3IODA

Crystal structure of mycobacterium tuberculosis pantothenate synthetase at 1.75 ang resolution in complex with 5'-deoxy-5'-((3-nitrobenzyl)disulfanyl)-adenosine
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
285
structure length
276
Chain Sequence
PAFHPGELNVYSAPGDVADVSRALRLTGRRVMLVPTMGALHEGHLALVRAAKRVPGSVVVVSIFVNPMQFLDAYPRTPDDDLAQLRAEGVEIAFTPTTAAMYPDGLRTTVQPGPLAAELEGGPRPTHFAGVLTVVLKLLQIVRPDRVFFGEKDYQQLVLIRQLVADFNLDVAVVGVPTVREADGLAMSSRNRYLDPAQRAAAVALSAALTAAAHAATAGAQAALDAARAVLDAAPGVAVDYLELRDIGLGNGSGRLLVAARLGTTRLLDNIAIEIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pantothenate synthetase
publication title A Fragment-Based Approach to Probing Adenosine Recognition Sites by Using Dynamic Combinatorial Chemistry
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Ligase
total genus 92
structure length 276
sequence length 285
chains with identical sequence B
ec nomenclature ec 6.3.2.1: Pantoate--beta-alanine ligase (AMP-forming).
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02569 Pantoate_ligase Pantoate-beta-alanine ligase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1300.10 Alpha Beta 2-Layer Sandwich Pantoate--beta-alanine Ligase; Chain: A,domain 2 Pantoate--beta-alanine Ligase; Chain: A,domain 2 3iodA02
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 3iodA01
5AHWA 1XNGA 2AKEA 2GKSA 1U3DA 3IODA 3KT6A 4F4HA 4I6GA 1B6TA 3FY4A 4MVCA 1MAUA 4MW0A 1WZ2A 4K03A 5K0TA 2G36A 3VGJA 2DEUA 5J59A 4EG1A 4ND7A 4ZCRA 3E27A 1MBZA 3FG9A 2JA2A 1NZJA 1ZH0A 4U8HA 5HG0A 2PXHA 1PG0A 4EG4A 1GPMA 4ZT2A 3PXUA 4K0RA 4QREA 1QU2A 1O5TA 1I6MA 3CLSD 4L2IB 1Q15A 1WOYA 1EFPA 1G8HA 1WQ3A 4I6EA 1NURA 2QJFA 2EJCA 2V0CA 2IELA 1PFVA 3HL4A 1IQRA 1TYAE 1U7DA 3CLUD 4U63A 4X0EA 3IMCA 1N2GA 1PG2A 1G59A 1M1ZA 3CLTC 2X0KA 5TEVA 3U1VA 1MRZA 4XFDA 3P0IA 1NUUA 3N9IA 3X1MA 1EFVB 1QRSA 1I6KA 3ZJVA 2O8VA 1KH1A 1LW7A 3RK1A 5LFAA 3H97A 2AG6A 3NBAA 2RE8A 3DLAA 1N75A 1HYBA 1ZH6A 3FETA 1M8FA 1NP7A 5DB4A 3A2KA 1J1UA 3HMQA 1G8FA 1TEZA 2D54A 3IVGA 1TYBE 2YWBA 1IH8A 1IHOA 1XNJA 3MUEA 3D6UA 1X8XA 1S4MA 5DK4A 1YIDA 2ZUEA 2IJGX 1GLNA 4KPUB 4ZT4A 1FFYA 4DDKA 1MJHA 3LCJA 1F7UA 1ILEA 1MAWA 3CVYA 4NAHA 3C8ZA 1N2BA 3I05A 4MVXA 4MUNA 4G5YA 2VTBB 1LI5A 1T6XA 3GUZA 4H3SA 3FI0A 5J5AA 4F3RA 3FWKA 1KR2A 3IOBA 1NSYA 3IOCA 1OD6A 3FHJA 3FIUA 4DLPA 1Q11A 3PNBA 4PBTA 3Q12A 4S1OA 4JXZA 3OTWA 3ND6A 4MULA 1QNFA 3TNJA 1KQOA 2E21A 4DNXA 1NUPA 1KP2A 3ILVA 2D5BA 4KR6A 2CV1A 1T6ZA 1YUNA 2QJTA 4MUHA 1O94D 2HGZA 2PIDA 1Q19A 2QUJA 1YIAA 5FO1A 3AL0C 4MUJA 4MLPA 2OQ2A 2A1TR 1N1DA 3N05A 3X1JA 1H3EA 5HUJA 2NSYA 4ZCPA 3DV2A 1R6TA 1K4MA 1VBNA 3Q10A 3A4IA 4WSOA 3SYTA 3QTBA 4OUDA 3TZLA 3IMEA 2H2AA 4MWBA 3ZJTA 4KR9A 1VL2A 1O97C 4EFKA 3COZA 1KAQA 5KWVA 1NUSA 3ZXIA 4I6JA 3VU8A 4ARIA 3JXEA 4XFJA 1F4LA 1YUMA 2NZ2A 1WXGA 4HK4A 1LI7A 1F9AA 1WKBA 3ND5A 1N2EA 3RK0A 3COYA 3IUEA 2PFSA 1NUTA 1NUQA 2XRYA 3IH5A 4HJXA 4HJRA 3UOWA 1WXEA 3UY4A 4ZT7A 4ZT5A 1N2JA 2V0GA 3ISJA 3ZIUA 2PZBA 1GTSA 3RHSA 1O95D 1MB2A 4KR7A 1M8KA 1EFVA 4RPIA 2YWCA 5H16A 3CVUA 1UFVA 1JEEA 1MC1A 1QRTA 4NATA 2QTRA 1N2OA 4A91A 3CVVA 1MOPA 1G8GA 3CVWA 3HGMA 2C5SA 3MXTA 4AQ7A 2WQ7A 2XRZA 3CLTD 5EKDA 2DPLA 1V8FA 4TS1A 3QE4A 2PZAA 1KP3A 3H9CA 4PBRA 2I1LA 4WNYA 4YP6A 4MUEA 1R6XA 3SZ3A 4HPWA 1I6LA 1GAXA 3TZEA 3FDXA 4KKVA 4R2LA 1XNHA 1ULHA 1IVSA 2PG3A 4CDMA 1T9GS 1KKUA 4YMIA 3INNA 4BWVA 1F7VA 3IVCA 3KT3A 3TS1A 3KT8A 2O5RA 1J1ZA 1M8PA 2R5WA 3P0JA 4PBSA 1EE1A 3CA8A 1NI5A 5BNZA 5TEWA 4MQ6A 1WQ4A 4CT0A 1WXIA 4MVYA 4MW7A 4GRIA 3AKZA 4NX2A 1N2IA 1KAMA 1O96B 3L93A 4J76A 4MW5A 3TQOA 3UC5A 3CVXA 4PY2A 4EG7A 1D2RA 1H3FA 4NDAA 1M83A 3COVA 2QTMA 4MVWA 5F23A 1JIIA 4JYZA 1J09A 1O0CA 2CV0A 4P2BA 2CFOA 4MWCA 2CSXA 2A1TS 2J5BA 3G5AA 1IRXA 4R0NA 3MLBA 3N2YA 2Z08A 4EG6A 4ARCA 3IDFA 1RQGA 5TS2A 1ZUNA 3TQIA 1WXFA 1QU3A 2A86A 4MAFA 2DLCX 4MW9A 4DJAA 2J4DA 1DNPA 1OBCA 3H99A 4RUKA 1EXDA 2A84A 5LM3A 1H3NA 4MW4A 1JMVA 1O97D 1VBKA 2OV4A 4GU5A 1J21A 1BS2A 1IFXA 2ZUFA 1JIJA 1N3LA 4UZFA 2BYTA 4JZYA 1EUQA 2A7XA 1O94C 3CLRC 3OP1A 5LLTA 3ND7A 1QRUA 1TYDE 1KQPA 1OWOA 3N8HA 3M5WA 3NV7A 1OWNA 2CUZA 3ZUGA 1U0BB 4YP5A 2D13A 1X6VA 4L2IA 4R2MA 1YULA 2CT8A 5HUHA 1GTRA 3SP1A 2J09A 3FNRA 3IVXA 1N78A 2RD2A 2B7LA 5K0SA 1Y42X 5KHAA 1PFUA 1N2HA 4CDNA 4YP7A 3MMXA 3IOEA 2H29A 2BTEA 1M8JA 1IQ0A 4EG3A 4MW1A 3RJZA 5H7XA 1N77A 2A1UB 5IHXA 1MB9A 2QJOA 1J20A 1GN8A 1U3CA 1XJQA 1OWLA 1P7PA 1OWPA 4UZEA 1KQNA 4OUDB 2ZP1A 4OJMX 1JGTA 1T6YA 2J07A 2Z09A 3S3TA 1IQUA 1COZA 3FH0A 4AS1A 2X3FA 1YI8A 4JXXA 3BL5A 4CQNA 3IUBA 4JFAA 1O95C 2HZ7A 1JECA 3HZRA 2WSIA 2X1MA 3PNYA 4KPUA 1Q77A 3DO8A 3CLSC 3F3MA 3SZGA 1WY5A 4MWDA 1O6BA 4DE5A 3A04A 2VTBA 1PFYA 