BLVA 5G1PA 1OREA 5CLLA 5LYJB 1AS2A 1E61A 3K8YA 1XVIA 2A5DA 3A36A 2OCLA 3AVPA 4RK6A 4LOJA 4D8YA 4LJ7A 3SF8A 4BY9E 5HCNA 2XQIA 1U0HC 1JXQA 3Q2OA 4DIUA 3D6MA 4RA6A 1TLTA 4BNHA 3FZQA 1G60A 3QE9Y 3AU8A 2HMYB 4AQDA 1JSLA 1KZYC 2VXYA 3T1HB 4DY6A 3KFXA 4RD1A 2CV1A 1JF8A 1GUZA 3BICA 3KB1A 1O4VA 3QKUA 1MJGM 2FUCA 1MH1A 2IPMA 2HF2A 2XE7A 5TRTA 2DXIA 1S5PA 2BFEA 1G8FA 5IM5A 4D4GA 5CFNA 5FWNA 4GLOA 1KQFA 4P54A 4S1TA 3SHOA 1JVNA 3MZ0A 4D0NA 4QYSA 4UHDA 4OLJA 3EGEA 3CWCA 4XD7D 1H66A 3AJDA 3NIWA 1PQPA 5B36A 3K70C 3KPWA 1A5SB 4U2GA 5CG2A 2OILA 1RADA 2IHUA 2PCJA 2BBOA 2JAWA 3KV1A 2D3TA 3O82A 3KJZA 1Z45A 4HUQA 3BK2A 4Q1FA 3I5UA 3N6RA 1R4MA 5TF0A 1BVUA 4F93B 2J5KA 4X1KB 3L0PA 4XH9B 1XMVA 3CBGA 4R2WA 1RJGA 3WWZA 1FFDA 2KSQA 2X76A 1UBEA 1H9BA 3KB8A 4NBVA 5CT8A 1MQSA 1BMQA 4OLAA 4R05A 4QOJA 2OCXA 4YV7A 2YXDA 2WZDA 3FHOA 2D8AA 3HDYA 2DPXA 1Q0QA 1CUYA 3E05A 1WZIA 1DG1G 4V0MA 1KJIA 5F12A 4DCUA 4CF7A 2XRZA 1YQQA 1YIOA 1A04A 4X84A 5ENVA 4JZKA 1YDMA 3N2NA 1YV9A 4BNNA 1N3IA 2FAXA 3VO8A 1FP1D 4HXGA 2EKQA 4QJIA 4OP1A 4CDNA 1Y8AA 5F2NA 5TS3A 3FFAA 3W2EA 5IYZB 2I9KA 4HS4A 1XMIA 3KZCA 4GPTA 3IQHX 5AKKA 2WZCA 2PFKA 5KWSA 1CDZA 3TIXB 1EGMB 1WABA 1LX6A 3EVNA 4LXQA 3SF8B 1ZYUA 3KR2A 5IHXA 3BORA 1NF8A 5EXEA 1P62B 3X3HA 4RA6B 3AFOA 2VJMA 4LTMA 2JH9A 3KFVA 1NJ2A 3N7UA 1QCDA 2JFYA 4NJMA 2YZKA 4HN4B 1XEXA 5EWLA 5IKXA 2GN4A 2ZSAA 2J3IA 2YC4C 1VJRA 5BSEA 3K2BA 4FMDB 2BFEB 3D5TA 4DIOA 5LNK6 1XMOB 5D84A 5CHYA 5KTKA 2C9ZA 4W5HA 2NZJA 1T5HX 2XD4A 4FS8A 4C7MA 5F4BA 1EFHA 1K8XB 1I0IA 3PXBA 4WESA 3GDOA 3BIOA 5T3YA 4XVHA 2ONJA 1YA4A 1BC5A 2GYUA 2P11A 4ZYTA 1CLEA 1BSVA 2V8OA 5F7OA 1YUNA 