3INYA

Crystal structure of human purine nucleoside phosphorylase in complex with 7-deazaguanine
Total Genus 85
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
85
sequence length
288
structure length
288
Chain Sequence
b'ENGYTYEDYKNTAEWLLSHTKHRPQVAIICGSGLGGLTDKLTQAQIFDYSEIPNFPRSTVPGHAGRLVFGFLNGRACVMMQGRFHMYEGYPLWKVTFPVRVFHLLGVDTLVVTNAAGGLNPKFEVGDIMLIRDHINLPGFSGQNPLRGPNDERFGDRFPAMSDAYDRTMRQRALSTWKQMGEQRELQEGTYVMVAGPSFETVAECRVLQKLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDYESLEKANHEEVLAAGKQAAQKLEQFVSILMASIPLPDKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
molecule tags Transferase
source organism Homo sapiens
publication title Crystal structure and molecular dynamics studies of human purine nucleoside phosphorylase complexed with 7-deazaguanine.
pubmed doi rcsb
total genus 85
structure length 288
sequence length 288
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3inyA00
1ODJA 5CCDA 1Z38A 1Z33A 1T8RA 4WKOA 1RFGE 2H8GA 4PNPA 4L0MA 5IFKA 1RR6A 4F3KA 1JPVA 2OECA 2HWUA 1RXYA 1TD1A 1SQ6A 1TGYA 5F73A 4L5CA 3GGSA 3OOEA 4OEHA 4R2WA 1YQQA 1PF7E 5EUBA 1TGVA 1CG6A 3GB9A 1YBFA 1VHJA 1OTYA 1PR4A 4BN0A 3SCZA 1K3FA 4TS9A 3IOMA 1PR6A 5CYFA 2A0WA 4L6IA 4R31A 1SD2A 4OJTA 2RJ3A 4MARA 4OGKA 2XRFA 1ODLA 1RYZA 4M3NA 3LGSA 1T8SA 5JPCA 2HSWA 2A0XA 1U1DA 1Z34A 4LNAA 1PR5A 2HN9A 3EMVA 5I3CA 3ONVA 1VFNA 4YMLA 4MCHA 5CCEA 1B8NA 1TCUA 3P0FA 4DA0A 4LNHA 4FFSA 1V45E 4G41A 1PWYE 1Z36A 1PR1A 1U1GA 5F7XA 4L5YA 3OZEA 4JOSA 1Y1SA 1OU4A 1A9TA 1A9PA 1YR3A 3EEIA 1B8OA 1PK7A 3D1VA 1TCVA 4NS1A 4WKNA 1Z5NA 4LDNA 1PK9A 3UAVA 3PHCA 4GKAA 2A8YA 4GLFA 5EPUA 4UC0A 4L5AA 2HRDA 4QFBA 1Y1RA 1RCTE 3DDOA 3LBAA 5EFOA 1QE5A 4QEZA 2QDKA 2AI3A 3DF9A 4JP5A 4U2KA 3E9ZA 2I4TA 1Y6RA 5CXQA 4F2PA 1PR2A 4TXNA 4OY3A 1JDZA 3FOWA 3MB8A 3E0QA 4EB8A 3DP9A 1WTAA 3ODGA 3FAZA 1V2HE 3BGSA 4GLJA 4PR3A 1PBNA 1FXUA 5B7QA 4TTIA 4TXHA 2B94A 4TTAA 4DA7A 2A0YA 1V41E 1ECPA 1OTXA 3KU4A 2GUWA 4G89A 1RXCA 3U40A 1SD1A 3DPSA 2AC7A 1PW7A 1PKEA 3EUEA 3ENZA 3OCCA 1YRYE 5B7NA 4TXJA 3K8OE 3UAZA 1LX7A 4WKBA 1T0UA 2QSUA 3IEXA 4DANA 3OOHA 4H1TA 1NC3A 4TXMA 4LKRA 3NM5A 4D8VA 3O6VA 5K1ZA 1PR0A 1K27A 5F7JA 1RT9A 4QAQA 4GMHA 1V4NA 4NSNA 5DK6A 4ECEA 4OGLA 1JDSA 5IU6A 2OC4A 3FWPA 4DABA 5F7OA 1I80A 3NM4A 3TL6A 3UAXA 1ODIA 3MMSA 1N3IA 1RXSA 4DAEA 3OPVA 4WKPA 1Q1GA 4DARA 1A9RA 3UAWA 1LV8A 4KN5A 4BMXA 3DJFA 3K8QA 3PNSA 4G8JA 4YNBA 2I8AA 4EARA 1JDVA 2Q7OE 1OUMA 1VHWA 4QATA 3FUCA 3F8WA 2PGAA 4F2WA 4BMZA 1ULBA 3OZDA 4IP0A 4OF4A 1ODKA 3NM6B 1YQUA 4D8XA 1JE0A 1A69A 4TXLA 4F3CA 2OXFA 1VMKA 1JDTA 4BMYA 1Z37A 3EUFA 4DAOA 3BJEA 4D9HA 4NY1A 1NW4A 3OF3A 3PHBE 5F76A 1Y6QA 3KUKA 4K6OA 4D98A 1V3QE 4DA6A 5B7GA 1U1FA 4M1EA 4E1VA 4F1WA 1NC1A 1G2OA 1CB0A 1Z5PA 4QASA 3O4VA 2ON6A 4DA8A 2BSXA 3OZCA 3UAYA 1OV6A 4LZWA 2OC9A 3LA8A 5F7ZA 5F78A 4TS3A 4MCIA 3KHSA 4TTJA 3E9RA 1OVGA 1V48A 3OZBA 4YO8A 4M7WA 3UT6A 1C3XA 5ETJA 4P54A 3PNPA 5CXSA 1Z39A 2IQ5A 3P0EA 2AI1A 1T8YA 4I2VA 1A9OA 1XE3A 5FAKA 2QPLA 1U1CA 4YJKA 1M73E 1ZOSA 3QPBA 4D8YA 3BSFA 1Y1QA 1Z35A 3FNQA 1Y1TA 3T94A 3C74A 3FB1A 4R2XA 3KVYA 1A9SA 1JYSA 3NBQA 4X24A 5CYGA 3INYA 5F77A 1T8WA 1JE1A 4WKCA 2ISCA 1RXUA 1JDUA 4RJ2A 1K9SA 2QTGA 5KB3A 3KVVA 1A9QA 1RSZA 2AI2A 2QTTA 3KVRA 5B7PA 2P4SA 1ZL2A 1Z5OA 3BL6A 1U1EA 5C80A 4QARA 1SJ9A 1LVUA 1ULAA 4JWTA 4TYMA 1JP7A
chains in the Genus database with same CATH superfamily
3VPGA 2CB0A 3BFJA 1Z0SA 2QPTA 1Z33A 3D31A 4UU8A 2ZJAA 2BI8A 1XEAA 3GF4A 4J9VA 2PD3A 1U7ZA 4FE4A 3L6OO 5BUZA 3PC3A 4LKOA 4II7A 5KYVA 4IDNA 1A4RA 5CBKA 4NCBA 3I2FA 2PWZA 3S5JA 3PWZA 1AKMA 2GKOA 3M7IA 2PU7A 4EUEA 4DHWA 1D2EA 1G98A 3KJGA 4JUAA 4QPCA 2PLFA 2CLMB 1M8KA 1SZDA 4FX2A 2WSIA 2FKAA 3I9MA 2QL6A 5IDXA 1YQWA 5K4HA 2C0PA 3VPXA 4CKXA 1YZYA 2AG0A 1PWXA 4MK4A 2OHXA 1B1AA 5T4EA 1FFDA 3G2HA 1ZX1A 2NXWA 4LW8A 2ZYVX 3FF4A 4CMKA 4FBLA 2IQIA 3R1IA 5BOSA 5KJ1A 4KX5A 4XCVA 2J41A 3K8ZA 5KYWB 4C6RA 1R5BA 3QLEA 3A2KA 3JQAD 1PS9A 1UT6A 2P30A 3M6WA 3GUCA 1I1QB 3L0SA 1ZGAA 1EWQA 2QROA 3B1JA 4J76A 2W6JA 4JVNA 4BATA 1M7BA 5KYTA 1KDRA 3MWKA 2JD0A 1F1JA 2RGGA 2XCIA 4O4LF 1OWPA 3L8FA 1QRTA 1FBTA 4HHEA 3U3MA 4GX5A 4I1UA 3FZYA 4C0KA 2R6FA 4JELA 5C31A 2YRFA 1PFKA 4S0XA 5AVYA 1YFKA 3MAJA 3E8MA 1KO1A 5D8DA 1ZYUA 2Z2XA 3OIUA 4MQMA 3FY4A 1K8QA 2OUKA 4CMEC 4E33A 1KGSA 2AFHE 5BQPA 3OHSX 3QFFA 3B9QA 2W2QA 3F67A 4FN5A 4FYHA 4XDZA 4XR4A 4ZDJA 3SF8B 2PN1A 1Q0PA 2Q4EA 1L5SA 5EJ6A 4Q7MB 3RTCA 1GARA 1RZVA 5HWSA 1QTIA 3VH1A 2ZB2A 1HFWA 4R2HA 4NAHA 4MAAA 4NJEB 5CG2A 3UUFA 2JAOA 3TXYA 5A04A 1YO6A 2GBIA 4RC9A 2WLTA 3ZTTA 4DREA 5CEFA 4HNTA 5JAPA 4NBLA 2PLNA 4XJXA 3AL2A 3KQWA 4PTLA 5TQVA 4HT3B 3L4SO 1ZI6A 2I4LA 9LDTA 2RGNA 2B2CA 1MV5A 4KCGA 2QLMA 2EQ5A 2IVZA 3O7WA 4JYCA 5KNCD 3OT4A 1T0JB 4XB6B 3SZOA 4E5UA 3KAJA 1VKJA 4XB2A 2Z5FA 4D6YA 3GPLA 5J5AA 2YZMA 3D3JA 1S2IA 4QE3A 3WB2A 2RGRA 4MUXA 1U8TA 3QITA 1XWIA 1XZNA 3DMNA 1ICIA 2B2XA 1KFEB 1R12A 3PKJA 1P9NA 1CUFA 2ZWIA 1Q1NA 3CW9A 1W25A 2A88A 3AVVA 3LSYA 2UZ1A 2B0JA 4RSHA 3ZIAD 4IIUA 4X91A 3ZI4A 1B6RA 1EVLA 1Q0TA 1ZGGA 2J7PA 3KUCA 2NZVG 3WMFA 1XL1A 5FYQA 2XHZA 4V0MA 1Z4LA 3NHKA 3ST7A 4DBLE 4JB3A 2FUCA 3L6EA 