3INYA

Crystal structure of human purine nucleoside phosphorylase in complex with 7-deazaguanine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystal structure and molecular dynamics studies of human purine nucleoside phosphorylase complexed with 7-deazaguanine.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3inyA00
1CB0A 1PR1A 4QFBA 1SD1A 3LA8A 2QDKA 1FXUA 3DPSA 4WKNA 1OTYA 1JYSA 2AI2A 1VFNA 4TXLA 1VMKA 3O6VA 3P0EA 1ODIA 1NW4A 1U1EA 1I80A 1JDVA 1Y1TA 3EUFA 1RSZA 3OZEA 1Y6QA 1SQ6A 1JDTA 1Y6RA 4NY1A 3UT6A 3OOEA 4LKRA 1ODJA 2A8YA 1RFGE 4BMXA 5F7XA 3KUKA 1T8SA 4DA7A 5F7JA 4D9HA 2A0XA 5B7GA 5IFKA 5IU6A 4OF4A 1T0UA 3KU4A 4UC0A 1K9SA 4G89A 3UAZA 1Z5PA 4OEHA 4GMHA 3EMVA 3UAWA 1B8OA 4JP5A 1LVUA 1U1CA 4TS3A 4PR3A 4M1EA 4F3KA 1PW7A 3C74A 4OJTA 1A9QA 4WKOA 5CCDA 1ODLA 1V41E 3GGSA 4NSNA 1Y1RA 1RYZA 3UAVA 1B8NA 5B7NA 4WKCA 2IQ5A 4TXNA 4OY3A 1Z33A 3U40A 4YNBA 3D1VA 5F73A 5B7PA 4TTJA 1Z38A 3PNSA 3FB1A 2HN9A 1A9RA 2RJ3A 5EPUA 3LGSA 3ONVA 1ZL2A 5B7QA 1ZOSA 4JWTA 2P4SA 4LNHA 4H1TA 1TGVA 1U1DA 4WKBA 4E1VA 4YMLA 4DA8A 1JDSA 1OV6A 1PK7A 2PGAA 1V45E 4TXJA 4WKPA 2I8AA 1RXYA 4D8VA 3K8OE 3OCCA 4IP0A 4TTAA 4F3CA 1JE1A 4MCHA 5K1ZA 5CCEA 4I2VA 3OZBA 5F77A 4DA0A 4QATA 1K27A 1CG6A 2Q7OE 4M3NA 3PNPA 3KVVA 4LZWA 3GB9A 2QPLA 4LDNA 1JDUA 1RCTE 2AI1A 4FFSA 4BMYA 2OC4A 4F1WA 1SD2A 5F7ZA 3EUEA 3DP9A 3MMSA 4DA6A 1Q1GA 4DARA 3P0FA 1Y1SA 4KN5A 4RJ2A 1YQUA 1A9OA 2GUWA 3K8QA 1NC1A 3OPVA 4K6OA 1QE5A 1PKEA 3BJEA 1T8WA 3T94A 4TS9A 4BN0A 1V48A 1WTAA 2OXFA 5ETJA 2BSXA 1A9PA 4F2WA 3KVRA 4L5CA 4PNPA 4MCIA 3E9ZA 1T8YA 4GLJA 1TGYA 4X24A 4BMZA 3IOMA 4R2XA 1LX7A 1C3XA 1PR2A 3FOWA 1ULAA 4NS1A 1VHWA 4G41A 3E0QA 1Z37A 4D8XA 3TL6A 5F76A 1PR6A 1JE0A 1PF7E 1ULBA 4LNAA 4DAOA 1OVGA 2AI3A 5JPCA 1YBFA 1OTXA 3PHCA 4L5AA 4OGLA 3NM5A 1A9TA 4JOSA 1Z35A 1YR3A 2HSWA 3QPBA 4QAQA 3DJFA 1V4NA 4D98A 1JPVA 3KHSA 1PK9A 4TTIA 2AC7A 4M7WA 4YO8A 2HRDA 2B94A 4R2WA 2H8GA 3EEIA 1V2HE 3FAZA 1TD1A 2QSUA 5KB3A 1U1GA 3DF9A 1ODKA 4EB8A 4MARA 4OGKA 3MB8A 1Z5OA 4P54A 5CYGA 4EARA 1YQQA 4L5YA 1JP7A 2HWUA 1V3QE 3NM4A 1PR0A 3BSFA 2A0YA 3OF3A 4G8JA 1A69A 2A0WA 5F78A 3ODGA 1OU4A 1PR4A 1YRYE 5DK6A 3UAXA 1PWYE 4GKAA 4L0MA 1LV8A 5CXQA 1TCVA 1NC3A 4F2PA 3O4VA 1VHJA 3BGSA 3OZDA 1G2OA 1A9SA 3INYA 4QEZA 2QTGA 3E9RA 3UAYA 5I3CA 3SCZA 3F8WA 4TXMA 4DAEA 1JDZA 1RXUA 1T8RA 5C80A 3NM6B 1SJ9A 4DABA 4TYMA 3PHBE 3NBQA 1K3FA 1ECPA 1Z39A 4QARA 1Z5NA 2ON6A 3KVYA 1OUMA 1RXCA 3OZCA 3FNQA 2OC9A 1Z36A 2I4TA 1M73E 4D8YA 2OECA 1Z34A 5F7OA 1PR5A 3FUCA 5EFOA 3ENZA 4YJKA 1TCUA 2XRFA 5CYFA 4GLFA 1N3IA 3DDOA 4TXHA 3FWPA 1RT9A 1PBNA 1Y1QA 2QTTA 1U1FA 3LBAA 4ECEA 5FAKA 4U2KA 5CXSA 4DANA 4QASA 1RR6A 1XE3A 2ISCA 3IEXA 4L6IA 4R31A 1RXSA 3BL6A 5EUBA 3OOHA
chains in the Genus database with same CATH superfamily
3CISA 3T9EA 1LNSA 3IAXA 3KE8A 4RD2A 3FNEA 1ZCAA 4J16A 2QE7D 1RI3A 2Z56A 4BNKA 5D7BA 2C7OA 1UPCA 5HKBA 2F1RA 3B53X 3DPSA 4RHXA 2K7FA 3CVUA 4LBZA 3AUJB 1OPRA 4NZZA 4S35A 2WIJA 3N70A 4B7AA 3H6GA 5CUQA 2ZRMA 3O93A 4I2NA 1E2HA 2QV0A 4JBGA 3L4BA 1UK8A 2LIPA 2XVMA 1RCFA 1U8TA 1P1JA 2J0UB 1HV8A 4N3GA 1RI5A 2VA8A 4N40A 4A8TA 1GVNB 3QV2A 3HDJA 3WQBA 4UKDA 1O8BA 1CDOA 1PLJA 1MPXA 2HV9A 1YZYA 3D8UA 4UEJA 5G53C 5HBRA 1K88A 3ZV7A 1MH9A 4C7XA 4YFVA 1L5YA 1U1EA 1V25A 2FPSA 1YSCA 1MAHA 1HOTA 1RJWA 2NZ2A 1P6XA 3KT8A 4J0IA 5JYBA 5DTJA 3QNMA 5BMVF 1TM4E 3UFXB 5FLKA 1Y4AE 1HEUA 3THOA 2VHJA 1SQ6A 3SJAA 5KMGA 3MT0A 3BD6A 3ADBA 2ZIXB 2J30A 1QZTA 4H3VA 1ZPDA 5AVQA 4G0PA 1KFJB 3NIDB 1NV8A 1D4AA 1W2GA 3HB1A 4AZ3A 5HOQA 3DHVA 4JC8A 1OOEA 2ZLBA 3DLTA 4F92B 2UV8A 5EEGA 4RV4A 1RFGE 4MEBA 2JFFA 4MW4A 2BDUA 3WL8A 3A6LA 3R0QA 5KNCH 1JR4A 2Z6AA 2ZSEA 5FBQB 1CJUC 4JA2A 4EMSA 4M9ZA 3C85A 3DT9A 4D9HA 3GLFB 3F7MA 5L4SA 4LYJA 4K9QA 3T0FA 1GQSA 2UVPB 5LYJA 3UJPA 1U0OC 2CNWA 3L4EA 3GCDA 2QRKA 4LOHA 5A4IS 5HKKA 4DR7B 4KH0A 5BNTA 1C9YA 2Q5FA 4OEHA 5H5JA 2BEVB 1S6YA 3OX2A 5TQ0B 5DGDA 3T5BA 2DLCX 1XZEA 1Q0RA 1FP7A 4BNJA 4RXMA 5JG7A 1YOVB 4BQQA 4CG3A 4HJXA 1M83A 5IVKA 1U7HA 6REQA 1T2CA 4JA0A 1NVTA 4AKTA 5U9CA 2BGGA 1YRWA 2PIDA 2QEQA 5EA2A 2VP6A 2I34A 3K09A 1Z2AA 5D51S 4LK2A 4DMUB 4CQNA 3WHKA 4XCVA 3NJ4A 4Y9RA 3EZ7A 2ZT7A 1QP0A 1RLOA 2BHLA 1ODLA 3ANXA 4UHEA 3SS8A 1OBHA 3OI7A 2ODBA 2MSDB 4LY6A 1HBJA 2ID9A 2FFAA 3G88A 1DHTA 3RAJA 4YREA 3E05A 4XSVA 1XFAA 3WGUA 5JJKA 1GR0A 3HYNA 4QRDA 1YUBA 2QNIA 4TXNA 2O3RA 2OD9A 1EFKA 4AROA 1E4EA 5KX5B 2BUCA 1ZVMA 2H52A 2ADMA 2PSHA 4IBOA 2G80A 5FCDA 1CR2A 1JR2A 4CMGA 1UC9A 2UAGA 2NPOA 2YWRA 1IOZA 1U31A 2ZR9A 2M1ZA 3GJZA 2A1TS 3VJRA 1LLCA 4EEKA 2J3KA 4F4UA 5HRAA 2C95A 3ZWVA 5KVCA 4MVJH 1GA1A 2AW5A 2NN3C 2PR7A 6ABPA 2IEZA 1IDN1 1VHDA 2OK7A 2B1GA 1AHHA 3LUJA 3V4RA 3LVQE 3I5MA 3FJYA 2JGFA 2EKZA 3GFPA 1R0XA 2FVXA 3C3PA 4HDNB 1U94A 1QH8A 1XJQA 3R3SA 4LHXA 4WXMA 4PWYA 4R9VA 4OYLA 2CMHA 5AVUA 4JT4A 2V1XA 4V0MA 1KDYA 2ZSAA 3R8FA 3T1QA 4BZWA 1ONOA 1XDUA 1IJEA 3TLZA 2PMFA 1Y5NA 3VNUA 3OWHA 2GEFA 4NMWA 3V55A 3JARA 4WKBA 4MROA 4FKMA 4KC0A 4DA8A 4TTVA 3B9QA 5DYGA 5IXSA 4ZGWA 1D4ZA 3PPIA 4B87A 2IF2A 2QUAA 4D9CA 4WJLA 4KE7A 5DCLA 2VCEA 3H4MA 