1O0BA 5DASA 4ZCSA 1PFWA 3X1KA 4Q93A 1O96A 3CLUC 3RBAA 4DDMA 3SDBA 2HMAA 1JIKA 3NBKA 2DUMA 2AZXA 1VLHA 1A8HA 1U7XA 5IJXA 1QQTA 3KFLA 3PRHA 1K4KA 2Z3VA 1EFPB 3ELBA 1ZJWA 2GOYA 3IMGA 4DDHA 1JILA 3SEZA 2E0IA 4MUKA 4MUIA 3H9BA 4EGAA 3AG6A 1M8GA 1KH2A 4MUGA 3Q4GA 3LE8A 1JEDA 1TQ8A 3UK2A 1CT9A 3L92A 1I2DA 4EG8A 2CV2A 2VXOA 4MWEA 1T9GR 1TFUA 2CYCA 4NZPA 3P0HA 4G5FA 3COWA 3QTTA 5KCMA 2WB2A 3G59A 1JZSA 2GM3A 4MW6A 5JBNA 1NYLA 1OBHA 4ND6A 1EUYA 2YXNA 2X1LA 1SURA 2QUIA 4MUFA 2E18A 4MW2A 3A05A 3AG5A 2CYAA 2QUKA 4ZT6A 2DR2A 4ZT3A 1K92A 4U7JA 1KH3A 4J75A 2A88A 3AFHA 5FO0A 3CR8A 1J70A 3HFJA 4G6ZA 4NAUA 1GZUA 3DPIA 2A4MA 5TGTA 3VRHA 2IP1A 4E1AA 3AIIA 3SEQA 5DEOA 2YY5A 4ZCTA 1QJCA 3UMVA 1K97A 4QBTA 3LOQA 3GMIA 3CLRD 3MLAA 3K32A 4ZCQA 3ZJUA 2JANA 4EF6A 2DXIA 3ZGZA 3K9WA 4EG5A 2QTNA 1EJ2A 3P52A 1TYCA 1OWMA 1JZQA 4XSVA 3HV0A 3GLVA 1H1TA 5FNZA 2A1UA 2J08A 1R6UA 1WJGA 2E89A 4Q16A 3RFFA 5J58A 1QTQA 1JHDA 2QUHA 2WQ6A 2DERA 1V47A 1WXHA 1FYDA 2DETA 3FOCA 3H05A 1VBMA 4YBRA 3ZXSA 3PNVA 2JAXA 4QRDA 1KORA 2EL7A 2PZ8A 2TS1A 3G6KA 3KT0A 2CYBA 3D6VA 4FZJA
chains in the Genus database with same CATH superfamily
3K70D 3EVDA 3ILXA 4QUGA 1ZIDA 3PD0A 4Y7DA 4OLAA 1ZNQO 2Q5CA 3BKXA 3CKYA 3QVMA 1DG9A 2JLZA 1CS0B 2ZUCA 4AJLA 1GPJA 1W1UA 2KPOA 2TSYB 4K03A 2C7BA 5HNKA 1MX3A 1TMKA 2WSMA 4H35A 3C3EA 3DVLA 4KIJA 2QV0A 1XMVA 1CY6A 3DG9A 1S89A 3JATB 1Z2CA 4PC2A 1MBZA 3OPYI 5EVCA 1ANKA 2IXTA 3GROA 5CCDA 2QVLA 1PG0A 1TM7E 3IQDB 4QOSA 1RKXA 1U0OC 1ULSA 1I5OA 2IA5A 3A6PC 2QM8A 1L8OA 4PEVA 1X8LA 3PEUA 2FP4B 2NU8B 2XKJE 4MO2A 4LK2A 4Z1OA 5HZMA 3GF4A 1PP4A 1HDZA 3FCAA 3ZBQA 4GX5A 3UJCA 4LNHA 3QPDA 4S1VA 5IVPA 2IS6A 1AQYA 2OHXA 2IHZA 3LC0A 1UFRA 3AUKA 3JD4A 1FU4A 1T9HA 4KXNA 5CT5A 1XVLA 3ROMA 3ABOB 1SR8A 1NLUA 1YZGA 4DBLE 2QENA 3NHAA 3P2JA 3UJ9A 1ZGBA 4NZYA 3RCBA 3WK9A 4RD1A 5AHRA 1SCUB 4KWCA 3BWMA 3L4EA 2OLEA 3TQHA 2A2ZA 4I2NA 5EEGA 2GASA 4HDQB 1QPZA 1MRZA 2DH6A 1HZJA 5LZ4A 4WKOA 4Y2GA 3A9SA 2YZKA 5KYXB 2QQ5A 3RYHB 1EUZA 1PJLA 1GZHB 1M2JA 3ROPA 1JWBB 2IW1A 2JCYA 3QTLA 2AG6A 3BWBA 4CMHA 2PSDA 3KDAA 1KI1A 1HYBA 3W2IA 1G19A 3Q7SA 4RELA 2B35A 4N6NA 2VBIA 4AJ9A 2MSNA 4H7EA 2G9RA 3HBFA 4R68A 3IVGA 3A26A 4RIEA 2PSJA 3IDOA 3UJAA 4Z0TA 2A9KA 5DULA 4Z7JA 3PE6A 3PB3A 3BMNB 1V1MB 2ZYDA 3AY6A 2P2ZA 2BN4A 1U2QA 3MUEA 1N34B 2UUAB 4JJFA 4PYKA 1TJ4A 4R7TA 3NUZA 4IPTA 2G76A 2WUVA 4PFSA 1P0PA 4HUTA 3IUMA 3AEQB 1EXMA 1HL3A 1V96A 2M6SA 1DCFA 3MZ0A 4K9QA 4ZN6A 4CN8A 2QZPA 5D6NA 2DGDA 3RVMA 2GN2A 3I05A 5D5QA 3KU4A 5EMHA 2HIAA 4L22A 1G4UR 5FF9A 1BROA 3FFTA 2VTBB 5EZYB 1Q17A 3A2LA 4A0GA 4XYLA 4GS5A 2HJ9A 1QFSA 1E1LA 2WZCA 3KHSA 4ISBA 4UMEA 5AW5A 4AKSA 5K6RA 1FS6A 4C2UA 1G5RA 4Q34A 5AP9A 2PIAA 3VOBA 1QPGA 4XDGA 2DTXA 3LP5A 1OD6A 2HL6A 4AXBA 1VSBA 2V8BA 1FIUA 2WOJA 1I1QB 2P6UA 1Z25A 3JQ8B 4JA0A 1ZOIA 2R48A 3WX0A 5BYAA 1YL7A 4P58A 4L85A 4ZPJA 1P62B 4PZAA 4J1SA 3ILVA 3C1OA 1TO6A 1SA0B 5B3AA 4B9AA 4PN7A 1JFVA 1WMBA 2QJTA 3F74A 1EK0A 1VRVA 1GTVA 3UOGA 3C14C 1ENYA 2QZZA 1IJEA 1BGXT 5IBQA 5LVAA 2PL5A 2WAAA 2B5WA 1RSZA 1E9CA 4L72A 1WUHS 1D2NA 1O2DA 2NU9A 3PC8C 1WXWA 4HTFA 4ZRMA 4EUSA 3B52X 3KL2A 4MKIA 4V1CB 1SQ6A 3IELA 3VISA 1E1RD 4JLWA 6NULA 5EGSA 5I8PA 1XHEA 4C30A 2P9EA 3ZW7A 5I3ZA 1VG9B 5F76A 3I6YA 2XTAA 3OOJA 3W5JA 3IHTA 4Y2SA 2D7DA 1SB8A 2W6PA 3ZCVA 2YWDA 4TMKA 5FNVB 5IPFA 3BH6A 1Z29A 3JQGA 3ANYB 4C4AA 3LT5A 2EP5A 4BMXA 3TZLA 4EHAA 1LD3A 2PS9A 3EASA 3F67A 3QE2A 2FI1A 3U3OA 4YUWA 3N59A 4UDYX 4RJKA 1OX5A 1YBVA 1G8KA 1JSZA 1YFLA 4AYXA 2P90A 3I58A 4LOLA 2N0SA 2DH5A 4TKVB 3BOSA 2VH1A 4WGGA 3DGFC 3MN1A 3D1LA 3NOVA 3MINB 4IVPA 4DR2B 1ZI8A 1F8GA 3U09A 1DRVA 2YS6A 1JU4A 2WHXA 3ET4A 3VYWA 1XD2A 4NQRA 4BMOB 5FAKA 5KVVA 1JR3A 3OD1A 4AWAA 1OHHA 1C9MA 1TC1A 2HIHA 1I01A 5CDFE 5FL7A 1UMBA 3RADC 1TTTA 1EGHA 2RKBA 3AWDA 3D5EA 1CDOA 2RG1A 3KJZA 3L1IA 5J2UB 5KTPA 3KNZA 2IRWA 2PH1A 3AF0A 2VTEA 3IPXA 4HJRA 3UOWA 5KTTA 1I36A 3KOMA 5EIBD 3AVVA 4Q00A 5C31A 4IUYA 1IEWA 4OSPA 1RADA 2DVMA 3WLQA 2D4HA 4XARA 2WAMA 5BNIA 2REBA 2AJDA 4LTMA 4AURA 5JBIA 2Q5OA 4PX5A 4UUMA 1ZK2A 1S7CA 4DUGA 2Q0SA 4R9SA 2QRUA 5M34A 4O4HB 1XYVA 5FEMA 2WG1A 2EEPA 3VHQA 1GL7A 3TSAA 4U7HA 2XVAA 4WQMA 2Q2VA 4X71A 5EHIA 1SXJC 4KRYA 1UP6A 1O57A 4LHXA 2JFXA 4GDMA 3RJMA 3OFVA 3TMKA 1QCCA 3TOVA 5DTEA 5JO0A 1YMVA 2EKBA 1AXRA 3L43A 4P32A 5IEBA 1TM2A 2PUWA 2Z6UA 1J1IA 2GD1O 3W9SA 9LDTA 4CM1A 2NYVA 2KS6A 4AMYA 3ZDCA 4UXJA 1UK7A 1U3GA 2X58A 5GJCA 3T3EA 3RAEC 2X2PA 2Q41A 1BX0A 3DV9A 1YZKA 4RHTA 1T3GA 4LV8B 1H0RA 3GLFB 1QO7A 3HTXA 1Q50A 5KNBD 1C4OA 1UFKA 5LQKA 1NNUA 1I7LA 4YJ3F 1P33A 2ARKA 1MIHA 2QSJA 3PIDA 2B69A 4AG5A 4BNMA 4YHBA 3OU7A 4ASUD 1U5AA 4EY3A 5LU9A 5FOWA 4TZTA 5E2AA 5B2ZA 4EY4A 2ZWAA 4TUYF 1I2MA 1MNQA 4NICA 