1LU9A 2WB2A 3G7UA 4DKJA 3FH0A 4Y2VA 4YFVA 3ZZMA 4EHKA 2QZJA 1GHTA 2FPSA 2OORA 2Q4RA 1A1VA 1YUBA 1DX9A 1JBKA 2X2OA 1PK7A 1A50B 1YB2A 2MYNA 1YVRA 2HK8A 3PQDA 2QTVA 5FFNA 3TPFA 3Q87B 4B8WA 4CMEA 3IUNA 1GYPA 1GZUA 3PRHA 3ZDZB 3DOUA 3ZDYB 1XRLA 1ZVVA 1FDIA 4IF6A 4M0LA 5K0TA 1N2OA 3IDFA 4QDKA 2ZM6B 2G36A 3KOYA 2QYHA 2IEDA 3EXFB 2I66A 1Y81A 1FMJA 2XAUA 5HQ3A 3O8CA 2ZBQA 2QLLA 4I55B 4Q82A 4M8KA 5EKXA 3ZX4A 2QTBA 1Y4DE 2GCGA 2BMWA 3EK2A 3V8BA 4L5AA 1D4ZA 1TKRA 1BEEA 1ODTC 1UBMS 2PGOA 5ICCA 4CMIA 2ODAA 1ISIA 1Y1RA 3KYCB 1OJ7A 3PNYA 4RVOA 1TYZA 4C4PA 2BKUA 4LF7B 5BNWA 3B1YA 1SZJG 4CM7A 4WHMA 1AG9A 1OBCA 3RD5A 2XF2A 1N6HA 4XD2A 3ZDRA 3JWEA 3W04A 1MB9A 2X1VA 3E61A 1THTA 5K8CA 1GNQA 5K0CA 4LOIA 1DL5A 1MT3A 1NI4A 2BR4A 2GBLC 2IUTA 1P8AA 3KWMA 4BQRA 2JFUA 3BBLA 3A6LA 3E9QA 1W46A 3EXHA 1B73A 1G8JA 1X8LA 1GEEA 1XBTA 3E9ZA 4GM1A 4AX8A 4EPWA 5HPYB 4LX0A 4CW7A 1RQXA 4HF7A 1G5RA 4P33A 4XI9A 5IKOA 3S2FA 3WYDA 3NC0C 3QUCA 4U1RA 5A3QA 4JASB 2FMIA 5CA0B 5KQLA 4CM3A 1RPAA 1YA4A 1CJVC 4Q4JB 1G2IA 2ZSAA 1CZOA 5IJZA 4R98A 2ZIWB 3BRQA 3AF1A 2Q9UA 2ZB7A 3B6ZA 3AHEA 4JFAA 1EU1A 2G5GX 3WBJA 3H3FA 4L8FA 1X94A 4D99A 5K8UA 3RT7A 1QLHA 1ZN7A 2B1GA 2BGMA 2YASA 1A9XA 1MRSA 1D1QA 1ITZA 2IUYA 2YUIA 4HDAA 3PTAA 5IKMA 1B00A 3E22A 3PP8A 3ECAA 5C5CA 1VJ0A 3CNQS 2C29D 4UVGA 3V4RA 3VR5H 2VDLB 3KNZA 2QS9A 1Y9JA 4RLHA 4HZUA 1YRQA 3ZKAA 4ERNA 6ADHA 1UZUA 3WLHA 1Y3DE 4ZEWA 4FW9A 3AVTA 2EX1A 3II6X 3UA4A 4CODB 1YR2A 4LDJA 1XO1A 2BKEA 4BGEA 3LLSA 5JC1A 1PBNA 1YE5A 1YNOA 1ZQ1A 5LVAA 1K68A 2XNSA 5CYOA 4I50B 4CIYA 4YHHB 2D5LA 2R8EA 2VQSA 2B94A 3NUGA 4LGMA 4R69A 4UARA 5EJIA 2FPWA 2XHEA 3I01M 4KAAA 5AO9A 2BTQA 1NW5A 3OLXA 4FPXA 4A0SA 5BURA 4ZI2A 1Q44A 3HR7A 3V7UA 3L6UA 3M9XA 2OCLA 4MI3A 3DMTC 1QZ3A 2X58A 3F90A 2XUOA 1JVBA 3AL3A 3QPUA 5KHAA 4WNAB 3FMFA 1NL3A 2ARKA 4JUIA 4YAEA 2W22A 2EKPA 5I7SA 5HBGA 3JQFA 2JRCA 2HD4A 1PW7A 2IPOA 3EFEA 3LRPA 3EUEA 3LV8A 3FDXA 2XJ9A 4ISBA 3GH1A 3K32A 4I9UA 3WL3A 4KPEC 4X95A 3KTFA 3HKDB 4K1LA 4QRDA 1PEYA 4K03A 1QX3A 3H4MA 4MZDA 3P1JA 4OBBA 3U7RA 1CYEA 4LRWA 1O57A 4OA8A 3RLIA 3AB3A 4HWOA 1BDBA 3V80A 4FFRA 3KVOA 3W6PA 1D1PA 1VE9A 3DTYA 3EEYA 2LE0A 3F6BX 2YFHA 4NMLA 3OTHA 3PCRB 5IJXA 3L4JA 1FLAA 4HAZA 4R2IA 1ZJ5A 2Y1DA 1E64A 5ALKA 2Z6VA 1VL5A 1OYYA 2ZSEA 5AQEA 1IPHA 2AR7A 3W9UA 3ZJ4A 2HEIA 4AZ3A 5KOIA 5B53A 3P32A 3C3AA 2Z9CA 3T9EA 1G6KA 3M5WA 3ITNA 3LW8A 1S2LA 4H6WA 1X7ZB 3CUWA 4ZRNA 3K1YA 5K1ZA 3V7YA 3ZDAA 1WY7A 1KI3A 1X2EA 1DIHA 1XVIA 1EFCA 1PR0A 2MSNA 2WJPA 4PCVA 4EKIA 5H8WA 1N2ZA 1RXIA 4ECEA 4KR0A 2O2CA 3BRSA 3D8HA 3R5HA 3N8GA 4M46A 4XWTA 5HKLA 1GVHA 3EEOA 4ZI5A 2ECFA 1NX9A 2ZSHA 2AT1A 3A6DA 3ETJA 2PUJA 2D06A 3PD0A 4G24A 4EHLA 1E6LA 3AJEA 3U16A 5H83A 5DM70 3WGNA 5J2UF 4UFOA 2PH7A 4H0NA 4R7GA 4JBHA 4KOEC 2LTAA 1WM1A 2QJOA 3KHKA 3NKFA 1N92A 3O91A 2D2FA 5GM2A 3VKWA 1H4QA 4GM4A 1WUTA 2Q3DA 2X9GA 2WKQA 5A4AA 2JRLA 3GPIA 2CXOA 4MA5A 2B34A 4R40A 1BQ3A 2C83A 2HXSA 1U0JA 4F6LA 4G4GA 5JAZA 3MJHA 3ON5A 2O1WA 5JSZA 1YVUA 4A0HA 1JSCA 1VSUA 4LVUA 4CDNA 4CG3A 3VR2D 2HNKA 4TSFA 2EWMA 3KWLA 4RDIA 1ADFA 4KE7A 4K8OA 1TT5A 4NU8X 5JSKA 5HTKA 3R9WA 1KI9A 4QREA 4YNBA 4LDQA 4RZUA 4EARA 4QBTA 4JOSA 2REOA 3SEFA 1P7PA 1RNLA 3CLHA 5U4QA 1QZUA 2HF8A 1G5PA 1V43A 3EARA 4HH3C 5DYYA 1EFAA 3KUDA 5I4CA 1U2QA 2W5UA 2IH5A 3ZDEA 1T1JA 3NRJA 1XMJA 1CDEA 3IO5A 3SJ7A 1ZVKA 3GLHB 2WKPA 1ZCFA 3CZPA 4C89A 3VKHA 1BGVA 4PXYA 2XV1A 4OF4A 2G6BA 3RO7A 3V00A 2C42A 3EJWA 3CEAA 4BO1A 3AZPA 2WINI 1Q2UA 4D4KA 5KYKA 2IOFK 1I33A 1XZ8A 5BRAA 6REQB 3HUDA 2OGWA 2WW8A 3FPSA 3QHQA 3NVMB 1TAGA 4LK3A 1KFKB 4URFA 5CCXA 1OTHA 5JD3A 2RGXA 1J2YA 4CQNA 3DVQX 4UCQA 4Z7OB 1UDWA 2JIRA 2QM3A 2ZS7A 1ONPA 4R8MA 1JDTA 4OA5A 4LX8A 2A92A 3I0ZA 3ZIAA 1BDMA 4QLOA 3ZQKA 2X77A 4BVAA 2HZ7A 5AT1A 4XIGS 4MMXB 4IXTA 4YHBA 1Z4OA 3DOHA 4DV6B 4Z8YA 2BFCA 5DN6D 2P78A 3FN4A 3JQ8B 2AOVA 4G0PA 5CJPA 3B52X 3WIDA 2NU8A 2LP4Y 5HE9A 1K0UA 2C3YA 3N87A 5A6VA 2OOKA 3PL5A 5DLYA 1SCKA 3OF3A 3GYGA 1QVVA 3PC7A 3DONA 3X43A 5FPTA 1YIDA 2K7ZA 3OECA 4HAYA 3AEKB 3UG6A 2YN4A 2Y9MB 3PX2A 5J5CA 2HCFA 4Z4CA 5BWMA 1MH9A 3DD1A 3FWKA 3E7PA 3EIOA 2H4YA 2OQVA 4QGHA 3UH0A 3N39C 5EJGA 3X1YA 5HKKD 5HIMA 2DLDA 1E1YA 2H85A 4QHSA 2GHIA 1UBEA 1ZUHA 3JVDA 3VVBA 3WL8A 3EZ6A 3PZRA 1JR4A 3JALA 3GGPA 2P8JA 3BX1A 2EF1A 3FLBA 3FUTA 3K05A 2AHRA 3EIUA 4KMMA 1NC1A 1QV6A 5BN4B 4AF6A 1V39A 1VIAA 2JHPA 2XDYA 2YNMD 2CXQA 5TGZA 1Y3AA 1XMOB 1DKQA 2GBFA 5AI0A 1L5RA 3SEZA 3RAFC 3HDYA 4P22A 5DPMA 2BSXA 1T15A 3ADKA 1MFPA 2VA8A 1DKUA 4E88A 2PU5A 1QGUA 2IYEA 2QTZA 4FOPA 1CUEA 4KGZA 2OFWA 3K53A 3LKZA 3LA8A 4COOA 5BNIA 2RSLA 3OIVA 3KTAB 2PSHA 4LHEA 3TEFA 1PL7A 3ES9A 1A2QA 1T0IA 2C31A 4YDHB 4YVFA 5GVSA 4TTJA 4H3HB 3LD9A 3ZWOA 1OVGA 2AXNA 2ZSUA 3PYXA 5C18A 2UU9B 1FIUA 2ISQA 1V48A 3DHNA 3K5WA 5DVZA 1ORTA 4I1OA 4HOYA 1M6EX 5DK4A 1P80A 1XTTA 2J0UA 5LOVA 2BM1A 1L3CA 4FEGA 4KITB 3OTWA 1C9EA 3FSGD 1ORIA 4P54A 5CGQB 5FI0B 4KK4A 5TS3A 4KQJA 3Q2OA 2JH8A 4HUQA 3LDFA 3NHPA 4MQBA 3RNOA 1OQAA 1ZAKA 2PWAA 3R7BA 2GT1A 1HFKA 4MQEA 2QTAA 1NFQA 2PT5A 1IY1A 4O8CA 5CLFA 2OM2A 1E66A 1B8UA 3E8XA 2WC1A 1ABFA 1NYTA 3OPYI 4B2IA 4E4RA 4D80A 2G0TA 3TL3A 2P9YA 3LYHA 5EJAA 2V6MA 