2PGAA 1V45E 3RS0A 1LDYA 1B6TA 3VR4H 4IGFA 2GCGA 3H5LA 1MJGM 3ZDYB 5JARA 5JS7A 1XRMA 3JQ8B 1ZA1A 2JAWA 1ZR4A 3RK4A 3MAJA 4JI7B 3U80A 4GE0A 4F9GA 2I4MA 4X54A 3WNVA 2ZRDA 1EDEA 2ORIA 3QWAA 1DC6A 1L8OA 2FQQA 4NMXB 1V7CA 4HF7A 4D4JA 5LR6A 1YV9A 5KQMA 5KTPA 4G01B 3RV4A 2ZYHA 1U0TA 3E4DA 4OFWA 4UREA 1RVDA 5DI3B 2BEJA 5GV8A 4PANA 3PC4A 4F5YA 1HDGO 4L9RA 1J0XO 1R00A 2I4OA 4GWKA 1K92A 1W73A 2B1JA 2QM8A 2FR8C 1RI4A 4J91A 4L0CA 4L76A 1AMOA 1F3LA 3FCCA 2F8LA 2AN9A 2BUAA 2WYUA 1E5XA 3BHJA 3GEGA 4XYLA 3FUUA 3MB5A 1KBZA 3NHRA 4OMCA 1QVWA 3QWFA 4JFAA 3RCBA 3HKCB 4ID9A 3AEYA 4LXYA 2C2YA 3NC4A 3L6OO 1P19A 5JSHA 4JH0A 4IGEA 1VKHA 2I7DA 2I3ZA 4TV9A 1KI7A 1ZICA 2HY7A 2V03A 4RSGA 5JJ5A 1NAIA 1SHJA 1XNRB 8LDHA 1U2PA 3A14A 3RU9A 3P1JA 3AO0B 4WAUA 5CLHA 3JYNA 2C8VA 1U6IA 4TLEA 1DBPA 3RJTA 2VNSA 3HB9A 4G5HA 1U80A 1I1QB 2PS3A 3ZPXA 2ZRBA 3NWPA 4V0LA 3FBGA 5T41A 3O9ZA 4GOKA 1KDRA 4YBZA 1QU3A 3I23A 3CVYA 4MS1B 3D5TA 1Q1GA 1GKUB 5DULA 2FPXA 4Q4DA 5JY1A 1XEXA 1Y8AA 3B5IA 3QJYA 3IBCA 1GRNA 3SX4A 4RYDA 4LQ4A 1JHRA 4O4HF 5I7UA 4FMCF 4CEHA 2GBGA 1RWOA 1V2GA 4D9EA 4MVJP 1ZS9A 4PG4A 1BWPA 5JSKA 3RVOA 4OLBA 5YASA 3M6AA 5EINA 3TPZA 1IK6A 1A8UA 1N5JA 1FTQA 4K6OA 2JLUA 2MOKA 4B74A 3R7AA 3LI2A 2DQYA 4Q4AA 2OO7A 2BMVA 2EBFX 1ZM7A 3ZN2A 2NTNA 4HAXA 4BN0A 1I6LA 4I5FA 3R6LA 4L1KA 1G66A 4UAJA 3VDRA 3DEYX 4PLYA 1DIRA 1YDMA 2V65A 1W4LA 1XCMA 4YIKA 4B9EA 5DRTA 1Q2UA 2V4ZA 8MHTA 3KQHA 3ZHVA 4Z4CA 2EIHA 3Q7RA 4KAJA 3F73A 2VCHA 1QQTA 2ZWAA 3OM1A 2DY1A 4R71A 3LX4A 2DLDA 4C7BA 3LNTA 3FI9A 4G9EA 4ENPA 1EFVB 2PXAA 4YMGA 4F8YA 2O8CB 4C0KA 3QRWA 3CG0A 3G79A 1QGOA 5FI0B 3TRFA 4EY5A 4PYJA 3NVAA 3SLRA 2W00A 3E27A 4PNZA 3EF3A 2IH2A 1ZJ4A 2JIQA 3TW8A 2B4TO 1VP9A 1JZSA 1BJTA 3O4HA 4HVAA 3CWQA 1X39A 2BFEA 2AZXA 4M54A 1WB6A 3QVWA 4KVZA 3CCCA 2F48A 1DLIA 1LK5A 1XRRA 1WUJS 1D2NA 2GFIA 4QOJA 1Q0PA 2RH5A 3D7MA 1JE0A 4HDSB 3DVSX 4O4LB 4RWZA 3RVNA 3KL4A 3WLLA 3C7KA 3U62A 1NZJA 2QU7A 3D8TA 5KSZA 5KYKA 3PEYA 1OXKB 1F2UB 2WJ6A 3G1WA 2JKYA 4BBAA 4HEHA 4XQCA 3ZU2A 2GAJA 3AC0A 4TLMB 1VKJA 2AWNA 1GUZA 2QE6A 4IHJF 4TYYA 5DIZA 2J9FB 2VJNA 4JS0A 1MAWA 2GGSA 1LW7A 2FN8A 3MINB 2NAPA 2OCIA 3PHIA 2QE7A 4HAIA 4DT1A 4EM6A 4YPVA 2EZ9A 2Q4OA 1LNZA 4RPLA 4RBNA 4HLNA 1XJ0A 3NVDA 1F0PA 3O1JC 1UOOA 2A33A 1X2BA 3F8TA 3GPLA 2AOVA 2BMEA 5HBGA 3LP8A 3S55A 3MS2A 1KEVA 4QOGA 1NGSA 3MWEB 3U1VA 4H3KB 4RHEA 4QAQA 3SP1A 1G8KA 3Q1KA 2BONA 3QVTA 4WBSA 3OIUA 2I2FA 3IQWA 1MW9X 3THXA 3OZRA 3NOVA 3EGEA 4HGRA 1Y6GA 2AC7A 2ANCA 4PHHA 1HM5A 2B94A 3ME5A 4RHUA 1GQRA 2XVZA 4MSUA 3T3NA 1K8YB 1FQJA 2H8GA 2HEIA 3VZBA 1Y3FE 4OD0A 2XZPA 3IAAA 4RIHA 4X90A 4OGFA 4BRWA 4W5OA 1CJTC 4D97A 2H11A 3EZXA 2VHXA 4PFSA 1H9CA 1CEXA 4G2NA 3QLUA 4LMBA 4Z9BA 4IJUA 3GHYA 1WABA 2KLHA 2QVLA 3LXRA 1TM5E 4J4BA 3R7BA 4COKA 3A31A 3ETDA 1FYXA 4R8MA 4OGKA 3G9XA 1DP4A 1E2JA 4Q03A 1ZH6A 3JAMA 4OK3A 4BWGA 5KVAA 4NU5A 2OB2A 2VHQA 3QE4A 1UAYA 5LZ5A 1RBMA 4XGIA 5LXTF 2Q2OA 2QYHA 2WHYA 4YJ2F 3TLXA 4AG5A 4C6TA 3CF4G 3KTDA 2FUCA 3VHQA 3WGNA 4BKUA 2JFZA 2H06A 1XZFA 4GKJB 2II6A 3K0BA 4IZHA 1ZGJA 3X3HA 3K6SA 3OF3A 4XGQA 1JYEA 2C98A 3FCAA 2GK4A 2XWPA 4RFLA 1E2NA 3K1YA 5BN5A 3HB7A 4FX2A 1DEAA 4ENVA 4MDEA 1L5SA 3V7NA 2V7UA 1E60A 3FVQA 3RYTC 1OBVA 3CR7A 4KWHA 3II6X 5DK6A 2D2EA 1ANKA 3AYXB 1LV8A 5CXQA 2WF5A 1OW3B 3GEMA 3PE3A 2ZVPX 4N5LA 4BP8A 4GEGA 2FAXA 5AKEA 5JIBA 3PTLA 5K6AC 4I1VA 1DTSA 4PQFA 1TK2A 2G9ZA 1U8YA 3TLYA 3VAZA 4DLLA 1CFJA 1U7PA 2FSIA 3G5UA 1S8AA 3OX3A 5KYYA 1E5VA 4NK5A 1H3NA 1EB9A 1VA4A 1KEZA 4F4HA 2QW0X 1MVLA 1BFKA 4AUNA 3NXSA 4KO8A 4GWLA 4N4AA 1C8KA 1E8MA 1LPMA 3NORA 2BGNA 3FWHA 4M0KA 3UA3A 4BGIA 2IHNA 4WECA 3Q98A 2H1OA 1PQ4A 1KOGA 4DC1A 4D6YA 1MC1A 3GP5A 1QKIA 3OCVA 2I7XA 3Q6IA 1MW8X 1DKOA 1M0SA 2PRKA 3DVQX 3C1UA 3PVZA 1M1UA 3K8ZA 4R0VA 3UXYA 3UW3A 4DAEA 4M0LA 3UICA 1GLGA 3OG9A 1JDZA 3R8XA 1J06A 2RHWA 3KJEA 1DG9A 5GTDA 5DT2A 3VSBA 4D41A 4H17A 4WD3A 3NQ41 4YWHA 3ZBTA 1C80A 1WUIS 5E3IA 3RNLA 4ZICA 2GPBA 3N2ZB 1FTYA 2DQZA 3N0VA 4HGNA 2QGFA 3B6KA 5AOBA 4G9BA 3ZZUA 4BAGA 4E5MA 3N6RA 1BZYA 2HSEA 3IERA 3NIGB 1L9XA 3HKBB 3PJDA 2JG3A 2OFPA 1W85B 2RBEA 3DFMA 5ESDA 2MYNA 4J29A 1F8GA 1T5BA 1JEQA 3FDXA 4NZOA 5LBIA 1TZ2A 3QBDA 4YGXB 2B83A 4GPZA 1QBKC 1V4VA 4QZVA 2PMWB 1L7RA 4KWEA 1KRWA 2IUUA 1GNVA 1G8SA 1OX4B 5ALUA 2IX3A 1PL6A 2BFBA 1F48A 2PX4A 3KHUA 4NAUA 2EGGA 2XDAA 1PNOA 2J9GA 2UYGA 1UBMS 1FNBA 1WPQA 4AZSA 2IS1A 4HN4B 1ST3A 3DYVA 3MWGA 4QTXA 1LUAA 1IN1A 5A4AA 1R6TA 4EJ6A 1AUPA 1PJ2A 4ZAXA 2OO5C 4FFBA 1EX9A 4BP9A 4CMBA 1PAUA 5EIXA 2REQA 4H60A 4WNAB 4NYJR 1N2IA 2MYUA 2WWYA 3TBFA 4C0BA 2BY4A 2VXOA 4AIRA 1TFUA 1SXGA 3H5IA 1X77A 4PX2A 2FWBA 5MF6A 3LCUA 4UBMA 4PICA 4OSPA 2PGIA 4BLUA 1LW6E 1M72A 1EGQA 1T5LA 2ZK7A 1MP0A 4Y2GA 4CU2A 4GMXA 1JVNA 3EN0A 5FAKA 4KPUB 4QOSA 4R69A 4BNHA 1CUYA 1SK9A 2IYOA 1DWUA 3HVIA 1RKXA 4G1FA 1Z2DA 4MW7A 4RYLA 4DR1B 3VKVA 2R751 3Q9SA 4AWAA 4MPPA 4GQAA 1XBTA 3HFRA 4BNYA 1KY5A 1FPQA 4LRTB 3AM4A 4YJ3A 5J4LA 3RSZA 5I4CA 1Z0FA 5IG2A 1G9XA 2E5WA 2Z5LA 5IUNC 2YKGA 1ODFA 4BVJA 2I6XA 3BAZA 1QS0B 4CMJA 2BHRA 3NYIA 4O4IB 3DLBA 2KMLA 4CLRB 1YASA 4QFBA 