2ZRNA 1F7VA 3G7UA 2AXNA 4EHKA 5BW0B 4G56A 2VF2A 1RKVA 2Y0DA 1BGVA 5CB4A 2LRHA 3ZLTA 1QOZA 1SFRA 3B1KA 3PGXA 3WK7A 3KTAB 3PA8A 3VMFA 5IKMA 3I5YA 4Y2PA 3PJGA 1UJ4A 2WUEA 4B4KA 2I3AA 4EUNA 2DT5A 3KSZO 4PQEA 1FZQA 1RWKA 2Q4DA 3QLUA 5FWAA 3QKSB 5CH5A 5CLLA 4GQAA 3EY4A 3KWMA 4PG7A 5ADWA 5C53B 3FUUA 4IBOA 2XRFA 1V95A 4FM9A 2IE8A 5HE8A 3OTGA 4F84A 2FWPA 3NC4A 1YQQA 3UFBA 1U8ZA 4UVHA 1ZD9A 2SKDA 3A2MA 4M22A 4AX4A 1ULTA 2GSWA 5AM2A 4CETA 3TPCA 3ADBA 4G3XA 1G41A 4KQFA 4BO2A 2CDBA 2ZYWX 1G55A 2RG7A 4RMGA 1HURA 2HBQA 3KDSE 3COVA 3WQQA 4CZ2A 4MVWA 1OIVA 3PNMA 1XWFA 2OY0A 2W98A 4PXYA 1HX7A 3MMPA 4E3WA 2ANCA 4NBNA 1DLJA 1VKRA 2XQIA 3B38A 3Q1KA 4E94A 2CSXA 4CKCB 5DXFA 2NNWB 5HIAA 5B37A 3BS4A 3ORYA 3MTEA 3RK4A 5IS2A 1NKTA 1Z0FA 3KB1A 3QLJA 4TVSA 5TS2A 1QH8B 2QAGC 4AJOA 4F1KA 2PT5A 3QV1A 4WLUA 3WYGA 1EVQA 1LI4A 2X7JA 4KXWA 3PUHA 4OD0A 5EC8A 3UO8B 4ADSG 2D5LA 1G5FA 4M1OA 3U3XA 5LNK1 2BRUC 4UD2A 2C4UA 4MXDA 1BCRA 2G9ZA 1Y0BA 5GOTA 4ED9A 1MC8A 5JH7B 1ZOOA 4MCAA 3PRJA 2OOKA 1WZIA 1GPBA 4KQKA 1MO6A 1RBYA 3CSDA 1A71A 1S1CA 2J0UB 3HO6A 2NYAA 4RMJA 4W7HA 5ANRB 1HNWB 3BMQA 4UBOA 4D8TA 1NGSA 4RLHA 3ZV5A 2NGRA 3EPKA 5DWDA 1KQPA 1C3XA 3LLUA 4V38A 4C1NA 2C7OA 3N8HA 3NV7A 4K87A 4W5WA 1M1YA 4YJ2B 4BQRA 4NEQA 3HEBA 3WKCA 1Y3AA 2HHCA 4WESB 1COWD 1OZFA 4IIJF 1KS2A 2WWXA 1QAOA 5D84A 3RRMA 4M0MA 3L7IA 3IVXA 3VZCA 1XAJA 3WWCA 4P80A 5CRIA 3B20A 3NDRA 3R1IA 2NO1A 2XYPA 1O8CA 1UODA 4CDRA 2ORVA 5EHZA 4PR0A 3TD9A 2D0OB 1KA9H 3NPMA 4FC7A 3BGIA 2Z58A 5IVDA 2VK1A 2V54A 4PQFA 3S1SA 1RAHA 4ITUA 5ADUS 1RXWA 2WDPA 4ENTA 1V4VA 2NPOA 4OO3A 4HAYA 4ZV9A 3SJUA 5C8DA 1DPFA 2G8LA 3C8UA 3M6IA 1ZEJA 2HWWA 3K70C 2FEWB 1G1MA 4S2UA 2XODA 5ECYA 1OWLA 4UZEA 1J2RA 4BZQA 1W6RA 3LYLA 3W8NA 1EGAA 3G82C 3N5CA 4E51A 1U1CA 2IZ5A 4OJMX 2WWTA 1L4KA 1UBEA 2EIXA 3BTVA 1W4ZA 3KYIB 2JZCA 4BYGA 3HR4A 3ZW9A 4DADA 2WHPA 3F9RA 3HFSA 1N8NA 5KCZA 3KTDA 3EGXB 3MTJA 4FLMA 3K4HA 4CQNA 4NP6A 4PSAA 4BKRA 3AYZB 4KAJA 2NZJA 4CMEA 2VZEA 4TQGA 3WGUA 2FWBA 7REQB 5M04A 5JS1A 3I6QA 1TEXA 3KQTA 4GOLD 4FD2A 4I14A 3GDWA 5AVJA 1BU8A 1QHXA 1MKYA 1UT5A 3A0RB 4GM4A 4LC0A 4EVQA 5LN1A 3OIWA 1Y8RA 3RANA 1EB9A 5CIYA 1UKYA 3SC3A 1SUWA 1ZGZA 2X5JO 4M1KA 4RMNA 4S2EA 4UE6A 4BO3A 4NZZA 1HXHA 5LXTB 5K4AA 3WQSB 2GCOA 2P5YA 1KDTA 3FUTA 4FILA 4GMDA 3V32A 2MINB 4G2NA 7MDHA 4IIGA 5L8VA 1F20A 4FE3A 1KZ1A 1FFBA 3L4BA 4B47A 3PPYA 1E66A 1ZCAA 3VBCA 4E21A 4CF5A 1YCGA 2XCLA 4U2BA 2JGJA 1VLHA 5K8CA 2NAFA 1XTTA 4O2AB 5KOHB 1LC3A 1G20B 2NSJA 4OKIA 1EKXA 2QNBA 4RZUA 3UPTA 3RKRA 2VDRB 4CLOB 2PYZA 4P4NA 3PQ5A 5U1PA 1UKBA 4MUKA 4DANA 2XWQA 3SVTA 2NPFA 3SBOA 1MG5A 1IEVA 2YW9A 2NADA 5E7MA 1QV7A 1KF0A 2P1DA 1Z37A 3AM3A 3EA5A 3NHWA 3ONWA 4WUVA 4X3OA 5E7JA 4WWHA 5EQTA 2WPDD 1K98A 4EMBA 2X14A 2FVXA 1NU8A 1E2MA 2GJ8A 1NXQA 2Q2WA 2A9QA 3F96A 4KH1A 4O33A 4FT4A 2DBYA 4YALA 5ULLA 1LSJA 3VOSA 4U1RA 3VR4H 1DTSA 3E5NA 4PPNA 3DWIA 3BMOA 2WM2A 3KUDA 3EXFB 5ALMA 5G4KA 2W42A 4B46A 1SXPA 5ECWA 5KCMA 5CFQA 4FDAA 3ILHA 5IH3A 4B2IA 2GM3A 4H6WA 4I5EA 4MW6A 1LSSA 5JBNA 3KKKA 4MKFA 4QT4A 2WKRA 2HNAA 1TVEA 2B34A 2NO4A 2P5UA 3FPEA 1SY7A 2RH4A 5CA1B 1JV2B 4GYKA 2RGCA 5TARA 1BX1A 1CY1A 1EEHA 1TC2A 2OGUA 3HNRA 5HKLA 2FSSA 3KOYA 3OSUA 1AGPA 3GGSA 1T36B 4Y9UA 3WSVA 4YPOA 4M98A 3B7PA 5EP2A 1EM6A 3FUVA 3GJSA 3FSGD 3TNDA 4U39A 2BFEA 1J70A 2MDTA 1F2TB 4J3JA 4JITA 1FRQA 1WULS 4G6ZA 4KEAA 5C3UA 5EKTA 1IUNA 3IAXA 3EVZA 3NAZA 3Q2OA 4TMFA 3FIJA 3PDIA 3G2HA 4DA0A 2A1IA 2IP1A 2OV3A 3UJ3X 2XUAA 4B09A 2XOEA 4Y18A 1ZAYA 4DQLA 4CGYA 1E1CB 1ODSA 1W46A 2C5LA 2CE2X 2PRIA 1DINA 4LBWA 3IVAA 4O08A 4CM9A 5CITA 4PLHA 5CJ2A 1E6CA 1KE1A 1ZGAA 1FSPA 4Z9AA 2ZK7A 3LGXA 2DC1A 3H8VA 3I8XA 4XJXA 4QTTB 3ANXA 1JQDA 3P52A 5C5DA 4YNBA 4MVJH 1LZLA 3SICE 2UYYA 5IXJA 3MQ4A 2Q4OA 2ZPAA 3IJPA 4WW0A 2N1BA 5CFZA 4BMVA 3STUA 4F38A 1K9VF 2Y3IA 2CHFA 2EJBA 2FP3A 2QTBA 4CV1A 4DWWA 4MV1A 1L8XA 1V47A 5HQ3A 3LTNC 2R7LA 2BFFB 3LQQA 1A3CA 1A9XB 1IDOA 3I1YA 1D2HA 4L9WA 4OQEA 1RWBA 1VJ1A 3IXQA 2G8NA 5AVXA 4YB8A 4AECA 1W4LA 5GPBA 5TJHA 3BJEA 1KORA 2ZIXA 3T8YA 4DL9A 1LV7A 1U7TA 3W77A 4G8BA 3ZDEA 4PZCA 1IPEA 2WV7A 4F86A 1TQDA 2GUWA 3D8BA 4LY9A 3GL9A 4PINA 3OFND 4MDYA 2EW8A 2EDAA 2V1UA 4DSNA 5JO9A 2ZM6B 4B83A 3BRQA 3DE0X 3V5NA 4HWPA 4EPXA 2KQUA 2VC2B 4YGXB 4CBVA 2Y1FA 5KVSA 4I4TF 1H2WA 3TEJA 4HNUA 3D3WB 1VIYA 5C8YA 5FUWA 5TIIA 1LLCA 3KB8A 4JELA 4BPRA 1WPQA 1EJ6A 4RBNA 4OLHA 4U8HA 5CT8A 3BTOA 4JC5A 2HO5A 3WL4A 5EIBC 3KPVA 1E1KA 1K5HA 1L4UA 2PUAA 4NFYA 1JR4A 2O6HA 4F3TA 4MKHA 5B3JA 1AKVA 3K09A 2HCRA 4C6TA 3OPQA 1ZN8A 4EPYA 1BXKA 3N2LA 3OOEA 3PC3A 5JCJD 2P0AA 2F2TA 1ONNA 4WDQA 4QBKA 1P77A 3WMFA 5H5JA 4BC1A 1XOIA 2FG6C 1NW9B 4M49A 1GGHA 2CEKA 3L41A 4I1UA 2ZT7A 4DBZA 4HH0A 2R25B 3QEBZ 1JDJA 