2I55A 3QEOA 4MITA 1O03A 3SG0A 1IN1A 2HKIA 1ZUIA 4KUEA 1NJFA 4GSYA 1Y5LA 4AQ7A 4ZARA 1K08A 1XWFA 3GZNB 2WSLA 4TRMA 4UVEA 4DWOA 2WWYA 1W36B 2PBLA 1EFVB 1MTOA 1NVEA 3FB1A 1U0EA 1PFUA 2OCGA 1CQWA 1EWYA 4GXRA 1XEXA 4G4IA 2HRBA 4DS3A 1SKAA 4OYYA 1RMTA 1VKNA 4PICA 2G0AA 2NACA 1LBSA 2CNWA 1BE8A 3KL2A 1YS2X 2GPJA 1UFVA 3IL2A 2V0GA 4ZOLB 3JYPA 3KEOA 1AKNA 3CH5A 1X77A 2P4HX 3P9XA 2X4LA 4UM5A 1ATZA 3D3WA 2ZVJA 1IQPA 3PFIA 1SNYA 2HJVA 4NAUA 3HK2A 5HGXA 1QGOA 4R6XA 5DIZA 2Q07A 4Z3KA 4QYXA 5JDIC 5AVUA 1LD3A 4DE5A 5KOHB 4J3JA 2AB0A 1TJ3A 1U1IA 3HUUA 5D87A 5ANRB 3GJ5A 1O6BA 1Y7IA 1E1QD 1WQ3A 2I2WA 2YYSA 3QNMA 1OX6A 4OFWA 3G68A 5CD9A 3I1FA 1V3UA 4ZI7F 1SPBS 2XTJA 2O59A 3DP7A 2XMSA 1CZUA 3VUEA 2H48A 3HV0A 4G81A 1IRXA 3L43A 2WUWE 2RHDA 1P60A 3KZMA 1OH5A 1PDOA 4NARA 3WLMA 1SHJA 1YJ5A 4KLRA 4YWJA 2FV8A 3JQBC 4YQZA 5AFSA 9MHTA 5TEWA 1AZLA 2H11A 2RG1A 2W2VA 1S2NA 2HYIC 1GV1A 1V3TA 1Y80A 2PTGA 3W06A 3L4EA 4AVYA 5E2AA 1QO0D 2GO1A 3W6UA 3ASYA 5JAQA 1JJBA 1RR6A 4GE0A 4CMHA 3AW8A 4ERXA 3B85A 4P7FA 4ZZIA 2QORA 3G2JA 5E8JA 4MB0A 1VDZA 4KV7A 5A5FA 5EQFA 3SR3A 4HK4A 1I7NA 1U2GC 1E2NA 2VP0A 3C7AA 3FR7A 3GJ8A 4R3NA 4BRSA 3NHFA 3TQRA 2I62A 4IDBA 4EG0A 3U7QB 1B42A 1SULA 3CUKA 2NUPB 5LYJA 2YDXA 4KDRA 3ESCA 3IBGA 1LV7A 4S12A 1LPOA 1UMDA 1JU3A 3X2FA 3EQ9A 1NQAO 3I73A 1E94E 3KJXA 3UZUA 1N78A 2WLSA 4MW4A 5L3QA 5LIPA 1NW3A 2V6BA 3K7EA 4Q18A 3VH2A 3UPDA 3DBOB 5TQ0A 3NASA 3NWBA 4LA4A 1UK9A 2P1RA 3GT3A 4X5OA 1QV7A 5EINA 3UJAA 2QXYA 3HWSA 1E5QA 3ZZ1A 1HX7A 1QGED 1OASA 4IVPA 1PR4A 1XCPA 1YD7A 1NXSA 2J59A 3GBVA 2ZBDA 4D97A 1YDFA 5EQTA 3VR5D 1H3NA 1E0DA 1ZM3A 3GLUA 4NZZA 5BNZA 5IK2A 2DB3A 2XGSA 4H7FA 3AXTA 4WOBA 3V1TC 1SHTX 1OXBB 4AQDA 5J58A 4FEAA 4XYBA 2HT6A 4ZO6A 3WNZA 1OIXA 1EUCA 2BBOA 1UM9B 1XRPA 4AG6A 2JVKA 4E5YA 4HQ0A 3UB4A 1U9CA 2IWRA 3V2IA 1WB9A 3QSGA 4UFPA 3E03A 2QBYA 3DAYA 3SEQA 1F0PA 1Z08A 5EWMA 4KO3S 4I50F 4AN0A 2BEUA 5CB4A 1XYGA 1E1NA 1W76A 4RL6A 1AQIA 5SY4A 5FV4A 1QRAA 3AOEA 1IZYA 2ROQA 2VJPA 4N5IX 5D7NA 2Y2VA 5AUNB 1FDOA 4F9TA 3DO8A 4KXMA 4OGKA 5FPQA 2NTJA 2CWWA 1Y9DA 3HA3A 2PO5A 1N2HA 1SCQA 3EVEA 2EATA 1RHKA 1VSTA 4PFJA 4YJ2B 4KPGA 5FBRB 3I58A 2ZRNA 4KNWA 3PF8A 3WRYA 1FBNA 4CKBB 2YHBA 4TYNA 3IHKA 721PA 3I92A 2XECA 4UKDA 5I3CA 1C9YA 4WBNB 1M1NA 3AF0A 1QRUA 3QNUA 1QHNA 5TS2A 3VC7A 4KVZA 4QICA 2AKAB 2KBEA 4BNDA 4L76A 4DTCA 2PLWA 3EISA 1V26A 2G4VA 3LT5A 5IHXA 1XD9A 3F8SA 4FDLA 3R7LA 1Q0LA 1AUQA 1M1UA 2SNIE 5CVJA 3V1UA 4BBJA 4PZPA 1QRSA 3MTJA 4N7RA 3IP7A 1QG4A 2H29A 1FNCA 4TWAA 2JIMA 3N2LA 3NHRA 5B6IA 4EABA 3QBVA 1MO4A 1TTPB 1DJQA 2YOHA 4IV5A 2EFCB 3C70A 4X6LA 4NK5A 4R01A 2H7VA 1I5RA 4XYGA 4MUGA 3WZLA 5HNKA 5F1PA 4Z2AA 2IS2A 3Q40A 3K09C 1XVLA 5KYGA 3INGA 1FS5A 3T5MA 1NATA 2IYOA 3Q3EA 1TXGA 4R1OA 3IDQA 5AYVA 1PLKA 2CJWA 4L22A 2VHTA 3WGZA 2FGKA 2GFQA 4DF3A 3EEIA 2VHXA 3L7BA 3G5MA 3MTEA 5AUQA 1O3YA 3R7AA 2E0IA 3OZTA 4ZMBA 2H54A 3LPLA 2F48A 2Q3JA 4I4TA 3QFRA 5G0TA 4FGUA 5BSUA 4D3XA 1CY2A 1CR1A 1PSZA 1K7YA 4CWAA 1EWKA 5JH7F 4H7DA 2JB9A 3M9LA 2O8CA 4I55F 1FVXA 1V6AA 1UKCA 3RAEC 2OQIA 1NTOA 5DM1A 3FFWA 4ZK2A 1DTWA 5KCZA 3G0IA 5JEDA 2XKKA 4P5PA 4V3BA 4WUVA 5AICA 1MOZA 3P2JA 1NJ2A 3COJA 4FJ0A 3DE5X 4ZOBA 3JQ7A 3HBJA 1GYQA 1SUDA 1XRRA 1RCTE 1ML3A 2WIJA 3AY3A 1W5FA 1YI1A 2G25A 2W6ZA 2XZDA 3DV0A 3QELB 3L0IB 4H4DA 4IZHA 1PK8A 1QK3A 2EKZA 2WJVA 4R4JA 4URUR 5LLDA 2OK7A 4H60A 2MYTA 2JCXA 1UWKA 1F14A 2ACKA 3QEMB 2GQ0A 4PYMA 3T1HB 3T1YB 5JXWA 4ROSA 1XSEA 2YICA 4J03A 4KVAA 5C52B 2V5VA 1U0FA 4IJQA 2DUWA 4NZPA 1X7XA 2AG1A 2ZRHA 3ORQA 5JG7A 5IKEA 3JWHA 3L7LA 4F04A 4JJ7A 1VE5A 1MMFB 1QZZA 3JWIA 3ET4A 2H1HA 2BTOA 2FXIA 5AW2A 1CY8A 1KZ4A 1JAZA 2GLXA 2EZUA 4NBTA 1T2NA 4JXKA 4XZ3A 1ONNA 1VJDA 4BWVA 1TTQB 1G1MA 1XTSA 2F9MA 3IJRA 3PI7A 1IN5A 1N34B 1OAOC 4PLWA 3R0XA 3MB8A 4NZNA 4EY8A 4Z7QB 4QSHA 2J9YB 3GNLA 3BREA 4GLBA 2VF8A 4O5OA 1YR8A 3IE1A 4CT5A 1PGJA 1HK7A 2I6GA 1CFZA 4L0DA 2G4LA 2GTHA 4ZICA 4HI0E 3FYHA 1BX3A 3VHLB 3IAEA 2R11A 1NZDA 2BUBA 1U2RA 2IF0A 1BXKA 2LNDA 5B4UA 1IYZA 3EUAA 4NU6A 2B4AA 4A6PA 1E2IA 2GEDA 1VG0B 1CZLA 1UJ6A 2QTLA 1KMIY 2NZJA 2ZDHA 1LQ2A 4IWYA 3SM9A 3Q1LA 3H6GA 4QTYA 1U5BB 1QRDA 2KI5A 4AWBA 1I9GA 3HJAA 1E2PA 3L6BA 3LGAA 5J47A 1OOEA 4L4ZA 4MVJD 5BOSB 2PX8A 3FPFA 3HYCA 3PGKA 2GX6A 1LS6A 1RACA 4KSCA 3U7IA 5I4IA 4YA6A 5LU9A 3H2JA 5KWIA 3L8EA 3PC8C 5AKJA 1RC0A 4D56A 2CDBA 3W5IA 1S3SA 3ADBA 5IXJA 3RHFA 4O4LB 1RZ3A 2FQQA 4WY8A 2YOGA 5KS2A 1SCUA 4PLYA 3NZEA 2P6MA 4C01A 5BR1A 4B3TB 3KKKA 3UTDA 1CK4A 5I7VA 1R4MA 2EWVA 2BM9A 4MLZA 1YTUA 1Q11A 2IDZA 4PPNA 1PYGA 2JAWA 3QI7A 3U31A 3CZ5A 3MJDA 3PXXA 1NE7A 2J32A 1NJSA 2QUKA 4U9UA 3KD3A 2G8NA 1KYIA 3JARB 3M1AA 1NC3A 1RI2A 2E37A 2C2OA 3QU9A 4I5GA 3E1KA 4OHKA 2AK2A 5H3LA 1NMZA 3RVOA 3QXCA 3V33A 3KFVA 3IXLA 5JANA 1PI3A 1Y0BA 4PZ9A 1PFGA 3RYFA 1LLQA 2NXNA 3B6KA 4G0OA 3U3OA 1VA5A 4QFCA 5E4JA 3WMRA 1DIRA 1NF3A 1QE3A 5FTWA 3ETCA 2BHSA 2HV9A 4OKNA 3VOBA 1DCMA 3DNPA 3IUJA 4RKYA 5ADVA 1MW8X 1OXTA 4ZAFA 2QT0A 5ED0A 1E4OA 4FKMA 4MR8A 5THXA 3ZEAA 2QVCA 1XEWX 3ZW7A 1DLIA 4LFAB 2JF0A 3PIDA 2QIOA 1QO9A 3R5KA 3SYMA 1DBRA 3ZD7A 2BMVA 1OX4A 5EIEA 3KHTA 1ZJWA 5B3JC 1V95A 3LUHA 4JGIA 2ETXA 5HRAA 4XGNA 1KIAA 