1HR0B 1JXQA 4NEHB 4RCVA 3PV0A 3FWZA 3MLBA 4M60A 2FEWB 3NHUA 1Q7EA 2O5RA 2IGBA 3RBZA 4HFNA 2G71A 7ABPA 1T36B 4RDIA 4E4YA 4Q9HA 3CPSA 5AKZA 1X7WB 3GRFA 3RFUA 2HU5A 1FMCA 4IJWA 1AVTA 4MP6A 3Q15C 1GARA 2SKEA 2WJAA 3JZMA 1BEZA 1ZITA 4F4IA 5ELXA 1CDEA 1L4NA 3ESXA 4DV0B 5LYYA 1Q91A 4GKVA 5L3RA 4CF6A 1XLVA 1P2BA 2EW2A 2XE8A 1NW4A 1ISIA 1U7ZA 3R9XB 1JDVA 1JG6A 1OJ7A 1VMAA 1Y1TA 4IMRA 1S3FA 3EUFA 5H70A 5AM5A 1YZHA 1I1OA 4ZJYA 1JDTA 2X5OA 3G68A 2E18A 3ZE6A 2EATA 3OQMA 3CE9A 4O2RA 4EK9A 3FF1A 3W6OA 2YH2A 1Y7TA 1RQGA 3HUDA 3WLPA 2YIMA 1U2EA 3IH5A 2BHNA 3ND6A 4FFPA 3BMNA 3W34A 1E5TA 1USVA 4OL9A 4HOYA 3DW1X 1EWYA 4Y9DA 5F7XA 5DHTA 1YJQA 3ELBA 4TWRA 3FRJA 1DC7A 3VYRB 2GD0A 4EG4A 1KY2A 3OWOA 3EGCA 4Q48A 1BS2A 3FIUA 5KREA 3KQUA 1UQTA 5C5CA 2BTEA 3MN1A 1MA3A 2O2HA 1T4CA 1QIJA 4HWTA 2R85A 1AQUA 3IUNA 2RGYA 3L04A 4B32A 3D3NA 2DMRA 2G70A 2PYIA 2VWHA 2EL7A 4Q7EA 1WDKA 3PC2A 4LDQA 4EIWA 3A1UA 5KO2A 1NQUA 2QJWA 1CUIA 4MAAA 1MUUA 2BFDB 3LDGA 1XKQA 4F6LA 2VPQA 3NATA 5LIRA 1PGOA 5HP4A 2LRHA 1VL0A 3NHYA 2OCDA 3MJRA 1RMTA 3D7SA 5MN6A 3MWFA 1VM6A 1TTPB 3PITA 5DGHA 4DNXA 5JQGF 3K6JA 1MFZA 5EWMB 1J9EA 2AG6A 1QRUA 2XF8A 2GVNA 1ECBA 4EZIA 3KQLA 4P86A 2PWYA 5JHHB 4JI2B 1QZ3A 3QA3E 3GRCA 1PW7A 2ID4A 3O26A 4N0DA 1DQNA 1OC4A 1KY3A 3C74A 3NBYC 3ODPA 4HLUA 2OCXA 2G28A 4FNOA 5AW1A 5LOVF 1HLFA 1W49A 3T1HB 4OHCA 2H9IA 3BTSA 4F7DA 2ZXUA 3O8NA 1ORIA 5FBHA 1RHRA 3UCXA 4QM7A 4NOJA 3D8NA 4AXXA 2WZQA 3WQHA 3MUOA 2PBRA 4C4RA 2QMQA 1NXWA 5D3MA 2FPIB 5T64A 4YIHA 4M98A 4LF9B 2DFTA 4I6JA 1JGTA 1JKJA 3G7SA 1SBQA 3FYSA 2NXJA 3IB3A 4RCZA 4RA9A 5IBCA 3UGQA 1V9CA 1UC5B 1E5QA 3CFYA 4F85A 2QVGA 2VLBA 4WHMA 3UJDA 2RAFA 4JN6B 4R16A 1SULA 3QW4B 3QXXA 4G84A 4TMTA 1PS9A 5F73A 5MFPA 3SOPA 4OO3A 3RFVA 4TTJA 2VHWA 3IOYA 1JEJA 1A88A 2R6HA 2R5NA 4UEKA 4GOXA 2DB3A 3KPUA 2YY7A 4Q6BA 4FHCA 1LPNA 1G8HA 5EPUA 2Q1XA 3KSUA 3TTTA 3UHJA 4TLLB 1AB6A 1HFEL 4CTMA 3G02A 2IEDA 2J3EA 1DCFA 2BJWA 1SXJE 3H1PA 1T0JB 4MRNA 3U4GA 3HJHA 2GHRA 1WZUA 2PNFA 3E3AA 5JDIC 5JR3A 1PV1A 4Y6PA 4P34A 5KTOA 1D5CA 1NF9A 1ADFA 2C58A 2I7TA 3MJVA 3HKDA 3SPXA 3WL4A 2P8SA 4Y1FA 4L5IA 3E5MA 4UTNA 1F1JA 4NBWA 1U1DA 4DLKA 2JGIA 2BT4A 3NBAA 3IR5A 1GRQA 1OPXA 3C48A 3P52A 2FB9A 4EFLA 4Y6LA 1Y89A 4AWBA 4BQFA 2GA9A 1RZ3A 2IZ7A 5G4KB 3LKVA 4V1CI 4YQYA 4JJ4A 2A5YB 1YRBA 5BSMA 5BT8A 5KYGA 4TZ6A 4BJ5A 3K0CA 4ZT7A 2MCFA 3TZ6A 2OGTA 3VC1A 5BOSB 4YJGB 1VLVA 1M0WA 2AN3A 2Z8ZA 3H4IA 3K1AB 4I5EA 3ZHRA 2K6GA 3E1SA 2GARA 2I4RA 4NFHA 1Y8CA 2YHAA 2WT8A 1WAMA 1ZIPA 4WZBB 5IKOA 3SVZA 2NVUB 4FN4A 5IKMA 4WKGA 2IS2A 4DMGA 2OCLA 3S6JA 2GRAA 3M4ZA 4AQDA 3K70D 5K1ZA 1DRVA 2UZAA 1QFZA 4CG0A 3KQYA 2ZI5A 4QAJA 4Z49A 3LT1A 1GQ2A 1ISPA 1GAEO 3QPCA 2R4TA 2CFTA 1XDBA 1FFCA 1PGNA 5C31A 4AF6A 2NSYA 6GPBA 4CIYA 5JFTA 3H9BA 1KIFA 1ZD4A 2GZ2A 3SKYA 3PJRA 1KU6A 1T4GA 2BAGA 4RVNA 1BGXT 2WE7A 1O5IA 3PNPA 1KPGA 1A97A 2O2EA 4MRPA 4CR7A 5HM6A 3C3YA 4FMDB 4OIMA 1NMQA 1S7CA 3LX8A 5E4YA 5EYPB 2O9JA 3U9SA 4JKOA 5DN6D 3L6DA 2FK7A 5K0TA 3Q3EA 5K51A 4RH3A 5K3AA 2DM6A 3EGDB 1F5NA 2RDMA 3LUKA 1JDUA 3VYUB 4F84A 2VTBB 1JIQA 1EKXA 1XMVA 3LUFA 2VZ9A 3V4PB 1Q21A 1YZQA 4MQBA 3DHEA 3JZIA 1B0UA 1M2OA 1D5WA 2Q6TA 4NP6A 5DM2A 4A27A 2FWJA 5C5EA 1V35A 1Z2OX 4LI0A 4X93A 1EA5A 1AKTA 4JL8A 4TQAA 5FULA 1GHTA 4IDGA 4DARA 5FJIA 3WMFA 3UWMA 4HQOA 1URPA 2OWDA 1DAIA 1KJ9A 1EM8A 2R00A 3VTAA 5ITSA 1CJBA 4QO7A 4PX9A 1WMEA 5F33A 2R44A 4I4TB 3MTAA 4WLUA 3VNAA 4CKZA 5LQAA 3HVUA 2NADA 3QTTA 4BDTA 3L8FA 1CQJA 1CPYA 3V8BA 2AOUA 1K6IA 3K0SA 2UKDA 3T3EA 1LSOA 4IOJA 1VPWA 2YV1A 3F47A 3LZ6A 2P9ZA 1KE1A 3S29A 2MINA 2YDXA 4LDRA 3A7DA 5FKJA 5D00A 2KX7A 4W7IA 1AKWA 2AMFA 3C24A 3CVVA 1W7AA 1YFZA 3B1JA 4FC6A 3ICWA 2XBLA 3DXFA 4FOPA 1US8A 2PE5A 2QMEA 3FSEA 1TJYA 1WTAA 2ZWPA 3IA2A 3GVIA 3W7BA 5KOHA 1H2RS 2BSXA 2MMCA 3P9XA 4Y9SA 3EGOA 2ZJFA 2C2ZA 1ZJYA 5F52A 1LBHA 1YE5A 3ZKWB 3QENA 4UTPA 4RE6A 4FU0A 3O4GA 1XMOB 1RLUA 4MS4A 4ARSA 3R3WA 4ZOLF 4QTTB 3WLOA 4MR9B 1HTBA 4U2DA 5KYVA 4DZZA 6CHYA 3ANTA 4C03A 1PR2A 2CNOA 1B93A 2LIVA 2RE8A 1L5OA 3ENQA 1TVMA 1U0HC 3WIEA 4K0RA 2MYTA 5L3SB 3MJCA 3RYHA 1SCUA 2ZZMA 1CRWG 1FFYA 1KHTA 1MC8A 1PFGA 1U3TA 1GA4A 2XEDA 1K7SN 1MABA 3OF2A 4HADA 2X77A 3WLIA 4HC4A 3GK3A 3I9OA 4RJLA 4UTXA 1RLIA 2GPSA 4K7JA 4EUEA 4C4ZA 4CLHA 2DUMA 4TYQA 1J8VA 1EUCA 2GEJA 3AEZA 4QD3A 2OBLA 3NFYA 4TWZA 4XUDA 5BQOA 3DCJA 4M1MA 4J2OA 5CFLA 5JJLA 1OVGA 4XEUA 1QNFA 5ALTA 5FD8A 2R68A 1YR6A 3AM5A 2PQ0A 2AEFA 4IFTA 3V8NA 1MX3A 4EB6B 1XN4A 2IZ1A 2B30A 1MOPA 3FA2A 4LPKA 3E9YA 3KKMA 3U3XA 4RULA 4NPCA 2ONJA 2XXAA 3BE8A 5KTRA 4JYPA 3EG9A 3QEKA 5DP1A 3IIMA 4F3NA 1KEEA 4CQJA 2IE0A 2ZRKA 1WCWA 3DOEA 4B09A 3TOVA 2C4VA 2L69A 3RADC 1YNSA 2WHXA 3AEKB 1R0SA 3UB3A 3MJHA 1KYYA 2I6GA 3UV7A 2ZRJA 3TB4A 3AI3A 4I50A 4KEAA 4V3CA 2Y0CA 2Z4RA 3CLVA 5H7XA 4B17A 4OHYA 1XFDA 1A76A 3BZUA 3KEOA 1NLFA 3K94A 4V2UA 4XXHA 2A9KA 4Y3UA 4JAVC 4MI1A 4HNHA 1PLKA 1SCAA 1YQXA 2EOAA 2G1UA 3O1LA 3P2OA 1XL1A 2XWSA 3I9JA 4Q02A 4R2WA 4RVOA 4U6QA 4ZVLA 6PFKA 4AKGA 3KOWA 2XWBF 1M67A 2QZPA 1IRIA 1VL1A 3GQBB 4R5HA 2V9ZA 4AN1A 2IW1A 2WJIA 2ECQA 3ISVA 3CZQA 