3IOBA 1JA0A 3O03A 4Q6BA 2D13A 3TQOA 4HUQB 3C5VA 2EP5A 3HRIA 4BHTA 1MR3F 4KO2S 3KZNA 3UJNA 1T5BA 1R4MB 4BNUA 4HG2A 3BVPA 5C8XA 2ADFA 1EP3B 2QNIA 1ZK1A 4RF5A 2AFHA 1AUVA 4B4OA 1SO8A 2N9UA 3LY9A 1XF1A 4BQOA 2PSHA 3LZDA 2ZRPA 4ZHSA 4UATA 1J9EA 2JGNA 3FH0A 1MUUA 2VNAA 2W6QA 4PANA 2I1QA 4BWYA 2AB0A 1DRKA 3TG8A 4DWOA 2IGBA 4PLGA 1LBHA 4ZT3A 5U1PA 4JQYA 2OPHA 5JJBA 1DKUA 4PHCA 4QQKA 1PQWA 1L5QA 2GS9A 2O50A 1GN9A 1ZOLA 2AN1A 4JLWA 3W1VA 2OR3A 2CBGA 4H6XA 4B3CA 1D1QA 3RAPR 3ADCA 1MB2A 1G42A 1OZGA 3T61A 1YS6A 3KVOA 1IU9A 2EZ4A 3BWMA 4QUHA 4YXWA 3MF4A 1MDBA 1RLTA 4OJYA 1VZ2A 2Q2WA 2X9LA 2VHQA 2GJ9A 2DX7A 1V9LA 2E37A 2X14A 3I8XA 1S8FA 4HH4A 5AIAA 5LQKA 1AMOA 1I5RA 4WKCA 3TI9A 4UM9B 2CFIA 1EH5A 1U65A 1XRPA 2VJMB 2H08A 2NOAA 1Z4QA 3UPUA 3IO3A 1DX6A 1GCGA 2DU8A 2AF4C 4NJMB 5EWLB 1XEXB 2VP0A 3GEDA 3DLPX 1FU8A 4QD3A 1YB7A 3SM9A 2Y1CA 4JR2A 3I72A 1N6IA 3L8CA 3VBCA 4CFZA 4EZIA 1XTBA 4N1AA 3OFNA 1UBKS 2Z4SA 4OBBA 5ES3A 4P82A 3IQDB 4ZODA 2YXBA 5I47A 2VNJA 4H27A 5L9AA 1E6MA 1PS0A 3Q88A 4WESB 5EZYA 1KJWA 3CW2A 4BMNA 1OFIA 1A9XA 1Y6RA 3LQ2A 3DKVA 3E35A 5EQTA 3QKWA 2DR3A 1URPA 1XTPA 5LL6P 4MVJP 1Y8ZA 5KIAA 4A6PA 1JFVA 3ZXXA 1NG9A 2ZIWB 2I2BA 2PEZA 4B3GA 1MGPA 5CA1A 4JVMA 2AFHB 1Z26A 3ZJTA 1VE5A 1XFAA 1W25A 1BA3A 3D7RA 3EIFA 3FDJA 4BQFA 2QTNA 1ZD5A 2PO5A 2JIOA 5A4KA 1A4UA 5DP2A 2X5OA 2HH9A 2A92A 1KH3A 3JQAD 4E12A 4DMKA 5K6RA 3KKNA 2ZPAA 3VAYA 5EWJA 3N0RA 4Q03A 1YMUA 3VR5D 3G2PA 2N1BA 3RRMA 5K0LA 5BSUA 3O6VA 3M82A 1RQ7A 3W2GA 1KERA 3CR3C 1E32A 3HU3A 4GL4A 4P4UA 4DIFA 5EHZA 1EZ4A 2QIPA 3I30X 1HDOA 4LVOA 3FN4A 3BAZA 3ENWA 3EIEA 2EF1A 4RO0A 3ACDA 4FGWA 1JBKA 