1BVYF 3TVDA 1E0SA 2QAIA 4PVCA 2AUNA 2A1UB 3K0AA 1KYZA 1XIVA 5ALGA 4V1CA 1CE8B 1C0LA 1GPAA 1X1CA 2YWBA 1GRRA 1BJRE 1C8BA 2O2SA 1QG0A 3E9NA 3LT0A 4LJ8A 4BASA 2VH5R 5C8YB 3H99A 3FETA 4UVDA 3V1NA 4Q9JA 4QWWA 4B3DA 1VQ1A 3G5LA 3NNSA 3ZCQA 5ILOA 1SCJA 3ESBA 4PLFA 1H6DA 4WKPA 3L0PA 1Q1GA 3VR4A 2DY1A 2M1XA 2VYNA 2JFVA 1F8FA 1A9RA 4M0DA 4Q9KA 1GZVA 1WXHA 1UPFA 2SKCA 2VSYA 2WRZA 2WAMA 2HSGA 3R4VA 5FF9A 5FWYB 5GAJA 4TZ6A 1RPTA 5KCMA 4L9RA 1GPH1 4LJ7A 2AJLI 3COSA 1B6SA 2Y77A 1W1UA 1ZWKA 1MLDA 3KZXA 4KWEA 4LZNA 2QMUA 3U1VA 1BRMA 1FMTA 3U6BA 1EVJA 3BM5A 3NYRA 1NQVA 1J8YF 5LC1A 4WXEA 3RS9A 3UK6A 1PJLA 4Q1BA 3CCBA 2CN1A 4RK4A 2OCYC 3UQZA 2Q6VA 4KDEA 2EW2A 4F2WA 1QO0A 2W2XA 2XIJA 4BNDB 3KQLA 3DXFA 2XYQA 1E5XA 2VOEA 4Y30A 1BWQA 1KBQA 2CFOA 3BH0A 3OZDA 3PWSA 1CEEA 1AVTA 4CL2A 1HDGO 2PWPA 4CG1A 4BGDA 1EUQA 4A03A 2GWRA 1TNDA 3WJ1A 2JLBA 1JPJA 2ESRA 3HCDA 1WHSB 3NG1A 1RRFA 2B83A 4F3CA 1MQ8B 1NUAA 4ETMA 2VHEA 1H8HD 1B8PA 3N3BC 2YMMA 4LC1A 1PJ4A 1ABEA 2WF8A 3CISA 4EA7A 1CUAA 4OX9Y 1S9HA 2JASA 3NJRA 3URKA 3RODA 5ERXA 1OA0A 4HGOA 4KFCA 3BQMB 1JKIA 1USGA 3EXIB 3FKSA 3NONA 1D0VA 1DKPA 4HZGA 3CLUD 4KO1S 5L7WA 3OTOB 3ZVRA 4KYIB 1QGYA 4JR2A 2RHTA 4RPGA 4WQMA 4JI3B 3VNRA 1KRXA 3EZFA 3QX9A 2J5KA 1BN7A 4PCAA 5AHXA 2Y4OA 4G0ZA 3TG2A 2FMFA 4DNXA 4BWYA 3IAFA 2D00A 1Z15A 3NTXA 4QUBA 3EXHB 3GWGA 1O96A 4I4TF 1W4LA 4K6GA 2H07A 2DG2A 2QD1A 5DM4A 4GUDA 2HHAA 3ZW8A 1OH6A 1YFZA 3SSMA 2X9VA 1OI3A 1W0KD 5IANA 2JA2A 3LG2A 1JIXA 3GHHA 3P27A 2A84A 3PUHA 3UK1A 2QHXA 4QU8A 1E6EA 4BQNA 1U11A 3HY6A 4CUZA 1MGPA 3AUFA 3DBLB 3CBQA 1G2OA 4WDQA 1W5EA 4A8HA 4QPPA 3JZAA 3QA3E 1JEDA 5DOZA 4RPJA 4GXNA 4D9EA 2Z6UA 3NV7A 2AWOA 2QRHA 3WDSA 4F60A 4OKIA 4UEOA 3SQMA 4Q24A 2ZRQA 3D9QX 4FOTA 1Y7PA 4OUKX 5F78A 1Z8DA 4N5MA 4B9EA 4C2TA 3EPPA 4LY9A 3PQCA 1U65A 4PGGA 1UPBA 2I8CA 2BR5A 3OPNA 4D0NA 1REQA 2KBFA 3FCAA 1DU4A 3E9RA 4QYIA 3WSVA 4LSZA 1KEZA 4YRRA 1MNAA 2ZREA 3HDQA 3RADC 2XCLA 1NZFA 1QYXA 2QY9A 3NX4A 4IDGA 4M7WA 4Y2SA 2QVGA 3SC2A 4B3IA 3IEMA 4D8UA 1W0KA 2HSDA 3HADA 1W6UA 2ETVA 1MVLA 3P9IA 2V7XA 2RK6A 1UPXA 3AJRA 4IGEA 5EZYB 4R6WA 2IU6A 1W8DA 2I2CA 3RS2A 4URWR 4CG2A 2YN2A 3IA7A 2VHZA 2PAAA 2HEGA 1YC2A 4OHPA 1IHXA 4QPNA 2BELA 1BCSB 4R68A 4ZDIA 1DCTA 1USIA 5G0UA 4UOZA 1E3MA 1G63A 1N3BA 2IHKA 2VH1A 2WUVA 3AOGA 2IH2A 2XA2A 2R6AA 1PEAA 3ZGVA 3NVKI 4ZCTA 3HHEA 3DULA 2V4MA 5G3YA 1T5IA 2POCA 3CRRA 2OYRA 3ZWDA 4K9KA 3AIKA 2Q5CA 2H1RA 5D84A 1UIRA 2P3QA 4I6EA 1E5LA 1PT5A 4B73A 4J1TA 5I9TA 3UJBA 1JYSA 1NF9A 1XNHA 2VHWA 5CX1A 5ALHA 4AMYA 2AKYA 3A3KA 4GWGA 4WUTA 2X8BA 3CWZA 3DAPA 2OO5A 3K0FA 4HR7A 3GCGA 1Z25A 1Y3BE 1ZMRA 2VKTA 1TUBB 1XRNA 2C84A 3N2GA 1M6VB 3DHEA 2Y1KA 2OKCA 1JDUA 2VSXA 2C9ZA 3EVCA 4DRXB 2FK8A 1UKAA 1XAIA 4KFTA 1MO2A 3TIFA 4AZ3B 4EZIA 4XFDA 2OV3A 5CFQA 4I2NA 1QTNA 2BVNA 4W8GA 3CN9A 3Q7IA 2NU6A 3PSAA 3ZQ6A 3ZU4A 1HM5A 4X44A 1DAIA 2G71A 3RIHA 3N8DA 4O25A 1DC5A 4G4SP 3KKZA 2PA3A 3QOYA 3NTLA 4MW5A 3TLGB 3ZNQA 2ZRLA 3NANA 1D2MA 3GDWA 1EZ1A 3IJPA 4HC4A 1KMCA 1CU1A 4MVJG 1I8TA 3U3DA 2ZRDA 4X92A 4XSGA 4IMIB 4WESA 4YV0A 2V65A 1W0CA 4IIJB 5IJ0A 2DKOA 1THGA 1W48A 3G82C 1L1RA 1PDWA 4D4IA 1E6CA 4TMZA 4HVAA 4Y6LA 5FTNA 2I6QA 2YHIB 3B1XA 4ARSA 4Z7JA 5BWCA 3OC6A 1WP4A 5AOCA 1G21B 1WUHS 4JJFA 2IRWA 3GAAA 3LNTA 5AM0A 2M9MA 3E3OA 1JBQA 3EODA 1RYMA 3IDOA 4C4OA 1KVUA 1DS6A 1QK5A 1TD1A 2J5XA 1S8AA 1A8PA 2W42A 1FNDA 2JI7A 2QJTA 3F9IA 4PPGA 5D5PA 2BCEA 1PVDA 1TGYA 1EBFA 4MVYA 5FUYA 3TR6A 4ARVA 1HTWA 2PZBA 4ZQIA 1P81A 2H4FA 2FP4B 1M83A 2ENUA 1B41A 2BONA 1YRBA 3CGGA 3ER6A 4K40A 1FSGA 1MX5A 2Q0QA 5G4KA 4DIEA 2XT0A 3ZLTA 4TSFD 3B6EA 2ZRCA 4R2WA 1VMAA 4L6CA 2J5RA 3R0QA 4LXUA 4QVKA 1MOSA 1QANA 2AQ8A 2NGRA 3EASA 2I7CA 4UMDA 4BEVA 4QYTA 2Z1DA 5AMXA 4BKOA 1T10A 2PQ6A 4NENB 3THOA 2J09A 2WICA 2ZTVA 3QBDA 2RAVA 4KACA 1E7QA 5KTTA 1ANKA 3D4PA 2R66A 3TTUA 2ZJ1A 3GDHA 1P39A 3E3AA 2B0CA 2VPIA 3GPDG 3NVAA 3C43A 5CHYA 3UB3A 4CLRB 3GXBA 3DYIA 5EJFA 4BO9A 2WQ7A 1JNYA 2J8ZA 2QPAA 4Q7EA 1U9ZA 2FY8A 5KOJA 1H9BA 1E59A 1OFUX 4F12A 2GASA 1IM8A 4PLHA 4K86A 1CQJA 2GUGA 5C8YF 2JLVA 1Y9ZA 4B48A 2Y8EA 1YACA 4JI7B 4RELA 3CVJA 1XTJA 1XXHE 1JJVA 2VT7A 1XZDA 5KDDA 2CJPA 3ZXSA 5EJ5A 1DAGA 4KUGA 5JYCA 4G37A 3JQ8A 3K70D 2QSZA 1GPMA 2XQFA 2IZ0A 5JNSA 1EINA 3WIUA 1QP4A 2J3JA 4UBKA 2F4VB 4PGFA 5BW5A 2P35A 1X7ZA 1OHHA 2CXXA 2XYGA 2W6JD 3PS9A 3DE4X 2HHHB 4M0PA 3E1SA 4K5QA 2VHQA 3SNKA 2JC3A 4HJXA 3A1EA 3NHAA 3X44A 3ZJTA 2RH5A 4J7UA 3VAAA 3JAWA 3IKVA 3GVHA 3UNXA 3HZOA 4CGYA 4DRZA 2BH9A 4C03A 4CF4A 2W0MA 2DPXA 1W30A 3Q9LA 3I5UA 3V4LA 5IBRA 4G1UC 2WY2D 5HKOA 4LYJA 3PI6A 4AW9A 1ISMA 3EZ2A 1DEAA 3ONVA 1Q1QA 1YIOA 3CJRA 3TOSA 1P8JA 4ZV9A 1RXEA 2GKSA 4YB8A 2X6TA 4QBHA 4YPOA 3H1AA 4QDZA 1P19A 1OGJA 5JPDA 4WWHA 4XM2A 1SKBA 3GFBA 3SIPA 5JXJA 1GLGA 3Q3VA 3VSEA 1RWQA 3DE2X 3WJAA 1UQTA 2CXUA 1ZSYA 2Y66A 3JYHA 3NDRA 4QQ8A 3ZHCA 5L4LA 1DPFA 4LHVA 5H81A 1CJUC 3ZNNA 2ACVA 2FPKA 3LQ1A 2ZRKA 3ZOZA 1JU9A 3SC6A 1IOVA 4BO0A 4JYZA 3DCYA 3KFXA 2TECE 3RTAA 5BXYA 3BTUA 3I09A 1JAHA 4XRRA 2R4TA 2I6XA 2X13A 2Y27A 3CX7A 1ZINA 2HIMA 2XUPA 3L46A 2J0UB 4G0QA 3TTVA 3CH7A 4DV1B 2G3YA 4MW2A 3PDIB 5KTOA 1J6UA 4ALKA 1PZXA 4FE7A 3ENNA 2JBHA 