1EGAA 3FYUC 2CFIA 2LE0A 3DFZA 3RRFA 2EF0A 2D1SA 1BKDR 1XCBA 3WZMA 2Q0XA 4QNMA 3CN9A 2EEZA 1GO2A 2Q1WA 4HNAB 1XV5A 2C4UA 5AW6A 4ZHSA 4ZI5A 1USKA 1ULTA 1VDZA 2DWPA 2PX3A 2WZBA 4JLNA 1NZDA 3F97A 4MVXA 4XSGA 3OTHA 4D5GA 3PRKE 3BCRA 1N5DA 3WLSA 4X6YA 3TI9A 2BKAA 2BGKA 3TR5A 3LWZA 2QT0A 1Y3DE 5DW3A 3ESAA 4CKEB 4IIVA 1J8MF 3DHWC 1RAFA 2YWCA 4CEIB 1A1SA 1BNCA 3WIVA 5LDHA 4PYNA 4LIPD 2P3SA 5EKSA 1QAQA 2VYND 4N47A 1NW7A 3BMQB 2ZJ3A 3TLJA 2QR5A 2HV8A 4Z7QB 4JR0A 2COEA 4YJFA 5GONB 3EOBI 4P3NA 4RNCA 2Z9CA 2JGKA 1M6VA 4R1QA 1J22A 1E6WA 2EX4A 2QT1A 1ZONA 4GO1A 3RFFA 4ODIA 3RS5A 1LXCA 1ZZEA 2H5IA 2MHCA 5KNDH 2W0MA 1TA0A 3E7DA 4BASA 3NETA 1CZHA 3SIRA 1T5SA 1KJ8A 5I9NA 4KSBA 2JHFA 5C46F 5JCJA 5KPDA 1QQBA 1XYGA 4O3MA 5DMXA 1V7ZA 2ZPUA 1OI7A 1X8KA 5D85A 4N12A 4Y2QA 3BMOA 4IO0A 1D4OA 3NTQA 1NATA 2GHTA 5LVAA 4OLAA 4FHZA 1ZRNA 4CODB 3ZGXA 3OU7A 4UVIA 1XD2A 2N1BA 2Y1EA 5CDYA 5DSTA 3WLRA 3DTNA 1YVEI 4DC0A 3SHOA 2R1TA 4B3XA 4BC1A 3I1JA 5B3AA 3VDNB 1M6EX 2VDNB 4HNQA 1WB4A 4KIUA 4OM7A 2VSXA 4PE5B 4D46A 2VIIA 3NHSA 4GLOA 3IVAA 4F7WA 5K03A 4XX0A 3F8WA 3LBYA 3DBHA 1Q7TA 1NDUA 1FQOA 5KYUB 1T1GA 3HQ4O 2JANA 4EKIA 2J0EA 4GAEA 3RYCB 1QHHA 4UAVA 3CJQA 4MLZA 3OT1B 3PHBE 4BVLA 1XRSB 1U9YA 3LT2A 2CZCA 3WGHA 1RQLA 3KZXA 3Q7SA 1K3FA 1SXJC 3I0MA 1UWKA 5HIJA 3F6YA 3TJZA 4HJRA 2O7QA 3BRQA 3IR7A 4QG7A 1GTL1 3VU3A 1NIJA 1ONNA 1OXSC 4QGGA 5CFNA 4QQNA 2QN8A 4B2LA 4LQDA 1IHUA 1E3TA 4JQSA 2QRMA 3W9UA 2XY4A 2YYYA 1I3CA 4G3XA 1KP2A 3UC5A 3L0OA 1EX1A 2M6LA 1YL7A 1F8FA 2WINI 4MRMA 5HGJA 1A0OA 4QXMA 5A6SB 4K6FA 5KNBD 3LBHA 1YH3A 2D4AA 2ID8A 3F3MA 4LCJA 1TTHA 2C5SA 1JILA 3OP1A 4MYDA 3ZTYA 2FXVA 3FDFA 1WJGA 1NVMB 2ZTMA 4WRRA 1RP7A 3HXMA 3MM4A 3T3IA 1WULS 2GSDA 4UM9B 4MGYR 5DM60 2D0PB 1CLEA 1WNFA 4NBUA 2EKLA 3FMOB 1BTOA 3RAGA 3SE0A 3VPGA 1UJNA 3STYA 1U0LA 2V0NA 2VRWA 3GAAA 4AUEA 4TMFA 4JJGA 5FDFA 4P7BA 1KJJA 3RWMB 5ALFA 2Y2UA 2ZB8A 3RABA 1ULSA 3WHIA 5BYAA 5CR9A 4ZTZB 3AETB 3EHDA 2G9VA 2J5XA 3FGZA 2FN7A 1U3CA 1VYUA 1KZ4A 4BNDB 4G0MA 1JEAA 2XW6A 4FQ5A 4F6RB 1QC5A 4J4HA 4C5BA 3TSAA 1JEEA 2FMTA 4WFJA 5A4DA 1U3UA 3DL2A 4AVYA 3UJ8A 4P58A 1V8ZA 1FRNA 3NEAA 3E22A 3IP5A 4AKEA 5CH3A 4CQMB 4DANA 3H2BA 3COYA 1E2BA 3PIRA 3C4QA 4BCBA 2ZBDA 1VTKA 5K9ZA 1P0QA 2QX8A 3GYGA 1F8XA 4HPWA 4I1OA 4ND8A 2I87A 4WMLA 5DN6A 4EW2A 5K05A 3PFWO 1ESEA 1PZHA 3F3KA 3QA9A 4FEAA 5ANRB 2AFHE 2HA3A 3G2PA 4OV6B 5IM5A 1HDOA 2QKYA 5DHFA 2ZJ6A 5FWYB 1Q17A 2Z2ZA 4Y1GA 1T1IA 2ABWA 3M6IA 4N65A 2AR7A 4NNJA 3T1NA 1YRAA 5EE0A 1ZIXA 4AN0A 4DJEC 3NU1A 1WZEA 3GFOA 1W35A 2P9JA 2J07A 1OU0A 2ZUDA 3KTOA 1PNRA 3BHMA 4FT4A 1F51E 4O4JF 2YQ4A 4LPSA 4FI3C 4B4KA 1K7XB 1EVQA 1S8FA 1BA3A 2GR9A 2O1WA 2WV7A 5IAKA 5E4FA 5AM3A 3FOZA 2Q4TA 4LRSB 2JAXA 3P0EA 3JWHA 1NT4A 2P9GA 1U8UA 4XQ9A 3ZWAA 4EI7A 2EJVA 4Z4FA 2CVQA 3ZU3A 2LP4Y 2QUHA 2VNJA 4KYIB 3OPQA 4N8DA 3NDJA 1JTFA 2JCBA 1ZAYA 2Z2JA 3GEEA 2H2AA 4I0WB 3ZE1B 3V1YA 3ICVA 3HR7A 1JVSA 3ROMA 2XSZA 3LV8A 1K1EA 1AHPA 3OOEA 3DMPA 5C18A 4ZK2A 1BVUA 5EIWA 1E1CB 1JR3E 2Q8PA 3V4OA 3GLIE 3S8YA 3AUUA 5A0FA 1KI9A 1ORRA 1JZTA 1TYEB 3D6AA 3FWYA 2UZ1A 4PRLA 1HSZA 4YI5A 3RG2A 1HK7A 4MZDA 3TLMA 3W6NA 2AG8A 2QN3A 3KUUA 3CCFA 4KDCA 5KSWB 3SM3A 2G36A 2YZMA 1LLDA 2WOJA 4KIFA 2QF7A 3KEFA 5LD2C 3KWMA 1JL3A 1PD0A 1CQXA 3LP6A 1T3GA 2K7ZA 3SC6A 1CRPA 5FNVB 1KS9A 1PZXA 3F2IA 2QTWB 2PXCA 1FVOA 1UXHA 4IDNA 4AMGA 4W63A 1RJ9B 5I8WA 1FB5A 2C5LA 4YCLA 2BM1A 3FDIA 4B4DA 1UPFA 1VI6A 5L8VA 2W42A 2QAGC 2G1AA 3KJQA 3OCZA 2PVCA 3KJXA 1TJNA 621PA 5I7WA 1B74A 3WBKA 3EPLA 1U98A 1KK2A 1F6WA 4ZOQI 3ZE9A 1X7ZB 1DXYA 1N1MA 2DWQA 2W8BA 4YUWA 1GP2A 2J32A 4MGKR 1I10A 3FLAA 4D4GA 4ZEMA 1L4HA 2O7NA 4QGBA 1KZ9A 2CYBA 3L7NA 2OD7A 5E7MA 4F5EA 5BUSA 1JA9A 3W5AA 1U8FO 1JEYA 1U2DC 3V1NA 1QO0A 1WP4A 2E4YA 2PS9A 3NRCA 4NICA 2ZDGA 4PG6A 5FFFA 3DE5X 4ZAFA 1CRZA 1W88B 2IYWA 2UYYA 3ENKA 4O0MA 3MJEA 4D0RA 4D9IA 5A62A 3HXOA 2CLSA 2IEIA 1C14A 3KOYA 1X7HA 4YAJA 3IJRA 4B48A 5A3JA 3PE4A 4NJOA 4C7OA 2O3JA 2Q0QA 3P0IA 4E2YA 1VHTA 3T8YA 2OMEA 3LC2O 5CNMA 5EHNA 1L4YA 1R0WA 4HXGA 4WLVA 2VJMB 5EOVA 4KZPA 5ARBA 4FFVA 1U2GC 1PYOA 4D74A 2JGRA 2QRVA 5JS1A 1D8AA 4M8LA 4PHGA 2IYSA 4LHYA 5J47A 2PZGA 2R6GA 5K09A 1Z0ZA 4QYIA 2ACEA 2PHZA 2X19A 1JX6A 2XLBA 3NCTA 4XM1A 5K4AA 4BKQA 5HRUA 1RYBA 1FQKA 1B4DA 1DIOB 5G0TA 1KQFA 2BFFB 1TE2A 5FWXB 1TZMA 4LRWA 2I22A 3C0KA 1FU4A 5LP6F 3OA0A 1XQ1A 1SC9A 5AJHA 3QOWA 1EDDA 3IPRA 4DJDC 2B78A 4ZDKA 3DV0B 3AHGA 3ZGYA 3WV5A 4AQYB 1NJ8A 2B5OA 4MTCA 4Z9YA 5T4EA 3JQAA 2Q9AA 4HYEA 4JLDA 1EFLA 2R84A 1YR1A 3FNFA 4CL2A 4IH4A 4FHGA 3I2KA 3R5TA 3CGWA 4RMJA 1WW2A 4TL6A 3V1LA 1NRJB 2KS6A 2ORED 3SDZA 1JDNA 5JHGB 1EK0A 5CB0A 1DCKA 2GJ9A 3Q11A 1QYXA 3CLUD 1OFUX 4PC3A 4BLTA 4DPMA 5CB6A 2PUWA 3GHHA 1W5AA 1I4OA 1MDBA 2GZRA 3PGMA 4IXTA 1GEGA 4DIKA 1PDWA 1GNLA 2ZAYA 2HU2A 1Z6TA 5D8DA 3EQ8A 5WRFA 3FOCA 1B43A 1RJGA 1RPZA 2VYNA 4BO3A 2ZJ5A 2GJKA 4O2BF 2BLNA 4MQFA 4J75A 4DQUA 4P3OA 1Y3AA 5CFZA 1SKBA 3KHTA 4ML3A 2CNDA 1HTWA 4J0FA 4F6CA 3EIFA 3GJTA 2UZ3A 1KKMA 4H6WA 3HI6A 1P5ZB 3LQYA 4MQEB 3SG0A 2OCKA 2PR2A 3QKWA 3VPBA 4CI9A 4P82A 4DGSA 1C3VA 3X43A 1WD5A 