3INYA

Crystal structure of human purine nucleoside phosphorylase in complex with 7-deazaguanine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure and molecular dynamics studies of human purine nucleoside phosphorylase complexed with 7-deazaguanine.
pubmed doi rcsb
molecule keywords Purine nucleoside phosphorylase
molecule tags Transferase
source organism Homo sapiens
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3inyA00
1OU4A 1RXSA 2A0YA 1RFGE 2QDKA 3UAXA 1JDTA 1ECPA 4WKBA 1Y6QA 4I2VA 1A9PA 4QARA 5IU6A 1A9OA 4R2WA 1T8SA 1TGVA 3OOEA 1V2HE 1VFNA 4BN0A 4YO8A 3PNPA 3KUKA 1T8WA 3C74A 4PNPA 1CB0A 1NC3A 4DA8A 1Q1GA 3OZDA 3EMVA 1K27A 4LDNA 1Z36A 5B7NA 4GLFA 5JPCA 1JDSA 2QSUA 1A9RA 3FOWA 4PR3A 3BGSA 3OZEA 4LNAA 1PF7E 4TXJA 1RT9A 5F76A 3NM4A 2ON6A 4D98A 1XE3A 1WTAA 2A8YA 4R2XA 2I4TA 1M73E 4UC0A 1OV6A 3GGSA 4TTJA 4E1VA 1YQUA 4QAQA 4TXHA 4WKOA 1Y1QA 4LKRA 3K8QA 5F7JA 1I80A 1Z35A 4LZWA 4OF4A 3EUFA 1VHWA 3UT6A 3KVYA 5I3CA 2ISCA 1YQQA 1K3FA 5CCEA 3PHBE 4D8XA 1Z38A 1V41E 4L0MA 1V3QE 1V45E 3DPSA 1ODLA 1PBNA 1PK7A 2I8AA 4EB8A 3GB9A 5CYFA 1RXYA 4OY3A 3P0EA 3U40A 5F78A 4JWTA 1ODKA 3OCCA 4WKCA 1JDUA 5K1ZA 3FUCA 4OGKA 1U1EA 3OPVA 5C80A 1Y1RA 3SCZA 3KU4A 4G8JA 4LNHA 5F7XA 4L6IA 2AI1A 1PWYE 5B7PA 2HRDA 4GLJA 3DDOA 1YR3A 4OGLA 4X24A 1FXUA 2P4SA 4WKNA 3NM6B 5F77A 1VMKA 3MMSA 1U1FA 4D8VA 1SD1A 4L5AA 1ULBA 4L5YA 1A9SA 3QPBA 3INYA 1Y1TA 3OZCA 5B7GA 5FAKA 3LA8A 3K8OE 4QATA 1RSZA 1SJ9A 1QE5A 1PR1A 4R31A 3ODGA 3BJEA 3P0FA 4JOSA 1JP7A 4F3CA 3OOHA 1Z37A 4DARA 5EPUA 4FFSA 1Z5NA 4YJKA 2AC7A 5EFOA 3BSFA 3IEXA 4F2WA 4NY1A 3PNSA 4F2PA 1B8NA 1JYSA 1V4NA 1RXUA 4TXNA 1PW7A 1TCVA 4BMZA 2OECA 1T8RA 3ENZA 1PR0A 4TS3A 3LBAA 1OTXA 1LV8A 3MB8A 5DK6A 1T8YA 4MCHA 4QFBA 3KHSA 2AI2A 3NBQA 4TYMA 3O4VA 3IOMA 5CXSA 1PR2A 4BMXA 4WKPA 3KVRA 4TTIA 1ZOSA 1A9QA 3UAYA 1VHJA 1NW4A 3FWPA 1A69A 3E9RA 1NC1A 4K6OA 1V48A 2HSWA 4YMLA 5B7QA 4MCIA 3OZBA 1U1GA 1T0UA 1SQ6A 4GMHA 4D9HA 3EEIA 3F8WA 4DA6A 4M1EA 2BSXA 4TXLA 3FAZA 2IQ5A 1CG6A 1JDVA 1OVGA 3DJFA 1Y6RA 1JE1A 1B8OA 3BL6A 1N3IA 2OC9A 3DP9A 1YRYE 1JDZA 3TL6A 4G41A 5KB3A 4F1WA 2H8GA 4H1TA 4NSNA 4MARA 4RJ2A 2A0WA 5ETJA 4G89A 3EUEA 1JE0A 1G2OA 4TS9A 1Y1SA 5F7ZA 3KVVA 1TGYA 5F73A 2AI3A 3DF9A 1K9SA 4QASA 3E9ZA 1Z5PA 3OF3A 4L5CA 3FB1A 4IP0A 1PR5A 1TCUA 1RYZA 2A0XA 4OJTA 1Z39A 1A9TA 3LGSA 4QEZA 4D8YA 4DAEA 1OUMA 4DABA 2B94A 4KN5A 5EUBA 4DA7A 1PK9A 1JPVA 1PR4A 1C3XA 3UAWA 2XRFA 1TD1A 3E0QA 1RXCA 4GKAA 1ZL2A 2RJ3A 1LX7A 1Z5OA 4TTAA 2QTTA 5CCDA 1LVUA 4DA0A 4TXMA 3O6VA 2OC4A 2GUWA 3UAZA 3NM5A 4F3KA 2OXFA 5CYGA 4NS1A 4DANA 2HN9A 3PHCA 1ULAA 3UAVA 1YBFA 2QPLA 1U1DA 1OTYA 4DAOA 4P54A 3FNQA 5IFKA 2PGAA 2Q7OE 4M7WA 4M3NA 3D1VA 1RCTE 4BMYA 3ONVA 4U2KA 4YNBA 3T94A 4JP5A 1SD2A 1PR6A 1RR6A 2QTGA 5F7OA 1ODJA 4OEHA 1Z33A 1U1CA 5CXQA 4EARA 1Z34A 1PKEA 2HWUA 4ECEA 1ODIA
chains in the Genus database with same CATH superfamily
1CIVA 4URFA 4DR3B 2CMFA 3WMXA 3RIXA 2ZSHA 4YMGA 3GEEA 3NBUA 1M2VB 3RG2A 1LK0A 2A35A 1NHWA 5JAUA 3LC1O 1M34A 2OLKA 5H3HA 3PUYA 1T9HA 1BKYA 2Z9CA 5JJLA 2P27A 2PCJA 2J7PD 1S8NA 2X8LA 3V3TA 1PJQA 3AF0A 4RV5A 5ERXA 3NT5A 2C8LA 5E4FA 4EFKA 4MWZA 3PCTA 4R2WA 3OO1A 3CRMA 2CV0A 5DTEA 4OKSA 2BWJA 1SEPA 3IODA 2I4OA 4P2GA 1RWQA 5DM1A 2FRDA 4OMCA 2ZRJA 1HDCA 5EZ5A 4CKEB 5JHGB 4MAFA 4BY9E 2H4XA 3BCRA 3DMYA 2RHJA 2PLNA 1D8TA 1FMTA 3MB5A 3ZE1B 2O8FA 5DIFA 4XQEA 1N1DA 3PBKA 3WYCA 4TV8A 3S2SA 1O77A 3TPFA 1A8IA 1YQDA 3PNPA 1NSYA 4OHOA 4ZZ2A 4OX9B 1H2FA 1EGQA 1UADA 4H1VA 4PNPA 3ZTWA 2I1VB 4C0WA 4F72A 4HWSA 2Z1MA 2GPWA 4A0GA 4M83A 2AOVA 3U81A 1P80A 3RS3A 3QWFA 4Z7NB 4LDNA 2J0VA 3AL2A 3VV3A 4YCAA 2CV1A 4E3ZA 2HHCA 2WWGA 4DLNA 2G70A 4XM0A 4C0XA 1P72A 1MCZA 2G28A 2QSUA 3ZVKA 3DTVD 3NEPX 3HSKA 1WMAA 3GBSA 2F62A 1G21A 4Y6RA 2PGOA 4YRPA 1U8EA 3IUPA 4PG8A 5JIBA 4J4TA 4L2IA 2XBLA 4J1TC 4CMIA 3D2AA 1PV2A 1N5JA 3UV7A 4ZICA 4TXJA 4Q05A 3HC7A 2EEPA 3FFXA 4KB5A 4CKWB 3JALB 1BTOA 3DFUA 3EDQA 3ICPA 3OUZA 2P1RA 1W94A 4IM7A 4AJ1A 2GMWA 3I2YX 3F4LA 4DZZA 1WMFA 2QR5A 3N7TA 1XDWA 1XKLA 2AYZA 2I1LA 4G1EB 4JYCA 3WISA 4AJIA 3NNSA 4RS4A 2A1TR 4FBLA 1YZKA 3OURA 4K9MA 4WCFA 2WM2A 2B9VA 1YRWA 1IEQA 4FXOA 3L7JA 2ZRPA 2VK4A 4BNYA 3GLHE 4Q1FA 1UINA 1ECJA 3K8QA 4PQRA 3I92A 4PQYA 1Q50A 2PAFA 3A6LA 1PJZA 4WT7A 2BEVB 2LKDA 5IC5A 1J24A 3HKCA 1QGOA 5E9AA 2CLDX 2B98A 1H0SA 2DZDA 4QHYA 1DP4A 1YSCA 3GP8A 3ESZA 1G6OA 1SXJD 2GN0A 3QOFA 4UEQA 3T9AA 1Y9JA 1H8HD 3F9IA 4MMZB 2JGMA 3EVGA 2AOWA 1FVFA 5IYZA 1HURA 2QYSA 3O95A 3R76A 2D1RA 3OQPA 1KTIA 5IT0A 2W90A 4PRYA 4CTMA 1J9GA 3E15A 4OI2A 2OMKA 3L0IB 5J23A 2R1TB 2WB2A 1HFJA 1A7JA 3QUSA 1YQQA 1VE7A 5IT4A 4QQFA 4PCAA 1QS0A 1I32A 1IB6A 2CD7A 1P7VA 3N0WA 4F85A 2ZIXA 3NOXA 3WQRA 1ZESA 1WD7A 1V1RA 3HE3A 4DM3A 3C0KA 4DDVA 1O8CA 1YS2X 4UM9D 2MCFA 3DWGA 4KO4S 2OXTA 3GJRA 3BZUA 3VI4B 4H3SA 2ASVA 3QOYA 4Z2AA 3K53A 2G83A 2JFGA 5AKYA 3ZIDA 2Z8YA 1X80B 2B4KA 1HE4A 4M0MA 2J9FB 1QNLA 5LQUA 1JDPA 3ZVNA 4IIGA 5KWVA 3PR1A 1E9RA 5E7JA 2GM4A 1NZDA 3ZQJA 4KIUA 4MQ6A 1U0NA 3NIBA 2D06A 1UDRA 2WI8A 2Z58A 3PGVA 4M1WA 1Y8ZA 3DVSX 1KDVA 4LXQA 4OP3A 4A8JB 3DT6A 