2I7DA 4QYWA 1TCVA 2RB5A 4DPLA 4C7OA 5CH8A 5G2OA 1T1IA 3ZXIA 4CIWA 4WKNA 4P6VF 4TYQA 1YAJA 3D5TA 1WUJS 4MHOA 2D2VA 3JRWA 1F12A 3LZCA 3Q9SA 3GVPA 3QKRA 5HFNA 3MGCA 4D9FA 2ZPUA 4NYJQ 5GZ1A 1MHTA 1U0TA 1E9DA 5HF9A 1ZM4A 1E1CA 3GWZA 4KRXA 2IUEA 1EHIA 1HR0B 4FDAA 3TECE 3VC3A 4UTNA 1W96A 4YEDA 1APBA 2DT5A 3N9IA 1T0HB 1XVUA 2QW0X 2X2EA 3W3AA 1VCOA 3DEJA 5B58C 4CEJA 5HZMA 2PH5A 1BDHA 2ZTSA 1INLA 1NVAA 3HGQA 3VU9B 1SCNE 1ZJYA 5EJ7A 2O3QA 3AF6A 2FG6C 4ID3A 3UG7A 4UM9B 3JSXA 3Q7EA 3RVNA 1E9VA 3PC4A 4RGQA 3QA9A 3TZBA 4QZVA 1YB7A 5KIAA 4WACA 2Q9BA 1YQDA 2XW6A 3BA6A 1ESNA 4X66B 4FX5A 2NVWA 1MVOA 2DBQA 2JAPA 1Q57A 5K45A 2IV3A 4QKQA 4YH1A 4CBVA 3FPCA 1YA8A 2H59A 4HYYA 4KQMA 4UVIA 3ADPA 3RROA 5K4GA 1GG9A 3IUEA 2QXTA 2SCUA 3KEGA 3NIWA 2WHRA 1L5GB 3LO8A 1E2MA 2KYRA 1CZKA 2AJ8A 4MIEA 3AILA 1IAQA 2XMGA 4KPUA 1ECFA 1Y4UA 4EOGA 1UBCA 4W1SA 5BN4A 3FOWA 5CDHA 3T3NA 4J43A 3NMUF 3CPEA 3V8EA 4W5QA 2I9KA 4GI3A 4DV7B 2PUEA 4E2YA 3D1JA 2FOLA 5FUMA 3RFVA 4WOKA 3P9YA 4NCIA 5K3FA 2OAP1 1QFMA 2DSNA 1K97A 1HYHA 1KJWA 1XJWA 3K16A 3MSXA 2AHOA 2DH5A 4ZGGA 5FWXB 2R48A 3Q88A 4Y1RA 1ZD1A 3PVZA 4MRAA 3KTAA 5CR9A 3KO8A 3VNQA 2DQSA 3U4IA 4Y2UA 5JPIA 4N0DA 3EMBA 2D6FA 1F2TA 3HYNA 5F2EA 1LF5A 1RXVA 2FPOA 1U7XA 2JFXA 4NQRA 1FVHA 2YHAA 3MQFA 1JLLB 1ZD4A 3Q7TA 2X4GA 2UUAB 3I6IA 2JFQA 4M9UA 1DWOA 5ENZA 3HJBA 5CA0F 3BGIA 4TXHA 5KKCA 1UFRA 3FSEA 1TM2A 2J07A 3CW8X 5HZGA 4GR9A 3S5UA 1Q7RA 1M0SA 2WKSA 1KGDA 2WWTA 2ZYDA 4GO1A 4RCZA 4U2EA 4XDHA 3LXUX 3TVYA 4F5ZA 1KMHA 2R1TA 3HTXA 4MB2A 1SXJB 1OLUB 4CFZA 3DMRA 3PVCA 3I34X 4JODA 4NDNE 1WZ2A 3DMTA 4WFJA 2QZ4A 4MWBA 5DYTA 3GLGB 2CYBA 2DPMA 3BWYA 1V4BA 2IDKA 4FP9A 4MWOA 4XQ0A 1KZ7B 2PXHA 4LF9B 3VFDA 1JSLA 2FX3A 1ELOA 2N1MA 2QTVB 2QY6A 3RR2A 4D44A 4EY3A 3ABSB 4LE2A 1YRAA 3N5CA 2PWBA 1EBUA 3DDZX 1P62B 2H6EA 4KMSA 2OUIA 1QS0A 4QGBA 1SBNE 3H0KA 2ZT6A 2X41A 1EZZA 4L78A 3X1WA 1JFTA 3T61A 2D4HA 1SU6A 3R7SA 4E2ZA 1WMDA 4I4CA 2Q27A 2W8BA 1IXRC 2I33A 4GPTA 1T0UA 2QSUA 3IEXA 4WY5A 5L3VA 2AL7A 2Z5LA 3DBRB 4GP6A 4CMIB 1S2MA 1NX6A 1PZNA 5ERYA 1EGAA 1N7JA 1TMGE 1KQPA 1ZD8A 2AOWA 4BIMA 2GA8A 4HYEA 2O2XA 4B82A 5JCJA 5G0SA 1FTWA 2FPIA 2J4FA 2GM5A 2PZJA 2QLJA 4UJ5A 5AVJA 1RQLA 3COWA 2Z58A 3P96A 5KYUA 3ESQA 2PKQO 3RVDA 1NVGA 2JANA 2PL5A 3REQA 1LFDB 1R6VA 5A7HA 3AR3A 1JHDA 3GIWA 1NP7A 1USKA 3DXYA 5HZKA 3TSZA 3B5JA 2XYHA 3KPYA 5EP1A 1TUGA 1LS1A 2I78A 3HJHA 4WL0A 3QTBA 5CA0A 3KPVA 2AFIB 2Y1LA 1JZSA 2CLSA 2VK8A 5AHOA 4U6NA 1MPTA 3H1PA 3DGEC 2YXNA 3NM4A 5GP1A 3UAXA 1DX4A 1FFBA 3ASVA 3EF0A 3N2NA 3B1KA 1VI2A 3I52A 4FU0A 1CSEE 4PAQA 2N3ZA 3CRW1 3JZMA 2NSYA 3HKCB 1D04A 2EGHA 4HBZA 4WDRA 3SXUA 1JFSA 1DJMA 2J0EA 2R6R1 4RVSA 3RIEA 1C1DA 1U04A 1Z0UA 1A9XB 2X8AA 1KDOA 4IG4A 4Y3UA 5AK3A 2B3DA 2Y1FA 3ZGLA 4ENPA 1L4EA 3SC3A 2K7FA 4JI8B 2O0MA 1RHRA 1OAOA 3QBEA 4KN5A 8ABPA 4ZXFA 3PKZA 1SU7A 1P7YA 2QP4A 3OCVA 5E1BA 3V9AA 1OH8A 3R3JA 3FZGA 4CEJB 2ONKA 2PGNA 4WXHA 5DI9A 4XVHA 2Q7OE 2ONCA 4IV8A 3K71B 3MJSA 1KYTA 1OKKD 5ES4B 2VCEA 5JLAA 4OPMA 2WIAA 4UOEA 2XNCA 2A94A 2NN3C 5TF0A 4DM3A 4I08A 2OOSA 3BWCA 2FW9A 3FI0A 2I67A 4ZPJA 3C3CA 3DDUA 1EX1A 5EJ8A 4ZP1A 4KLNA 2PDAA 4PIVA 1PL6A 1G20A 3DC7A 4BUZA 2B61A 1X1TA 3G1UA 2PKEA 3QBJA 2P5UA 2YZ2A 2QRVA 3EJ6A 3HLTA 2NYRA 4HWKA 7REQB 4LIPD 5EQDA 5FEUA 1L4BA 1Z6PA 3B60A 3I0MA 5ICFA 4LVCA 4WNAA 4C0SA 1C30A 1M76A 2EFEB 3UN1A 4G5YA 1J49A 2BZ1A 3N0XA 4MKFA 3DVAB 3EUFA 3BE4A 4DAOA 2QD5A 4X1OA 5FOXA 1YBMA 1CNEA 1DP4A 1WIWA 3PK0A 1H85A 4QJIA 5GMOA 2CVZA 3MBKA 5MGNA 1WB6A 3THSA 3T1TA 1M75A 3H84A 4A27A 4U8HA 4WNIA 1WTCA 1Q1AA 4P3OA 1B93A 1YQEA 3L06A 4ML3A 5DFAA 1KTIA 5TXGA 3OX2A 2IZ6A 1O2DA 3CVWA 2PS0A 3NWPA 4LSGA 4I9NA 4ZGBA 1XVVA 1FZQA 1P2TA 4L6AA 1YDEA 4H3VA 1VBKA 4KN9S 2XNDA 3MLBA 3IRUA 5E7QA 5L51A 3QMVA 3VHXB 2KW5A 1LDYA 3L04A 3X1DA 5ELXA 1RXWA 1U1FA 2G9ZA 3NALA 1XQVA 4RSMA 3KETA 1J1IA 3GQBA 1A5TA 1CRLA 3KB2A 4B3FX 3QLVA 2O3SA 3JQAB 2WAAA 3QKSA 2DFLA 3ISVA 2QJFA 2OZKA 1XZQA 2A5GA 2VXYA 4L8YA 3ILVA 3OEHD 1V1RB 4P08A 3BMNA 4Q1AA 5HJEA 1XHLA 3O4VA 5F52A 3ZZUA 1KH3A 3L02A 4NOLA 2O2EA 4RNCA 1T0BA 3VZPA 4BLQA 3RUFA 2FW7A 2GHQA 2PYZA 3E7DA 2GEJA 2G1JA 4CXMA 2OXRA 1BIFA 1N6RA 3GAZA 3PU6A 4H1UA 3UKOA 5GIOE 5FHRA 3RU9A 1IULA 4ZWNA 3RUPA 2XQJA 5H4GA 1M2VB 3BTOA 3U4DA 2JLSA 4RAQA 4RS4A 4WVFA 1HE1C 2WG1A 3K6SA 3EDMA 2EJVA 2FLWA 4NV0A 4DJAA 3G2NA 4YO8A 1OIVA 1WUYA 3G3EA 3SSOA 1E4EB 4DMKA 3K1TA 5I7HA 1I7QB 3KUUA 4RIHA 3R7WB 4CN9A 2VH2A 1CULC 2Y0EA 1LRJA 1UZLA 3AM3A 1BE1A 1T6ZA 4I14A 3MD0A 3BXGA 3ZCRA 1EJ2A 1JIIA 4UZEA 3T15A 3M0EA 4R1NA 1QHGA 2NXJA 2N42A 3P0EA 2F8SA 3MWEA 4L3WA 5FAKA 3TW8B 2JAQA 4MQFB 1W6RA 2OILA 1MABA 5DGHA 5E0KB 4CNQA 4IXMA 13PKA 2HMYB 5TPZD 2DTEA 1OXVA 2JGKA 3AFNA 1FUEA 3VZDA 4Q7JB 2O8CB 2B8NA 4J6FA 3WYGA 2DX7A 5KTSA 4OHUA 4C0BA 2YDYA 1C9KA 2VYVD 3KQMA 2W48A 2BEKA 3E0XA 4RH3A 4EK9A 2WWGA 2F8MA 4BQPA 1R0XA 1HG0A 2H7YA 1FPQA 3PC2A 2AUMA 3SLRA 1QF6A 2MCFA 4GP7A 1CZNA 1R66A 5EP4A 2FR8C 1LWOA 1THZA 3L01A 1A9SA 2QX9A 3H1GA 4EG5A 3SSNA 3FWYA 1LI7A 1W52X 1JQAA 3NXKA 4RA9B 3RPEA 1AQLA 5LMZA 1ZCZA 2J3KA 4X1IA 4J9UE 5FYDA 3WS7A 5C32A 3EGXA 3EMDA 2A1TR 3SDBA 1HXHA 2YYYA 2X1HA 5C7LO 4LZPA 1X0XA 3HGMA 2CUTA 