1UDBA 4D43A 1ZGJA 2QL6A 4K9KA 4UULA 3DDZX 2G0TA 2OM2A 3WL7A 3O2JA 2C4VA 2ZAGA 5LZ8A 5ILGA 1R9MA 2G72A 5K7SA 1XU4A 4G5HA 4LW8A 4BRSA 5IXSA 1MW8X 2AFVA 3TQCA 2P6OA 3VH2A 4MQ4A 3EEFA 2V6IA 3QFFA 4WK2B 5JZSA 1GDDA 3NCHA 2J3MA 1ZCBA 3HMQA 1KS9A 4L4SA 5EZSA 3OQNA 4CM4A 4QO8A 1DIHA 5DGXA 4P3XA 5AOCA 2YWBA 2NO0A 1QGUB 3D7RA 2BCGY 5JC8A 1XNJA 3SHFA 5LWQA 2CUKA 3DLIA 4YUVA 3UICA 2WU3A 1S4MA 1RYHA 4C3UA 5JALA 1ZZEA 2IJGX 2OGWA 3BCUA 4UARA 1RC0A 1JDBC 3N8KA 4A3SA 2PL9A 3CIFA 5EMKA 3BFPA 1LDBA 1YDMA 4L8WB 2FAXA 2I5PO 2WUDA 2X0RA 4JYCA 5CW2A 3QUBA 1ILEA 4GRAA 4KDEA 1NF9A 1NW7A 3K20A 1U28A 2ZIFA 3GLSA 4E2WA 4KR2A 3CW8X 1X13A 3C5EA 3DZFA 4Q1DA 2PR2A 2QRMA 3DOFA 4H08A 2HWUA 3AP3A 5EY5B 4YMGA 2WWHA 2DMRA 4Q9IA 2I8LA 3MS7A 4MV6A 1US8B 5GVSA 1B0AA 3GAZA 3QY0A 4YECA 3FE2A 3H8SA 4JBXA 5BW6B 1M76A 3OTWA 2XB4A 3AONB 2FKAA 4Q3DA 4GBGA 4Z0PA 1X1AA 3TDKA 1NUPA 1KDOA 1VKOA 2D5BA 2GTPA 2FOXA 3OFSA 4ZVSA 1R4AA 2Y05A 4JLOA 5BV0A 2WMDA 3RARA 1E4EB 1M54A 4MUHA 5EKSA 4HX5A 4D5EA 3H8JA 2BD0A 1NZFA 3VKVA 1MRNA 2H2WA 2PIDA 1NC3A 2LKDA 4GG1A 4CKBB 2N1MA 4PLGA 4AU1A 1YIAA 3HDTA 4KUGA 3C6BA 3KJIA 5FLEX 2QBYA 1FJHA 1G4AE 3R3JA 2ASVA 5BQOA 3SNHA 4BBZA 2X4GA 2VEDA 3FMVA 4C43A 3ITEA 3L1KA 3X1JA 4IDAA 2FX5A 2VKQA 2CHGA 3HP4A 3WR5A 3IKJA 1U3WA 4P4SA 1D2EA 2B78A 2RHHA 1S8OA 3ED1A 4QXMA 3WGGA 1V7CA 3AESB 4BY9E 4MPDA 4DUPA 1YF3A 2IBMA 5FHQA 1OC4A 4ZVOA 1IWPB 1GAWA 2QPOA 3FPLA 3OJCA 1VRCA 4KVAA 3H2KA 3NETA 5B7PA 3D7MA 3A1VA 1E69A 4DA7A 4DFDA 4EM6A 3COZA 1KAQA 1UADA 4FWBA 3U3KA 3Q9NA 3MGCA 3OQIA 1F8FA 2W6JD 3JR3A 1P80A 5IN4A 3E18A 4ARIA 1H9BA 2I6XA 4DZRA 1DX9A 1WF6A 1Z6TA 1LI7A 3WQBA 1F9AA 1WU8A 3GLIA 4WOBA 3U1TA 3U13A 1I94B 1O58A 4Q37A 4A8JA 4LSMA 2VS1A 1EFTA 1G5HA 1V48A 4KLRA 3QEAZ 3QU4A 2Q6TA 3IH5A 4BN0A 1QP0A 1UXJA 1VIAA 3K8ZA 4PZ9A 2W6ZA 5KYWA 5TS3A 2RGDA 3JYLA 4PRZA 5CUQA 3FCEA 1GTSA 2J5RA 4GM0A 3KVVA 3RAFC 1MB2A 2VDMB 3HLYA 2Q1UA 1PNTA 2IOYA 2I1WA 2NP6A 4BQQA 4NESA 3NW9A 2R79A 4MRMA 1IN8A 3MJ4A 3DMDA 5EVJA 3QFSA 2IZ0A 2GHRA 3OF5A 4MUYA 2I66A 3NXKA 2JI9A 1MJGA 1W85B 3F98A 2PX4A 4GDFA 2YWFA 5KQPA 1T5HX 4KPYA 3IEVA 2EHDA 4CL0A 3EMVA 3X2SA 1JIQA 4QOHA 1E2PA 2B4AA 5FBQB 3GJRA 4BX0A 2JD1A 1OQAA 1Y89A 1CZRA 1G3QA 3L77A 4D9CA 3QW2A 4KC0A 1X15A 2I3ZA 1FDIA 2VPXA 3QE4A 4ZD6A 3EK2A 4ALLA 1TAHA 3D3JA 4DV4B 1TLTA 4IOJA 1QKJA 3E2IA 1RU3A 3D9QX 3BMCB 1GFIA 1JYFA 1DXYA 1ZXLA 4CGZA 4XDHA 4L5JA 1CEEA 3WWOA 2COEA 2OK8A 5JOQA 4KWIA 3U0BA 1T29A 4FSHA 3I0NA 1NA5A 1REQB 1Z5WA 5B1IA 1EGQA 4TWRA 4PF1A 4YRTA 2ZVPX 1RVDA 3NHBA 3K5PA 4K2AA 3UTDA 1W19A 1F51E 3OZDA 1DEXA 5ITZA 3IRUA 2QRJA 4TLEA 3O4IA 5AW8A 8OHMA 3IVCA 3L4SO 1GZ7A 4MP8A 3T3DA 3NALA 2R6GA 5FPKA 2WYIA 2XYRA 5M5BA 3RYTC 3ZV7A 4OBWA 3HR7A 3OTQA 4R51A 3RI3A 4G0PA 2WHYA 2WQZA 3RLIA 2BTQA 1PEKE 4YRBA 1XZMA 1MJNA 4AJNA 3CUSA 3OIDA 4UM9B 4NZOA 1XVTA 2REQB 3OM9A 3HL6A 2YBDA 4MS4B 3SIPA 4HDMB 3KV1A 5KTRA 2QTCA 5MFPA 3O3MB 3RUCA 3PXXA 2VHZA 3H9EO 3W5AA 4EFDA 3FHLA 1NLFA 3E3MA 2Q9CA 4JP3A 4P7KA 5A3QA 4MP3A 2NZ8A 4C7MA 2OCXA 3DULA 3UGQA 2GAOA 4NRDA 3OZRA 4FCVA 4FMDF 4R2HA 5SZIA 2CNLA 1VJ5A 3M4YA 3G9XA 1RXUA 4AUMA 2GPYA 3QEMB 4QRHA 1B26A 3CR7A 2YV3A 2PWPA 2Q7XA 3ZH2A 2JH8A 1J24A 2NZXA 2HMVA 1W5BA 4HDOB 4CMIA 1XRJA 2O14A 6Q21A 1LBSA 2GAJA 2IUSA 4AJ1A 4M0EA 2G1PA 2XB8A 2R6JA 3L1HA 1RWXA 5ES3A 4HLUC 1PKEA 2WNHA 1HQDA 4UCFA 4RGBA 3KUUA 1QYRA 3OLYA 821PA 5KEIA 1M73E 3LQKA 3AJAA 4II7A 3LGSA 1BHO1 2JASA 1X8JA 2XMSA 4TVOA 4FYYA 3WV5A 2WMNB 2DG2A 4A8HA 1AH2A 1Y8CA 3D54D 1OBCA 2Z2JA 1XLTC 5KQLA 2X9QA 1UOEA 4QEKA 4F5EA 3PNSA 4A27A 1CB0A 1YJ8A 4YXFA 5A3SA 1CQXA 1RYBA 2BF4A 4D8WA 4F4DA 1X80A 4AMBA 2BYTA 1Y3BE 2GK7A 4J7CA 3K5IA 1EZ4A 4ZO9A 4AJ2A 3OP1A 1A27A 2OD9A 3UAVA 4EHNA 5LLTA 5T8KA 1KMHA 3ND7A 2I1VB 5CXQA 5ES4B 1N32B 2ZBRA 5F52A 4B87A 1SWVA 1U3VA 2CUZA 3MJVA 4JGBA 4C3OB 3T15A 1X6VA 3LO8A 2B2CA 3AR8A 3GMDA 3DFMA 2CEAA 2GN1A 4WCFC 4JL6A 5GP1A 3VZBA 3IQWA 2CNDA 3WIDA 3M5DA 4M9RA 1M6NA 3E22A 1XZDA 3PKJA 2IP2A 2OHFA 4NJMA 3M3DA 1KZ6A 2YZ7A 3S44A 4MSUA 1B0UA 1C1DB 3W1WA 1JR3D 2GB4A 5JEEA 1OHHD 4WV3A 4C89A 5FL7D 4M1ZA 4RFSB 1KY4A 4H4DA 4Q66C 2QL7A 5DWVA 4RXTA 1JALA 2YN2A 3FNIA 4MB6A 3T41A 1FJ2A 4MW1A 4FFOA 1M1NB 2QVBA 4IDQA 2ZZNA 3KEGA 5BQPA 2AXPA 3G9TA 1ZRNA 3CLHA 3AF3A 3AI7A 3ZNQA 1WBJB 4JV5B 2B1IA 4HC4A 1N3IA 1GN8A 4C2AA 4BHRA 3FCXA 5BWOA 1AGYA 4YCJA 3UMFA 2YFKA 4MYRA 3HK2A 3O8LA 1KQNA 4E30A 3LUAA 3T1YB 4X7MA 3THYA 4F04A 4DUGD 3R7FA 1EB8A 3G02A 1NQOA 3K1TA 5LBUA 1BVHA 1JBEA 2GNOA 4ICIA 4Y2UA 5C80A 5JNSA 1CK4A 2PBRA 1HQYE 2Z09A 4TS3A 2OUKA 5BV2P 2K87A 2DF8A 4EUEA 2FWIA 1X7XB 1AN9A 1MU0A 2XADA 3JD0A 3LPNA 4RKFA 2V5UA 2VJOA 1JECA 3PR2B 1ZK3A 2ZBUA 4QSHA 3OCJA 1J2EA 1OTHA 3UPDA 4HR7A 5AW2A 4MGIR 3RS3A 