3U4MA 5KYVA 1N2CA 2JLBA 5IT5A 1E0AA 1Q0UA 1UBEA 2FMIA 2I34A 3EXEB 4J6EA 2DVMA 3WFZA 1NVEA 1EB8A 5I9TA 3EDOA 2IP1A 4EUNA 2B8WA 4YCBA 3PHLA 3TNFA 4RZQA 5JYBA 3HVRA 2R7NA 3BERA 3HJRA 4C87A 1FW8A 4BQNA 1Z16A 1FYFA 2HU8A 5EJMA 3CX6A 2R1ZA 4A7PA 1RI5A 5KVCA 3ICQB 1C9EA 4BNGA 1PTJC 2JGJA 2C3OA 1SC1A 3NYRA 2Y8EA 4LK3A 4UASA 4R1OA 4U8GA 3C7CB 2J87A 3FGNA 4KXYA 1O6CA 2Q3LA 4TYNA 2QAGA 1CU1A 1PDVA 4GMFA 1QVVA 2YV5A 1NJ1A 3ILVA 1UPUA 2BI8A 4JIMA 4LZOA 2HADA 2OENG 4Z8XA 1ZICA 2XYGA 5F1OA 3QWBA 1PK8A 4EF5A 2XTNA 4G8JA 821PA 4RK1A 1I33A 3V4ZA 3UWSA 1W6UA 2O1WA 1BXRA 1KNQA 3K7EA 4DC0A 4Y6OA 4TVSA 4V0LA 5F7XA 4ABTA 1UBRS 4WJKB 1QG6A 1TZKA 4KPUB 5FUMA 1TVEA 3HU1A 2ZT6A 3I8OA 3PRKE 3B5JA 4OPMA 3KLNA 4U2DA 5IZCC 4ID9A 3ELYA 2H1CA 2REQB 4OOFA 5JCXA 3VYWA 3M6IA 2FPMA 3NOOA 1HZJA 3GUZA 1DQRA 4WLVA 3M2TA 1L5LA 5JAHA 2EGHA 3RU3A 4ZOLB 2DHDA 5AK3A 4WKNA 4GOKA 3MCZA 1AKWA 5EAIA 3MA0A 1RJGA 3ITNA 2QV0A 3KSBC 2D2EA 1DADA 2YC2C 5BN1A 3DZCA 1ULBA 3P2MA 2QMUA 2IUUA 2BDUA 5DM4A 4J43A 3E48A 5C32A 4QSMA 3BAZA 3SYMA 3E3AA 3F4BA 5CLGA 2OHXA 1X8XA 3D8HA 4UBJA 3RE1A 3FXAA 5HJ7A 1QAQA 3JW8A 4TZKA 2ZTVA 3D81A 4LZAA 1QV7A 1BO6A 3RYFA 4CEJA 3LYHA 3AF2A 3PXEA 2JARA 5JEEA 2PL9A 4MRAA 4FW8A 4P4UA 1ES9A 4QREA 2Y4OA 3TQHA 1E6EA 1TMKA 4MO9A 4E6PA 3PXXA 4RY9A 4KR2A 2DUUA 3ETDA 4ZZ0A 5KYUA 4H17A 4YMIA 1TAUA 1G8JA 4WK2B 5KNBH 1KIMA 3DBVO 2EATA 4D6YA 3A3PA 2ZBGA 4KN6A 4IIXA 1UANA 4O08A 1JJVA 1XO1A 4Q4HB 2F9FA 4XOUA 3I1IA 3H5AA 6Q21A 3O9VA 3R0VA 3WLQA 5LQKA 4R9SA 2HMSA 4IXWA 5FNZA 1BC5A 3CB2A 4EELA 3H2YA 5KU7A 3VVBA 1G8PA 3AM1A 2PMWB 4WRRA 4I7EA 4D8TA 5HKAA 4DV5B 4LXXA 4OLHA 1GRCA 3QHPA 3WZLA 2JIZD 2ZAIA 1ZAYA 1V6CA 3RYHA 1ZC4A 1TYBE 3L0PA 2FYTA 2OCKA 4O0LA 1NQAO 5AOAA 3VSAA 4E15A 4ZJZA 4GD3Q 4BECA 1UKVY 3ST7A 3VNBA 2VHXA 3HJBA 3U3JA 3QFSA 2BFOA 4J9VA 2XIJA 1NPDA 3EZGA 5FOXA 3IOYA 2RI1A 3FYCA 1RHQA 1X8KA 3FOAA 2J6HA 4PSVA 3Q7RA 1ZN8A 1QHSA 1GYPA 4LRSB 3GCWA 5F1PA 3VKVA 2ZBRA 4XYLA 4JP3A 1M10A 4OGGA 1ZY2A 3RWOA 4I50B 2WHEA 1XZIA 4H0FA 3ITDA 2IYRA 4DE5A 1OTXA 1XHEA 1IBCA 1W85A 2A5JA 1OIVA 1ZM7A 4BDTA 4MCHA 2WWYA 4FSHA 2AI2A 2GBFA 4X94A 1J0BA 2J09A 1DQYA 1I1HA 4FKBA 4IDBA 4P93A 4ARVA 4DCNA 4EFMA 5FOUA 5IWCA 1CUWA 2O4UX 4K28A 5KYKA 4AMGA 4WSOA 4HX5A 3DLHA 3PXBA 2ZUWA 3M2PA 3FCXA 3LPAA 2G9QA 3O4VA 3OY2A 3ZHTA 4EI8A 2WTUA 5KSYA 3M6WA 3UY4A 4TN1A 1X86B 2ODPA 4MJ7A 1NXVA 2JGLA 2Q6OA 1ZOSA 2IW3A 1ZDMA 3GPCA 3NTOA 5EZSA 3V5NA 4KVZA 3K9FC 3NGMA 3D4BA 3A9CA 2FP4B 4J1QA 4EA6A 4BP9A 1VKRA 2C04A 4RZSA 1S6YA 3RIGA 1G4HA 5K8TA 3OZGA 2V59A 3T35A 3FUWA 2EP7A 3ILXA 13PKA 3OIUA 2KB0A 4P4NA 4Q5IA 4Y1RB 4BS9A 4GMGA 2HRZA 4F86A 1A7AA 3D6TB 3S8EA 2AQ8A 5AIAA 4F9FA 3J81k 3HDJA 1UWKA 5IX8A 4BNFA 4OQNA 1U1GA 2VC2B 2XQJA 3JVIA 3TOZA 4XWTA 5DLQC 5EA2A 3QVOA 4ZTZB 1XHLA 3EEIA 3UXYA 3CZAA 2XQKA 3OAAD 2WEKA 4CJXA 1HX7A 3ENQA 3NUGA 4O2AB 2CLLB 4G0ZA 1C3EA 2BKEA 4JX9A 3RUDA 2JLZA 4JV5B 4OBXA 2QQ5A 3W1EA 3HJFA 5TQ2A 2FWPA 3S29A 1TLTA 2Q1TA 3BXPA 4QFCA 2V0CA 1KAQA 1T36A 3HJUA 4I4TA 4E13A 4DG9A 1YZLA 2G67A 4LDZA 5EIXA 2VQ3A 2W2PA 2DBQA 4OYHA 3S28A 1P8AA 1YR6A 2UAGA 2MYPA 4CM3A 4XB6B 1U7OA 3I5UA 3CY6A 2BCJQ 3QITA 5CDGA 1D6NA 1JDZA 2Q5JA 1G20B 3C3DA 3JR3A 4RORA 4JNCA 2OBXA 2PNFA 3SEFA 2QR3A 3F47A 1KI6A 4QTUB 4U2EA 4BX0A 3MINA 1SA0A 5I4KA 1B93A 1NQOA 5K3DA 3FVWA 2IXTA 3OZSA 3M82A 4ZVNA 4K46A 2D6FA 1DBQA 2Z9BA 3A1TA 3SVLA 1XDSA 1XTSA 1WZIA 3JR7A 2FDXA 3EIEA 5E1DA 3VVCA 3O8RA 1WETA 4D42A 5I6DA 3NPAA 1NQWA 5H59A 4BNMA 4EZBA 2YHSA 3DOUA 4US1R 2JHGA 4F4FA 4OHMA 3MCWA 1AQUA 3F8SA 3LDHA 4HC4A 5ISMA 2DPLA 5I01A 5MFPA 4NYMR 2GARA 5IVPA 1FDVA 4URUR 1GZ6A 2VDJA 4KODA 1IPHA 4P4SB 1RRFA 1T29A 2W4MA 2P2CA 2XRMA 3HN2A 5JCJA 1K9SA 3R6DA 4LSMA 1NBOA 3UB3A 4D97A 3QKTA 2ZIGA 4QASA 3BL5A 1M6NA 3HCDA 2E85A 2VXOA 3BIFA 1O9BA 3OD5A 4MQFB 4JN6B 4NCHA 2OILA 4J3FA 4P81A 1P31A 1PSZA 1U5AA 3B1JA 3F97A 3G79A 2C9BA 2CUZA 2WBLC 3K2BA 3O3NB 4IQFA 1RMTA 2PXXA 3GBPA 1IWBB 1WHTB 2A33A 3KYCB 1SKUA 4PV7A 1XUOA 2O0KA 2OCIA 3GJ0A 2RHTA 4HI0E 4MQUA 1EWKA 2AQHA 2HSGA 3HZRA 3P4UA 3TEFA 1O6BA 3GRKA 4RCZA 4UHJA 1PIWA 2IOFK 1XRPA 3DXFA 4XIFA 5TY0A 3I42A 4NJEB 1UC4B 3G6KA 5ED0A 3GPDG 1TQ4A 1PK9A 3E9DA 3QLVA 1DLIA 1QHNA 2XUGA 1J4AA 5AVJA 1JPVA 4YREA 1GAQA 1NSFA 5CTAA 5F4BA 4PPYA 2Y0EA 3KT6A 1W2HA 3P96A 4LJ7A 2H9IA 3HI6A 3EGWA 2HDWA 3AVTA 1D4OA 3VSDA 3IMGA 3TR6A 4O29A 1YFLA 1JFFA 1E1LA 3TRHA 3ECAA 3RF6A 2CXHA 3B3JA 4CMEA 1XMVA 5LOVA 4DR2B 2VDMB 3FVTA 3UICA 1NUHA 1PZGA 3L4BA 1PX0A 1V6AA 2MOKA 3GY0A 4TVOA 3QPCA 4NZZA 2WWVD 5KQMA 1CJBA 3E7FA 2OHOA 1DXHA 4Y6QA 5K3AA 3TL2A 5EXDA 1RI2A 5G1OA 4O63O 1NR1A 2VJQA 3IJ5A 5AJWA 4CIYA 2QUIA 3V33A 1CTQA 1U5CA 3H83A 3DLAA 4L50A 1DHTA 5EY5B 1Z4JA 1HG0A 2H7VA 4DR7B 1VKNA 3IP8A 1NIPA 2I8LA 3K05A 4OU4A 3EGDB 5IVDA 2IU0A 3BTVA 1LK5A 3MBIA 2IIQA 2OEPA 3IRUA 3FOBA 1K8XB 1QCYA 3A4LA 4EGAA 4YY3B 3X44A 5K0BA 4IEFB 2QPLA 2C1ZA 4F4UA 4GE0A 3GZNA 4EHFA 4X1OA 1S2NA 3H3FA 4UEKA 1QJCA 1XX6A 1SHJA 5ALXA 3C3CA 3CLUD 1TVMA 4RACA 4EHNA 1APBA 2G5GX 2WIGA 2QTCA 4M3NA 1BFUA 1PJTA 1ZLYA 2V9CA 4N18A 4ISCA 4E5DA 4QUEA 2Z30A 3DM5A 4OHBA 1SZJG 2L18A 