3HI6A 1Y1PA 2YHSA 4P35A 1JEJA 5CLJA 2EKDA 2V1XA 3I3OA 3RC9A 3HJRA 3ZWXA 4ZJYA 3W8NA 4H1HA 1P1BA 1QHFA 4C87A 1DHTA 4C14A 5EJEA 3CXRA 3MC1A 4UDXX 2INGX 5KU1A 2QK4A 1GILA 5G41A 3BJZA 2JHGA 2NUAB 3RAPR 4AWAA 4NCAA 3AVUA 1X39A 4BN4A 1QAOA 1L4FA 2DY0A 4GWLA 2GN6A 1JQ3A 3D4BA 4U7FA 2B20A 3OZIA 3WAGA 3HP7A 3QU4A 5JYBA 3F78A 4QFDA 3VTKA 4R8SA 2EHJA 3FROA 3EUWA 2C82A 1JP7A 1VIMA 3MTDA 3U44B 3TTTA 1E98A 3EG5A 2ID7A 3NEPX 4GVLA 1TAUA 1IIRA 3PEEA 4U39A 5E38A 4O4JF 5K0NA 1N2XA 4BX2A 2PRZA 1E9CA 4MWSA 5DCLA 4PO8A 4ZKEA 3TDKA 2FEPA 2BI4A 1OLXA 4F4CA 1IWPB 3UO8B 1CW2B 3B51X 3H6HA 3T4XA 1YMQA 3OU7A 2YVQA 4B75A 5LQNA 2HMSA 3C3JA 1YOVB 3MPOA 2X8LA 4Y7DA 3W6NA 1N6OA 1OKKA 2C7GA 1GXSA 4F46A 4C4ZA 4B7ZA 3QQ5A 3VKVA 1BXGA 1Z3IX 3CRMA 3OZAA 4AT1A 2ZYTX 2VUSA 3GYBA 4B0PA 4DV5B 3VA7A 2VPPA 4TWZA 6ABPA 4DSUA 3LHKA 1M34A 5IM5A 4EKDA 1P2GA 4HDMB 3GJXC 5K0EA 1XXHA 4ISCA 2QMEA 4WOPA 1SBCA 1D2AA 5LOVB 1E3IA 1TGVA 2JLQA 3AUKA 5DTEA 1NW6A 1SCAA 4O4HF 3RTBA 3CNOA 2BGLA 2XOKD 1VRCA 2A35A 4FR0A 4G86A 3ZWCA 5CFPA 5MHTA 4UQLA 4DV0B 4YJ3B 2VSQA 4F85A 3P9NA 3LC0A 2J45A 2GRUA 1P5ZB 1WNTA 3T3PB 3GIDA 4OQQA 5J59A 3I2IA 3IEKA 1VL2A 2HBZA 1XLTA 3L6DA 1SVIA 1C50A 1VHJA 2QRGA 2NVUB 4V0QA 1GTMA 1KZ6A 1NHWA 4MJ7A 4OTZA 4L85A 4N3CA 1N0UA 3D7KA 5JZSA 5BMVF 4MRMB 3L7KA 4HUJA 3V6LA 1S0UA 4ALLA 4ZOQI 3PX3A 2JLAA 2DQZA 3BE8A 4KQIA 2FSIA 1CJCA 2QM0A 5EP2A 1D4FA 4IIEA 3OJFA 2Q1SA 1SCIA 3NAMA 3TOZA 4DUZB 3JQEA 1E62A 5JJLA 5CNMA 4FMCB 3UCXA 3ORFA 4RANA 1OT5A 4QXRA 4RVGA 1H1LB 3A1NA 1NN1A 3OZFA 3MYYA 3EQZA 3AI2A 3PG5A 2JCSA 3OIGA 4AM8A 1GZ3A 4CE6A 2C2HA 1RJGA 2X3FA 4OGWA 4IIDA 3OE7A 4ZEXA 3GPBA 5CH3A 3F7NA 2NO0A 4NOMA 1QZTA 2P9BA 1IDN1 1P29A 3V7WA 4XSVA 2ORIA 4HWGA 2I1LA 4PHCA 1FU4A 1DAPA 4DG9A 3CSSA 2QR2A 5TMBA 5I4BA 3WO0A 1L2TA 4QPZA 3LPNA 4GOND 5TT0A 3FPBA 2FX2A 2IHZA 1WZCA 1U1DA 2DKFA 1PJAA 3ZQ4A 8LDHA 3PJRA 4MPJA 3FPAA 2OV6A 1LDGA 2QNIA 4IQ8A 4F3YA 3V55A 4F38A 3K0AB 2D3WA 4QLAA 2M2IA 3PUWA 3KXDA 4ZT7A 3U4MA 4DLNA 2IGTA 2DM6A 5K3OA 3DB1A 1F4LA 4RF4A 4UBNA 1AJEA 5IT5A 4BMSA 5KNCA 3DBLA 1GNVA 1JRLA 2GESA 2R86A 3LSTA 4TTTS 4WOJA 5ALJA 3B7WA 3PR2B 4JN6B 4INOA 5LQSA 2OY0A 3LUJA 3T5BA 1N6NA 1V16B 2HRZA 1U3VA 4QOSA 1HNZB 2J9ZB 4EY4A 2DUJA 4NU5A 1JIJA 1N5KA 2QGFA 3AETA 3CRNA 3M70A 4RY8A 2GXAA 5AUPB 1RYYA 3ZVMA 1E2HA 5L7YA 5FWYA 2C0QA 1J20A 1SPXA 4R8KA 5CFZA 1CPYA 2JDIA 4CKYA 1C4XA 1PR9A 4QYIB 2CLCX 3ESYA 1O6ZA 1SUEA 2AFHB 3MWYW 3HYSA 3MN1A 3DTNA 5DF1A 1DXYA 1D5WA 1UEXC 3QX7A 3RREA 2CUKA 1RD4A 1ACJA 3AYXB 3HB9A 2GPYA 1JAXA 3KU1A 3ZWMA 1E3WB 1JEYA 4CETA 5HK8A 3QMWA 5FL3A 5BOVA 3U7QA 1USVA 3S99A 3WLIA 3FLMA 3DA8A 3H2HA 4HB4A 3WRYC 1GZHB 1Z6AA 5C8ZA 4CCYA 2QMOA 2C5GA 1ZZGA 4YMUA 1TCBA 3RQIA 3BDIA 2R751 5K2MA 4MKXA 3TQSA 4E13A 3D6MA 5U9CA 1GOTA 1WHSA 1Y8QA 2EARA 2AE2A 4RIEA 1EQ2A 4QJBA 3ZD8A 4L51A 5C1IA 3HCOA 1EIWA 5TGTA 3OMWA 1G7CA 3H2BA 3HCNA 4M9QA 5DLPA 1EJBA 2CV2A 2Z5GA 4G8DA 3OKAA 4U6SA 3PA6A 3CX8A 1PP4A 1SXGA 3DOOA 4D3ZA 4TQUS 4A8JC 4GPBA 4ESOA 4TTVA 1M2GA 2FSGA 5EKSA 1IHDA 3TTYA 3M5PA 1MTZA 1WF3A 1UT8A 2ZRBA 2JAHA 1UM9A 3L6CA 3CU5A 1U80A 1NXWA 3D5QA 3H1BA 3N2GB 3U48A 2VYVA 3E84A 2NX2A 4FNAA 4F4IA 4ZCRA 1L7PA 1LNZA 2HMWA 1QPGA 2JJ1A 4JBWA 5LIRA 4AZ0B 3AMVA 2NU6B 4G1BA 5AW9A 1X7WB 2A9KA 3DCNA 3TJMA 1UBTS 4EUSA 4TKVA 2PXCA 1R6BX 4URXR 4X00A 3Q2KA 1A2BA 3UXMA 1HL3A 4C1BA 5C35A 4MVJP 3JD3A 4YONB 1UXGA 2IU3A 3BGDA 4OHZA 2C04A 4GEKA 1E89A 1RAFA 2EQAA 3M49A 4NPCA 4RH0A 1LSJA 3QX8A 4R83A 3NOQA 2WSBA 3ULKA 3GRAA 1TC1A 4K9RA 4C1NA 4TZKA 5M7EA 1V71A 5BV2P 2H1CA 2XMDA 2C0CA 4E08A 4DLWA 3GVIA 5BWNA 5ER9A 4JT4A 2P2YA 3ETLA 1WTAA 2GXQA 4L50A 3WXMA 4F2GA 4Y9TA 1O9GA 1P0FA 3G8DA 1W85B 3OAAD 4FGJA 3DEAA 3EWAA 3QOXA 3ODGA 1IAVA 4RBNA 1QQ7A 3BC1A 2WBLC 1RTTA 5C81A 2VEOA 3FFAA 3IKLA 4L8GA 4UBJA 3FOZA 3M6LA 4PZZA 1THMA 5L53A 2RI0A 5AW3A 4CM4A 1ACLA 4BQSA 3GBPA 5KYYB 2O8VA 3I4FA 2BFDB 2YVLA 5G4KB 4PX5A 4CT0A 3B5IA 5FDFA 1GZ5A 2N1BA 3BHIA 3QKIA 4RTNA 2PUDA 2PGDA 4LTDA 1XAHA 2IS6A 1FL9A 3GEBA 3L49A 2AFVA 1YUMA 3KKLA 1MG5A 3O93A 2GD0A 2Q1TA 4EYKA 2CJWB 4NENA 1DKLA 5IN4A 1GT6A 1XLTC 1EWRA 3TRHA 2J4CA 2C4MA 4LNUB 3EOZA 5SICE 3S2SA 4AD8A 4F6RA 1QHXA 1SD1A 4GL2A 2H52A 4XD7A 2B8JA 5JRZA 4EUKA 4LK2A 4BQFA 1A7AA 4B0OA 3WYEA 4C04A 1DGQA 3ZGNA 1SN7A 3T38A 3N2KB 3PUZA 2AKEA 2YWGA 3H9BA 1BCRB 1UANA 3A2NA 1A76A 4FQ7A 4WN3A 4B9AA 3SJZA 1R2QA 4FNMA 4ZVVA 4GW3A 1RYDA 3W2HA 1I30A 4MV5A 4N12A 1S5PA 5BSHA 5JROA 1ZL0A 1O0CA 1PN3A 1VECA 1MXFA 2YN0A 4BWGA 1SVNA 3LKVA 3H17A 1VLLA 4ZJUA 4DRXA 3DV0B 2WJIA 3CLRD 5JASA 3AF2A 2QYTA 2WE7A 3NM5A 1VSBA 3JR3A 1LBTA 3M3PA 3OQPA 3ZHSA 2KM1A 5ITWA 2ODEA 2NU9A 1PGQA 3H83A 2VDMB 2WJ6A 2IY8A 2PRSA 4DBLC 2QEQA 2HR1A 1NA5A 4K6HA 3RC8A 2GJ8A 5B55A 2YY5A 1K27A 2IPMA 3FVTA 5DULA 5CNIA 1AV7A 3ND8A 4NH0A 1MAVA 3NNNA 4OGLA 4DMLA 4YRBA 1KIMA 1ZITA 2J67A 3GRKA 3HN7A 3WV4A 1BXRB 2H2FA 2OKGA 2VRBA 3QPWA 1AQJA 1A7JA 3IP9A 2UZ4A 4HQOA 1S4QA 1JJ7A 3GLRA 4RKFA 2B5OA 4DXAA 1JLHA 1SKUA 4QTUB 3CYFA 1G59A 2VJLA 1S02A 1Z4MA 1YZQA 1B0UA 2QB5A 3A28A 4PQEA 4N0EA 2X19A 4QUGA 1MEJA 4RVUA 3UK2A 2P4EA 1ATIA 2JKVA 5IVHA 2BT4A 3UCEA 4JR1A 2C8VA 1TC2A 1FTGA 4X8MA 3W3AD 3IIKA 3O1HB 