4KBGA 4ZCLA 2DPGA 4CT5A 4YRNA 5ESXA 1RRMA 1VSTA 3CO0S 1D4ZA 3N6XA 2NT3A 1X1TA 2Q2NA 3EZ2A 1PV2A 4QECA 3GG9A 5BWLA 1EK2A 2HQOA 1T9DA 3EUWA 3MF4A 2F00A 1KVUA 3OUZA 4UNNA 3UCEA 1P29A 4DDMA 2GBLA 3I01M 5EWMA 5FEUA 1GR1A 2IYYA 5C8ZA 2ZANA 4XZ3A 2ERCA 1JIKA 5SYAA 1ABEA 3NVKI 2B4TO 1HFWA 5IJXA 3OESA 5SZHB 3CZ4A 4JJKA 5JDCA 5I9BA 1PFKA 3ZQJA 4F2PA 5M29A 2F6RA 3DO5A 4MR9B 1VG0B 1BS1A 2CXHA 2XZDA 4UNSA 1DIBA 2QSZA 2RI1A 1A88A 1ULBA 4TT3A 3EVFA 5B53A 2IHUA 1JILA 4BC0A 1LNQA 3WLJA 1YRQA 5C34B 5AVTA 1AMNA 1E9FA 2VNSA 1A4XA 4OXXA 3UHFA 1R00A 3ESCA 3ETGA 1KH2A 2ZI6A 3A1DA 3Q4GA 2JZNA 3VDMA 4JVMA 1EFCA 2NT4A 4OOEA 2R86A 1IXYA 4LZAA 1ZL2A 2F43A 2GBIA 2FZKA 4L51A 4LHVA 1T6NA 3VU1A 2OCYC 1OLUA 3I53A 5LOVF 4BMPB 3BEOA 4A2WA 4MGZR 2ALJA 2B21A 4O1MA 1ZI6A 1RTTA 3MTDA 3KYDB 3EXG1 4D42A 4J0HA 1U3UA 2JD0A 1VL1A 3RVJA 2DBVO 1HA3A 5CVCA 2RKWA 5BSUA 2QGZA 1W88B 3PEEA 4WZAE 1YOVA 4OXRA 5AVVA 1H2YA 2WAXA 4GI1A 1ZRHA 1RABA 5IKEA 2FQXA 3DBRB 1C8LA 3D8TA 1V5GA 4ZICA 3EZXA 2NZUG 3PG5A 4UQPA 3KQVA 2XGSA 1T2AA 3DDUA 3VJKA 4YRSA 4NJEB 4LHEA 1MO4A 1C3EA 2V7PA 3KB6A 4RZSA 1CUUA 4E1AA 4JVNA 4R9RA 2EZ4A 1ULAA 2DKNA 3IXLA 4JNCA 1KJ9A 1K4YA 4Q1EA 4U0KA 4ZOLB 2YVUA 4QGSA 6REQA 3SBXA 5JSQA 3HN6A 3PUYA 5AI0A 1BZYA 4ONEA 4PTYA 3HB9A 4C14A 3WFJA 5D6OA 3BBPA 3EDRA 2JJ8A 3ZI4A 1TUGA 5FFFA 1HY3A 1ZAKA 4KVFA 2ID7A 2G4LA 4ARZB 1NR5A 1WDTA 1M66A 3SF0A 3CE6A 3D7LA 2Q2OA 3EOBI 4NOJA 2O8NA 4PYQA 1PGNA 1QIMA 2A30A 2FVYA 1XNRB 4ZVRA 3WYEA 1Q0QA 2OEPA 2OZLA 4QL3A 4ZI3A 5ADVA 3I62A 1JX6A 1EWQA 1QX4A 3S70A 1XLVA 2ZWVA 4QBFA 1GDTA 3MQFA 1G21A 4MGEA 4OI0A 3P9IA 4IIBA 4M9QA 4JN6B 3W4KA 4C0QC 1L5OA 4P4GA 3QX8A 2HD4A 3EXG2 1GTZA 4O0LA 4LDJA 3U7EB 1XDDA 3G6KA 1BQ3A 1VLVA 3PVZA 4M9CA 1PD1A 5JWRA 4P33A 4HRXA 2HMYB 3K73O 1U2TA 4ZALA 3NH9A 3QYJA 2KW5A 4QNNA 4WCVA 4UUBA 3QNWA 2V8OA 4DPMA 3QVKA 2C2YA 3H87A 1BWRA 3KE9A 3KQPA 5A1TA 4DV6B 1SCBA 1N5DA 1WDWB 1P3DA 2GUGA 3IT1A 2L69A 5DP1A 3O94A 3GZJA 4MW0A 3G89A 3W2EA 3W5CA 1NN5A 2I71A 3ETJA 1LTKA 3SIRA 2BVNA 3ME5A 4Q4AA 1TKRA 1G3IA 3FRJA 3KHUA 5AM0A 5TT0A 4FXPA 5AJHA 3RJ5A 4EG1A 3QXSA 1IHDA 3URMA 4DLLA 4ZCRA 2Q3LA 1RCFA 2VJCA 1PE0A 3IV7A 2MTBA 2XMPA 4IHJF 4RKQA 2RB5A 2XGJA 3WYNA 1PVOA 4CLXA 3UFXA 5BSGA 5KTKA 5CLGA 2BISA 3VJMA 3W5SA 4L5AA 5H9VA 4B48A 4ZV7A 4ZQGA 4DJFC 1NJ6A 3IDZA 1QE0A 2JBWA 1M3SA 2FNAA 2JPDA 3ESRA 1QO9A 3QFRA 3QF4A 4P9NA 1F8UA 4I6EA 2EQAA 2XLBA 3STWA 4V0RA 3PRKE 2Q5EA 3C3AA 4U63A 4X0EA 5E4YA 1ORVA 3IMCA 2JFPA 2YYZA 3O7WA 3OZUA 3KELA 4HSGA 1LUAA 2KWIA 4EF5A 1SUDA 2CNOA 1FP4A 4S1NA 3VSAA 2QMUA 1GN9A 2ZTMA 2C2ZA 2CFTA 1Q16A 3ELUA 2YIDA 4YLGA 4BLPA 2BE7A 3NTLA 1C29B 1G291 2ZZKA 4DT1B 2XWPA 3KR0A 1Y80A 4QD3A 2NU7B 2VSYA 5EIOA 3FETA 3PDWA 1NE2A 3ZY6A 4BYMA 1M7GA 2VSFA 4D45A 5KHOC 4DJ5X 3T1HB 1A9PA 1H5UA 2VZLA 2J45A 2R3SA 3I4CA 4LE1A 2VFAA 1TZ2A 1V9SA 3KK0A 1T4MA 5KUTA 1KIAA 1F0KA 3MPUA 5JD6A 2R00A 1QFMA 1QF9A 1G7CA 4DW8A 2E82A 2BZGA 2RARA 3ORSA 2HUNA 1A50B 3QWIA 4D0NA 1ULUA 4ZU1X 3A6HA 3FGNA 2GZRA 4K9SA 3LCJA 4DR1B 2J4CA 1GKUB 1LPMA 2W2KA 4Y9SA 4DIDA 5D7BA 1PYDA 4UE3S 2WFLA 4A2PA 4O4LA 1KJZA 2BLNA 2FMKA 1OXVA 3ZZ0A 3W8RA 3KQUA 1Z33A 3H65A 3TB4A 2CF6A 4ZO8A 4JBLA 5CVVA 1KFEB 2ZYTX 3RWMB 4F3KA 3U61B 1QOQB 2Q1SA 1UDXA 3F46A 3MD9A 3SY8A 4BHTA 1DS6A 1SG0A 3FHJA 3UW3A 2WVAA 3TIVA 4V0KA 1RHMA 2QI9C 1J2UA 1IY8A 4QEZA 2X5NA 4NONA 1R2QA 4MAAA 5KYKA 3BCHA 2FKNA 1T6ZA 4F56A 4Y98A 4M46A 1IVYA 1HORA 1ZUWA 3ROKA 1KOJA 2IH2A 3ETEA 1JDVA 4WZZA 4JUBA 2C7GA 4PM4A 1T91A 1WMAA 3M4ZA 4V0ME 5C37A 3ILSA 4U6QA 4KMMA 2A9OA 3VDQA 3LUKA 2BBOA 2F7SA 3M4XA 3NBFA 3OPYA 1U0EA 1Y9EA 1HOTA 4C5CA 1CXZA 1TO1E 4CM9D 3EQ9A 2UVQA 1POXA 3IBTA 1YRAA 2QU8A 2VAPA 3IBFA 1N6PA 5T5QA 1L5SA 1E3MA 4O2BA 2ZREA 1CUGA 3HMKA 5CM9C 3DV2A 3TFQA 3ENVA 4LF7B 3LQFA 1HZZA 3SQOA 3SBEA 1WR8A 3VNAA 3QGMA 2FLKA 3M0EA 3TSYA 3GWGA 5JSHA 1I6WA 2DRIA 1CWUA 1MORA 2ODQA 3D8SA 3T94A 5FTMA 5B1HA 5AJVB 3O75A 1T3ZA 1VL2A 3EC1A 3K3PA 2VQEB 1VI6A 5CR9A 4WTOA 1JSRA 1P1HA 1PQWA 3HYRA 3VU8A 4OB7A 2XH8A 4HMOA 3HUDA 4QG7A 5CFRA 1SOUA 1D1TA 1EK6A 4JLSA 5EUBA 4NXNB 4HK4A 1WKBA 1C4WA 3CX3A 4YJHA 3S2SA 4LF4B 4Z9YA 1NVVQ 1USUA 2FSVA 2XDQB 1L5GB 2QRQA 2WJPA 2PFSA 4JJ8A 3K8OE 4HWKA 3GARA 4X64B 2PGXA 1N6OA 4GMXA 1WCIA 1U9IA 4MO9A 1TUIA 4HDSB 4IZIA 4KLCA 4A2CA 4A9AA 4HH1A 2CXXA 4JB2A 2I54A 5GONA 2PPVA 4EUKA 3K6RA 5M3BA 5CX1B 4KJXA 1O87A 2NTYC 5CPBA 2QDXA 1V16B 1FQJA 2IXGA 4LVCA 3TK1A 1NBMA 2AK2A 2GTHA 3LKBA 1VGVA 4IHAA 3ESDA 3RS0A 5CFMA 5K3BA 2HB6A 3G9QA 1MC1A 1SZJG 1RYMA 2GBPA 3WIUA 4O5AA 1J5PA 1XRNA 3VAZA 3KUXA 4D9NA 3N1UA 4YX9A 5JAQA 4E2ZA 3R8FA 1SXIA 4Y0NA 2HMSA 3A1UA 3HNPA 1Q1ZA 1G8SA 3OE5A 4S05A 3QVGB 4RNDB 3REOA 1AKQA 4I55F 3VVCA 3WGMA 1ODLA 3RHFA 4AZVA 4YP9A 2FUCA 