2QZ4A 3ZQKA 3BK7A 5TS2A 2Y05A 2JIPA 5ALMA 4QWMA 4II3A 5LD2C 1VIYA 3L4SO 4JQZA 1H2ZA 3IQIX 1NC1A 4UEKA 2W0SA 2Y1GA 3ZCXA 4AJ1A 3PFKA 1QUFA 2V6BA 3MMNA 1SD5A 4HB4A 4IKPA 4MYCA 4WLNA 4L5CA 4MP8A 2ZRIA 2F64A 3KYBA 4TWBA 4XR9A 5JFGA 1TU0A 1QB8A 2FB9A 1RP1A 2Q0HA 4K8OA 2P3OA 4NMLA 4RTOA 3RWBA 2IPNA 5T7BA 4KRGA 3H4IA 1LDNA 1YR3A 3K9FC 2H5JA 5K1ZA 3K70D 1ONBA 2IFTA 3I28A 3PX2A 1JIJA 4REMA 1QWOA 2GRUA 2HNBA 2XPCA 1NBHA 2JAOA 4LHVA 2FZWA 4J0DA 3WL3A 4NICA 4TVOA 1EUCA 3H2SA 16PKA 2X5KO 1L5YA 3T1QA 2ZWAA 3B7GA 3UMYA 5EZYB 2X7XA 2G1AA 1MTOA 1J0EA 1YZNA 2Z95A 1V45E 3TQIA 3UPDA 1A9XB 1WULS 3QX3A 3DOHA 4EW2A 1ENPA 4XGRA 5KREA 1M74A 2AC7A 3H0CA 3QPBA 4UARA 4DPMA 2VJNA 3C24A 5G40A 2R8OA 1VG8A 1PVOA 2QRJA 1MOZA 2QP4A 3Q8XB 4QJ3A 1HFWA 3GYGA 4OVKA 5FOXA 1A4IA 1WBBA 2DBZA 1BE6A 3DV9A 1EEXB 3ML1A 5CA1B 3IKMB 1SAYA 3GEBA 1L5FA 4I8XA 3PTLA 4LRSB 4D3ZA 4PCUA 3AV0B 3G8YA 4EYQA 2VRWA 3ZVKA 5J59A 1RAHA 2P79A 2Q3MA 4K28A 2FN3A 4JSYA 4NRDA 3WGLA 2WIDA 4LXIA 4CQJA 4JU8A 1X19A 5HKLA 1WUHS 4HQ0A 3K0BA 1GG9A 1AKMA 4G9EA 3BRWA 1VFPA 2RHOA 5CLGA 5EWJB 5A7FA 5JRDS 3R9WA 3EDRA 3GLUA 3DO8A 2WC1A 4R81A 1Q84A 2RK3A 3N2KA 4G5QA 4QBFA 4LVCA 2O54A 2Q5OA 3EWAA 3O2SB 2H17A 3EEOA 1LB1B 3Q98A 4XIGS 5TNXA 3VPHA 2PXAA 2VWPA 3PUZA 5CURA 1L7OA 4WNIA 3W90A 2UUAB 3NB0A 2AJDA 5K3SA 721PA 1GZUA 4NDNE 2WNIA 4AG5A 4D92A 4CCYA 5HUHA 1JNYA 3AW9A 1NXWA 1P31A 1OTHA 3LWBA 3AKYA 2ZUBA 3BCRA 3H4MA 3N3BC 4KXQA 3WQSB 2DRIA 1YS4A 4GOND 4D81A 3VHRA 3WGKA 2X58A 2P4SA 3ILXA 3UCEA 1VJDA 2ZYDA 2PH5A 1RJWA 3SJBA 3UHFA 2Q9BA 4HH1A 1CEQA 3A26A 3D6VA 2AR0A 2GPWA 3AF2A 1E1CA 3B51X 1NQUA 4X1YA 1IZZA 2YCBA 4UM5A 