2NVOA 4FK8A 4TVKA 4B5LA 4EHNA 3KZOA 1N2BA 1N9GA 5C5DA 4CU5A 2W2KB 1K89A 3FPHA 4UTZA 3PCXA 3OJEA 1FFEA 3EXHC 1TUBB 3ZNOA 4DWVA 4EW1A 1S1CA 2CWDA 4YQFA 4GZ5A 1ZOOA 4BXOB 5EWLA 1E79D 1MOZA 5F1OA 4M83A 3IV6A 3JS5A 1OBOA 3AJ8A 3EZ9A 1WKCA 1NXQA 1WXQA 4FGKA 4NDAA 3AKDA 4RTMA 1DBSA 3L77A 2AD1A 3E0XA 3H5TA 1YULA 2PWPA 1F7VA 3U19A 3CE6A 4GFDA 4BIIA 5DEIA 2B4QA 2QG9A 3OOSA 3DWIA 3P9PA 2GM5A 1LRKA 4QJ5A 4Y6OA 3WKDA 4IFIA 3ZOKA 3GGGA 2Z8YM 4FMPA 5MDHA 3PFCA 4GYKA 1LC3A 1E77A 3I37X 2XODA 5AKXA 2QLJA 4BGDA 5HHTA 5I9LA 1JH9A 1KEKA 1DKMA 4DLXA 3HEBA 5REQB 4PAOA 3KQTA 3MFYA 3ECAA 1G21E 4RIGA 4M9SA 4N03A 1VL5A 1LS6A 5IC6A 1T6XA 3T7KA 4DN6A 3KKZA 1TQDA 3E8XA 3NT2A 3IHLA 2EFCB 2WP0A 1DGQA 2O2JA 3L1IA 1P1RA 3UAOA 2G5CA 3DB2A 4RA6B 4PHFA 4XOUA 3EIWA 3WTBA 5JCZA 2GUWA 1Q57A 4ZPXA 1G5RA 2E6UX 5B58T 1P31A 4GVXA 4QDTA 3UFXA 9ABPA 2CC2A 2BVNA 1IUPA 4M46A 4KLAA 2YNMC 2EBUA 2JIDA 1SELA 5KNBA 1XD9A 3CJRA 3ZWOA 3QJ5A 1N4AA 4AUMA 4OCZA 3LRTA 3OECA 4H0CA 3ONWA 3TR6A 1CY0A 3FWNA 1H2BA 1RAAA 2H63A 4IMJB 1HYEA 4QLOA 3MQFA 3UANA 2OOSA 3HU5A 3AM3A 3CU5A 3PHGA 3A9CA 3LDUA 3JCZA 1MHPA 1TEHA 3HA3A 4G8DA 4JEIA 4MQ5A 4CKCB 3N39C 5H9WA 2BJVA 3AQ4A 1B2RA 2OAGA 4C20A 2HLPA 3O8LA 2JLYA 4EH1A 4GOMD 1G16A 3ZI7A 4BV9A 2JFBA 2AN1A 5AOAA 3TRHA 4ATNA 4ZCQA 4CIDA 4RZ2A 5HILA 2V0GA 3G2LA 3L3BA 4IRXA 4RAOA 4PYRA 2PJZA 4N3AA 3FKSD 4Z5XA 5K0GA 4EO7A 1DEXA 2GDJA 4E5KA 4MYCA 3SC2B 1H2FA 5TQ0A 2PN1A 2AZDA 1NBWB 2SNIE 3ZWKA 1FLVA 3ASUA 3ETLA 4QDXA 3EZNA 1HTTA 1M5UA 1YOVA 4AKSA 4RMNA 5EIBC 4ZO9A 2ACKA 2ZAOA 5JEDA 1CBUA 3LZDA 5JV5A 2VYVA 2OLKA 2C2WA 4L75A 5U1PA 821PA 4IM7A 4L4RA 5IHPA 1KETA 1ARZA 1GNTA 5JT1A 4DG9A 5EPOA 1XZGA 2WRZA 3LQ4A 3V48A 1NMYA 2X5XA 3VNBA 2O2IA 5IM4A 4JBNA 5FTWA 3LCMA 4OHZA 1CUFA 2V5VA 2RHJA 1Q0SA 3E18A 1XXHA 2BJHA 3ZIDA 1U9JA 3CLKA 3K31A 3N0RA 5CA0F 4ABTA 4HDOB 3I64A 1C4WA 2DBVO 1OWMA 4LQCA 5E7JA 4YO7A 4J1TC 1HXHA 4BVFA 3FM9A 4DWJA 5FL3A 4LGMA 4ZP1A 2ZP1A 5CH5A 2B7BA 1THTA 1WHSB 1V8BA 3BSWA 3FETA 1YB2A 4M1ZA 1U1IA 4ZEXA 4AURA 5BVHA 4AMVA 4ZTUB 3RT9A 1V39A 1D1PA 4IZOA 1XAGA 1V4NA 1Z2PX 1A2BA 5LQKA 2ZUSA 2WJ4A 3QZUA 1FNNA 2BM9A 2NTVA 4EELA 3HWRA 1GLNA 2ISSD 3KSMA 1CUHA 4X7RA 3I01A 4NC9A 5A7FA 4OXYA 3UZUA 3MZ0A 4G8BA 4LQLA 1LJLA 3W6PA 3PT9A 1E18A 3TF5A 1ONPA 1W48A 2QSUA 1L8QA 2YYAA 4TUYF 3V8QA 4IDHA 3WLHA 2CLOB 4R54A 2YWJA 4F71A 3DF9A 4HDNA 1YS7A 3CF2A 2FMUA 3FY4A 1CS4C 3HYLA 3NUGA 4LVOA 5DYNA 4ABYA 4DR5B 3H75A 4FDMA 5JY6A 3K4QA 1RXEA 1XDGA 1QZXA 1Z83A 2KLBA 1IM2A 1UQRA 4L8YA 4LOLA 1TPYA 2JVJA 5HJ2A 1PJ4A 1X7XB 2RGNA 2V98A 1L5MA 2ZE6A 3R6DA 2WWRA 4Y0VA 2QMUA 3CZPA 4MW9A 4RNDB 4C05A 1O0BA 1N3BA 3FNRA 4BL5A 2FUG1 2JI9A 4JJFA 1F5SA 3WFZA 2Y99A 4MJXA 3C4VA 4JLAA 4YUYA 4LTDA 5ES3A 4EI2A 1N5OX 2FEOA 3BXEA 1DAMA 3JQ8A 3QUTA 1USWA 3ZHZA 3PDWA 4BB9A 3IRVA 3SHQA 4CKBB 4G8JA 2PL3A 1A69A 4WXEA 2B5VA 5EI5A 1C7RA 1Y6JA 1H3EA 4M9CA 2FZVA 4QOFA 5G1OA 1MJ5A 4L85A 2ZKLA 4CKYA 5ILOA 3G2OA 5FT9A 3DUFB 4F2GA 1OU4A 3VISA 3B85A 4UE6A 8ABPA 1GCAA 4U2BA 5JAZA 2AZ4A 4CZ2A 4LGCA 1T5IA 3F6SA 3F8SA 3PJFA 4Z99A 2GBIA 5AUNB 5LMCA 4G67A 4WERA 5DB4A 3OA2A 4FW9A 1GTG1 4ENUA 4FCVA 3CXUA 3AILA 5DYYA 4BVGA 1OGYA 5AI9A 4YEDA 3G59A 1D6NA 2ZSIA 1IY8A 1YZKA 5KYWA 4O8CA 3BPSA 3HUFA 2QJOA 3PUYA 1VE9A 3OZDA 2TYSB 4LDAA 1BE1A 1J2RA 4JJ8A 5EZ5A 4D4LA 1F9AA 3SYLA 1TNDA 3L5OA 3OY7A 3T1YB 4EECA 5E38A 2BKVA 3WSWA 1J49A 1FDUA 5AK6A 3L9WA 1JFLA 4TKVB 3FN4A 1E7WA 2YBEA 4GLBA 4C7JA 5B4VA 1CUAA 3C5VA 3BEOA 3MS7A 3RW9A 4AU1A 1ZI9A 3C3XA 3VH1A 1DIHA 1UKAA 3R0JA 5KOJB 4D42A 1ZGCA 1FBNA 2Q8QA 3QXSA 2QM7A 4ETWA 3A06A 1LTHR 1Z0JA 1R6AA 3HNRA 2P91A 4OHPA 4Q66C 4QDZA 4DCVA 4E0BA 3F5SA 4EY8A 2HJHA 1IH8A 1MQSA 4DVGA 1P9LA 4BFUA 4IQGA 9GPBA 3U7FB 3ZJUA 1RBQA 3ZW8A 3HY3A 2Z2XA 3MGAA 4B6EA 5EXSA 1V1RA 1MQ8B 1VYVA 1U28A 4CKXA 5LD2B 3UOAB 2BE9A 2VATA 4MKGA 3ZJTA 4GL2A 1P4HA 1F4VA 4F97A 4CM7A 1KDOA 2AZMA 2EVWX 2XE7A 3Q5EA 3WYGA 3SOZA 2FX5A 2W2TA 1YMUA 4KU4A 2Z2YA 2ZWMA 1I4TD 2GJSA 1FNMA 3BXPA 3DEIA 4ND3A 5CURA 5AJUA 2PL1A 4DF3A 1G20B 4OHWA 4QXOA 1OIXA 1KAQA 3ZHOA 1V11B 1WA5A 3C3EA 5IJ0B 1ETHA 1T43A 2R2GA 3FVRA 3GEDA 4NYMR 3SYNA 5EGSA 3TOXA 4OOEA 4YP1A 2VK1A 2CEAA 5CLJA 1C1HA 3N28A 3LT4A 3ZE0B 4QO8A 3JTMA 4XWWA 1H3FA 5FPQA 3UJBA 4JL5A 1FFAA 5FWNA 1M6HA 1RWXA 4A03A 1Q74A 1SRRA 2IW3A 3LYAA 4XEHA 4I8IA 4XE5A 3V97A 3TLAA 1ISSA 3GLHE 4ZTBA 5AVKA 5KSPA 5JXWA 3V5NA 1P5FA 2A4KA 1GGKA 4CIXA 1NVFA 1GAXA 3O3MB 3D5EA 5A7HA 1HQKA 1MENA 3KPYA 5FBRB 1N9ZA 1PEAA 2JZOA 2WUEA 3B1YA 1GG5A 1QWSA 4KN9S 5DLDA 4ZZ1A 2A2ZA 1RZVA 3IVMA 3UEOA 4YT4A 1U1FA 3NIFB 4BO8A 4HDSA 5JD3A 4O4LA 5LL6P 2JPDA 2QUJA 2HHLA 3GLUA 4QG3A 1HQDA 2JDID 1F2UA 3D3EA 1X1BA 1E79A 2ACWA 5ALWA 2J4DA 2WZDA 3FNIA 4H0FA 2KWIA 2PM8A 5IP5A 4DEYA 1SB8A 3ROGA 1CRQA 4N76A 4IS3A 3WRWA 1FP1D 2J9FA 3CNBA 1WMAA 2D5BA 4HWSA 1L8LA 2QG4A 2E5FA 1T6BY 4MI9A 3A9WA 3CRNA 3MINA 3WWPA 3IQXA 3KUDA 4XQGA 5DWDA 4IUCS 5EJAA 1WMBA 1PR1A 1QFXA 2YHIB 3A1CA 4P93A 3SS7X 2HHHB 1WQ1R 2PJDA 1W0JD 1XX6A 4EHHA 1PG0A 4EVIA 1WDMA 2QX4A 3GLGA 1Y8ZA 2ZZKA 4TN1A 1FOEB 2JH9A 3OPYI 4EX6A 3C3BA 4PQGA 1Y4SA 