4TLCA 3TL3A 4N3NA 2AK3A 4DZTA 2L17A 4WNYA 3GVHA 4NENB 1S01A 3H1PA 3K9NA 4OGKA 3VC2A 4R3NA 3WGOA 8ADHA 4BGDA 2PGDA 2EW1A 5JBQA 2E5FA 4EIWA 3TZEA 3WTCA 1XP8A 2XCTB 4ALMA 2BCJQ 2YX1A 4TLMB 1TU3A 1EBBA 4EWLA 5CDTA 5BUQA 2HAEA 4KRGA 2P8SA 1BDHA 3EWSA 3H1TA 3KT8A 4DAEA 5IUKC 2X8JA 3ESBA 1EZ1A 2GTIA 2M2IA 2PX2A 2YXPX 1FRFS 4BNLA 2RH8A 4MDHA 3BK2A 5GZ3A 4EO4A 3TUJC 4DNFA 3TQSA 1U8XX 2XMDA 5ITVA 4FZ3A 3ROQA 3VKFA 4ZKDA 2ECQA 1A9QA 1JFFB 3IQGX 3GFPA 4G1MB 2BHRA 3DH0A 1UBRS 1USGA 4GSLA 4PO1A 1YBHA 4HB3A 4RIGA 4IQ0A 1XVIA 4FFNA 4WHMA 1TPZA 5A6SA 3T3MB 1FVFA 2WTBA 3GLHA 3IOMA 3I6BA 2PRJA 3QLUC 4IHKA 1ZN9A 4PR3A 2IOHA 3WFZA 3QPCA 1J0AA 2C9YA 3VU0A 2IT1A 4JJ4A 4CF7A 2VQ6A 3VUFA 2UXDB 4CM8B 2NUTB 4FUQA 2QPAA 5FUYA 2CFOA 4F8JA 2DPXA 5AXCA 2ACVA 2ECOA 2OBFA 1QFJA 3KUKA 2RH5A 3TRDA 3W0LB 1Y8ZA 3KYCB 4MKXA 2OO5A 3T4UA 3PUJA 3TZBA 2FFJA 1PL6A 4FNGA 2ENUA 3QXJA 1KSJA 4QDKA 3TTYA 3T1TA 4OBBA 3KVYA 3OT1B 1HTBA 2GN0A 2PZMA 1XZGA 2C78A 2X7HA 3HO8A 4L27A 4W1QA 4Z1MA 3DD1A 3V4VB 1QU3A 2AQHA 5HDBB 1THTA 4ZARA 3WGYA 2C3MA 4X63A 2ZYIA 4JCOA 5KQSA 1Q0HA 4D8XA 3I01A 2ZBVA 2NAPA 3D7KA 3E48A 4EA7A 2WHRA 1ENOA 4MS3B 3PJDA 3VNSA 3CONA 5JXHA 1YJBA 3RREA 5TGZA 3H5IA 3TTTA 5HMLA 3AFIA 3FTQA 3SF8B 1VHLA 4I9GA 3IDQA 5JY1A 3RSSA 4HVAA 4TWBA 1DDOA 2J46A 1BD4A 4JZYA 4UZFA 2ZW9A 4DV3B 1P81A 5GV8A 4PSVA 2ATIA 3T35A 3LPCA 2HNKA 1KJWA 1XVAA 3PVCA 5G2OA 3U5ZB 3TYXA 1TYDE 1YRLA 5LA6A 3QF7A 4E33A 5EJGA 3WL5A 2Q3JA 3HR8A 1F2DA 1JG3A 5H8WA 2D13A 1SD5A 2OBNA 2VZ8A 3NBZC 4Q7MB 5I9MA 2QZ4A 2J09A 1C80A 1PZEA 3IE2A 2FZEA 2I87A 3B6MA 2JGDA 4ILKA 4INJA 1ISJA 2NZYA 5AVSA 4RZIA 3WJAA 5HILA 1CPYA 1F6BA 3OZFA 3RVSA 4REQB 4B6FA 4EQ6B 2NWQA 1BWQA 3MWFA 3WOHA 1X7GA 1J9GA 2ZLBA 1YVUA 1VCOA 1QVAA 3W2TA 3CEPB 4UNQA 1PEYA 1MGOA 3ZW8A 2PLFA 4NV3A 1ZK1A 2W48A 3CG4A 1JJ7A 1GRCA 3KM0A 1GA6A 3R3HA 4C04A 4LV5B 4LBYA 4MHTA 1WD7A 4AY4A 4IOKA 1T43A 1U0HC 2AMFA 1JHMA 1UT6A 4ZAYA 3W79A 2BFCA 3FPAA 1NHWA 2Y6UA 3V8VA 4O4JB 1SBHA 1WVGA 2ECFA 2BM0A 2ODNA 2B30A 5HS6A 3WB0A 5CDYA 4FFVA 4F45A 4RJLA 1HT2E 5SV2A 1RXIA 1DG3A 2JAHA 2R6ZA 5IF3A 2BKUA 1P18A 2RGGA 2X41A 2YHBA 3I73A 3S3TA 4RQTA 3MXOA 5JJIA 2YJGA 3DVQX 2G88A 3THOA 5BSWA 4LBZA 2D1YA 4H7PA 3KG2A 1DG1G 1JKJB 2AYZA 3EUFA 3BQNB 2CDCA 2VH2A 5KTNA 2WD7A 3LT4A 3O1IC 3CHYA 3BHMA 4KB5A 2WFAA 4UFOA 4EMSA 1CJVC 1NVVR 3Q7PA 2J3DA 1VHTA 2C31A 3ROEA 3L4JA 1BSVA 1L5HB 4IMPA 3EXIB 3AEZA 1SUSA 4JLDA 4CMEC 3E5MA 4DCPA 3UHAA 4ZAXA 1SC3A 2ORYA 4BNIA 4B4DA 2RDMA 3EJWA 3TMAA 3WAKA 4DV7B 3T52A 5AJZA 3ZCQA 1V4NA 3G23A 1CIVA 4D3FA 2OM6A 4PIVA 4OYHA 2GCEA 4W6QA 2O07A 5LDDC 4NJOA 4FCWA 1W0KA 2POCA 2C7RA 3AVTA 1Z83A 4P6VF 2JKYA 3R6WA 4QFBA 2DWPA 5CNMA 1ZJWA 2Q1XA 4DIUA 3IA7A 5LMNB 1PZGA 4Q82A 2H5JA 4AXXA 1V45E 1XN1A 3H1FA 3L4BC 4I1VA 3LK7A 3ZWVA 1RZRA 3LRPA 1I3OA 1U5BB 3K1AB 1QLWA 4WKCA 2Y1DA 2F90A 4DB2A 1ZC4A 3AVXA 4TWIA 1H9CA 2ZRMA 1KEEB 4U2DA 1OB2A 4OAQA 3E23A 1N0WA 3HZOA 3L92A 1P7VA 1OXBB 3M1LA 2YHUA 4FZRA 5EZQA 2AEJA 1C1HA 1HTTA 4US2R 3B1WA 5GZ6A 4NZPA 3DV0A 2WYWA 4FFWA 5CX4A 4ZRDA 4G5FA 1A04A 2FUEA 1OI2A 4TN1A 5DM2A 1MZVA 1PSZA 3O95A 2H57A 3OWHA 5JJ5A 4JI7B 1DRKA 1LPOA 1JWAB 3KV3O 5HF9A 2ZWOA 4N65A 2IKQA 5FLYA 3V2GA 3DAPA 4ZGWA 3ICEA 2FPPA 1ONOA 4O4IA 4WZBB 5JISA 4UZSA 5H70A 4ZT3A 4HRYA 1XPOA 3B85A 2ZRCA 4XUCA 5JLAA 3TWOA 4QUKA 4HEHA 4GVPA 4CEHA 3E84A 2BEWA 2V0NA 2IYVA 4R1NA 1QHSA 2GI4A 5CIQA 1WS6A 8GPBA 4ER0A 2HF9A 4MLZA 5ALQA 1QK5A 2YW2A 1NXXA 3WYFA 4DLVA 5CFNA 5ESDA 2J67A 1Q1EA 1Y33E 3S2UA 4KITB 3KCNA 2O8DA 2ZR0A 2PVSA 2WA1A 3OZXA 4I3FA 3EAQA 3FWPA 2P9TA 4DCOA 4ECAA 2ZDHA 4TKUA 5JDIA 1KBOA 3PIRA 3FKJA 3GMIA 3F6PA 2AYXA 1L1FA 2ZDQA 4HX9A 4UUPA 5B7QA 4KR3A 1DFGA 1Z0IA 2OVBA 4G0ZA 5A7HA 1NVDA 1M6VB 5DLEA 1SC9A 3SVZA 2EKDA 4COOA 5KS2A 2IOQA 4KTVE 1PBTA 4G5GA 4O2RA 1OWMA 1RP1A 3C1AA 3GLVA 2AQ8A 4LHYA 3NYIA 2AFIE 2IU6A 1KNQA 1EX1A 2RSLA 2ZYHA 1YASA 4Q16A 4E22A 1ONPA 3VNUA 4J07A 2JI6A 3NGLA 3RAJA 1KOLA 1QCZA 2WQ6A 3R5XA 1GXSB 2C58A 4MKGA 2YWJA 2VNHA 3LA6A 4Q3CA 5IJ0A 2AUMA 3LLMA 4DKXA 2QN2A 1C7JA 1D2GA 3DEFA 721PA 1XKTA 5JYDA 5LP6A 4GIBA 1BO6A 1XF1A 3L05A 2DUJA 2FEAA 2ATXA 2EWVA 4BCDA 1Y5IA 2LPMA 4D3SA 5LBTA 4N5IX 1G6HA 1OB5A 2TS1A 3DVSX 2R7AA 3PQ7A 4J7UA 4Z7NB 2KBFA 5FOVA 2AKYA 1N1GA 5BORA 1TUBA 1FPQA 5DMHA 4JL5A 4AWBA 3DZBA 1ZM2A 4O3MA 2R1TA 1QDLB 3D3QA 1ODCA 2ZIAA 1UPFA 3AUTA 3E6AA 1T3HA 2B4KA 1FW8A 2WOOA 2R5FA 4KXVA 4RHEA 5CH3A 1AGRA 2JIMA 3LHKA 3SOZA 3S2IA 1ZNZA 4HVCA 2CGEA 4UFPA 5CEEA 3AC0A 4NZ9A 2XQKA 5BN5A 1IBMB 4RANA 1VSVA 3PF9A 4BE9A 1Y7IA 5ABPA 4BMSA 5CVTA 1BJRE 5DKFA 2ID8A 2QRHA 4OP3A 4ERXA 5L95A 4J4TA 3H4MA 2Q0QA 5AKJA 4FHDA 5EHNA 5A5FA 4QREA 2E87A 3P19A 4F9GA 3CLSD 1V8BA 1U94A 3FR7A 3Q85A 4MS1A 4R7GA 5KBYA 1G0OA 