4EFLA 3AUJB 2C2XA 4F2HA 3WHIA 1PD1A 2ZIXA 1U7ZA 3L7YA 3RASA 3S0JA 1TZJA 1EUCB 3Q3HA 3IE1A 3F6BX 5SV2A 1UOEA 1LQTA 4K6CA 2BMJA 4J4BA 4DLVA 3HGTA 1DTSA 1GDHA 4G4JA 4QGFA 4WDRA 3LK7A 2OM6A 4Z9FA 4A5OA 1Y3IA 1YT5A 2C8LA 2I8AA 4NZNA 3VHXA 1P19A 3DZHA 3MJ4A 4GMHA 1BQ4A 4PYLA 4URHA 3IALA 3RRYA 3VMMA 1H1DA 5KTSA 1QYCA 3H1BA 2BKUA 3LPDA 1DAPA 1S8OA 1GHTA 2H11A 1ZRHA 3FF1A 3NGXA 4IM7A 4LDNA 2O4UX 4F38A 1Q3TA 5C1DA 3A2KA 3GZJA 2FUKA 4NXNB 4D0SA 3CKMA 4CCSA 1QF6A 4I5IA 2F1KA 3O1LA 4PFQA 3OT4A 3P2KA 5BNWA 1QTIA 2PR7A 1XEWX 3IUSA 4KR9A 2V7EA 3JAKA 4RFLA 2RHWA 2X0RA 4BE9A 3NEJA 4S1WA 2BZSA 3CJTA 1S1CA 3VR3A 4S24A 3GROA 5IAAA 3A4VA 3INGA 5KTTA 2X2OA 3N2KB 4ESOA 1E6EA 4IOKA 5EIBC 3KEOA 1JG2A 4PC7A 1X39A 1OIVA 2FWRA 3LIIA 2NT3A 3F5DA 2R4UA 2GSDA 4E46A 5EZSA 2ZW9A 1L7EA 2CJYA 2P2SA 4C43A 4ZQGA 5K51A 4E31A 2ECQA 8ADHA 4NE7A 3K6KA 2JFVA 3P0HA 2WAMA 1QH0A 4EI9A 3DJYA 2OP0A 2UZ0A 4F56A 3PA8A 4IQ4A 1BXZA 4MLZA 3HA5A 3UOAB 1QJCA 2CLLB 3UW3A 4CCYB 3E6AA 3JZIA 2HCBA 1EQUA 2C1XA 4KO1S 1GVNB 4QGHA 1YAJA 5E0KB 3DDUA 1JA9A 3MUEA 4B44A 5T8KC 3CF0A 5A05A 2QX4A 3COPA 3BT7A 1F4PA 1ZIDA 3AKCA 3HKBA 3ZD8A 2G82A 3S2UA 1UINA 2VPYA 1YRQA 1E1CB 2F8LA 3RU3A 4KODA 1G20E 4X1YB 3LUDA 3TD2A 1R18A 1SPBS 3G2QA 4BJHB 4QTYA 5LOVF 2C7GA 4YMTA 5JNUA 1OPXA 2X0IA 3U61B 2ZIXB 4W9NC 1BMDA 1TM5E 3VH1A 1WXFA 3LMKA 3NC1C 3TXYA 3KJFA 3RRBA 3G0HA 2OHIA 3PRJA 4BB9A 4EGFA 4XSHA 1KE2A 4DVGA 2WIKA 2YXLA 1R15A 4PR0A 1ZJ4A 3GBSA 3H97A 1RKBA 4AP6A 2IPXA 3VZQA 1KZ6A 3VHXB 2ZYSA 4OM8A 3UMFA 2L69A 2G67A 2Z5FA 4TV8A 1GDTA 4L8WB 4F8YA 2O2EA 2HRBA 2QXUA 1C1YA 1M7BA 2XWQA 3IEKA 1FQOA 1OF1A 2RSLA 3NYQA 