2QTAA 4L0QA 3SQOA 1K66A 5K8VA 1RLUA 4UEJA 1ZM9A 1U2DA 3HFRA 2WVAA 1RR6A 3QUTA 2FUCA 3WA6A 3MMZA 3TMKA 4B44A 1RBQA 1RLTA 5DOVA 1FUKA 5TPZD 4ZGBA 2HJWA 1CLUA 2RKWA 3FB4A 4RTPA 5JS8A 1JEOA 1UXJA 3FH0A 3TG8A 5C1IA 4F56A 1DKRA 5B3LA 5JW6A 2FVXA 2H0QA 3SDSA 1OX6A 1MAVA 2QZJA 3SC3A 4XIYA 1IBSA 2ZRBA 1FFXA 4UREA 3IVMA 3TBKA 3VYVA 4UUOA 4C4RA 4HFJA 3R3WA 1CQXA 1NUSA 2JAPA 2D3WA 1HETA 1H2ZA 2FSHA 2Z83A 3F4KA 3QBJA 1NWHA 4BVFA 1NJ2A 1WOYA 5CEFA 4ZOEA 3KQHA 1IHPA 2J59A 1IEWA 3K1AB 3V42A 1Z06A 4JI2B 4ARSA 1OQAA 1NBHA 2XVYA 3ZGLA 2WAYA 3QVTA 1VHQA 1P61B 3OX2A 3CSUA 5CT6A 4A1FA 3LBHA 4YRAA 2B4TO 2RJOA 3AP3A 4Z9AA 5KTPA 2CDRA 3IPYA 2I6TA 1BVRA 5SICE 3Q41A 1XNGA 2R00A 3WZMA 3B7GA 1DWOA 1G3IA 2FW6A 3ORSA 4XTCS 2J45A 5B58T 3KFVA 4EHDA 2I80A 3M34A 5DNUA 3S6JA 2YY5A 4IJ5A 2QIOA 4CGZA 3HTXA 1XJ5A 1IY2A 3Q3IA 2C9CA 4X1IB 3K4HA 1GLNA 3UEOA 2C61A 4BMNA 5DYYA 4FD2A 1NXOA 4DSTA 4OG2A 3ZY2A 4PLTA 2O8CA 2EX0A 3FD8A 2Q6KA 3QUCA 1WVMA 1PUXA 2HA4A 1UBUS 2ORWA 2QSJA 2Z09A 4KE7A 3Q6NA 2K4MA 1GSOA 4MS3B 1PVVA 4I4NA 1VE6A 4PAGA 4Q7MB 4BMDA 4L4UA 1HSOA 5IAOA 4LE0A 1DAEA 5ALYA 3WAGA 5F2KA 1OYOA 2RHHA 4GLOA 4NEQA 1XCLA 3FTFA 2LRHA 4KL8S 3HO6A 3NEJA 3VPHA 1DUVG 3VXKA 4CQMA 2Q2VA 1PV4A 3FOWA 1TIKA 4AZVA 3VR6A 2B4AA 4MPDA 4RNCA 2XTJA 2J46A 4JBLA 1NVTA 4URVR 2IZOA 4HT3B 1UBNA 2NUPA 1S1MA 4H6VA 4X3CA 4EJSC 4ZDJA 1VL8A 4Y6SA 1KR2A 1QV9A 1AB6A 2DFNA 1A5SB 4H7DA 1GLVA 1CP3A 4C30A 2F55A 4HGZA 4QJ3A 1Q1QA 3SHVA 3ERCA 1L5OA 2VI5A 2OAQ1 2ZSUA 1EVYA 4ZYZA 2WAOA 4MVYA 1P7WA 1XSEA 3OEED 4M8IA 3M33A 3LUPA 5KOJA 4TMFA 7MDHA 5AXAA 1H2YA 2MSNA 5LPNA 4UVDA 2OQIA 2W6JD 2EBUA 1BRMA 4DRXB 4TTQA 1AQJA 4QAQA 2BEUB 3LX4A 4M0EA 1SPBS 3P0IA 2CLEB 1Q21A 2AGVA 4PXSA 5IVKA 1XWFA 4G1BA 1M0WA 2WJ3A 3GD5A 2Z04A 4DJTA 3OKCA 3VNQA 4KJZA 1XZMA 3VU9A 4ZOCA 1EXVA 3UAGA 3CLHA 3HXOA 2WIBA 1S2OA 1WZEA 1U2ZA 1WHSA 3CZ5A 3IXQA 4L4XA 1E5TA 5ULLA 3PWKA 4C7VA 5IDWA 5JZSA 3EUFA 2NU8A 2IVFA 1V43A 1B6GA 1HDGO 2GO7A 3AR3A 3DKIA 2WWXA 2PZBA 3ABOB 2HHHB 4G56A 5AW3A 1KP3A 2X42A 2RK6A 2P69A 2AKEA 4WK6A 5GP1A 4AF7A 3NWBA 3I58A 3LQQA 3OJCA 2IIBA 2PJRA 1SC9A 4BAUA 1SBCA 2BDTA 5JDCA 2X14A 1NHGA 1Y7PA 4ZV7A 1XEXB 2CMKA 3PUZA 2HWWA 3SBEA 2FMXA 5DGIA 3OQHA 4GF5A 5CD1A 3E22B 1XG5A 5B6IA 4NCAA 5FBLB 3NWJA 4KAXA 3EXG2 4JJKA 1F17A 1D0IA 3RBAA 1KZ7B 3FDIA 3EVZA 1R8XA 3UGQA 1OZFA 1RI4A 3T9FA 4OHKA 4HP8A 5CU7A 4N7MA 3E7XA 2ZM5A 3DF7A 3IE1A 2PPVA 4H08A 1H8EA 1N9KA 1X7WB 1D07A 4XUGB 3SHOA 1EWTA 3AX6A 1J2TA 3RK0A 4KGZA 5K1ZA 2REBA 4B40A 2ZB3A 1Y3IA 2Y1XA 1QKKA 3L6UA 4LY6A 4XM2A 2C4VA 3MC1A 1ZH0A 3N1UA 4IWYA 4OQMA 3D3WA 1A7KA 1KEPA 3NDPA 3L6EA 1RQLA 1YQXA 2PYDA 2O7QA 1BYUA 1UM8A 2BLNA 3IQWA 2NV2B 3I1FA 3OD1A 3PDHA 5DNEA 2DECA 1GZSA 1XNQB 3T34A 3KKNA 4UTXA 1ZJ4A 1ZAKA 3MW8A 4Y7DA 3FTCA 2Q3HA 2EZTA 1DNPA 1XK7A 1E2FA 2EW2A 5GINE 4AAYA 4MWDA 3OQBA 4ZOLF 4YCLA 1BQEA 1NKTA 1QF7A 4MQMA 3Q5GA 4NNOA 3ZZMA 2ZCJA 2I91A 1YFKA 1NMYA 1VL6A 1F60A 3ENNA 4WLNA 3RVLA 1RAIA 2QI9F 5SV2A 4PAWA 3WP0A 2BP7B 3NBMA 3ADPA 4X1YB 1GRVA 2YWCA 4GQAA 4EKIA 3KKMA 3NTUA 5FOVA 4ZU6X 2QRMA 4GX1A 3T61A 3RADC 4OGLA 3S7ZA 3DLBA 3WYEA 1DC3A 3CLTC 3N2EA 1NW3A 4MDHA 4YA6A 3TK1A 4DV4B 2ANBA 2D0OB 2Y67A 3WDLA 4B76A 1C1DA 1ZBQA 5CNJA 4BMSA 4XSHA 3N3AC 5ILQA 5BSHA 2VZ0A 3ME5A 3NIFB 3RG8A 5SZJA 3QPBA 4NDNE 3HB1A 5A4KA 3R3VA 4D4JA 3OQNA 5E2BA 2V5UA 4GWLA 3OZCA 4YUZA 2HR1A 1CIPA 2JIPA 1S4MA 2ARKA 2EBHX 2Y4NA 4G63A 3I9LA 1T43A 3PK0A 3QKRA 3T7DA 2NZJA 6CHYA 3OICA 2AWOA 3IR5A 4JA0A 2X5OA 1YDGA 3IERA 3C4QA 4PX2A 1GILA 1M6VA 1IZZA 2AS0A 2ATCA 2YICA 5CURA 3F5FA 5SYAA 2QD5A 1DGQA 2CXOA 2CY0A 3P9IA 1Z2DA 3JSAA 3OOHA 2JEZA 1GPNA 1XXHB 5KYGA 3LBYA 5IBCA 1IK4A 2BUBA 1ZP6A 3D4LA 4XQCA 3RV4A 1EMDA 2VHCA 5EPUA 1RHRA 4NJMB 5ITSA 1ULHA 4F92B 5FWXA 1KYTA 1ZI9A 5FDFA 1C7EA 1YFZA 5T8KA 3GQBA 5DHPA 4NHEA 5BSEA 4FYKA 4B75A 1T13A 2YDXA 621PA 2QN7A 3U7HB 3PL1A 4F2WA 1Q95A 2O8EA 3HB7A 1FFAA 1NG9A 3A9VA 3ZDCA 4XPIB 3QKSB 1QC5B 2OBBA 2HMYB 3SGLA 3RW9A 3T5TA 2WJYA 4JYMA 3DGFC 2J3HA 3BK2A 4EKDA 1PW7A 1PD1A 3CVUA 1SCUA 1NF9A 4A9AA 4S35A 3JQ6A 2HCRA 1HYHA 5EJIA 4MKIA 1NVBA 1PUJA 1CY1A 1I4OA 4L1KA 1D7AA 2ZGVA 1NUAA 3RANA 4HLDA 4ZC1A 3IVGA 4BEVA 1QMPA 3ZG6A 4RDCA 4G01B 3DTVA 1VTKA 5K4GA 1LX6A 2PUCA 2H7CA 3QY0A 2Y92A 3CF4G 1JR4A 2PV7A 2XZTA 5C5IA 4TYMA 3LX8A 1M2JA 3KDSE 4Q9JA 5HPYB 2JLCA 2HLPA 1DKUA 4UUPA 1UDCA 2BFNA 3HG7A 3ICWA 3L6OO 2W7TA 1S3IA 3LBNA 4R9UC 4RVNA 2G63A 1MEEA 3OZUA 5A5VA 5DISB 5AR1A 4TTPA 1WTCA 3RFCA 1W76A 4Q0MA 1MC4A 4H3VA 4TTIA 5G4KB 3V48A 2EFHB 3CN7A 1FUEA 3JARA 3L82B 1J25A 3LFTA 1P1JA 2H4ZA 1JX6A 3TLEA 1QTIA 4YASA 3ANLA 5BYBA 5E1MA 3TLJA 5CH5A 2WILA 4JT8A 4O2AF 3BQMB 4UVGA 2D74A 2W83A 4KSCA 1WY5A 4YRTA 3ZU4A 4AKEA 1HNWB 4N9QA 2IF0A 2BR3A 5H16A 2J31A 4ILEA 4JMLA 3SZOA 2V65A 3HBJA 3K6KA 4UBKA 4WDQA 4W5OA 3II6X 3K6JA 1JA0A 3AFOA 4IUBS 4J0KA 3KZVA 1SXJA 1SG9A 2XB8A 4ZDWA 3GD7A 1IY9A 3FTPA 4RH1A 1NVVQ 2GK4A 3DBLA 5I3ZA 2JB9A 3RR2A 4FGSA 5EWLA 3PC4A 3BDVA 1ZIOA 4EENA 1QF9A 2HCTA 1ZCAA 4PHFA 5E9JA 4K9RA 2PD6A 1L5VA 1VHLA 2RB5A 3L7IA 3OHSX 2JA1A 1VSBA 4HDSB 4RKYA 4MINA 1E58A 1KEEB 2V3CC 1H42A 