2YR0A 2G72A 5IYZB 2VP4A 2GK3A 2NO7A 1JI3A 1LV8A 1EBBA 2P11A 4KWCA 4YP0A 5K6RA 2E55A 1KORA 4QUIA 2B2NA 4DILA 5B6PA 3TXXA 1SC9A 2QWXA 3BK7A 2D7CA 5GGXA 3FIUA 3I01A 1Z6XA 2E5LB 3CEMA 3AEUA 4E5PA 2NTYC 5KPJA 4RPKA 1X3LA 3FUCA 1P0PA 4FYIA 3BWVA 4UREA 4FYVA 1VJGA 5JRDS 4XUDA 1JNXX 1DO8A 3OCXA 5GZ3A 3QE0A 3TB4A 1QBKC 4OJYA 2PUTA 1MA0A 4W1PA 1NGSA 3LUDA 4ENVA 1TE2A 4AO7A 2V7PA 3R76A 5KSZA 4UUQA 1H3EA 3IEIA 1I94B 1HMPA 1LLUA 1OYWA 3EQ8A 3FDJA 4KHZA 1EMDA 1JG6A 2BW0A 2CD7A 3MLAA 4WLNA 4D8XA 2IHUA 4DV3B 1MKYA 4RV9A 1PVOA 1XZPA 4PANA 1SC6A 4I4LA 5LCXA 4ZIRB 1C2YA 2VT6A 3SPXA 3TLEA 1WY5A 2J7PD 3KOMA 3L4BA 2HM7A 1JLMA 2O0KA 4ZHQB 4Z5XA 1VMKA 1ZHHA 3IPCA 5IDWA 4DUGD 1V1JA 3A58B 4NCJA 1W4RA 3A3PA 1I36A 1KBZA 2C07A 3GEGA 2Q2OA 2AFRA 2AF3C 3QYPA 4M1SA 3V97A 4YXFA 2P40A 1GNTA 1T4CA 3O7MA 2AOTA 4MI6A 5J1TB 1E5VA 3WR5A 1S1MA 1GCAA 2A9QA 3COPA 1ZU4A 4X3PA 4A1OA 4RK0A 2UYHA 3HR8A 1S7GA 3VO8A 3HVUA 2QVBA 1SKMA 3KKQA 3WOHA 5JDCC 3QVWA 1R0CA 4QOIA 1KI8A 3S1SA 1IJEA 4HWTA 1T0PA 4RA6A 3DEKA 4GLOA 4I9FA 2R1ZA 1UJ4A 3QWBA 4ZVQA 1H05A 1WLSA 4Q3CA 2VBFA 3A36A 3O3NB 4C6TA 5IX8A 2DQKA 1M33A 5GJCA 2R6HA 4NYMR 5KTNA 2DWCA 2QVZX 1G5TA 3CNNA 4PG7A 1WQ1R 1NZJA 4W8HA 1V5IA 2Z56A 2V6JA 3RFUA 2GN2A 1TK2A 4YAWA 4QAJA 4DXDA 1CB0A 2AUTA 3EPHA 4TYYA 3F5DA 1DTSA 1LQUA 3O4HA 4GICA 3EVAA 1U9JA 1PTJA 1XLVA 1SD5A 3QPCA 2FDRA 3RIXA 3OTGA 2YWHA 1BG6A 1G5QA 2YH2A 1YKGA 4WFKA 3K5PA 2Y71A 5FWXA 2VK4A 2Z3ZA 3PPIA 1X14A 2GXUA 1AU9A 3E48A 2G1UA 4PZCA 5HF6A 1H8ED 3A0UA 5AW0A 5D2CA 2RGBA 3ZGXA 2A9JA 3HB5X 4FVTA 3UPUA 1FMCA 2PY6A 2QKYA 4ETNA 1COZA 2D2IA 3BIWA 1MEEA 2CY0A 1KZYC 5JT1A 4E31A 3KKEA 1VL0A 4Y2YA 1Z29A 2G40A 3GFRA 4TV9F 4ZCQA 1EVZA 1GA1A 4BECA 3I37X 3AHIA 2GCEA 4H31A 1PS0A 3OPYB 4GWKA 2ISSD 1V5FA 4G5FA 2J3EA 1BHSA 3SKYA 3UJPA 3TQIA 3T7CA 4MR9B 4C7OB 2JNWA 1D2HA 3F5MA 3LU1A 4MVJI 2OD7A 1YCGA 4UEKA 4BU1A 4EPXA 5EXEA 4HMOA 2IHJA 5LSAA 3M5CA 3R75A 4WK6A 3SLKA 4EF4A 3NIGB 3AU8A 3WRXA 5JTUA 3TMKA 1Y48E 2HRQA 4EEXA 3VDNB 4LRXA 3EIXA 2CVQA 5FORA 1WB4A 3DHYA 1YR1A 3HSKA 1Y1TA 5GV7A 4RD1A 3DW3X 5KNBD 5HJ7A 4UUAA 2JZOA 4PZAA 3SX0A 3DMGA 1LPNA 1R18A 2HJ9A 4MEBA 4E5KA 5H02A 1F0YA 1TO1E 1DSSG 2WTMA 2Y2UA 4HGNA 4PFKA 1RU3A 3KQHA 4JP1A 4TLDA 1NBME 2W83A 4KK3A 1LPSA 2D1QA 5A6SB 2PM8A 4LEIA 1E8MA 1TMKA 1N3YA 1UJNA 2NO5A 5C8DA 1BD4A 1SOWA 4BJ3A 3F7OA 1YH3A 1US8A 3NDPA 3T1OA 2IUFA 3BWXA 2E89A 3WX0A 1P2FA 1WA5A 3WLQA 1SVOA 1P1IA 2FSVC 1DXQA 3UT5B 3LIPA 5DM0A 3HUEA 4LRTB 2QAGB 1X3SA 2P77A 4HXFB 3SZUA 3T7AA 4BZPA 1E20A 3TNFA 5C80A 1SOMA 4E46A 1CEQA 2XMRA 3TZKA 1ZSNA 1CBUA 1GLVA 3RGGA 3GP5A 1NQUA 1UMBB 3FYDA 4U2FA 3A4NA 4UU7A 4R41A 1U31A 4TWBA 1QGDA 1VGRA 1GQSA 4YRSA 1NF8A 4E2FA 1QDUA 8GPBA 4B1FA 3OJ0A 4UZFA 1DQYA 1TQ6A 4HXEB 3FKJA 3G1TA 3VMMA 2ZGVA 3LLCA 4L0MA 1FXSA 3C3YA 1XNGA 1NUPA 3ROGA 3HKCA 1V7QA 2GYVA 4ZA2A 3SXUB 2Q7DA 4AECA 4LMBA 5AVVA 1HE2A 1JPVA 1F06A 1FP6A 5GPBA 2O8FA 2HWUA 3QTLA 1HNNA 3VOTA 4RQAA 4CKCB 1P2UA 1T43A 5H59A 2IYTA 3ZHQA 2YCBA 1ZSVA 4JIMA 4EX7A 1IM5A 1HQDA 2ATXA 3TNLA 2ZSFA 3D8RA 4RTQA 1MC1A 3GZTB 5KEIA 1M1XB 2JH9A 3DVRX 3EBPA 3WGKA 2CHEA 1O95A 3CEHA 4YCJA 3DFMA 4TMYA 2D0OB 5GTDA 1LCIA 2BF7A 2Q5QA 3QPAA 1DAMA 2R1UA 3KJIA 3RNLA 1XDSA 5IVPA 3K9HA 1JQLB 2X8WA 4V0OA 1YUNA 1CS0B 3MJEA 3GLGA 3DWGA 2OWDA 2JLYA 2FEOA 4OV6B 1IEXA 3VBEA 4L16A 4MGKR 4ABTA 2WMYA 3PCXA 1C4KA 4XX0A 4PXAA 1XZBA 3A1VA 1C1HA 3DM5A 1PV1A 3JQDA 3BQNB 1QWSA 3MGKA 4PYRA 3HR4A 1FQWA 4Y0VA 5ISMA 1NU6A 2VIIA 2O3JA 3F74A 2OV1A 1PQUA 5KPDA 2HADA 2WU3A 2COKA 3RTDA 3TI9A 2WMOB 1NYLA 2O6LA 5C5EA 2ZI7A 3TZHA 1NF2A 3G7NA 1KFCB 4EG7A 3LI2A 4CLOA 1CY4A 2NMVA 4FZJA 3AY0A 1K06A 2P0AA 3G2MA 4HD8A 5SYAA 3PUVA 3OI7A 2VTDA 3EVTA 2JVJA 4V2IA 1PJZA 3GHYA 3R6TA 1PBTA 2B37A 2YOFA 3QY0A 4L6IA 5FA5A 3UJCA 2FPIB 2CNWD 2HA6A 3FMOB 4EKNB 4XRGA 5FUBA 2A5FA 1OBFO 2AXQA 4L27A 4NK4A 3DL0A 4NG5A 4Z0HO 5JADA 4BL5A 2W4QA 4LQCA 4N8SA 3ANXA 1CF4A 2B4QA 4MJXA 4PXSA 3TEMA 3QENA 2CDCA 2XRFA 3WO1A 3FNEA 4KXFB 2FN3A 3R9KA 1ODLA 2XE8A 3GRUA 3W2FA 3BD8A 1GWNA 3UBTA 1N2BA 1ZVJA 1VHLA 3MILA 4MUHA 4OSEA 3DKKA 1D09A 2J46A 1XTRA 2QV7A 4DGQA 4ODIA 2DH6A 1NNLA 2ZUDA 3BGWA 1HFJA 3PXCX 3WI7A 5CA1F 3PUYA 4XIFA 2H3HA 3ZS9A 1TZ2A 3B20A 4W99A 5EZQA 2X40A 4B6EA 2HY7A 4D43A 1OMOA 2A9FA 3PDCA 2RK4A 1HQCA 1PWHA 2P0YA 2ZR7A 1I2BA 3KQQA 3O9ZA 3OZUA 4NE2A 3TBFA 5D1NA 5FBQB 1RYBA 2XRMA 3DQPA 1KE1A 3ZWWA 1PT8A 1QCDA 5HR5A 2KS6A 3BMOA 4WESB 3VI4B 2IA5A 3ENVA 5AK5A 5K0FA 4BFWA 2I91A 3H3JA 3OQVA 4JK3A 5E6SB 3UAGA 2WFZA 1W93A 1V45E 5C7OO 1ZNWA 5HG0A 3WNBA 2P91A 5K8VA 3C3KA 2E9SA 1TF7A 1RWPA 3IPXA 4ZXPA 1P1RA 5FJIA 4DYDA 5JAUA 3BEDA 2D0DA 2M1ZA 3ANNA 3HRIA 1Z36A 4ZRDA 2BGKA 2HU7A 3TZQA 4XYLA 3L1KA 3CNHA 2VKQA 5BPFA 5KNLA 3K6SB 3OQIB 4NPHA 1TIKA 1DI0A 4E3ZA 4ER5A 3HVIA 1PHPA 1Y6FA 6AT1A 1AKVA 5DNUA 3OZEA 2ANCA 2HIGA 3HCFA 1AKRA 4KQCA 4NYJR 4BLSA 3OQNA 4Y9SA 3RI3A 3IQHX 4M4SA 3A8TA 2Z3WA 1G20B 2IT1A 4UTPA 3BORA 2VF5X 5EIAA 2O14A 1XYVA 3P0IA 1KS2A 3K1JA 3QVXA 1VSQA 3TD9A 1LVHA 2I2DA 1XQYA 5E3JA 3OO0A 5CIYA 4KC0A 4MTCA 3CXUA 3HXQA 5GGYA 2CJFA 4DV4B 3IV9A 4UMFA 3W3AH 2I4OA 1QXSA 5BWOA 1BA3A 2R7AA 3PFHA 3TFOA 1KI7A 5KBYA 5I5GA 3RKRA 