2EP8A 1U8AA 3HJFA 5DOVA 4RFVA 2AHRA 2B20A 1DEOA 1JI0A 3DMRA 3EIXA 3UIEA 4BMYA 2EFHB 2IITA 4YJ3A 4DIMA 2WYUA 3I61A 4IIEA 2G0NA 4DCSA 2EKQA 5BQ3A 4DMFA 4GO1A 1U7DA 2YIJA 2YWXA 2AH5A 3F7TA 3FYUC 3P71T 3OZWA 3K09C 5B3JC 2I7DA 3KEMA 1G59A 4ZEWA 2YZ2A 2P5TB 3N2EA 2GLTA 3PI6A 4TUYA 4ZVPA 3VH4A 4DQUA 3IUSA 3L0BA 3DTTA 5HW0A 2Y1LA 4G8CA 4Y6PA 2ZIVB 5FBRB 3WRYA 3SC2B 4LJ6A 2AZTA 4ENVA 3I76A 4LJSA 2RB4A 2P9JA 5ALYA 1UPCA 2X5XA 4EVSA 1P9NA 1QHFA 1ZIYA 3DBHB 3ED5A 3NFYA 3EMBA 3FAKA 5EZYF 1TT5A 2BI4A 3GX1A 2QD3A 1MQSA 3E3OA 3Q8LA 5E9QA 3UUFA 1Z0JA 3OJLA 1JRLA 3OQOA 5FUBA 1A9TA 1AKRA 1NQAO 1YJCA 3GK3A 4TT3D 5D7NA 4CKWB 4F11A 3ESXA 1DB3A 3L3BA 3TRHA 5EIFA 3DXZA 3R3VA 2JAUA 3RQIA 2Z9DA 2HRRA 3RSLA 5I3CA 3EWAA 3ZHRA 2ZUEA 5A0VA 1IN5A 1GLNA 5CDHA 3DBVO 3SE7A 2JS7A 4C87A 1LQ2A 1MAWA 1UPUA 3I3OA 1BQ4A 2ZJ7A 2OXRA 3I83A 3OHPA 4L7VA 5F2EA 3ECCA 2DQKA 4LY0A 3HWSA 3EF3A 3JARB 5JAMA 5BO5A 4PHFA 1ESMA 1T5BA 5DCLA 4HWSA 4OI1A 2JJYA 1FP6A 5EWJB 2VHYA 4ZDWA 3C2QA 1M34E 4PQGA 3S1AB 4KGXA 4QM7A 1Y1TA 1K6EA 4UVIA 2I3BA 3PFIA 5IJ9A 3FBTA 4H7FA 1WTAA 3AF6A 3GLKA 1U28C 3TSWA 4YXWD 3RGGA 3Q12A 1CERA 1HE2A 3ET5A 5FNVF 1BDBA 2YRXA 4HL6A 1QNFA 2JLSA 2SHKA 2YJNA 4DNXA 4TXJA 4D9KA 2Y93A 2OHJA 3U7RA 3IP8A 2X0FA 1YUNA 4OHYA 3A6JA 1YA8A 5ALRA 1JFLA 1O94D 2Q49A 3KZMA 4RA6B 3UK1A 3ZGNA 4RZ2A 4FFLA 1DDIA 4JI6B 5BUSA 2QUJA 2WF7A 4AW9A 4FPXA 3FCOA 4HQ6A 5AI8A 5FOQA 2H3EA 2JH9A 3ON5A 2ILTA 1HF3A 2PFKA 2F1RA 5HHTA 2ZUDA 3GEEA 5IFKA 1NBAA 3O1JC 5IN5A 4IDDA 3G68A 4BV9A 5IRCD 3H11A 4C3ZA 1GG9A 5MFZA 4IIJA 1UBNA 1UAGA 2MYNA 2C4NA 2YXEA 1VBNA 3H2HA 2JFOA 2LDXA 4MYCA 4X9XA 5HYVA 1ODJA 5J2UF 4HY3A 5CA0B 3LK6A 4HT3B 1OLXA 2JVIA 4UE2A 1AMOA 3D02A 4D4KA 3LRXA 3SX4A 4D9EA 3OTHA 1EFLA 2OD2A 3WO0A 1H6AA 3EVEA 3SSAA 5ELMA 1OKKA 1X7ZB 2XZPA 4LZZA 5B58T 2PMDA 1U6IA 2ZPTX 4PC1A 1H0KA 1H1LA 3PE3A 3QXCA 3IEKA 3H5WA 1AC5A 5K0NA 1XPUA 4JT9A 2XSZA 4O4HF 3GT3A 1XMQB 2ZIZA 4JUCA 1BCSB 2A5JA 2WIBA 5K3AA 1EQAA 3H83A 4AZSA 4X44A 1P1BA 4HD8A 2NACA 4LRTB 5HJEA 4W9NA 3HM2A 1P91A 3GPDG 1DAMA 1ZIXA 2V0GA 3IUQA 2I6SA 2P6MA 1V3VA 3G5UA 2HIGA 4ML3A 2HRCA 5ED0A 3FTEA 1PRYA 1IAQA 2WF6A 3NKFA 3PXDA 3K0AA 4TQUS 4A8JC 2PKQP 3EC7A 4JNKA 1UM9A 1WV0A 1ZNXA 2H4HA 3JQ7B 4LGVA 2NXWA 2YJZA 1JSCA 2XWSA 1AKNA 4L7QA 1HE5A 4Q9LA 2OCKA 4NYIQ 5AM1A 1PWEA 3U7QB 2BJVA 1RZUA 5LLSA 4LYYA 2IYNA 3DAGA 1IHUA 2ADFA 3LTEA 1JAYA 3K96A 4I81A 1UOOA 2HF8A 3Q3CA 3GOQA 2VDVE 2Y0EA 4Q39A 4ZEVA 3NFRA 3GR6A 1Z0DA 2YHIB 2V5VA 1MABA 2P27A 5EKDA 1U9YA 1CQWA 2C9CA 1DXQA 1KSFX 2Z4SA 4N8EA 5DF1A 3TLGA 2XCSB 2D2XA 2YV4A 4UREA 3FSRA 4B3MB 4RVFA 3ZVMA 3E03A 2OILA 4PYJA 4Z7OB 1NW5A 3RVOA 4DR6B 4KFSA 4RKWA 5EYPA 2C8KA 3UK7A 4EF4A 3PYLA 2FW8A 3TSOA 1T4CB 2IPNA 4NPHA 3GNSA 4DCUA 4ZO4A 4GICA 3HL0A 1JQAA 5GY7A 2O2DA 5CJJA 3RSGA 1E0JA 4QC2A 3NYWA 3GLIB 3V8MA 2XNCA 5KQRA 4IQ4A 4TV8A 5AI9A 1SUCA 3WAGA 4K6FA 4KNWA 3H2ZA 2AZ4A 4E13A 5I7FA 1XL1A 4B7AA 4X1YA 2VP0A 3I45A 3RRFA 4OXYA 2J3QA 3I6MA 2QPLA 3ZWKA 3H19A 2AYYA 4QJBA 4TRJA 4JB3A 2ZZMA 4J1QA 1HEUA 1NMZA 1U02A 3WBKA 2YQ4A 3O38A 3DEJA 3X1ZA 3GCXA 1QIIA 1ZONA 3GOHA 1J9ZA 3NT5A 2ACEA 4FNMA 4QGGA 5ER9A 5FLKA 2E85A 5TEWA 1JH9A 1IOVA 2HXYA 2P35A 3AUYA 4M83A 5MDHA 4XGRA 3ICPA 4IIDA 4P98A 4U00A 2Q5LA 4BVBA 3S29A 2ZI4A 1T0HB 2PANA 3FYCA 2OESA 1LRKA 2JGIA 4GXNA 5DWQA 1TVKA 3L93A 5GM2A 2UUCB 1QTIA 2EZ8A 1URPA 1MD9A 2Q0XA 5IARA 5AQ1A 3F2IA 1EFRA 5EEHA 1I2CA 1E2IA 4N49A 4Y8VA 1C41A 1V1RA 3IBGA 1GSOA 4IJ5A 4JC4A 5BOSB 1DAGA 3T3GA 3A9WA 1QH0A 4B3FX 1L9KA 4QJ5A 4DV5B 1RYZA 1Y4AE 4Q1VA 2LNDA 2QORA 3W5IA 4EUHA 5C1BA 4JP1A 5G4LA 3VKHA 2KSQA 4A6EA 4MWCA 1Z18A 4B3IA 1QF7A 2PUJA 4ZTZB 3UWOA 2BKEA 1P7CA 2XTZA 3BWVA 4P3KA 2IQIA 3HE3A 3K1ZA 1W44A 4YO8A 2FPGA 4EJSC 2OGZA 5F9FA 2ZQYA 4FFDA 5IM4F 1XEWY 3LY7A 4FFMA 1WW2A 1ZUNA 3N28A 4LRUA 1MTZA 3BDIA 4MQEB 2R6HA 3LP8A 4NMWA 1KERA 3PQEA 4B2YA 1ORWA 2O0MA 3OPMA 5EINA 1GCOA 1SK8A 3U3MA 2O4CA 2X13A 4PAQA 2ETVA 5CT6A 3CZQA 5J4KA 4D8VA 4N0QA 2BZSA 3NWBA 1M72A 5BY2A 3HBLA 1H3NA 4D0GA 1ZBQA 1I0LA 1SD1A 3BWCA 1VBKA 3CO5A 3CMCO 1K66A 4TTPA 4XQ0A 4A5OA 1CSEE 1YUBA 1GZ4A 1OXMA 2JFNA 4FINA 5TQJA 1AXGA 1GITA 1RM0A 3BVPA 3ETDA 4PRLA 1FLAA 3WE7A 2X23A 4D41A 2IYSA 2AN3A 3OMXA 1C14A 2A7XA 2NUBA 1H2HA 3WY9A 5C1OA 4V1CI 3NBYC 1QORA 4FE4A 4GEKA 3PNLA 1J42A 1VPVA 4FSDA 1L7QA 5GV7A 3ZCTA 4DHEA 5INTA 2H59A 2C0QA 4JA2A 1JHYA 4RTMA 4KMSA 1UBKS 3Q1LA 2B3DA 2QX4A 3FPSA 4GI7A 4ZYXA 4QQ8A 1PK9A 1PDWA 3ZV6A 2CXTA 1GNVA 1VHWA 2AFHB 3QU7A 4KO8A 1W5FA 2C97A 4FYPA 5BW8A 1RHRA 4N3GA 4X61A 1YCHA 4GGMX 2FN8A 3HH8A 5T8KC 3AHJA 4G1FA 1NVKA 1RACA 3OX3A 1QHGA 1S02A 4BEBA 3BD9A 3QI7A 1MFZA 4I4TA 4R69A 3VR5A 2X9GA 3L5OA 2O5EA 1CR2A 4IQGA 3BSSA 1IY2A 1YS6A 1SCQA 2H8GA 2ZG6A 3AJDA 