1JHOA 3U62A 5A4MS 1HE5A 1MC1A 3WQHA 2XYRA 1EFCA 1P1FA 1DARA 1QB7A 1WW2A 1NYTA 4FFRA 4JR2A 1PZNA 2JD1A 3TPZA 3EGOA 5LZ5A 3GRUA 2PUAA 3PE3A 3UOWA 3AR6A 2QLJA 3ONDA 4MV3A 4N6NA 4B8ZA 3R5KA 1ZN9A 1K97A 2X9NA 2NN3C 3D02A 3IDAA 3R3JA 4IH1A 2GZDA 1IZ0A 1J21A 2HUPA 4QU5A 2YIJA 1VM6A 4UUNA 3TL6A 1EKXA 3ZDFA 3LBFA 3LMKA 1RQNA 3HXQA 2EJWA 5K4HA 3R6LA 4EIWA 4WXRA 3REQB 1QRSA 4NSNA 4WN9A 2JJYA 3RVBA 3X1DA 2Q3JA 1RD4A 4TT8A 2P65A 1QQ5A 2BGRA 1NVGA 4YO7A 1P2VA 1A27A 3FMOB 2E5WA 4RPJA 3CJQA 1NR5A 1U7ZA 1Y4AE 4DY6A 4QUHA 2BRUC 5JXGA 5HNKA 5KNCD 2I66A 4WY2A 5SYMA 2FAXA 2GHRA 3ILHA 3NHJA 4I1RA 4AY5A 2XA1A 1NSTA 2A30A 4JITA 1ISJA 4LF8B 3FFAA 2ZRIA 4YVFA 4K6KA 3ASVA 4C4SA 2I6UA 3MBKA 4MW5A 3NAGA 2WKWA 1YIOA 1KMHB 2NVUA 4PLZA 4EVRA 1CFZA 3KYBA 3P9CA 4DUYB 4IX9A 4KGVA 3BF8A 4C78A 5IAEA 5D6NA 3N87A 4F1JA 4EQ6B 1SBQA 1V47A 3AZQA 4JP2A 4CIAA 4ZT4A 4EB0A 3OZVA 2GN6A 3KRTA 5DK4A 1ONNA 1A0OA 4L8FA 3MWLA 2AMJA 1EVZA 3ZNPA 2VHJA 1MABB 2QV7A 1TM7E 3WKDA 2IA5A 1E62A 4C89A 5CFPA 5JAOA 2ZU0C 5KNCH 3F49S 3AKZA 3Q85A 2AHRA 4YXWA 3B3QA 2CFCA 4PNHA 4YRRA 2ZOSA 4YRLA 4RFSA 5HIMA 4B3BA 3KZXA 1RP7A 1SCIA 1VCMA 2EIXA 3F9RA 3V1KA 1QQBA 3O2QB 4GPBA 4ENQA 4M1KA 1Y7HA 4WOJA 4MPRA 5KC8A 2NW6A 4EDFA 2SICE 4TGLA 5FLYA 3SQNA 5DNWA 1F12A 5HUJA 2D4HA 1VA5A 4TUYB 1O2DA 5ALHA 2ZBPA 3UAWA 4MRRA 1YZVA 4IDDA 5JD6A 4AJ2A 2BM1A 2XF2A 3EISA 2QL5A 3QEMB 3RU9A 3SLRA 1YCDA 4FS3A 2YW2A 5L3RA 4BU1A 1I13A 3PGLA 3DHEA 1GL9B 2QTTA 3BN3A 3U4CA 5P8WA 1AXGA 3DZBA 1P7YA 3V1YA 2YZ2A 4BQEA 2O6LA 4G9EA 4IBOA 3SZ3A 2RDMA 3T1QA 1NW5A 4EG7A 2AUMA 2ZT5A 1TKRA 4ZT3A 2GUWA 2XSZD 3B52X 3C41J 2G7MC 4LPKA 4TLBA 2VHWA 1Z4KA 3N74A 1K63A 2AXQA 5LP6C 4G1CA 2M6LA 5F64A 4F3KA 2JPDA 5E4JA 1IUPA 1BWRA 2XQFA 4ER0A 3QU5A 4QDZA 3N8GA 1FXWA 1OHHD 4GAEA 1ACLA 1PNOA 1JHRA 2HSDA 3O75A 1UBJS 1AKRA 2GEDA 3ETGA 5D1NA 5IUJC 1K4MA 2EARA 2P7IA 4PCVA 1NBME 5AW6A 1YE5A 1K6MA 2CJXA 3D3KA 2X0RA 1SHUX 4FGWA 4F4CA 2CV2A 1QIMA 2WYWA 1TT5B 3U44A 1P0IA 2JIZA 2VF7A 3RHSA 3ISVA 2GEFA 5IFKA 3WO0A 3Q8KA 4YRNA 4I4LA 1JLLA 3CH5A 3FFWA 4PSKA 3Q8WA 4DYHA 4HDKB 1YNSA 2OXRA 3Q8XB 4CFYA 1L3IA 3SHQA 1TLLA 4MWGA 4X5OA 1JMKC 1Q91A 1PQYA 2GZMA 5FQOA 1AM4D 5ARCA 1K7YA 2FEKA 3QVGB 3WK4A 4ZIRA 2JI4A 4ZAXA 1N3YA 1XN1A 1HQCA 4UHFA 1GSAA 3GCXA 2P78A 1VG9B 4NZPA 5BV8A 1J8YF 2WP0A 1UJ6A 2PE5A 2XB4A 4A2WA 3A36A 4MV1A 1YOVB 4LCJA 5FTLA 1Z25A 4L72A 5ALOA 3BL8A 4GOND 1P6QA 4M8NE 1I1QB 4DYVA 5DF1A 3U16A 2GWHA 3B36A 3WL6A 4IQ0A 1JR3A 3B20A 5LU9A 4YJ3B 1PJ8A 3RYCB 4U5XA 2UZ4A 2WUEA 2VNJA 1JDTA 3V2GA 4LECA 4R1NA 4EW2A 3KZKA 4P53A 1XROA 3FZQA 4X6XA 3WLIA 2C7QA 1UAYA 1VL5A 1SC6A 2ROQA 4AY6A 4C9BA 4DLXA 2JJMA 4DEVA 3OJFA 1YJBA 4P35A 1GTMA 1R5JA 2XT9A 4XRRA 3D6NB 2Z4SA 5E0KB 4YIKA 2H1FA 3O8OB 3RSLA 1W4BA 2BTQB 1V2GA 2BM8A 5DGTA 1GGKA 2D00A 2BCEA 4OAQA 3RIHA 2ECOA 2G72A 2EKBA 2E1RA 1BX3A 2R4QA 2AD1A 3RI3A 2GFIA 4UHDA 5GJBA 4RE5A 1W4CA 2VNHA 1RMQA 3GRAA 1MB2A 3UJAA 3W34A 1ZOLA 4NK4A 4JP1A 4JXKA 4P3YA 4J16C 2QHXA 3N39C 3BH6A 4TLMB 1NW6A 2IELA 3NJ4A 3W5UA 2CSXA 1TO1E 4DZRA 1K68A 3U09A 1S7CA 3AU8A 4BE4A 3O3OB 4GM1A 5EXSA 3W7VA 1TU0A 2ZE6A 4MYRA 2H51A 3SD7A 3SSMA 2Q28A 3UTDA 5K0TA 2C0QA 1UP6A 5DM0A 1WUIS 3ZBUA 1KOJA 2QLLA 5IDQA 4KDRA 2XAAA 3EA0A 1B7GO 1BHJA 1IB0A 5FBKA 4JROA 4GVPA 2JF0A 2MWMA 5C37A 1R0ZA 1JJBA 2FP3A 8ATCA 1BDHA 2L17A 1WRBA 2OPHA 3VR4A 1PNVA 3EF3A 3LQYA 2REXB 1QHYA 3OZEA 1TZJA 1U8AA 3BDIA 2H59A 4RDXA 2C8KA 3H5TA 1JMYA 2ZVQX 3ESCA 2VZ9A 5AM2A 5CVCA 4V0RA 2OVBA 3WB9A 2EWWA 5K03A 1PEKE 2C03A 1P4JA 3PPXA 4DCJA 5BR1A 2YXBA 5D85A 3LWBA 5BOVA 3UJ7A 5KHLB 2Q5LA 1D0SA 3VYSB 2B1QA 5TDHA 5J58A 1Q84A 2AG1A 2X8BA 1OTHA 3GYBA 4UZFA 1DINA 1UBLS 3IBSA 5DBOA 4E5VA 1XPOA 3ROQA 4LHSA 4X66B 3N2NA 4WNYA 5A0FA 4FFBA 4MA5A 4YRZA 4PYLA 1H0KA 1PJBA 2R6CA 4B6RA 2XGMA 4UEWA 5K3EA 2IS1A 3KB1A 2ST1A 5F7JA 1U9ZA 1Z35A 4LTDA 3FZYA 1K5GA 2QQGA 1DIAA 1G55A 2OV3A 3DMRA 1XL0A 3WOHA 1BOFA 3WO1A 4KHPB 2CXUA 5PGMA 1TX4B 1W36C 3VOSA 4AUKA 1PJSA 3Q9LA 4PX9A 3WJAA 1CZOA 1KMIY 1LSOA 3Q87B 4KLNA 5ALGA 1S2LA 1KKMA 1T4DA 5ITZB 2X1MA 2Y66A 3I4FA 3F7TA 3PC8C 1YZUA 4FMPA 4TTVA 1LBSA 4IV0A 3JQDA 4Q4AB 5FXMA 3MFYA 1JQ5A 3AESB 1QTNA 1YGYA 2QZZA 5BT8A 4ETNA 4G0UA 4L5JA 3CKLA 2Y71A 1GTZA 1V3QE 4QFMA 5FTKA 4LX8A 4IIDA 4CM9D 4BNTA 4I36A 4J1SA 2FWRA 4Z5XA 3DPSA 2RHRA 2RC6A 1UM9A 1EH5A 2W6ID 3JTMA 3S2FA 3WGYA 2HZ7A 4BWYA 1L5FA 2SNIE 1WNTA 5CG1A 4BKPA 4MB2A 3IALA 3RUCA 4HNVA 1ZONA 1WCYA 1KZ1A 1RLIA 1US8B 5G0VA 4EAQA 4E6EA 4HPWA 4C43A 2W2TA 1JEQA 3SJUA 3U4QA 1OX4B 4ZO4A 1G4UR 4KI0A 3I61A 3HYNA 1Q1ZA 4OKIA 3C97A 3FSGA 3L0DA 4LSWA 3DAOA 1BSVA 1RXYA 4F6LA 1NYLA 3KG2A 4G8BA 3ZR4B 5I45A 1BKSB 1K8RA 2I78A 2X2PA 1MF7A 1UC9A 3FGZA 2ID9A 2ZVPX 3M1AA 4Q02A 4WZBA 5EZYF 1ABFA 3HR8A 4HRYA 3S99A 1T26A 4B9EA 4ARZA 5DI3A 3V4SA 1HTTA 1Z7EA 3B12A 1KRXA 3NP7A 1B2RA 1DTSA 4XCXA 1H6CA 3EXIB 4KO8A 4LA4A 1B4DA 4D4LA 1KGDA 2EVWX 2YVAA 3BGVA 3E9CA 1V11B 2GPAA 4BLVA 4JI8B 4MGYR 5EHGA 5EWMB 3K20A 3V6MA 4EKNB 4EPWA 1Q1BA 2AE1A 3W8RA 3OPVA 5A4AA 4O4LB 1G2PA 5EJAA 4QQRA 5TEWA 3OJWA 4ZV9A 4A27A 4IIBA 5I7VA 1IJFA 2GBLC 1WXIA 2Q5IA 1J0DA 4XCVA 