1ADCA 1Z0AA 4D9MA 4I9NA 5LNK1 5IUKC 5CDUA 1ZGGA 2ZB2A 1N32B 1WPXA 3CKLA 4JX9A 3UG7A 4JQOA 2JIZD 3DXZA 3ILHA 4JVSB 5D6NA 3T54A 2R4UA 3VTZA 4KMSA 3UMVA 3ZXYA 1UJ5A 4DJFC 3ETJA 1UMCA 4E4RA 2QORA 4YLEA 4URZR 1NP7A 1RTTA 2OHJA 4FDAA 4GXTA 3DMNA 3COVA 5ER9A 2BSQA 2P5UA 3S81A 4ZKEA 1QB8A 4A36A 3EZ6A 5JLAA 3WJ7A 1LLQA 3PGKA 4XWYA 3OLCX 4TQ9A 4B6PA 3HU1A 1V5GA 3RS4A 4IZIA 3KZKA 4G6ZA 4XGKA 4LISA 5HJ7A 1Y6RA 1ZHHA 1GZHB 5KTTA 2ZIGA 1OWNA 1ZJWA 2JHAA 4Q18A 1LLFA 1A04A 3VQTA 4DVJA 3ORQA 2PL5A 1CUUA 2GCNA 4YDRA 1BX1A 2BV3A 4MV6A 2AQKA 3GRRA 4Q3CA 1EP9A 4IGKA 1APBA 3BRCA 4GU5A 1QZUA 3VR6H 1NSTA 1D1QA 3OE5A 4P32A 3LGAA 4NONA 2VSQA 1C1DB 3FSJX 3HA2A 3HL0A 5EN4A 3VKUA 1X7DA 3GD5A 3GA0A 3L7IA 3N9IA 5IFKA 1DMRA 3H1BA 4EJSC 3N8KA 2WT4A 3SNHA 4WZ6A 1YVUA 3ZGVA 1Z62A 3DCYA 1DJLA 3FKSA 3K9BA 2QTHA 1SBZA 3R5FA 1FYWA 1K9SA 1I5OA 2PWBA 3M6XA 1PT7A 2FUEA 4AJ4A 3LFTA 4EPTA 3CLSD 4XD7D 4I3HA 1SY7A 1U04A 4MQLA 4P98A 3T06B 1FNSA 3PFHA 1R18A 4ND6A 4PO3X 3KLNA 1NSYA 2IHUA 4YP5A 2Q7DA 5IT0A 4JP5A 2WWGA 4GVPA 4JCCA 4YCBA 1SWWA 1TC2A 5B53A 4WJKB 3P0HA 1X8LA 2DPMA 2OGZA 3FMIA 4XOIA 3N59A 3KUXA 1XUOA 4DRXB 4IMPA 1SC4A 1R15A 4MEJA 2WMOB 2IHBA 3OFNA 2YUTA 4WY2A 3LTEA 2R79A 3RS7A 3RBAA 3R0IA 1OZFA 2P78A 1FNCA 4M1WA 1OB5A 2YW2A 1BXKA 2C2KA 5AW2A 1N4DA 1YU6A 1IVYA 3PYMA 1UF9A 2I67A 1JQDA 1AKQA 4OJTA 1RPJA 4WKOA 4YRLA 3T9FA 4KIWA 3LC1O 1QG6A 3ZEAA 2Y4NA 3GGSA 4IIJF 4FZJA 4DCNA 4EY3A 5LBUA 4UXHA 1ZY2A 2A7QA 3LD9A 3ZBUA 2JJ2D 2FFQA 1OH8A 4HZUB 1R8YA 1Y63A 4I14A 1CW2B 1PYGA 3UMFA 4FHFA 3ZY6A 1FIUA 3U4AA 1X74A 2AT1A 2O14A 3EVEA 5CEEA 5GM1A 4WZAA 4J1SA 4MIEA 4JXXA 5L7YA 1OSNA 3PLAE 2PGOA 4WDQA 2X8BA 3A3NA 4B83A 1NP3A 3HKBA 1X3SA 3G6WA 3K0HA 3M6FA 4RZQA 5HNKA 3AERB 3B2NA 1W85A 4PNHA 2R8RA 3S2IA 5KQRA 2QN7A 3PKIA 2DSTA 5JZOA 2FFHA 1I36A 2NZ8A 3NTOA 2AA3A 1ZP6A 5EESA 1TKCA 2ZI4A 5EP3A 3TOSA 3DWGA 2I1QA 2ZUBA 3W9YA 1Z18A 3M1LA 1TK9A 4KYTA 1MCZA 1U3WA 4JT8A 4KX3A 1OAKA 4Q1DA 4UDXX 7ADHA 5I7OA 1OX4A 1YS2X 2CEKA 3DD5A 2VDKB 3HM2A 2DHQA 2NO1A 1E8NA 1M8PA 2RI1A 3IQEA 3KU1A 3EGXA 3KXKA 1M2VB 3VH4A 3EQZA 3I0NA 3NHFA 3U7QA 4C3ZA 3KP1A 3ZHSA 1SQSA 4JBIA 2Q1TA 3QBJA 4L16A 3V2GA 4UBOA 4AWXA 1OFHA 1TIBA 5IAGA 5EHXA 3ENWA 5DHUA 2PMCA 3ND5A 1IHPA 1IN4A 2IU3A 4XDZA 1QJ4A 5IULC 5LQDA 4L74A 3ZHYA 3IP7A 5A9SB 2QOEA 3PGJA 1H5QA 3BGWA 4QPJC 3SZOA 4D8VA 3FPAA 3K8OE 4YHHB 5E3JA 4WCVA 3JZAA 1XQXA 2Q1YA 4Z53A 1EU1A 3D59A 5KC8A 5K4GA 2ODTX 2YHUA 3WVNA 3X2FA 1U8ZA 4M0DA 3V9AA 1NWCA 3RNOA 2X41A 4Y98A 1DE0A 1FFWA 4MWGA 4RACA 2QUIA 1PL8A 2GUGA 3W2EA 4H35A 1GZ3A 1XZCA 4E5YA 2W2NA 3IXMA 3BAFA 4GDFA 3VU0A 4NE7A 3PRJA 3NV9A 1QTIA 2YN2A 4M9XA 4ALKA 4EPYA 3LZCA 4FKBA 4P08A 2F9FA 1W29A 3JVDA 3TFWA 1AMUA 2WKRA 3HWWA 3SKVA 1CG6A 2AXEA 1LBQA 2IF0A 4NNOA 3TXXA 4M3NA 3AI1A 5KCMA 1XZMA 1GXSB 4R8LA 3JY6A 4HDKA 1KK3A 3N8DA 4FWTA 4I9HA 4B4UA 4MYHA 4KVFA 1SZDA 1U7UA 5F9FA 3GB9A 3L01A 4XYGA 5E0KB 3RVLA 3FSGD 4O4IA 2P6UA 4CLRA 1OB2A 4JGIA 4RD4A 1D9XA 1UOQA 3LY7A 4QA9A 1AV6A 2UUOA 1YFJA 5K0CA 1T36A 3DO8A 1XTKA 3DP9A 4M87A 1X7WA 3AVOA 2F90A 1E0KA 3DDWA 4G5QA 4WOKA 4NFYA 5A9TA 4EFMA 5G41A 4FKZA 3ZJYA 4FZ5A 1E0JA 1GKKA 5SY9A 4OI2A 3MJFA 2HNKA 3B52X 3M5PA 4PU0A 3CRVA 4NJMB 2DT8A 1M8KA 1R88A 1YI0A 2CFRA 4LJLA 3TLBA 5FR1A 1VL8A 4QU9A 2Q3DA 5GJCA 1A8PA 2C5GA 1TAHA 3PQ3A 4Q7QA 1JBQA 1VIAA 1Y3IA 2YWXA 4Q4JB 4XTRA 3W5VA 3R9XA 1P4JA 3AL2A 3IT2A 4JQYA 3ULKA 5JADA 1N6LA 1LPBB 4KW7A 3AR5A 3H1EA 3RIMA 4QBHA 4HVLA 3AI7A 4HWOA 3K3PA 4LCEA 3QUQA 4KAXA 2LD4A 4NULA 3ZTWA 4EGQA 3NR2A 2J0QA 2AVDA 1V48A 3D1LA 4FCTA 1JDBB 4OHOA 3U4DA 1FDRA 3V6LA 2PCJA 3EMDA 4A8JC 4D6PA 3MCAA 4ZJZA 4RTOA 4YRIA 3KKLA 2X9GA 4B3RB 2O0MA 3P2YA 4FTWA 4F4JA 2V7EA 5JH7F 2VPIA 3ITDA 2DERA 3RIEA 3V46A 4N7MA 3WRXC 4UOZA 3KB6A 1NKVA 2TSYB 5DF1A 3P9SA 4Z51A 1I4WA 1XZNA 3PLNA 3VA7A 2JGEA 1P2TA 1BKSB 2BFDA 1VHWA 2WK1A 1VBNA 3BB1A 2IXGA 2N47A 2NO7A 3Q4GA 5FTKA 4D3DA 4HXFB 5K8CA 3OESA 4Z0TA 4D8XA 1E2EA 1N1GA 3C4JA 1CUVA 4WXRA 3FNHA 2GKOA 4HLQB 5EWMA 5F35A 4I81A 3AM1A 4WBNB 2E3JA 3FZYA 2O0KA 1XSEA 1B76A 1KI8A 4TWBA 3CO0S 4KLZA 3ZS9A 4EQ6B 2GCEA 2WMYA 1KZYC 3DDSA 2PMDA 2IXEA 3DZBA 4M1QA 3S8MA 4CUKA 1TK3A 4MHTA 1JHAA 3HJNA 4YRAA 1Y42X 4C9BA 4E6EA 2B4YA 4MDFA 4KK4A 4R2HA 3TM4A 2AI3A 5BO5A 3MWDA 1A7UA 5AHKA 1LGYA 1QPGA 2XMGA 4GR4A 5DBHX 3WAGA 5DM0A 1V3TA 1W0JA 5HIMA 2WE8A 4QVGA 2IWHA 2YASA 4GKBA 2GEBA 4AJNA 1RE1A 4DSNA 1QONA 4TROA 3TJMA 3O75A 3FVWA 4HNGA 3TOCA 1A9TA 4AP5A 3TEJA 5EGNA 2JH3A 3U9TA 1OF1A 3WNDA 4AS1A 4DMRA 4ITUA 2FE1A 1KORA 2WPNA 3MXOA 4D96A 4LZZA 3W4JA 2JIZA 3RV3A 1GNRA 1R4ZA 3Q9UA 1JPVA 1ZYUA 2BKEA 2DPHA 3SZMA 1E1MA 4OAQA 3E35A 3BHIA 4Q1FA 4WGGA 2IUSA 4WFKA 6YASA 1OA1A 3CS3A 4BP3A 1OV4A 4L0QA 3KQWA 4LMAA 1OKKD 1V2HE 2EKQA 2Q2QA 3A6DA 3WLJA 5KB3A 4GRDA 1PFVA 2A67A 1PIWA 2WSLA 2OHGA 5H0IA 3VTFA 1MT3A 1ACJA 2W70A 4EJ0A 4PLWA 2IYPA 5LQSA 2RKBA 3QPUA 2IDKA 1Y7LA 4MGZR 4V39A 3RSLA 4EKDA 4HVCA 3E23A 3IBTA 4UHJA 3CTPA 1JHXA 1PV2A 3B1XA 3VR0A 3WK8A 2PSDA 3O7MA 1E63A 1CEEA 3OCXA 4C14A 4C21A 3BCHA 1EG2A 3IP8A 5KAPA 1WMDA 1Z82A 4YECA 1N7HA 1LPOA 5G4KA 1ECLA 4GF5A 