4ZI3A 3CCBA 1C2YA 1QCYA 1GZ6A 2FN4A 4FT2A 4OH7A 2QN3A 2DVMA 3KQMA 4CG3A 3AEQA 4D4IA 2I34A 3EOAI 1MG5A 3OWHA 4GLLA 4P3NA 5DGTA 4R6XA 1Y3HA 3A04A 3WWPA 4YUXA 3JAKB 2GETA 1ZP6A 3OCUA 4HPJB 2A1IA 3K15A 4YBRA 5JC8A 3U6KA 2OPBA 1R9GA 3KQPA 1DQYA 4Y1GA 1P1HA 3VC2A 2HOQA 3VC7A 5JLAA 1QR2A 2CFSA 3C6BA 4LHXA 3VKVA 1HNXB 4I3GA 3NHWA 1TC1A 3VI4B 4JA0A 1EXDA 2GEKA 4Z4EA 3BFJA 2O57A 5F9HA 4TTSA 3DLTA 5IDYA 1HLGA 1TU3A 4FXPA 4YAFA 2GM3A 1AIPA 1UUFA 1VHLA 1ZAKA 3GGGA 1P8AA 2Q5EA 3CE9A 4JP3A 4WV3A 3T5DA 4P2GA 5HX7A 4D26A 2P8JA 2IUEA 3NBKA 3TM4A 4YYEA 3OQNA 2Q8NA 4C07A 4DSUA 2OBNA 1J56A 2OO5A 3HR7A 3J80A 1FSGA 1D2EA 1S2MA 2AOXA 2EEPA 3QSGA 4OHUA 4OQPA 4RZIA 4ZARA 3THYA 2NPFA 4YJFA 2HT1A 3HKBB 1DXOA 3CEAA 4DUGA 1RW4A 4I6EA 4N4AA 2I67A 1T9GS 3SE0A 1UP6A 3AFGA 3AQ4A 3ECCA 2F6RA 3H7IA 2C5AA 4G5SA 1QRUA 5BPFA 3B1FA 4XAQA 1DHRA 4EFDA 1XCJA 2PMKA 3CUTA 1IIBA 1VCNA 2HWUA 1AXGA 2CNLA 3HB0A 2JHAA 4UHFA 5G1OA 5C1IA 1R3UA 2ZUFA 3H0EA 4L4ZA 5T41A 5BOSA 1Z25A 1XU7A 4MUYA 2JLBA 2WF9A 5GAJA 1P1KA 1SQ5A 2EW1A 4G85A 4BVFA 4TV8B 1X9HA 1WKCA 4RK0A 2YN4A 4WXHA 3UG6A 4B47A 4QGBA 1OWNA 1PHPA 5DHSA 3B2EA 2W37A 4ND2A 3W1EA 1AGYA 1Z06A 1X1AA 3WC4A 1LSJA 4DIMA 2WE7A 4OHMA 2Q6TA 1D1SA 1V8ZA 4PF1A 1JPVA 4XDZA 1GGEA 1QHEA 1GTJ1 3DAYA 4I4CA 4DCMA 4OGLA 4OFZA 4EMTA 5IBCA 1T8WA 3AEQB 3OTWA 1XAJA 5ALJA 3OMLA 4MRNA 3M0EA 4FE4A 3DBRA 4OHCA 1RXCA 3K72B 2XMSA 1G3MA 2VF4X 4OCZA 3IAM1 4YALA 1SPXA 2VZ8A 5KPJA 1LDYA 4TS9A 1IXSB 3MNFA 1P4GA 4TWZA 3ZKWA 3EVDA 3CVXA 4JC0A 4B76A 1SIBE 4RPLA 1IM5A 1LTHR 2ECKA 4R31A 1UBGA 2NVWA 1WSAA 4XIFA 3RGWS 1NLMA 3EVEA 1NAHA 1HFEL 1Y5MA 3HXKA 4IHAA 4BV2A 3D4IA 