1ZGHA 1E98A 5G40A 4EQZA 3BFXA 2WQZA 4ND3A 3GRZA 3HCFA 3ER9A 1BN6A 3EMDA 5CVJA 1H2HA 2AF4C 1V35A 2DUJA 3K9LA 4PG7A 4R81A 3QX7A 2IWHA 3TKLA 4GT1A 1E99A 2QM3A 2VQDA 3EIXA 3F6YA 4ESEA 4LF9B 3K0KA 3CM0A 2QYTA 1VGRA 1L7NA 1XF9A 3BZWA 1F1JA 4NECA 4R54A 4NARA 4UBNA 1KY5A 3RHZA 4DV3B 4KLRA 2VRBA 3Q98A 1D2HA 2JEYA 1C4WA 1DEHA 3ZOZA 2AMYA 1ESEA 1GZUA 1WZUA 2V7BA 1BEUB 3PLNA 5LBIA 1R8SA 4QPDA 2J3LA 1AU9A 1DRJA 4F21A 4F3NA 1NX6A 3I6QA 2XWSA 5F77A 4CMAA 1M3SA 1U80A 4BVKA 4UNIA 1K2WA 1G60A 3GJ7A 4N0QA 2ID4A 5TPZA 4D43A 2ESRA 1GR1A 3UK2A 4HNTA 1GCOA 1IOWA 3DHVA 3QVJA 4S1PA 3AKCA 2NUTA 1IG0A 5C81A 1T15A 3N0RA 2FOXA 4FQ7A 1EDEA 2FSFA 4KQMA 4B0OA 2P8JA 9GPBA 1R4NB 4W5QA 2FFHA 2HQ1A 1YZFA 4GGPA 1CEQA 1GL6A 2DC1A 1M1NA 2ZJ4A 1Q7TA 4KRXA 3H18A 4HRVA 1VGQA 1LW6E 4KC0A 5LP1A 1PR1A 2I87A 4L9AA 5LYYA 4BVJA 3RT1A 3EWSA 3KT8A 1AZSC 2H54A 5DSXA 1Y8AA 1VG1A 4JQYA 2QYHA 2C7RA 5EUCA 2CBGA 3CE9A 2GJ9A 3G9QA 4QYTA 1JKJB 1V3VA 1WMDA 5HF9A 3SMVA 1NN0A 1EU1A 2YJ6A 3GEDA 4AJLA 4RMGA 1P9NA 4BHTA 2YL2A 4BLTA 5KWJA 5TX7A 4OM8A 2CK3D 2QJTA 2LUOA 4LZZA 3T9DA 1X15A 3UW3A 5AKKA 4NV0A 1V16A 1W8IA 2GZ3A 4V3CA 2B20A 4Y9DA 2ICAA 1WKCA 3UHFA 5HS6A 3AXTA 1BJTA 2B61A 4DCVA 4ZKDA 2UXCB 3MUFA 2VO1A 4BV3A 1QFZA 2A0KA 3BTUA 4HR7A 4DIUA 4ZDIA 4E21A 4HLNA 1KYZA 1L7RA 4E46A 1NULA 4MQLA 5COAA 2BELA 3TM4A 4BQRA 3HP4A 1YRBA 3LPCA 3T5PA 1CS0A 2PQ0A 3GGPA 4JUDX 3CR8A 2V98A 2J5XA 2JLXA 3TLGA 4OB8A 2OAP1 3ZHUA 3H1EA 4YT2A 1A95A 4AMVA 4XCQA 5DLPA 4UCXA 1EHIA 3UUEA 4Z4CA 3G85A 3VZRA 3HY4A 5ALRA 1Z5WA 4NNJA 1E9VA 2LE0A 4YWJA 3RKRA 3OE4A 4OHVA 4NMWA 1MRZA 3F7NA 4IRUB 4BN4A 5HYVA 1TVKA 5LZ4A 4TZTA 4RSRA 1PQWA 4UDOA 4E1BA 4JI1B 2H08A 4EK9A 2GF9A 2IQIA 4N65A 3VUEA 1T5SA 2PTGA 3DL7A 4H16A 1FRQA 2BZGA 2H4JA 3TR0A 2PAAA 3ABSB 1HDXA 4II3A 2XV1A 3DCJA 2XTZA 1EGAA 1NP6A 2EJCA 4BMXA 3OEEA 1BZYA 1W88B 2C2YA 1VJ5A 3WGGA 3ZHRA 1JLHA 4BFZA 1IEXA 3H1BA 1LDNA 4D96A 1U28A 1KWGA 1SOWA 2Q1UA 1J9EA 2VJDA 4TVBA 5DHAA 2ODBA 3G2IA 2W6JA 3M4XA 2JD0A 3I28A 1FS5A 4TOIA 4Q7EA 1X7YB 1TFUA 4Y3UA 3O8QB 2WIFA 1LI7A 1YZQA 2AEFA 2Q6VA 3GFPA 1ZW6A 2RI6A 2IHYA 3HB4X 3PI6A 3T5CA 4OFXA 2OG2A 2E82A 4FZVA 2HU5A 4KK4A 4ZK2A 3ACCA 5ICGA 1HE1C 2WMNB 5CX1B 3DM9B 3GUVA 4IJQA 2QU8A 3G2LA 4I99A 1EFUA 2GD6A 4GPD1 1OB5A 4LDAA 5B5SA 2WSYB 4IR7A 1E79D 4GP9A 4JX8A 5KTMA 5G0SA 2OK8A 4EYQA 1X7DA 2LZ0A 3O82A 3TM5A 2GQ0A 5L3SA 4GPZA 3TQQA 2ZRQA 3GFQA 4WQMA 1BMTA 2BZSA 5F2NA 1V5FA 3PGJA 2IQ5A 1KZ6A 4FDVA 5B36A 1P7ZA 3AHIA 2BOVA 3AEKB 4BFVA 5H3CA 3G23A 4PYOA 1OVGA 3LX6A 1RKQA 1T24A 1QVRA 1PWHA 5LFAA 2KQUA 2P75A 1E2NA 4KOEC 3SFZA 1WDLA 2X2FA 1JZSA 1N3IA 1W30A 5BN5A 5JH7B 2XUFA 5LR6A 1E66A 1ETUA 1HFWA 1NXPA 3EDYA 4XOIA 1YDHA 1AGYA 4NU6A 4EUFA 5EVCA 1W5FA 3COYA 4OAPA 4Q9LA 4F1WA 3Q3HA 2OBMA 4HNGA 1IEVA 4ZVUA 1IRIA 1EZ1A 1F2UB 1QO0A 1ENPA 1JIQA 2PKQP 4FYXA 1F8UA 3GCZA 2PL3A 5IJAA 2WDZA 4XWOA 3G5TA 3BMQB 4HMOA 5TQ0A 3Q3CA 3H1AA 4WHMA 2Q4DA 3KWLA 1B0ZA 2X3FA 4JI3B 2GN8A 3DXYA 1Q7BA 1IIRA 3K1ZA 3TFQA 2CNBA 4KSBA 4AJEA 4Z7JA 5CFZA 3H04A 1SCAA 4KMRA 2PL5A 2K2QB 3JWEA 5J2TF 3PXGA 1N2OA 1GTSA 4M87A 1BAPA 4S1NA 4MAAA 4JH0A 3WSWA 1QH0A 2YXNA 4I55A 3S4YA 4K9NA 2J9GA 1V71A 1YDFA 4JVNA 2G04A 1CUYA 1ZOPA 2JVIA 3JPYA 3PNQA 3PGMA 4P58A 4X7RA 3DBRB 3I23A 3PUWA 2J7KA 5IJXA 2JRCA 3WHLA 3DF9A 4ECAA 1KZ4A 4MDYA 3HGMA 4IINA 3BPSA 5DVZA 4Z9YA 3I72A 3HUDA 4NPHA 4R8MA 4RPCA 1Z4PX 2OAEA 5ALKA 2NXEA 1QR2A 2W37A 3B13B 1OLUA 1G0NA 1B43A 1Z22A 4Q3CA 1MOPA 1EE2A 2YH2A 1ZITA 1VJTA 2Z98A 3ECSA 3MD9A 4LQDA 3TR5A 3V1TC 2IBTA 1F0YA 3K9QO 7YASA 3H1TA 3OPMA 3QQPA 2V8BA 4BKOA 4DLLA 4DQUA 2IS6A 1RJFA 4EMSA 3JQ7B 1LB1B 1TEHA 2GESA 2BFEB 2WYVA 2GTPA 3I9FA 4URHA 3W6ZA 4N6GA 3LX5A 1T3SA 1JH8A 3CRNA 3G0DA 3PUVA 1UKAA 1QJ4A 1S3SA 4ZVSA 3F3MA 4A1OA 1AO3A 2CGEA 3NH6A 5HKLA 3QM1A 1GNTA 3KKZA 1LD3A 1DAMA 3A27A 1U65A 3IV7A 1Y7LA 1C9JA 3W2FA 2D8MA 4JVLA 3AKDA 4PANA 5J4HA 5I9IA 1IULA 2Z1DA 5A7GA 2YN2A 1II8B 4C0SA 3GFGA 2NXWA 1T2EA 2JKZA 5HMLA 1T1GA 2OQVA 3SXUB 4GGMX 1VECA 4MEAA 4BBZA 4GKAA 2ZDGA 5M7EA 3H5RA 3HYCA 3TF5A 1QF6A 5ALVA 5JASA 2QLTA 2PCLA 2YC4C 1V9LA 3WRWA 1AGXA 3BE8A 1XD9A 4E4RA 3PFCA 4LF5B 2E9SA 1ZD4A 4BB5A 1M1YE 1Q77A 4E51A 3JWJA 1A04A 1E6MA 1GUAA 2JGAA 1ZC3A 2AOTB 4Y2RA 1O03A 4C5BA 5BWBA 3S44A 3FHCB 3AJAA 1T3HA 2I4RA 3DMNA 5EL0A 3B1YA 3TTSA 4JUFA 3Q0TA 3QEJA 1Y8RB 5EJEA 5AKHA 2DKNA 1SU6A 4KXVA 2ZBDA 2AJDA 4UQOA 1S89A 1EEHA 5C53B 2RARA 3OZIA 4F7WA 3WYFA 1S02A 1NUPA 3PHCA 3OC6A 3H75A 2RGRA 2FFRA 4RXTA 5CEEA 3PC3A 3OFKA 4XRGA 1WPXA 3ZU6A 4ZEVA 4HFRA 4MWOA 4C0QC 1U1DA 2P30A 1YQWA 1K98A 3GFOA 3EGEA 4RZIA 3WIVA 2VF2A 3K9GA 1CHDA 2ZI3A 1PQ4A 4IHKA 5ECWA 5SZIA 3GT4A 1Y3CE 4YAJA 1WOMA 4BGEA 3CUKA 1VSTA 1ADBA 1MOZA 2A86A 5H02A 1EM6A 2RGNA 3JQQA 4Y1FA 3LCCA 5AM5A 1BDMA 3OCWA 4LDPA 2J30A 1RBZA 3AK4A 3NRCA 1JXMA 4LI3X 1SD2A 5CCXA 5JFGA 1USKA 1NXTA 1Z6QA 3ONEA 4QL3A 5DRYA 2B3DA 5C3UA 5D51S 3TKAA 2QTGA 5E38A 4FFMA 4KIFA 2VUUA 3EWAA 2NYVA 3K0AB 3LT4A 4YJ3F 3BFJA 1BE1A 1DCMA 3TCXB 1UFVA 2C95A 5IC4A 3CW2A 1ORVA 3NO4A 1MB9A 1YL7A 3IIEA 1BGWA 5K0CA 3L8YA 3BXOA 4DLSA 1OF1A 2DPXA 4AJJA 3DOHA 4B4KA 1TAHA 