2W98A 4BTVA 4K6HA 4IIUA 4KXUA 5FO1A 1MVNA 4MVJF 3I39X 3R9WA 1PR0A 2WLSA 3IMEA 4YJGA 1MX9A 4GP7A 4ZHQF 1GITA 4LSZA 5F51A 3HMKA 3M2TA 1W4CA 1LJ8A 2C96A 2CB9A 2D54A 4L3WA 2X0IA 3H9QA 4XD7A 5G40A 5TJHA 4DDVA 4D25A 3UMYA 1FFHA 1FDTA 1A5ZA 3W6UA 4BX2A 1VSQA 1GD1O 3USZA 2P40A 3DVAA 5EZYF 3WK9A 3X1KA 3DPIA 1EGMB 1KO7A 1QV7A 1OAOC 3QEBZ 1K3UB 3VOSA 1VI5A 3LUHA 1VCNA 2IBMA 2O2GA 3THYB 3T5GA 3KBBA 4LFCB 1SGWA 2ZSUA 3KWLA 3ZH2A 1DO8A 4OHUA 3K8YA 3I8OA 1GTJ1 4PAQA 4DREA 2P6MA 4ER7A 4F2PA 3VR5D 1NW3A 4KR9A 3QU9A 3R6WA 5KOYA 4W99A 2CWWA 3PQ2A 4X71A 3ZCPA 3AUAA 1M33A 4EHIA 2LPMA 3HVRA 2JARA 3DUWA 2BC9A 4WVFA 4BMNA 2VOJA 1TB4A 2ET6A 3PD1A 4YH1A 3SDBA 3WFIA 3EW9A 2XIQA 2IYAA 2JJ2A 2C0CA 2W4QA 1F0KA 2E7ZA 4TTTS 2VTBA 1Q0TA 3D6NB 1KWGA 2Z6QA 2G17A 2OCAA 4G5SA 2FRDC 3G17A 3GUVA 4R8KA 1J90A 3NFRA 3MK31 4YMTA 2ZB7A 3QKSB 1IZ7A 4MVWA 3VO2A 1CRLA 1LNQA 3RSQA 4V38A 1P3Y1 1PJ3A 3RUIA 2FSPA 3N2EA 1R0LA 4I4TA 3LSYA 3L05A 3FCOA 4GGMX 5LQNA 2PKYX 4GNRA 4YV2A 3ADDA 2YJNA 3PX7A 4FJ0A 3F4KA 4OMDA 1OWPA 3STTA 4TOIA 2RGDA 3GH3A 3KB8A 3LPAA 3A05A 4P4TA 4RKEA 3G8CA 4HBZA 2Q8NA 3CPEA 2CXHA 1KO5A 4NCIA 2WVJA 3N0TA 3ROKA 2QI9C 2UYOA 3IT3A 4HK4A 4KDEA 4O5OA 3BULA 1R0ZA 3A4NA 1UXOA 3HBAA 2J9RA 1DZ3A 3OZCA 3FD8A 4HDMB 4J03A 1JPNA 4OXKA 4ETNA 2Z30A 4MA5A 1CDZA 3W9SA 3C5CA 4DR2B 1IONA 3ZIAD 1NJFA 2QXYA 2DQSA 3D7NA 3FPLA 4ZYZA 1PUIA 2V7XA 4PM4A 4JDPA 2PKRA 3F6PA 1YHZA 3JRXA 3ZCXA 3SEZA 4L28A 1FVHA 2ZYUX 3HO1A 3ZKWA 2E55A 4JASB 4JROA 4YP7A 1NNEA 4DG5A 4A2QA 3U39A 1YB6A 2OVBA 4MS3B 1GNSA 1R6DA 2PT9A 3PC6A 1NBHA 3D6FA 3PQ7A 1D2HA 1HKHA 1ZISA 3EDCA 4Q3NA 5F1KA 2CUNA 5DYWA 2P4HX 4DCSA 4TQUS 4L8WB 4QJ3A 4C88A 5DK4A 1RJFA 2IU6A 2G8LA 3AVTA 3GCWA 3LC0A 4FZRA 1USIA 2GEKA 2WICA 3QE9Y 2EL9A 1RFLA 5TQ2A 4NCNA 3CRQA 1QDUA 4DPLA 2G4CA 1ZHFA 3P32A 4M1KA 4Q7JB 5K8JB 5AUOB 1XPJA 5IKXA 3O9VA 2FPGB 4HAOA 4QPZA 2RCYA 4QASA 1NDHA 2RHLA 4UUMA 4X60A 2EJCA 4YAEA 2MSEB 1RP1A 3BREA 1PFUA 4CKWB 3AU9A 4JP8A 2XZDA 4EFDA 4MDHA 3IURA 4NESA 1RRKA 1W5EA 1WCYA 2HBRA 2ZYTX 3BH0A 2G76A 4MGEA 3ZWDA 3L0YA 1XXLA 3LQFA 4EATA 3S1SA 4NATA 5EE5B 2C00A 3AFNA 4FZVA 4GLLA 2UXDB 3FSGA 4RY9A 5K8IA 4B35A 1TYDE 2V7QD 2P8JA 3UWKA 3BIWA 4RSRA 4I5GA 1M6YA 2J3IA 3QTBA 2QTFA 1I33A 5DSXA 3RTEA 4AJKA 1W36B 3AEKA 1VBMA 5KX5F 1QGZA 2FPRA 4UBKA 4X92A 3SXJA 1IJKA 4ACBA 4URWR 1JYSA 3P2IA 3VDQA 4EA7A 2AK3A 2HRCA 5A0TA 1U2ZA 2JLAA 2LXNA 5B57C 1YUNA 3K5PA 1QCYA 3T95A 1IBKB 2AK2A 2ZKIA 4MKIA 4PYIA 1NI4B 3C3AA 3KYJB 2B1QA 4WCFA 5CK4A 3PUHA 3TX6A 5CLFA 1UMBB 4KUEA 4DILA 2FLKA 2IJGX 2ZB4A 1HGXA 3A11A 3KEGA 1MVOA 4PLTA 3UK7A 4ZIRB 5A3RA 1GLVA 1QRRA 3BQNB 1DARA 2A9OA 2AFIB 1QPZA 3ZLVA 3M8KA 1AK9A 1P81A 3KIPA 4M0UA 4C4PA 1D0VA 1OZGA 4EGCB 2NZJA 2ZTVA 4NG5A 1C3EA 1Z3CA 1J9ZA 4BEWA 5IJZA 4HNAA 4LUCA 2WTEA 3QLVA 3IBGA 3NYWA 2D13A 2YJ3A 4XX1A 1WWKA 4C2AA 3RKUA 3D5QA 3H84A 3NWJA 1HMYA 1Z13A 3UUFA 2FV8A 2HRZA 4JVMA 1C7QA 4FCWA 3K0EA 1ODCA 3LPMA 4Q1CA 1BW9B 4ZC8A 3UUWA 1HE5A 4H15A 1JSCA 1R4NB 4YMHA 2ZROA 4CKEA 2XKJE 3G8DA 4LF7B 3SQNA 1ATIA 1JFSA 1T35A 4B44A 5KUTA 2A0XA 4IF6A 4CEIA 3V1UA 1KP9A 2CJWB 5LP1A 3H8SA 1L3CA 3GP8A 5JBNA 3BMQA 3OEWA 5GVRA 4UC0A 5HWSA 2IIPA 2ZUTA 3QFFA 3OPXA 4FIDA 4GEKA 4KH1A 3NB0A 1NN0A 3IAUA 3CPHA 5CNKA 2Y1DA 2Q3HA 2TS1A 2V9CA 2Z95A 3BFJA 3ZQJA 1WBDA 2AXNA 3LWBA 3BZWA 3P9NA 1IBMB 3RIXA 1TW3A 2IEGA 5TXGA 4O6VA 3RAEC 1XMJA 4HS9A 4K9KA 3CUSA 4P81A 4WFIA 1C8VB 5AJTA 4PFKA 1N34B 2RH4A 1E1LA 1HH4A 3EW7A 4LSMA 1WCIB 2BMWA 1XALA 3SFVA 3ILVA 3KNZA 4L4SA 4CLOA 5EMKA 5GIPE 4OM8A 4BEJA 2XUHA 2DKOA 2YINC 1IIBA 5AKGA 3ECSA 3BS4A 4EKNB 3EFHA 1H2XA 1BQ4A 1M9NA 1RHMA 1WTCA 1XU9A 1Y48E 3PI6A 3H18A 4KTTE 4E3WA 4BOYA 5A3QA 4YAFA 5C3MA 4Q9IA 2ZOSA 3UAVA 2R47A 2RGRA 3ZR4B 3O3OB 3L8DA 5J2UB 1EK6A 3PP8A 3WMGA 2JCYA 4FYMA 1UOPA 1BX3A 3BE4A 1PZFA 2BMDA 2ZW9A 3E53A 5KNCD 1JI3A 1EAYA 1FUKA 1M1NB 2SKCA 3I2IA 3LL7A 3W7VA 1R4MB 4DV5B 5KYUA 3HE3A 1ITZA 4OUDB 2ZRNA 1U0FA 3CVWA 1ZWLA 1ZOIA 5AHWA 4FR2A 3FH0A 2VHCA 1GUFA 2DUUA 1HL7A 3QLUC 1O6CA 1RS0A 2CXRA 2RBKA 3PHLA 2BP7B 1OKKA 3HUTA 4IEFB 1HEYA 5CX1A 1KQGA 3DAPA 2F3RA 2FVYA 5CLIA 2OCPA 2ONCA 1KPHA 2PZFA 3ONVA 3OQIB 3AHEA 3CV3A 2CCGA 5ESWA 5CVUA 4BUZA 5E2IA 2SECE 4B3GA 2QTLA 1TM1E 1ZIOA 3TFQA 2HRRA 3R5JA 3IAM6 3OZXA 1H6BA 4JWTA 5DP2A 4B33A 4HFRA 4LGYA 2GKSA 1T4DA 2P2SA 5CX4A 4OSOA 2OPBA 5KYXA 5DISB 1ZH2A 3BWDD 4OJMX 4EY7A 3GPDG 2PUDA 3QGMA 1D3AA 5CVCA 4BFCA 2QR3A 1OV6A 3VHXB 3BWYA 3GGPA 3R5SA 2XYPA 4UCFA 1EM6A 3I4LA 4E08A 5EMHA 2QIOA 5LA6A 1DKQA 1ZFNA 1NUQA 3IXLA 1K9VF 1RD4A 3A1VA 4RE5A 4FFMA 1EK2A 2WY2D 1GU0A 2O8EA 2WF9A 1V95A 3JQCA 5IBRA 3ZCRA 2AE1A 3AETA 1MJNA 4BNDA 3CEMA 4C3UA 1WY7A 2GNAA 3KRTA 1UBTS 2VK2A 3SK0A 1EVZA 2CFOA 3B9RA 2XXJA 2P65A 4BAZA 5IF3A 1JE1A 2JK0A 4RLQA 4B8YA 4YR7A 1XEWX 1D03A 3K7EA 1XT6A 5IYZB 3D0OA 3EY9A 1EE9A 4B85A 4BPRA 4QBIA 3C3CA 1DKLA 4MVJD 3I53A 4YV7A 1QVVA 1WXXA 3BGVA 5CIWA 5CM8B 2I78A 4AO8A 3K1ZA 3R4VA 3QHQA 2IHYA 4AZ3B 3VMFA 1T5HX 5L9AA 2JAQA 2OFOA 1M66A 4XI9A 4A6EA 5M5BA 3VFDA 5EIEA 3HCWA 3PL1A 4A0QA 5ES4B 3NS7A 1KH2A 4X20B 3KSBC 2A88A 3DT6A 4DNQA 