4LECA 1INLA 1BW9A 2G06A 2NYRA 4HLUA 5ALWA 1YZKA 3L8ZA 4MV8A 4F2WA 1NRJB 1T4BA 1S9DA 1B41A 1Z2AA 2JHCA 1AK2A 1SQFA 3B8EA 4RVFA 3USZA 2JCVA 2QVLA 3UB3A 1VBKA 3NVDA 1DDGA 1JMKC 4I9UA 2DYKA 3STYA 2AZXA 1U3GA 3PJEA 5CVJA 4EG5A 3F6CA 3HJAA 4B3HA 3THYB 3D5EA 4BFWA 2WHEA 2JFNA 4YJFB 4EVSA 2XUAA 1V6CA 2B7LA 2E18A 3WE7A 5CITA 3KYCA 3W6NA 1TNDA 2VJDA 3ADDA 1W5FA 3I6ZA 4BNKA 1GU1A 1KTIA 4AU1A 3FUVA 1R8JA 5TPZA 1PJ8A 4A16A 4NZZA 2IWHA 1T5LA 2G0TA 1V7CA 1J8MF 3FPEA 4G5GA 2AA3A 3ISJA 1V3TA 3ITKA 1WZEA 3O90A 4BVKA 2ZRLA 2RKOA 2PGOA 1NUTA 4NZPA 3LGSA 3S70A 2Z9BA 1MA0A 1LDBA 3GFBA 4AG3A 4ETWA 5BOSB 4DG9A 2HQSA 1M2FA 1MC8A 4NY1A 3D6TB 1D09A 4LOAA 3W9YA 4RTSA 5EIAA 1VKHA 4ZRNA 4WCFC 1FTQA 1U3CA 2X8LA 5EA2A 1BKSB 2P9JA 4IIFA 5IMBA 1GKYA 3M9WA 2ZT7A 4NTZA 4RZ3A 4ZRDA 2B35A 1NTRA 3T9EA 3C7CB 3E48A 5KNBD 3COYA 2J9RA 2B99A 1YH3A 1X86B 4MITA 2XMGA 2Q2VA 4PINA 4D9EA 4DW8A 4RESA 5J3JA 3QEOA 3DBRB 3RT7A 3CIFA 1F8YA 2XYRA 4YK7A 2FMIA 1H2HA 3MJEA 4E5YA 3DGEC 4LEIA 2B9EA 1L8LA 3DMFA 4RJ2A 4U2EA 3ZKWB 4BS9A 4A5SA 1CS0A 3S40A 1XR3A 1N5IA 3D59A 3V1TC 1LLDA 1TFRA 1X1DA 5KYKA 3SZUA 3F3YA 1E1MA 1LBSA 3F74A 1PX2A 1ZHHA 1LH0A 1ZJ5A 4HWKA 5F23A 2R1VA 3DKKA 2A2ZA 1OXUA 3TS1A 1LU9A 1H42A 1BW9B 2NN3C 4UBIA 3A7DA 3ZHYA 1N5JA 1U0NA 1GSIA 4IR7A 3VDQA 4IIJA 1WMDA 3VDRA 4JJGA 4LWOA 4ETMA 1R5BA 4QPDA 4Y2PA 4CBVA 4GOKA 4DLUA 5DV9A 3NM4A 2QT0A 3PNVA 1KKUA 2HMSA 2HFKA 2IVFA 3CW8X 3N9IA 3PHBE 4YFVA 4CM1A 3SHTA 3ZIDA 2X9VA 2A9RA 3BHNA 4F0JA 1ZIPA 2IHKA 3KYCB 4TKLA 4B45A 5K2MA 1O58A 2GAFA 2QZZA 4LYDA 4BNMA 2OG2A 4JD5A 1TJYA 1BEZA 4MIKA 5D1HA 2JI6A 1AQ6A 4DPLA 1UAGA 1H0RA 2ECFA 2HJVA 3IOCA 