4OV6B 4B80A 2K7ZA 2KSQA 2ODNA 4V38A 1FTWA 5T5QA 3OUUA 2XZLA 4GZ6A 1WXFA 3SVZA 3I9JA 3U4DA 5CD9A 2ZRHA 3RCBA 1SVKA 1UQUA 1VYVA 2CUNA 4YLYA 4QDXA 2P79A 3EQ6A 3OPYA 2BT4A 4FMCF 1Y6QA 4K86A 3ZVMA 1M72A 2C77A 2QM7A 2R8EA 2I99A 3P2EA 1FDWA 1ZBDA 4R1TA 4LF4B 3FYDA 3HL4A 5AVKA 5I7RA 4OAOA 3TBFA 2BUAA 2PDAA 4ANFA 1LTQA 1EUDA 3CT6A 1MP0A 3V7NA 2PUJA 5U1PA 4MUXA 4I3HA 5ILOA 2ODQA 1P2BA 4ZT2A 3SYTA 5KTTA 2V74B 1U8UA 2CXQA 3HWX1 4PX3A 4CT0A 3AVUA 3AB8A 1CSEE 2B69A 4EB3A 3WKCA 3W5CA 2V4MA 1FMJA 2AD5A 4UHBA 3SZLA 3HKDA 4MQEA 3STXA 1IRXA 1KAOA 3EF0A 2HW8A 5A71A 3IIJA 4EYEA 1DAHA 4DNOA 1VIMA 5E1BA 2C4TA 1VFNA 3LVRE 3RF7A 2JFNA 3CW8X 4C21A 1SUPA 2QXUA 3LK7A 4BMPB 3C74A 3JRNA 2VWGA 3RFTA 1EQ2A 1RABA 5E3IA 3C7AA 3T4UA 4AL4A 3C3JA 4U7FA 2VBGA 2G9ZA 1YKFA 5ENDA 2CCKA 3HYTA 4TLEA 5JMOA 2PWZA 1E7QA 4C6RA 1H6DA 1QHXA 4NOKA 4V02A 5K7SA 5ITWA 2H0AA 2E5LB 2D1QA 4I1UA 1YR7A 5CFMA 1QHEA 5E4YA 3WLNA 1IBKB 3ZWNA 3DVAA 3IUQA 1QK5A 4IHJB 4UE3S 3T3EA 1TKBA 2IYLD 5CUQA 2Y77A 5TMEA 2OV1A 2PZFA 4DWJA 5F3DA 1XP5A 3PUXA 4KO3S 3SSNA 4CMBA 2XGJA 3GMSA 1LDMA 3EZ6A 2C1XA 2AMVA 2FEPA 2QUZA 3RSQA 1UKEA 1Q0SA 5A0VA 2QU7A 4E88A 2EF0A 1AT1A 1WMEA 2J9YB 4PRLA 3JWIA 1LWOA 2P3QA 4GUAA 4L8LA 5EXTA 3SYRA 4DJAA 1COWA 1D3AA 1TCAA 2A5GA 1CZLA 3FR7A 5ESWA 4D98A 1YV9A 2QMHA 1R9JA 4QTZA 3VNVA 3TUZC 3K1AA 5JXWA 4WACA 1CUGA 4G25A 4IJWA 1FUYB 3UKJA 4PG5A 4UD6A 1KDTA 4DL9A 1XNHA 2AQKA 1XLTC 2Q3BA 3OJXA 4IFTA 4QTTB 4MXDA 3EQ9A 2Z3VA 3T3GA 1W59A 2AOUB 3WC4A 4D3YA 4V0SA 4PZUA 4LKRA 3ORRA 3BHJA 5JR3A 3H1FA 3OCYA 1KEVA 1OBHA 1UPCA 4MR9B 2QBYB 4XVUA 1PGQA 3QMWA 2HYDA 4D0RA 4HVTA 1Q1EA 1MIOA 2QL9A 1NBMA 3LQ4A 1E59A 3GELA 1LI5A 5HBGA 3TRIA 2J6IA 2WWTA 3S55A 2I7CA 4NCJA 3GLIE 4F46A 1DAPA 3FROA 4O3FA 5K6RA 2AMFA 3LT2A 3B1FA 1Z45A 4V0OA 1G5IA 3EEYA 3OTWA 3LCUA 5ALTA 3X1WA 4DV0B 1CQIB 3AUFA 3O26A 5T3YA 3I30X 5GVSA 3H5WA 3M5DA 1DL5A 3TSCA 3X1MA 4C5CA 5AUOB 3AUSA 1GY8A 4EY6A 4QJIA 4MS3A 2I4IA 1AVTA 2OZLB 2CXRA 1V41E 1R37A 3JQGA 4A6DA 2FN9A 3PHJA 3AINA 4FVTA 4E5KA 2E4YA 2BKXA 1OV4A 4RFVA 1OAOA 1GG8A 1KR5A 1M66A 4RSHA 2O7SA 2AFRA 1KP2A 3HDTA 3HWWA 4LK2A 1XA3A 4OOEA 5A6VA 2FE1A 1JG4A 1YVUA 4TS4A 2O0HA 4R9RA 1QQTA 3VTAA 4BKUA 3LF1A 3QVWA 5EC8A 3ZS9A 3NHRA 2YXDA 4X8LA 5B3JA 2WOJA 1CUFA 4LJRA 4AJHA 4H7HA 4YPFA 3OBIA 1W96A 1TUBB 2SCUB 4GZ3A 3TIIA 3ZBPA 4H7FA 1DG3A 2FZ4A 4DDHA 2FU5C 4O4LF 2C5AA 3F1KA 4UULA 1H3FA 1R3UA 4B6PA 5CFRA 5IKEA 4PZZA 3ZQ4A 4L75A 3C3EA 1T9DA 1GPDG 1ZGGA 3EE6A 4K9PA 3KSRA 3SFVA 1WXEA 3A9RA 3WTCA 4BV8A 5K4AA 2J6BA 3SBDA 4O5OA 3QEAZ 1HR0B 3O94A 3PS9A 4K0RA 4M6WB 2DTEA 4P82A 4LYDA 4XIIA 1UJMA 1OHHA 4LVNA 3EZFA 1D8AA 3ROFA 2WHPB 2GRJA 1GZ5A 1UT6A 3E61A 3OLZA 2PMCA 4ESVA 3P94A 4CI9A 3SY8A 1QZXA 3JQEA 4RIFA 3VTKA 1E9AA 2ZB8A 3M4JA 4BJHB 4M0LA 2PBRA 3QRWA 1U0EA 4XDZA 3GLGB 1TD9A 1U2RA 5TT1A 5KKAA 5JCOC 1IONA 3EMBA 4CR8A 4WLOA 4XWYA 1VB5A 1Y9AA 3EEFA 1S3GA 2Y27A 1ISFA 5FBQB 4KG7A 4BUZA 3BXXA 2IYTA 4QYWA 2PS1A 4HH3C 1VZ3A 3UG6A 1D9ZA 1R74A 4DNFA 4ARCA 1BS1A 1ZISA 3FA2A 3VSBA 4NYJQ 2XMCA 3SG0A 3NKLA 4CDMA 1D6SA 3A1EA 2JCBA 3A2MA 2XJ4A 3IT0A 2QG6A 2CXPA 1TQ6A 3AETA 3PT9A 4YCJA 4BAZA 5K0SA 1SN7A 4HPJB 3ER6A 3KFXA 1JFTA 3G5UA 2HT1A 5EG5A 1SD1A 3WNZA 1HEIA 2GA8A 1VKJA 2HJVA 3EZNA 3KD2A 4IDPA 3BFVA 1C0IA 1G9SA 3CCBA 2WZQA 1A9SA 1R0WA 1KO7A 2MYUA 3K2QA 1AF4A 1YU9A 4JNKA 1BDJA 1WCWA 3A31A 4FP9A 4NV3A 4UAUA 2IWRA 3VSCA 5CJ2A 3W78A 4LXUA 4BRSA 2DQKA 2ZJYA 3IKTA 2HRRA 1JUDA 2FFJA 2P0EA 5CJJA 5HX7A 3WHPA 3ILSA 4BN5A 1ECCA 1R27A 1NP3A 4TKUA 4DSOA 4GMXA 3LOPA 5CDHA 1Q22A 2CHVA 4Y2JA 4NYIR 2DSTA 4GMKA 4F9TA 2ZI6A 3SM9A 5CB4A 3HA7A 1EJ0A 2X5KO 3ODGA 1NURA 5IAKA 5A04A 2NZUG 4I8XA 1YOBA 2LDXA 3B48A 1FF9A 3ITEA 4LTNA 2EQAA 2ZS7A 2XTMA 3W2EA 3X43A 3KZCA 1T1RA 3T7JA 4EJMA 4EHIA 4UBOA 1RHUA 1NPYA 4QRHA 1Z5GA 3J81A 2Q1WA 5SY4A 2PX6A 2NZYA 1YRHA 1TTPB 2I55A 2J8ZA 4L51A 1Q3KA 4QBFA 5AYVA 1GDDA 5EZYA 3KPJA 4FFSA 3R9KA 1LV7A 2AL7A 3IP6A 3RS5A 1YNOA 1PX2A 2GILA 2AX3A 3CNQS 1ZGJA 3I01M 4II2A 1S2IA 5TV2A 4QDUA 1AS0A 1KNXA 3C3YA 2WTXA 5EESA 1CULC 2C7GA 4DGSA 4ZI7F 1KDRA 4US2R 4GXQA 1U7DA 2GTHA 2LW7A 4ZQHA 1OWOA 4YDHB 5DX0A 1JYSA 3FHOA 3Q9SA 1LZLA 1IN6A 4YX9A 1IUNA 2QE7A 4F8JA 3NR2A 3OLVA 3T5GA 3V8QA 4CCWA 2RAPA 3ONNA 3R74A 4A6XA 2BFDB 3V8NA 3ZWDA 3H9UA 1ZZEA 4FDUA 1WQ4A 3A4IA 1A2KC 2PGXA 1M2EA 3JXEA 2RIPA 1JG3A 3NVMB 2NU7A 2FZEA 2UKDA 3MGAA 1P39A 5HCUA 4R3NA 4D9BA 1DO8A 1LPOA 2XECA 3OIWA 5KWIA 3P1JA 4X1KA 4X0EA 3UJBA 1JSXA 3M9LA 1YRLA 5L6LB 3RU7A 1MAWA 3IURA 1SUBA 3KQMA 3TW4A 4XVQA 4QELA 2QD3A 5AWFC 2YWBA 1H05A 1LY1A 3IV9A 2ZCVA 3NT4A 1U02A 3SZGA 1VIAA 5HQ3A 1EB9A 6REQB 2YMQA 2AZTA 5LMUB 2ZE5A 2CVPA 1W581 3FMIA 3H2JA 4QYMA 5DB4A 4IFBA 4GRAA 2ONJA 1XEWY 2K87A 5K01A 2I3DA 3RS0A 3PYXA 3GU3A 1JR6A 3KVRA 3I05A 1KAEA 1SHTX 3K0FB 1D2NA 1NRWA 1A9QA 2XUKA 3UAYA 1K5PA 2CB9A 3NDBB 4JGBA 2FR8C 2GPSA 4G1FA 3B1XA 4OJYA 5GGXA 3JAMA 5AUNB 1KJ9A 5ED4A 2FN3A 2WPDA 2EKLA 3RASA 2B6HA 4EY4A 2R8XA 4OQ4A 3GMIA 4YRIA 4S0XA 2QM0A 2WR8A 2X9VA 4RO0A 4MYUA 3T1NA 4YP6A 3HACA 2ZJ6A 1W8DA 1NRJB 3IQIX 2PYIA 3JD0A 4MRMA 4JOCA 1T0UA 4WAUA 4EVQA 