1A8HA 2MSNA 4LZWA 2ZUCA 4EG0A 1U9IA 1GGHA 1KAGA 1L5VA 1XA4A 4POAA 5D6OA 2P5SA 4DLYA 3Q7EA 3B1VA 3E9QA 2Y67A 3GL9A 4XWAA 5EIAA 1IL0A 5LYJB 1Q1NA 4ER5A 4F1WA 2BH2A 2ZS7A 1LEHA 5DM1A 2OESA 1UAGA 3EDOA 1VP3A 3VR4D 1BWRA 3W6ZA 2FZWA 3R2JA 1Q22A 4U8GA 4D56A 4MPTA 4NAHA 3H0KA 3JX9A 3VYWA 3ZWCA 1G0NA 4Q4LA 4ZODA 4AZWA 4RTJA 3WDSA 2B37A 1UJCA 1B42A 3H5RA 2E82A 4MUGA 4RJ2A 1QAOA 2O6LA 3MTGA 1E61A 2F9MA 3HY6A 4ZQFA 3AEQA 4OP2A 1K8ZB 5T67A 4N5IX 4A5OA 3L1VA 2I2WA 1OD6A 4FFDA 1YXMA 1LU9A 2FTKE 2HPVA 2VDWA 2CXNA 3BJMA 4CF5A 3OPVA 3SR4A 2NYVA 5B1YA 3OIDA 2RBGA 1E92A 2C04A 3A4VA 5IEBA 3D02A 2C0PA 3TDKA 1CYEA 2Y1LA 1Z3IX 5FPPA 2WC1A 3RF7A 4INJA 2CDNA 5DT9A 2IHTA 4RPHA 1E1CA 4MUIA 5FPHA 3TLEA 5KKCA 2M6SA 1UANA 1RJDA 3H2SA 1VJ5A 2OXFA 1G2QA 1RW4A 4MVJI 4DLSA 3B89A 1O58A 1IZ8A 1CFZA 3BTVA 3ESCA 4GGPA 2JC3A 4LHSA 2VS1A 5J2TF 1UBGA 2DQ4A 3GFSA 4L9AA 3KVRA 3OD5A 2VP4A 5E8RA 3UOWA 1FRZA 5JAQA 1WNTA 1Z5GA 4P5DA 4M0PA 1G4UR 1T8YA 2XHZA 1E4EB 3PWTA 1F0NA 4OQNA 3VO1A 3KJFA 3BN3A 4KFSA 1RQ2A 4ZCPA 1B7GO 5EZSA 2O20A 3U3RA 4A2PA 5JO0A 1L7QA 4GR9A 4NV1A 3JD1A 3H5AA 5L51A 3AEXA 2G88A 2DECA 2GZ1A 3M5CA 4X65B 1PJ8A 2C4WA 4W5QA 1GGFA 1C0KA 2TRSB 1UXIA 4NS1A 5A6VA 3G2JA 5F4ZA 3QFCA 5L6MB 1EP2B 4FOOA 1Z37A 3FROA 4JLOA 1MH1A 1X7ZA 2BF4A 3MF4A 3PQEA 4HEA6 3MHTA 4C4YA 3ZY4A 4E13A 5E3HA 5LMNB 1K08A 1S2OA 2Y0PA 4TMVA 2GN0A 3AW9A 1QH8B 2VZ0A 4CL8A 3ZWPA 1FU7A 2C2OA 4JDUA 3X1WA 4FEYA 3AF1A 3ZXUB 4GYJA 5FPTA 3G1UA 5F3DA 1WUYA 2NP7A 4HX9A 1S01A 3T6KA 4DIOA 2P75A 3S68A 4JZKA 3CSSA 2V7QA 4M49A 3FGOA 1CUZA 1P6QA 1XYYA 3PE6A 3J7AC 4GR5A 5CW2A 1POXA 2XHEA 3CNQS 2ZRHA 1F7UA 2WSSD 3GJ3A 1NQWA 4EGFA 3P2JA 5EKUA 2WVGA 4PSAA 4O1MA 1T8PA 4BV8A 2G5PA 3IUYA 2WTUA 2CW5A 3EX7C 3UKJA 3GRAA 1ACMA 4QYMA 3QPBA 4DFDA 1L7PA 3BFVA 2QVYX 3GFBA 2PA0A 1CVLA 1NJ1A 4JP1A 4CMHA 1UOEA 5C32A 4D98A 1ECCA 4FOLA 1EJ6A 3EDMA 5FQNA 5CDTA 5E9JA 3ZXIA 4NG4A 3PNKA 2L0XA 5FWXA 1YT5A 3HVHA 3JW8A 1HT0A 1QRDA 2AD5A 4YCJA 5DLQC 3V80A 3OQOA 4DLPA 1FFGA 2EQ5A 3EEIA 4A92A 5IC5A 1RDFA 2IOFA 1AO0A 2QJFA 1L1FA 3UENA 5GAJA 5I6DA 2X5JO 4ON9A 3FTPA 2ZJAA 3T99A 3L8GA 2P0AA 1Z8HA 5CM2Z 3OX1A 3KZVA 5DW0A 4LI3X 2AOTB 4UW9A 1JALA 4HNVA 4TV9B 1YMVA 1GV0A 3EEBA 1X0XA 4EKEA 3KPJA 1DTWB 1F12A 5ALDA 5EUCA 4RS3A 2BZGA 3SNKA 1Z7GA 1J8YF 1NYLA 2XCTB 3C5HA 4L51A 1K4YA 2R62A 1YQQA 1XD8A 2W6ID 3GRYA 3WDKA 1OFGA 4ROSA 2GLUA 3L7DA 3SSAA 2P9HA 1O87A 4MI3A 1V3QE 1IUKA 4HHEA 3K2QA 4YCAA 2A0YA 3QP9A 3ICCA 4TMWA 5TVKA 3TVTA 3W2FA 1XEXB 2IPOA 4FINA 1COWD 2XV1A 3AESB 3IESA 4JD5A 2GTIA 4IOLA 3ENNA 4C0XA 4E70A 1E3IA 3ZDRA 4AN4A 2Y0BA 4HLUC 1XCLA 2QAIA 1VJ1A 5H02A 3NYQA 3WY9A 4TV8B 13PKA 2C7QA 2PXXA 3KUCA 1U9ZA 2W2KA 5TE9A 3ZY5A 1ZUWA 2PBFA 4ZC1A 4BO9A 5JUWA 4E1AA 1LBIA 2A5JA 2C29D 2ILTA 4Q4AB 4NHOA 1OWLA 2HJSA 4XUGB 1GVHA 3BZBA 1M34A 3G0GA 5DTRA 4BXOA 4UMVA 3NHLA 4NMHA 4EF4A 4RMGA 1SVWA 1Z88A 2J31A 3BGSA 3PNOA 1WDWB 3FF4A 1DRKA 2H57A 1G2OA 1IDOA 1N2GA 2ZIWB 4M2LA 3DL7A 1FFDA 4U7GA 2X8WA 3IP9A 2NWQA 5IDWA 3E9RA 4HDQB 3UAYA 1T9KA 3TFOA 1DT3A 1OFVA 2CYAA 4XLLA 3EPHA 1Y3HA 1VPDA 2WUFA 3WL6A 1MO5A 2I7CA 1KO8A 4Q05A 3EOZA 3WTCA 5FF9A 1P0CA 1P44A 4UMEA 3TW8B 1QFYA 3EC2A 4B6OA 1SCDA 2V7TA 3E2MA 4HH3C 2FWAA 3C45A 2RHCA 3DHYA 4K2HA 4EYKA 4F9EA 2BFEB 5LUAA 1O6ZA 4MWOA 5BWOA 2GXSA 2G40A 4BO0A 1TVEA 3MNFA 2XB2A 1C3OB 3PFGA 2E21A 2DFPA 1BE6A 3RLIA 5CBPB 2PX5A 2AJLI 4RA6A 2PL9A 3LLSA 1TM2A 5HCUA 1ORWA 2FUNB 5EJFA 4OLHA 4MWEA 3HR4A 2J6BA 3OBIA 1A95A 5I9SA 4CQLB 1KP3A 1AF4A 4L2IA 4ZRDA 4ARVA 1NFFA 3H8VA 4DXAA 1N6RA 1PBTA 4M86A 3SFTA 2BELA 3ZHUA 1DJPA 1VIVA 1YR7A 4LZNA 2NUAA 3T1VA 2OC9A 4IZ6A 1J5PA 3IVXA 4LC1A 4ZREA 4DT1B 2E4VA 3EFOA 3E1GA 1X6VA 3X44A 1A9ZA 3DA8A 1HDXA 5DNWA 3IQZA 4DQVA 3B5JA 1PSWA 1NOJA 4A9AA 4CL3A 4EVSA 3E3MA 3DFFA 4GI2A 4CKCA 2R8BA 4QJ4A 2QTAA 4R98A 5HIAA 3VSEA 4B3JA 3OLXA 2YMMA 5CFOA 1N8TA 3BK2A 2J4FA 3GVHA 3MD0A 1XAIA 1L8XA 5CYFA 4PX5A 1LQTA 1I3LA 1ADGA 3OC0A 3DDOA 2JLBA 4D43A 1WSDA 1T9GR 3OKPA 3SC2A 1YCGA 5CFQA 4AB1A 2KE5A 3SX0A 2HHJA 3ANNA 1UFVA 1WXIA 4G4SO 4EEZA 3IP1A 3UUGA 3FAKA 3VRHA 2X5NA 2XMZA 4IQ4A 3UK2A 2F3SA 3ZUGA 4DC9A 1QVAA 2CHUA 2JB9A 2X2FA 4QBGB 4KBFA 4RJKA 1Q0HA 3GLVA 3K35A 4IKEA 5FPYA 1F2DA 2JI7A 1FK8A 2PX6A 3ZJ5A 4NEQA 2GVDC 2WW8A 4P2BA 1PNTA 3FCSB 4RQBA 2L2QA 3EWSA 4CTJA 5AHRA 4MR7B 4RABA 4ZALA 1SKAA 1GEEA 3BF8A 4JC4A 1BQ3A 3CXRA 2EG5A 3LFUA 2CV2A 1L5LA 1F2TA 1W19A 3WLAA 2WVHA 2N42A 4DGQA 4JJAA 4MWCA 4BMPB 1TCAA 2GF2A 1I2ZA 2HYDA 2Y6UA 3KD2A 1FXUA 3OY2A 5CVDA 1V26A 4L7QA 1FZTA 1D0IA 1RRFA 3G9TA 2RK6A 2W6OA 1CUXA 3FJOA 3QMVA 4LYEA 3UH1A 4QYTA 4E03A 4L8GA 1AKMA 5ABPA 2NNWB 2QDXA 4V0SA 3PFKA 1D7AA 2YWGA 4LZJA 3H2HA 1ST2A 3A36A 1RZUA 2H3HA 4JNCA 4K6CA 4OK6A 3UJ3X 2VF2A 4WT7A 4PC6A 4C7KA 4MXDA 5BSEA 3DONA 2D2IA 4LDPA 2EDAA 1ODIA 3PCRB 1I80A 5LIPA 2D4HA 3ICEA 5FTLA 4YRTA 4AMZA 4G5OA 2B61A 2ETXA 3UWDA 1EX6A 3WFJA 2X9LA 5LB2A 3GZJA 4JI8B 4MGHA 4UHKA 1YTUA 5CT9A 3BB3A 4GI3A 4JUFA 2H0QA 1V1JA 2JBWA 2XNDD 4IGAA 4IV8A 4LFAB 4QU8A 1QTQA 4XJTA 3JZDA 1A8IA 4WPGA 4Q24A 1EEXB 1NXSA 1OIVA 3F49S 3GFRA 4NYIR 3Q1LA 3WBJA 1UODA