2WUGA 1P77A 1YT5A 4XJVA 3LBAA 4Q3NA 3O31A 5KX5F 2RHOA 2H57A 4KQKA 4QOFA 1EHCA 3H5AA 1JQEA 3SI7A 1Z68A 4LGYA 3FSRA 4A82A 1TRHA 2OAQ1 5KYXB 4B33A 3ZE6A 1P5JA 2FGJA 3C6KA 4A5SA 1BROA 5KQSA 2P6UA 2JVIA 5FPSA 5FTLA 1VM6A 2VQFB 4R05A 5HKBA 1VE3A 3EXEB 4IEIA 4HCJA 1JXOA 5CXQA 4HN4B 4H0FA 3ZCTA 1H5UA 3AOEC 4ROTA 1E79A 3TM4A 4F2PA 5I7WA 5IFLA 4QT4A 4KI0A 1EB8A 4IVQA 1Z2CA 5LD2C 3NEAA 3FCOA 4HYTA 4TXNA 1QIEA 4BVJA 1CD5A 1QKIA 1AM4D 2F3TA 1CJTC 3KQTA 4RFVA 1OAKA 2KJQA 2I76A 3JS5A 3Q6MA 1RWWA 4Q3AA 4BLOA 2Q6LA 4TLBA 1YB5A 4WZBB 1UDXA 4V24A 4DL9A 1F2UA 2RONA 2X22A 2OVBA 2WP0A 1RRKA 2VF2A 4J29A 4LI3X 2WT8A 2R5FA 3K73O 2WDPA 3LUAA 3VVMA 2HC9A 4QGFA 1PAUA 3TW4A 5JXGA 3PGA1 4WZAE 3DEIA 1A5SB 1NRWA 2CBZA 4C7XA 1UR5A 1J23A 2OZVA 1SQ5A 4OAPA 4C07A 4MMYB 4AF8A 4XWOA 2Q62A 4EW1A 2NSDA 1OLXB 4UD6A 1CUSA 3FAZA 1NBIA 5C7YA 2XMPA 3GARA 4DIMA 5B64A 1AZWA 1LK7A 3GZJA 4MKIA 4YV1A 2PRKA 4ZO8A 2AQIA 4UCWA 3MFQA 4DC1A 2PKXA 3H5TA 3M4ZA 4IHJF 2BMEA 4TTAA 1K92A 3RJTA 1M34E 5HX7A 1ZNXA 2WJHA 1PW5A 2ADFA 1Z47A 3BB3A 2WWVD 3WMWA 3G0DA 3NFYA 3FSGA 2DR3A 2ID4A 2J6BA 2FQYA 3ILXA 3RWMB 5LXTA 2REXB 3HCWA 3HEMA 3BCHA 5AI6A 3A37A 2XBUA 2OFFA 1PUJA 5IZCA 3IVGA 5KNBA 1CLUA 1EYZA 2G7ZA 5AHKA 1QF7A 2BFBA 3CB4A 1E9AA 3K0EA 4X9XA 3I04A 4EYQA 1F17A 5KKNB 4RXTA 2IODA 3PQ3A 3B48A 1KU0A 1Q15A 3HYLA 4ZALA 5IMSA 4KR2A 2PT6A 3MW8A 4UM8B 4YJ3A 2Q6TA 1K6IA 3DPSA 3RVMA 3WHPA 1KEKA 2EEZA 2X5OA 1TB4A 2ZIEA 5DCYA 1CWUA 2NVUA 4IGKA 4ZO9A 4YJGB 1L4YA 4JQYA 2Q5EA 1S7CA 1L6RA 2BKLA 1JZTA 3D2AA 4J16C 3STWA 3A11A 3TM5A 4ZT3A 3PNMA 4RA9A 3MXOA 5E4FA 5ER6A 4F5EA 2A5DA 3T6KA 2O7VA 3U0VA 4NG4A 2WJYA 4JS0A 4X1IB 5EE3A 3N59A 1SRRA 3H87A 3H2KA 3WKEA 4UOQA 3I6MA 3NWOA 5A9SA 4A16A 4OOEA 5HJ5A 4XA8A 2EGGA 2FZLA 1O94D 2QL5A 1F3OA 3OOWA 4O4IB 1Z62A 2P7HA 4WBSA 2GZRA 4X1KA 3T5TA 1SWVA 3IYLW 2JBWA 3TLYA 1T2UA 3GGGA 2Y0PA 5F35A 2JI4A 3RRYA 4KH0A 3JYNA 4D6PA 1KJYA 2Q2WA 4A8JB 1TFUA 4Z99A 2CLIB 1DV1A 1E2LA 4YFYA 3J81k 3H9GA 3OFJA 4TTPA 1NNI1 3TWOA 1V4NA 3K0BA 2WILA 2GGSA 4GLLA 4PSCA 2CXSA 5EWJA 3U7FB 4M9CA 2P6RA 1CF2O 1J9EA 2ZUBA 4M7OA 3RBXA 3ZKWB 1VYUA 3VISA 4FMCF 3FM9A 1JR3E 4KZPA 1SG6A 1B6TA 2ZBEA 1RYFA 2I6SA 3HJCA 1CY7A 2ZJYA 1TF2A 2JAUA 3K0CC 4URHA 3N8KA 4D9CA 5DGIA 1PJ2A 1GL7A 1UJCA 4I7EA 1N3IA 3OLZA 1GGJA 1P73A 2WYUA 2I65A 3H9UA 4IRMA 1NT4A 2OXCA 4DAEA 1QYCA 1LLFA 4V1CI 4HMQA 1UP4A 2A9RA 4BNGA 2HA3A 2HQOA 3C97A 1QB7A 3HMQA 3T35A 4WXPA 1U9IC 1IVNA 3LVFO 5JYEA 3GZ4A 4H7PA 4Y1RB 5AM3A 1D7AA 4N0PA 2QG9A 4HN9A 4AJ2A 3MIZA 4DW8A 1PKXA 2E2WA 5CHEA 3N0RA 3ZYCA 4EVSA 3WKBA 1GSOA 1EAYA 3L7OA 3DDSA 2R5NA 4WSOA 3VHQA 2A7XA 4CKWA 3OP4A 2FEKA 3HE3A 4EH1A 5JSHA 1WX1A 2JCVA 2NAPA 4XVQA 5FBWB 3OJCA 2AWNA 4F9EA 1NMQA 5JQWA 1E3WA 2XQKA 3KZNA 5CB6A 2CUZA 1RYNA 2FTKE 3O4FA 4EA8A 3K6KA 3EXAA 5LFAA 1BE6A 2RHCA 2ZM5A 1G38A 4AKIA 1AC5A 3MOIA 2DZDA 1S1CA 2UVPB 2YMLA 4EG1A 2F8LA 1FQJA 3NM6B 5JQGB 3U7HB 4AJJA 3D3KA 1AXEA 4TUYF 1IN6A 5C3UA 2XWQA 1Y8QB 4C4RA 4WCVA 3JW8A 4KBFA 3M6AA 3OWXA 2VQ3A 4N3BA 4IZIA 3LX5A 4P4NA 3PJFA 3EWNA 5JDIA 1AB6A 2CGEA 1LX6A 2FE4A 3LJKA 4K8RB 1ZGZA 4O3FA 5AJZA 1K63A 1JW9B 3RVBA 1NJ8A 4MUKA 1BU8A 5C53B 3ZCVA 4Q1DA 2Q5OA 2NQ8A 4HEJA 3P2MA 3I72A 5IF3A 4EWLA 1JG1A 4JLKA 4V0SA 4JL6A 5HCIA 2BH2A 2AD5A 1Z74A 2BP7A 2ECQA 3DZFA 5E2IA 4UNSA 1SXHA 3U3RA 1KK1A 1FFEA 1PT7A 3UXYA 3EDCA 4KBGA 1SGWA 2A5JA 1FUUA 1OPXA 2B98A 2IIPA 2TYSB 3GG9A 2XWPA 5DHPA 4DMMA 4PYQA 3T5PA 5D3MB 2XUKA 5FWAA 4YIKA 3RFCA 1AMUA 3V4VB 1VKHA 2A2ZA 2O0JA 3KQKA 4I4NA 4P80A 2EL7A 1U8ZA 4IDFA 1DARA 2Y99A 1MBZA 5H0IA 4QRIA 2XJ4A 1SUSA 5E95A 4CNBA 1NMYA 4YCBA 2F4NA 1GPLA 3ANMA 3G0BA 4IH1A 4R1LA 4QJ5A 4RZIA 4TN1A 2DUMA 4UUBA 5AKXA 3ZLUA 1WKCA 2VPTA 1YRLA 2GBPA 1T3HA 3E9YA 3OY2A 5D5HA 1Z2NX 2BDUA 3STTA 4EKYA 4LBYA 2ZSKA 3AERA 3AEXA 5B12A 1DIGA 1N1GA 1UJMA 1ZXBA 2O5RA 2UUCB 3ZWVA 4D79A 3WMXA 2B35A 3OEYA 1SQFA 2BGNA 1EX6A 3M4XA 2EU8A 4NHEA 4UJ3A 1WXEA 4DWJA 4D02A 2WF7A 3OSUA 3F46A 4E6PA 3AESA 3NUZA 4JA0A 5IJ9A 3E18A 4YUXA 3HJFA 3BMXA 3OZBA 2IHVA 1OFVA 2OV2A 2WWFA 2ZROA 2BMDA 3ANSA 3L84A 2I3DA 2P68A 3Q41A 4MR7A 4N5DA 4TKMA 2Q5IA 3H18A 2RB4A 2IY9A 4P98A 4Y9UA 4TROA 5H82A 3ZK8A 4DUPA 3WA7A 4BP9A 3I2JA 2PZ8A 2HI0A 2OG2A 3BFXA 2YJ5A 5F2OA 4I2VA 1EUDA 3IHLA 1G5IA 2QPLA 4LY6A 3BH6A 1JFFA 1FFAA 2I5PO 2ZETA 3DZBA 3Q3JB 4IS3A 5AI8A 2ACEA 5HFJA 4D9KA 3BJIC 1ZOSA 1C80A 2ATEA 2CXHA 2ZJ2A 4MKGA 3ABOB 4L4XA 5AUOB 1C4OA 2R8RA 4QJ3A 3IDZA 2QTMA 4RVHA 3BSFA 4YLGA 4EAAA 4LZZA 4RX1A 3D8SA 5I8PA 1OGIA 4ZOCA 3UYLA 1ZH2A 1P7CA 2IWHA 4D9IA 1ZUNA 1EB9A 5FTMA 1Q0SA 4GZ6A 4O2RA 1Y98A 3RM3A 1H2RS 4B3MB 5G1NA 2PH3A 4W5TA 1WUKS 3MTBA 3W5DA 2P9ZA 3ESAA 3K6RA 2HCTA 3NBQA 3P9ZA 4EM6A 3CLKA 4UQOA 1C30B 3KZCA 1QVWA 4BC1A 4FYYA 2F1IA 4GVXA 1VIVA 2H5JA 2JI8A 2UYGA 4HDRB 4KOAA 4JEUA 4XGIA 4JI2B 2H2IA 2J08A 2M32A 1ZIDA 2I6UA 4WA8A 2PNFA 4JGGA 3AU9A 2ES4A 3KZ1E 2HMVA 3CPHA 4FCWA 4HEA6 5ALLA 3VH4A 2MSLA 4CLHA 1QPZA 4OB6A 4X71A 3N8HA 5AOVA 3ZCXA 4E4TA 5DYIA 5B1IA 4G5OA 4N7BA 2PX3A 1C9JA 5T67A 2WPDD 5JY6A 1RSZA 4JP3A 1U0BB 4OATA 4PLCA 4G5HA 2JJ1D 3MCTA 3KT8A 1XF1A 2PAFA 3VNAA 4L3VA 3DLAA 2PHZA 4HPXB 2EEPA 3TFQA 1WVGA 1AHIA 5CDUA 1PL8A 4LTNA 1QH8B