3LL4A 4FDTA 4IL5A 2CFTA 1GKLA 4M8LA 3AT1A 4HEQA 2J3JA 2P4QA 4IOJA 1UDBA 5B1IA 4K6CA 4WFIA 1H2XA 5A6SB 3M81A 1XLWA 2E5FA 2ZYHA 3JQPA 4M1EA 1W2WB 1E8NA 3SQMA 4Q4JA 2H17A 1P62B 4NBLA 5JH7F 2DFKB 1GGEA 3PNKA 4EM6A 2FZLA 2NQ2C 4REQA 3TB4A 1AGNA 1JAIA 2EL7A 3D3JA 2VP9A 3K9WA 3DMGA 3S8YA 4I5FA 2F8MA 1GTJ1 3IKLA 1Y6RA 3KKLA 3C8HA 2WRZA 3QTLA 5A1TA 4CM9A 2BMJA 1W47A 3BL6A 4MUJA 3E8SA 4QXAA 4D25A 2ZXFA 2W6IA 2XGGA 3ID6C 1Z8DA 4DB2A 2JLSA 5BV0A 3C5EA 5FR2A 1DWUA 1NT2A 1S01A 4AIRA 5CJPA 1NW7A 2BHSA 3UV3A 3JD1A 3T7CA 1T2VA 2NZ8A 4BV2A 5J3JA 4M98A 4E2WA 2VHTA 5JCPA 1XTUA 1CFJA 4WD3A 3TXAA 4DY4A 3ZGXA 1JLKA 4FDLA 4R1UA 2XVXA 5JPIA 4JS0A 4RK7A 5IM4F 4KWHA 3V1UA 2A0WA 4LCBA 3EZLA 5ETJA 3PD1A 3MSCA 1QVAA 4M8SA 4C0HA 4KR6A 5AT1A 4FB4A 3DS8A 1KAGA 2XMRA 1GNRA 2C5FA 3W5AA 1OH8A 1CP2A 5LB4A 3NBAA 3VKHA 2QTZA 1F2TA 2A9FA 3B1VA 1D4FA 2X8AA 2IHVA 5KDDA 3FSJX 1ZJ5A 2GNAA 4QOHA 1HDEA 2AI3A 2QJWA 1TM2A 3GROA 5CVVA 4UPDA 1N6LA 5KUTA 1AKYA 1I7NA 1L4NA 4N76A 3CLRC 2ORVA 1QGYA 2BM9A 1MV8A 4YP5A 2P6OA 1NV8A 4KXQA 1VIVA 4JENA 3R7WA 4OBBA 4IGEA 3DZKA 2RGWA 5LMZA 3MCAA 1Q7EA 3FI9A 1L4FA 1S96A 4G4IA 4CW7A 1PVOA 4TWIA 3BCHA 3HFGA 2P11A 3FPEA 5FUWA 2VDNB 2ZSJA 5EJGA 5C8YB 2Z1NA 3HCCA 1Y8CA 3AZOA 3DL4A 3M9XA 1ZD3A 5FV4A 1OFVA 4ZFNA 1Y4UA 3D7LA 3LGSA 4FX2A 4FYHA 4IDAA 4RPGA 1LH0A 4RNDB 3QH4A 4KN5A 1V7ZA 3D6FA 1EXDA 1UXKA 4WBXC 4TVKA 3A3OA 4L6CA 4TWZA 1CUUA 5A03A 1A97A 2VUIB 3F1LA 1E9FA 4GEKA 2BI4A 2A5YB 4M0DA 3BWEA 2PZMA 1KVSA 5FBWB 3F3KA 3RROA 1R18A 2GM9A 3ADKA 4B82A 2ETVA 1EE1A 4WNIA 3VPAA 4AS2A 4D99A 4F7DA 1E3EA 1VA4A 3EGVA 1DTWA 2DFDA 4IO0A 3RRZA 3TDMA 2XCSB 2FGJA 3JY6A 4C2BA 2MSLA 1K7CA 3WRXA 1I7LA 2FPOA 3ZLBA 4MV9A 4B3HA 1A4UA 1PJ4A 3S2GA 4FR0A 2PT9A 4J7CA 1ND6A 3L8ZA 3SLKA 5DSTA 2PRKA 1CK4A 3A26A 3I5MA 4J49A 1BX1A 4ZJYA 5JSUA 2HGSA 1U8YA 3IJRA 4TKVB 4OLBA 1SZCA 4GXNA 2PBLA 3NWPA 2H1LA 1P1HA 2NUAB 1DX6A 1ZRHA 4X84A 1WWKA 2C0CA 3QBTA 5FNVB 4EPVA 1AQIA 2AXPA 2FW8A 2WJVA 4LVOA 1EX6A 5FQNA 1I4TD 1MW9X 4RQUA 4MI6A 4C1NA 4LOKA 2CK3A 1AHIA 1KAMA 1T5BA 2IPMA 2BJVA 1M8JA 3GJZA 5J2TA 4ENVA 1KJWA 2Q0XA 1I7SB 4D9IA 4AN4A 5EE5B 3L7CA 1AQ6A 2C7BA 3AM5A 5DTQA 1V1MA 2O2DA 2WZCA 1H1DA 1PGPA 4LY0A 4H6PA 3VO8A 3ZTTA 2C5SA 4J29A 4AT1A 5HZGA 4GZLA 4C7OA 5FUBA 5G3YA 5B1YA 3CIFA 3KO8A 4HDQB 4M7WA 3TS1A 3NHAA 5TR9A 2XMZA 1EFAA 1G9XA 2O23A 3ZI7A 1T8UA 4DIBA 5LSAA 4Y1EA 1HFKA 1YQTA 3FNRA 3O7MA 1U63A 2WVGA 1LBEA 5K2MA 1IATA 3KOMA 1PR6A 1Z4MA 3JPWA 3VU3A 5HGXA 5KYWA 3L5KA 1K8QA 3OQJA 4N0EA 3AUXA 4OVKA 1QIKA 1A4RA 1N0UA 2GCEA 3EK2A 4AUMA 3SWWA 3U61B 1B73A 1P4SA 2A2ZA 1P8JA 1UAAA 4O3MA 4Z53A 2IV2X 5JTUA 3UJ6A 3F90A 3KALA 2C4KA 4MIKA 2IT1A 4HWPA 1QR6A 2PH3A 2RHGB 1ODIA 3DCNA 3GT0A 3R4VA 3IJEB 3RVRA 3O1IC 3OHMA 4NDAA 1B8VA 1FVHA 5P21A 2ZETA 4Q18A 3I2IA 4CLRB 2Q45A 1LNZA 1W19A 2WDPA 1SIOA 2B1RA 1DFIA 2WJAA 3D1JA 1YA6A 4JVMA 3KSMA 4XX0A 4YS6A 3PNOA 5G0UA 2FZWA 4CG1A 2GBCA 8ADHA 1JIXA 4W1QA 4I8DA 3H8JA 2HUNA 5AW4A 3H1PA 1E9EA 3G1WA 1A2QA 1VRCA 4RADA 2OYRA 2AXEA 1FP7A 3DE1X 1KZYC 4CT5A 4WTOA 1VBMA 4QPJC 3MYYA 5HUHA 4K7JA 1T2FA 5BW4A 1IVNA 1DI0A 3ZXXA 1UDAA 3IAAA 3KUCA 4M1MA 1M8KA 3L5OA 1D09A 5BW6B 2WP8J 4LXGA 1ZR4A 4YAIA 2RHMA 5BMVB 1N8NA 3OOJA 1DELA 4GYYA 4HY3A 1FBNA 4EKEA 1SULA 1XEFA 4FIDA 1N6OA 3K1TA 1NUQA 3PCRB 1CXZA 1Q6YA 4GC9A 1E79A 1S7GA 2UUBB 1RADA 1OBCA 4BO6A 3TIXB 1ZUHA 4B3TB 4JI0B 1JDBB 3BXZA 3QXJA 2YJTD 5J5CA 3I39X 3CVWA 4I1VA 2QJFA 3F6SA 3HA3A 1FMCA 1T8WA 1WDWB 3Q2KA 5EUMA 1CJMA 3NHYA 1TCBA 4DA8A 5I7OA 1CT9A 2AJLI 4BP8A 4AF6A 2XUZA 2XVAA 2ZWMA 3PKJA 3W04A 4CF4A 3O4FA 2P9ZA 4AKSA 4B3RB 2E55A 4DMMA 4P92A 4H7IA 3IEVA 3JQAA 4IWNA 1NT4A 2Z5GA 4KFTA 3PIDA 4NENB 4S1VA 4YLGA 1JDSA 2ZTLA 3KC2A 3UFXB 1E3LA 1HBJA 4JR0A 3RTAA 1AMNA 4FZRA 1A9RA 2FPWA 3JQ9C 4XUDA 4D4MA 3AUYA 3S1AB 2J1LA 4TRMA 5MN5A 5IWAB 3G8AA 2BHTA 4AWAA 1M7HA 3TGWA 1EWYA 4FKZA 1K06A 1VPTA 2C9ZA 2J0UA 5AJVB 3RGWS 3IAFA 4DR5B 2FKNA 4RVHA 1EUYA 4QQKA 4EITA 4ZYLA 2HOQA 2ZIVB 3A10A 1MB0A 2IH2A 5TS2A 4RTKA 2AH5A 1Y4DE 4XEUA 2IY8A 5FIUA 1Q15A 3RARA 1R00A 3ZVLA 2I1WA 5IBRA 3LS2A 2A8YA 2Q46A 1ZGBA 1W4AA 5T6MA 1W87A 1JSRA 3PNMA 3ZN2A 3OKFA 2APJA 3NTVA 3OZRA 3PHHA 2ZS8A 1PG2A 3N2IA 1KK3A 3ELBA 5DCYA 4ZT6A 2H1IA 4QUBA 3VBEA 3O74A 3L6CA 4JELA 5A9TA 4KIJA 3MS4A 2B1JA 3I0MA 2ATEA 4D4KA 1O9HA 3PJDA 4B71A 4QUIA 4WCVA 4KXFB 5BYAA 2JFBA 1IXSB 2Q9UA 3O4RA 3PEFA 4C6TB 4EEKA 5DHSA 2JJ1D 2QRNA 2FSPA 3G8BA 4P0QB 3U3XA 4COKA 3HXTA 1UFOA 3DFZA 5CAEB 2WJZB 4XYGA 2PFGA 4CLDA 4QNMA 3ZBTA 2R6FA 3BWVA 3PQ6A 3I04M 1LRKA 1Z0UA 3A4YA 3JYPA 5LQSA 5TPWB 5C4IA 4MA0A 4CCSA 1QWOA 1Z26A 1X3LA 2F3TA 3QFRA 4HDMA 1V9SA 3GBVA 2JGIA 1YUBA 3I5XA 8GPBA 4R98A 1NBWB 4Q66C 1C30A 1RRPA 4G36A 5FFNA 4AKTA 2R8ZA 2VBIA 2RG1A 3IXMA 1N3LA 2VBFA 1CEYA 2PZLA 3L1KA 3N2KA 3VJKA 1RCUA 3I0NA 2OGTA 1RYHA 4QGAA 3GFRA 4LYGA 1WCIB 3UMJA 3V7YA 3VOBA 3U4QB 1EQUA 2HBRA 3L0YA 4R8RA 5IUKC 1IN5A 1SXHA 2C20A 3PWTA 4XWGA 2BKLA 1C5KA 1OROA 1YK0A 1L5HB 2B78A 5CYFA 3T3DA 3VVMA 4F84A 5B6JA 1VKZA 4LEIA 5H81A 2CVQA 3VO2A 1ZM3A 3MOIA 2UYOA 4DGQA 2ZDHA 4V24A 4FGKA 3PTZA 5F35A 5F5LA 4JWTA 1HDIA 5KHOC 