3L7DA 3QWHA 2ODWA 3BB4A 3O4RA 4OATA 1RBQA 4UNIA 5JEEA 2YY6A 5KTRA 2CL6X 1EFPB 5BWCA 5DTQA 4IF4A 1KEKA 1H4SA 3BC1A 5AESA 5K8CA 1VSQA 2C9YA 2VSOA 3HBFA 1V48A 1PWEA 1C0EA 1U2EA 2OGZA 1QK4A 3R75A 3ADKA 2YTZA 3RD5A 4D3XA 5A03A 4BKMA 1ZRSA 3SQDA 4CN8A 4OIFA 3A32A 5T67A 4FYWA 5B1IA 1N3LA 3C3PA 1UM8A 1XDGA 3DCIA 2ZWOA 3DLIA 1A5BB 1E1KA 1HE8B 2FK7A 2QG9A 3QLVA 4R71A 4P83A 2Z6AA 2EAUA 1S2IA 2F9FA 3MCZA 4PZAA 4JBWA 1C9NA 1J8VA 5LMZA 3CVWA 1GTRA 3EPLA 1XI2A 2CV0A 3ZEIA 1N32B 5EHNA 4CLXA 1EKXA 3GP3A 2GPNA 1QE0A 1ZISA 2IK8A 3NIDB 1ZVVA 1VQ1A 2HCRA 1KJQA 2ERCA 3N8DA 1NVWQ 5CG1A 2ZZMA 3R0QA 3ILYA 4L0CA 4BBPA 1CS0B 1D6JA 3ZG6A 2ZT5A 1C0KA 2YJ5A 1C4KA 1V3UA 3JSXA 1ILEA 1WMBA 1SKQA 2R1VB 3OF2A 4DMHA 3BD6A 1O1YA 2ZYIA 1ZQ1A 3N2EA 2VYNA 3QUAA 1HYEA 1UC9A 2FPIA 4GI7A 1JDVA 4JMLA 5JDCC 5A7GA 2BDTA 4LS3A 4HQKA 4CQLA 3MA0A 3BZWA 4IIJB 3ZWCA 3LX8A 1BYUA 1GFZA 2OCDA 3D02A 3KTAA 4HOYA 2O8FA 2X9QA 3S7ZA 4WXYB 5KNCH 3QXXA 3N70A 1E0DA 4BFUA 3GGOA 1ABFA 5EIXA 1KPGA 1ZOPA 3BE8A 3GLIA 3WKAA 5FB3A 4KJXA 4PCAA 1ODJA 4EGSA 3V1LA 2QTZA 2I4NA 3GDFA 1ESCA 3IUNA 4H59A 4Y2HA 4AZSA 1HNWB 3RU2A 3N2IA 3ZJ5A 3EQ8A 4MUXA 1Y5NA 4FMCB 4RZ2A 2PQ6A 4GZMA 2AMYA 2ACEA 2G36A 5JY1A 3AL0C 2QVBA 4JYBA 3CNLA 3KR1A 3W7AA 4XGQA 4A91A 5ALHA 1UIMA 3TECE 3PDHA 4DMMA 1TOAA 4BFVA 3PZRA 3OTOB 4A2WA 4QATA 3SD7A 4IIHA 3HB4X 2YWFA 1USUA 4YMIA 3RIEA 4JLKA 1MRZA 1ZUHA 2R7MA 3M6WA 1PJSA 1OA0A 2CC2A 4MEJA 4Q82A 5LIRA 2WP0A 3U3DA 5FI1B 3AONB 3O8RA 1PGQA 3W5VA 1WA5A 3KQQA 5FP0A 4YAEA 4Q1CA 2PRYA 2IP2A 3C5EA 3TUJC 2PLFA 4EVRA 1CQXA 2C04A 3U0VA 1EXVA 1OLOA 2IUUA 7YASA 5I9IA 2AFIA 3A6HA 1E1LA 4DBLC 5JAPA 