1DSSG 3GAZA 3HRIA 5E0OA 1P0MA 2QN1A 1NUTA 3A1VA 2MHCA 2PSHA 3OO0A 3CLUC 3U3ZA 2YIVX 4JJ4A 1BE6A 1FRVA 2I6SA 3NJRA 4KFSA 4YEDA 5TQJA 3A2NA 1X8JA 3FMPB 1ITZA 1RJDA 3FUCA 5JBNA 3MT0A 2CJYA 5B3KA 1ZL0A 3NYIA 3T7SA 3AVVA 1K1EA 1CQWA 1EK5A 1NDQA 1DAKA 3NXKA 1FLVA 4FYMA 4C4ZA 2VP5A 4GPEA 2UUCB 3H5LA 2ZYUX 5KS2A 2O3QA 3OSUA 2IU6A 1HFEL 3I2KA 3BSSA 2IUSA 3RUFA 1IQRA 3UBTA 2ZJ7A 5THXA 1L5YA 5CDFE 2F8TA 1Q16A 3VISA 3RV3A 4CEHB 1KSFX 2GSWA 4YT8A 3DOOA 4H4EA 4Y2HA 5DNCA 4PSUA 1JVSA 1IC6A 2C3PA 3CUVA 3PI7A 4KU4A 3N2GB 4EMUA 3UMYA 1Y3BE 1QRAA 3QLUA 4NCIA 2VDUE 5KSPA 5A5DA 2JVKA 2W2XA 4A8JC 3NHBA 4TMKA 3CIOA 1CJCA 4ZCMA 3GLFE 4A92A 2DY1A 3BEOA 4YBRA 2UV8A 3VPDA 2ID7A 1PGJA 5ICSA 7REQB 1NQTA 4RPIA 1U3DA 4X24A 5BR8B 4LMPA 2MSEB 2M6RA 3R44A 1XTBA 3K0HA 1P18A 2PSEA 3FVRA 1HL3A 4YJFA 1M2HA 2E49A 4OIFA 4JI5B 2IYQA 2CZCA 1U1FA 2GS9A 3MYRA 4YAUA 4J0GA 3NNDA 1JWLA 4B3DA 3G2JA 1UZMA 4J7AA 4LHYA 4PFQA 1KDOA 5G0TA 4UDYX 3MGBA 4X6LA 1MO4A 1W0JD 4ZO6A 1GTL1 3U7QB 1V1JA 3UOAB 4X20B 5ALSA 2PMDA 3N53A 4P7GA 3JZAA 1LLFA 1SKBA 3LA8A 4M4SA 4EUEA 1EBFA 1VKOA 4KKVA 1E1DA 2G0NA 4GI1A 4OHRA 5EMNA 2ERYA 5IS2A 3KOUA 4CTNA 4UM8B 1XU7A 3RNLA 3JQBC 1HT2E 1TOAA 1JU9A 3EPPA 2ZTSA 2NOAA 2CNOA 2FQWA 1OLXA 1WB6A 1EK0A 2YZ7A 1DB3A 2YIDA 3BILA 2Q3FA 1KO4A 1ECBA 1RWNA 4G07A 4K8OA 2RHWA 4L3OA 3SJCA 2BH2A 4M7OA 4RA6B 4YTEA 4B1FA 1ZVMA 2GYUA 4WPGA 1S8OA 3PQ8A 4CPDA 1AA6A 2A7XA 4G3XA 1I30A 2IJGX 1YB4A 1F0NA 1A2BA 4JU8A 4LMRA 3M5WA 3KT0A 3V1NA 4PR0A 1EFVB 1L5RA 1ZUNA 3JAWB 3DBHB 4UZSA 4AY3A 2H16A 2B8JA 2QI9C 5IKOA 1AV6A 5JD5A 4OH7A 1Z2AA 3JVEA 3KELA 3KLMX 4S2UA 4HDRA 4B4UA 4C07A 1NN3A 2O5EA 1ZNZA 1E2JA 2DKFA 4BZXA 1PSWA 1MT3A 1BU8A 2FEWB 2IDKA 2YW9A 1IHXA 4MGIR 4C7KA 5EMKA 1K6JA 2DBZA 1MJGM 3BG5A 4S12A 1W4ZA 2AC4A 1PL8A 1WO8A 2ZB4A 3I04A 5BRJA 4HZUA 2GKSA 1OXTA 5FA5A 4UMFA 2POQX 3VYTB 2WU4A 4Z6KA 3D6VA 4CETA 2P2GA 3MB8A 4P86A 5FFFA 1MU0A 2Q29A 2WUDA 3P9KA 2YYSA 4HNRA 4O0MA 4M0UA 1ZQ1A 3H4IA 2R7KA 3HBMA 5HOQA 2VK2A 1UBMS 4RXMA 4U8HA 3ZDDA 3JU3A 3GNQA 4I0WB 2VUHB 4YJ2B 4HXYA 3EJWA 4K1XA 1A5TA 1RYFA 3ZX5A 2CBZA 4RQTA 4ETMA 2IZ7A 2CE2X 4B34A 1HDRA 5GJWC 2XT0A 2AFIE 3PX2A 3OOSA 3HA5A 3HEMA 1SK9A 1OZ0A 1Q74A 1FNSA 4LWQA 4KEAA 1UWLA 1HT3A 1TZBA 1ENYA 3RRFA 4MUNA 2ZUVA 1LSUA 4AN1A 3A9TA 4LMAA 3LLSA 1D2RA 5IK2D 1NOKA 3BX1A 1GYQA 4DYDA 3LT1A 3OQ6A 3EVBA 4OUDA 5HHTA 4KPEC 3IA2A 4MCIA 4N5DA 5K3FA 5SYNA 1M67A 3PSAA 2ODAA 2XWPA 3MERA 1E7RA 1YS1X 3OH8A 4DMRA 4D9HA 1C29B 1U7TA 2DHRA 3BTSA 3EFOB 3P2JA 3SE0A 3FOFC 1XR3A 4P3KA 1P1RA 2H5IA 1OJLA 4ZO8A 3V8MA 1M1YB 1CQJA 5EMLA 3JYNA 2Z95A 4O4HB 3DAHA 4EW6A 2TMDA 1UFRA 3MWKA 3VTFA 5JD4A 5JYDA 4GP7A 1YC5A 1CR2A 1C8KA 1VYUA 3K09A 3BD9A 2H4FA 5A4IS 3UB4A 4PVDA 1KXZA 4CG3A 4DLYA 4QUKA 2ZXUA 3PFGA 1NF8A 1WB4A 4NFYA 3LCJA 4BJ1A 1U8ZA 4H1HA 3LHSA 4MS1A 4ZI7A 1N5RA 3AF4A 4G1UC 4JGGA 3WL8A 5I9BA 4BNZA 5LQRA 1TT7A 5CM9C 2PSSA 2QIPA 4IY1A 5FYDA 3ZGZA 1CUDA 3ZV4A 4KIGA 1OX5A 3ESBA 4PZ0A 2P3SA 4TQUS 2R5FA 2G09A 4QGFA 3ZGOA 2V7QD 4ZVQA 1QOQB 1EG2A 1EDZA 1NN1A 1VOTA 2VXCA 2LVBA 4LBVA 3SHFA 1A72A 2NO7A 1F48A 4NTZA 1Z6GA 3LYAA 4EUSA 1I2ZA 1SUFA 2EOAA 5DT2A 3NV7A 2I2CA 4BNIA 3WNDA 2NV6A 4FNGA 1SUEA 1NTRA 2R8BA 4CM7A 4B3SB 4JLUA 1JE0A 1ACMA 3M0EA 4M1OA 4CMCA 2YWJA 4PSCA 4F0JA 4OJMX 4FWTA 2EX1A 2FOLA 2I6XA 5F7ZA 1XT6A 1QHHA 2FPPB 1R10A 1V3TA 1TM4E 1HE3A 3TW6A 1NIJA 3AKEA 2VT2A 4PAQA 4AK9A 4WFJA 1J8VA 3H1GA 4XXHA 1EHYA 2G0TA 8MHTA 1OC2A 4WE3A 2F8LA 2HIMA 1I2CA 2ASEA 1WEHA 5C8YF 5JVDA 1HGXA 4MR7A 3GJ5A 4OQYA 3WL5A 2FMTA 1FQJA 1NJ5A 2CL0X 3O3CA 3OMXA 4DB4A 1P9OA 1ZKDA 2RIRA 2Q1XA 2CJWA 4F6RA 3H19A 5EOVA 3R6TA 3SJZA 4Z1MD 4Z0TA 4ZZIA 3DMTC 4FCTA 2D7CA 4TL6A 2WSLA 3FG9A 2IKSA 5CB4F 2VT3A 4ROTA 2PX5A 1JSZA 2J5QA 4MRVA 2B2XA 3SEQA 3ZCTA 3TIVA 1VJ1A 1ONBA 1Q14A 4JYZA 5E8RA 4GL2A 3OT5A 3RC7A 1CQPA 4A6PA 2HV9A 3FYUB 3EAFA 2P9EA 3QP9A 4DLVA 1DQPA 1SKQA 2GNPA 3EGXB 3N59A 1XJQA 3MCUA 4TMVA 3NAZA 4XSGA 4BVBA 4RJLA 1E4EA 4B3MB 1SGWA 1IWPB 1WZCA 2N9UA 1A9XA 1C1YA 2NTEA 4KI7A 1NLMA 4NMLA 3QELA 2V7GA 4I19A 1YA4A 2FW0A 1XMIA 3AR2A 1KMCA 5FBHA 1MJGA 3JQ8B 3CUTA 4P31A 3UB2A 1D5CA 4JY7A 5G2OA 4Z7OB 4PLPA 1CV2A 1IHDA 1KMMA 1OWLA 2V55B 4ZC8A 5KOYA 5A05A 4LY3A 4ZCPA 1U2TA 3HL0A 2YJNA 1FYEA 1BXKA 2XWQA 1ZXBA 2NYRA 3QXXA 2P2NA 4J1TA 4PZDA 4EABA 4LS3A 4CKCA 4M1YA 4OX9Y 1WUTA 2TECE 1SPXA 1YJXA 2JLWA 1FVXA 5A5GA 3KYJB 1GL7A 3REGA 5IABA 3LY7A 2ERXA 5TC4A 1PJ2A 1L7OA 5IM4A 4P34A 5EIHA 5DGDA 4M76B 3ZX4A 1VIYA 4D74A 5LL6P 5DX8A 2NO5A 4NFLA 1J39A 2LV8A 4CM5A 3Q88A 3O73A 2DFTA 4DLRA 1SOAA 1QFYA 1WE2A 3OFNA 2NNLD 4E70A 4FLFA 4LJLA 4DIKA 1EFHA 1LUAA 1SK8A 1BMFA 2XOXA 5GJVC 3W6PA 4C4YA 4CLOA 1YJQA 3FLAA 3GJXC 3OMWA 3OZFA 4A03A 3SX2A 4ASUD 2IYFA 4BATA 3R9XA 1VYTA 1DG9A 5M04A 1L5MA 5HM6A 1Z62A 3CINA 4MROA 3IDQA 1ZNWA 2VJMB 4AJNA 1E2MA 4J0QA 5FEUA 1M6EX 3V46A 2OHJA 1GYRA 5CT4A 2BGWA 3PYMA 2Q5QA 1RAEA 2QQEA 3HDGA 4GBMA 4EI2A 4CF5A 1C7QA 1KC3A 1FW6A 4FINA 1LWNA 4GI7A 2ZPUA 1EZ4A 1V8BA 2YBDA 3D5QA 4Q3EA 1ZJZA 3IUEA 3UMCA 2VDOB 2O0LA 2Y2UA 1J06A 1OKKD 2FPIB 2JHFA 4KQGA 4NC9A 4R2HA 5AI5A 1EXWA 5A9SA 1HUQA 2FK8A