4JYZA 1R5OA 3CF4A 5TT0A 1WM1A 3L5KA 3IP5A 1LPSA 3SYNA 3UGKA 4S12A 1Y89A 3O38A 4RJIA 3TRFA 3GJ0A 1QZUA 4ZAVA 1FSSA 1QIJA 2EL9A 1GGMA 1N7JA 1WXEA 2JGRA 4ACBA 1QM5A 1XLTA 4WL0A 1EESA 1IZ8A 4G1MB 3VTAA 4GOMD 4K9QA 2WA2A 4GD3Q 2BTOA 1OBFO 3L1VA 1UMCA 4Q1AA 3OMWA 1LW6E 1O97C 2HWKA 3I1FA 2ZI6A 4E13A 3NVKI 1K4KA 2Q1SA 2FPIB 4I08A 4GMDA 3TMKA 1UQRA 2QMQA 3KJQA 4CQLB 4ZICA 3KTAB 5EIWA 2O8FB 2AOUA 3MXOA 1G7TA 3QPCA 4JASB 4G1VA 2DPGA 2GNOA 3R76A 3I9MA 1K9SA 4M0CA 1JHZA 2QL7A 4P98A 3GLIB 4L9RA 2IS6A 3HA3A 4HVAA 2QVGA 1UJ5A 1GR0A 4DQXA 4ZIRA 3I6YA 1XRMA 1VCHA 5EUQB 1K6EA 3TTTA 4IMIB 3GLGE 2ZE7A 4CF6A 1L4LA 3AM5A 5DN9A 3LOUA 4MRPA 3NDPA 4KLNA 2BMFA 1OWOA 5F73A 5JDIC 4LQ4A 4ND5A 1DRWA 5CAEA 5I4BA 4DLSA 5KQGA 3G7NA 3OUZA 2O2GA 2JEZA 2AI1A 2JAXA 4YR9A 2GPBA 2A0FA 2HSGA 3AJRA 3HB7A 4KITB 5FO0A 2J3LA 2DWOA 4M99A 3WV4A 3N5CA 4G41A 3TK1A 4YRPA 3WIDA 4X00A 1DQZA 3JYLA 4HEA6 5EIHA 3EXG2 2C7BA 1EGAA 5CH5A 1L1QA 1VYHA 3QE3A 2L2QA 1G5FA 5M29A 4RH0A 2EYQA 5G3YA 1K6IA 4LQLA 2AFIB 2W9XA 1EFVA 3IMFA 3N2YA 5JBIA 3U7FB 3CEMA 4KX3A 2W2KA 2GILA 4KC0A 1Z6AA 5E9JA 2Q4BA 2CXNA 3FCCA 2ZBRA 1SBCA 2C83A 2NUAA 2AVNA 3CMCO 3K53A 4WADA 4KIJA 4XFJA 5GV7A 5JJLA 2G9RA 1T8SA 3E03A 4M0FA 1UOQA 2QLTA 1LUAA 1VLZA 3I2YX 5B1DA 2P68A 3UV7A 3IOEA 4BNGA 1SG6A 1E4EA 4O8ZA 3ST7A 3AF6A 2DFKB 3MMZA 3E8MA 3NZEA 3IQWA 4HEA1 3DL4A 3WSVA 5IJXA 5JXGA 5A5DA 1UMCB 2JRLA 1YAHA 2ERYA 1ZNZA 5CM8B 3UJBA 2WQ6A 4L74A 4GEGA 2VHEA 4JGBA 2VT7A 2ZRMA 5KVSA 1YZHA 5C32A 4L8VA 5HVNA 1LXCA 4BKQA 3ZXIA 2AOUB 2PZKA 4RABA 1XTTA 3P9QA 1X87A 1E7MA 1UWVA 3B5IA 4DYHA 4JBYA 4XLTA 2JZNA 3W3ZB 4OQLA 2HXGA 3THSA 3DL2A 3DVLA