5BSTA 2OBBA 1BA3A 2P2NA 1IQ0A 1T6BY 2Q1TA 2YIVX 3ZEAA 1XCOA 1CUCA 4DC0A 4OIMA 5IWCA 2UAGA 3DOCA 3PJEA 4I2VA 4KV9A 2VPPA 4UEOA 3TW8A 1T0BA 2VPIA 3HVUA 4YT2A 1DVRA 2UYOA 4IL5A 1OPXA 4L78A 2HHJA 4V0OA 4MTLA 1IY0A 1XZBA 4IEIA 3T9AA 1ZM3A 2Z43A 4XM2A 3V6LA 1L4EA 1NBMD 2LWIA 3IO3A 1HDOA 1WNTA 3ZCUA 5A9SB 3TAXA 5LXTF 3OF3A 2A67A 1WUKS 4MHOA 4Q3LA 2FEMA 1HKHA 2F3TA 3L6RA 3U40A 1KWKA 2BR3A 4KBYA 1JP7A 1E7SA 1FYFA 3ANNA 4KSCA 1GADO 3EX7C 4JXXA 1IB6A 2CW5A 3R5KA 4ND5A 4IX1A 4O2AF 3GH3A 3UMRA 3CPSA 2DSNA 1CZOA 2YV2A 4TS9A 1BXGA 1QHNA 1DBPA 3V00A 5FTNA 2DQYA 3DKKA 3LQ4A 3SMVA 4ACAA 3TIFA 3CLSC 3CB2A 1RQ7A 1CYDA 3ORRA 4BAGA 4D4IA 3R7LA 2QT9A 1MOZA 2RHCA 4IHQA 4MDEA 1D6MA 1P2SA 3RIYA 4H31A 1PFYA 5EZ5A 3JRXA 2BL4A 5BWNA 5IFLA 1K8QA 1NOIA 3A27A 2IGBA 5EESA 1QHEA 4IV8A 3WBJA 2H63A 3RBAA 2QF7A 1PLKA 3ORQA 3VQTA 1YXMA 2FOLA 2WD8A 1QIDA 1P1CA 4D57A 5F7XA 1E1DA 3QEJA 3EVAA 4QUBA 4B17A 5K1ZA 3M6FA 4OU5A 3KFLA 4PE5B 2ADOA 3SZOA 2HTFA 3GPCA 1OU0A 4E03A 5CA1F 3ELBA 1VMAA 2RAVA 2A3RA 3N75A 1LBQA 4JKYA 2GBLC 2PUDA 4NYIR 3TPFA 3UGKA 3KJFA 1BD3A 1DTWB 2GZHA 3CF6R 3JWEA 1Y7HA 3AETA 3CUEF 4QPNA 4N0DA 4YCLA 4X7RA 2O8EA 1CETA 2EGGA 5LQNA 5JDCC 4LRYA 3KTOA 2F3UA 4IJWA 1VHQA 1NMYA 3I72A 4F92B 1OW3B 1I2DA 4NVRA 3KP1A 5TPZA 4A8TA 5LZ9A 2GXUA 3CS3A 1VA5A 4E1BA 2BR5A 3NIBA 3SG0A 2OXEA 1HYEA 2IIVA 5EHGA 5EHXA 1PHPA 4MNTA 4I99A 3SHVA 1MX1A 4EEXA 1FQOA 1VL5A 1UJ6A 4Q3EA 2ZIWB 4LHZA 4TMVA 3PX3A 3OKAA 4YR9A 1JT9A 3JD2A 2DE0X 3IIKA 5JXIA 3A05A 4ON9A 3SHTA 5T4FA 1JI3A 3ZDYB 2DR2A 1QB7A 3VU9A 4D4GA 3KQNA 3ZXYA 2OTCA 5DHAA 4RGVA 2CY0A 4F91B 1ACJA 4BVFA 2X6RA 3CGWA 2CZCA 2NO9A 4ZU3A 3K0SA 4ZMRA 2ZPUA 3FW1A 5DT2A 4QJIA 2O8CA 2F1IA 2C54A 3E7WA 2FRXA 4IFTA 3R6GA 2A52A 4Y1RA 2XBMA 4PU0A 4DDTA 3T95A 4E0BA 2IY9A 4W8OA 4KLNA 4E2FA 4QTXA 4EX6A 4RV9A 3SEQA 3NRBA 1YZNA 5AKEA 3DDNA 5CPFA 2HOQA 4Z1MD 1QJCA 3RE1A 1RE1A 1G3MA 2ZJ0A 1CFJA 4PYRA 2GLXA 3DKPA 3LOQA 5A4FS 4OLBA 3GJXC 1G6OA 3PNQA 4IKOA 1P7YA 3TRFA 3O8RA 1A5SB 3EBOA 5F5NA 3C98A 5T4EA 2JLUA 2C9ZA 1X1RA 1XAHA 1UKEA 2QTNA 1B73A 1M2OB 1WUIS 3GMTA 4OHBA 5ENVA 3K9QO 3WA7A 1JHAA 3AR9A 1JPVA 5JADA 3QFTA 1IMOA 5FNZA 4F4IA 2JF0A 1T2EA 1A95A 1J23A 3B5EA 5CLHA 2FK8A 3GPLA 5CG1A 5HP4A 3PC6A 1HE3A 1KGSA 4EL0A 2CK3A 3EGIA 4AG6A 1BJKA 2B8JA 4N5HX 5C1PA 3JQAA 3O3CA 1NXSA 2J6HA 2YWRA 3E81A 4HN4B 3AX6A 5FR1A 4ETNA 1IYZA 2ZIUB 1TX4B 4TMXA 5D3MA 1MMFB 1R37A 5AW9A 4BZZA 3UKOA 3Q8KA 4RNCA 4CG0A 3O6VA 3DYBA 4QRDA 3CNQS 2OCGA 1KYWA 3DYIA 4RWEA 2NU9B 3BGDA 5LLDA 2CDRA 4GNRA 3R6DA 4ENSA 1B8UA 3KS9A 4WI1A 1PK7A 4K88A 4L4YA 1ARZA 1R8SA 4FZJA 1GJRA 3PGLA 4LFAB 1SIBE 3AR4A 3FM9A 4KG7A 4DCTA 5AR1A 4LXIA 4KK4A 1XL0A 3UJNA 1T1RA 1T13A 2XZOA 2Q1YA 3T1QA 2I52A 1E9BA 4CWAA 3GLFE 1T25A 2FZVA 3C6QA 2HJWA 4CKZA 4ENQA 3UK0A 2ZJ2A 1VE1A 3L7YA 4YA6A 2BHTA 4PZEA 1VMDA 4WVLA 4IX9A 1W52X 3QNMA 4X8MA 3RGWS 4CVNA 3RUIA 2DEUA 1WZUA 4OFWA 4Y1EA 3A7DA 1XTKA 3F3KA 1GKLA 3I9JA 1B6RA 2VAVA 3B36A 4RL6A 1MA3A 2PXHA 1R66A 3E5RA 3VX4A 1KI9A 1W35A 2GEKA 2A0WA 2HXSA 3MPOA 3B6KA 3CCBA 4ZT2A 1IY1A 3TLZA 2BSAA 4G5XA 2QNRA 1K1EA 4JBYA 3BMXA 4KQ2A 3ELYA 2ZXFA 1LCIA 3L5KA 4RIHA 1XD2B 1H2AS 2VLBA 3H7IA 3AHFA 1PYOA 1EFPA 4US0R 2Q7DA 1P1JA 1YDWA 1IHYA 4WX2B 1E0DA 4ZVVA 2HT6A 4E7PA 1PZNA 1UMBB 2PK3A 4HUQA 4FW8A 3VI3B 1EI9A 5JQGA 1FC0A 1M7BA 3KC2A 3LF4A 1TYAE 1M67A 1NYQA 1QE3A 5LQMA 3CRNA 4K26A 2GDJA 1U6KA 2H16A 4HCJA 3ZDAA 4DCVA 3WDMA 3OE1A 3K9GA 1O08A 2B94A 3F4BA 4NBRA 5AKHA 2DQZA 5GVRA 1UK6A 2XD9A 3Q6MA 5TEVA 3AU9A 3VPCA 2QE6A 1NUUA 4PZPA 5AKKA 3X1MA 4K0KB 1I6KA 1XT6A 5ER6A 1GUFA 1PW5A 2J0VA 3EY9A 2DPMA 2A59A 2W2XA 1JB9A 2XQJA 3RFVA 4WN9A 3HA5A 4ZJUA 3ZJ5A 4KQ9A 1LRJA 1DX4A 4R81A 4UTOA 1Z7BA 1Y6ZA 4XIFA 5DB4A 4D9GA 5LUBA 3GBVA 5JSZA 1W0KD 1GTG1 1NUHA 2FZ5A 2Z3ZA 3X1WA 4MVJF 1OUMA 4KTTE 3HGQA 1MQAA 4KQJA 1M2WA 3USES 4DCJA 2BMDA 3OFJA 1U4NA 3AEYA 1I0IA 3SSOA 5CW1A 4F06A 3FOZA 4KYTA 4BCCA 3GGPA 1UAAA 1HQCA 3ONDA 1RZRD 4TV9B 3CPEA 4BVHA 3WLLA 1GUYA 1TNDA 4YQEA 5FAXA 4RETA 4DQ0A 3OURA 4NNJA 3AERA 4DR5B 4DDKA 2C99A 2DX7A 1UK8A 1IE3A 3UA3A 1F7UA 2GD0A 1XXHB 5AJWA 4UDXX 2AJ8A 2OOSA 4C0JA 4DA6A 1YGYA 3LVQE 5I5EA 2CVPA 3SXUA 2R00C 4I9HA 5BSEA 4NULA 2W9XA 1T0UA 3KJGA 5JR3A 1GNTA 2GZ2A 1P75A 2IE0A 1UOPA 4NPCA 3OZGA 4KNYA 4KOAA 4M9XA 3JVUA 1L4BA 3B6ZA 2Y1GA 3QKWA 4JJGA 5J5AA 4F3RA 2KE5A 1SD2A 1NIPA 5CK5A 5DGIA 3VO1A 2NPIA 3ZWXA 2W6NA 3FIUA 1AUQA 1XCGB 3AVOA 1YL6A 4JUAA 3T5TA 3K70B 1Q11A 1G0NA 1V25A 3AKEA 2QP9X 5IUJC 1CQZA 3UBMA 1NVAA 2LVBA 3N0RA 1VKHA 1KFKB 2FCAA 2WA2A 3R0QA 4LEIA 4KR6A 2VHEA 3I1FA 4LG1A 2QTHA 3L82B 1FRVA 3QG1A 1A8IA 3AIKA 3LZCA 3B8EA 4KK3A 3BL6A 1UEXC 2ZJ3A 3WZ2A 5FWYA 1H6BA 1IULA 5A4AA 2JIQA 3I9NA 3HPQA 3EPLA 3AL0C 1UC9A 1IN4A 5LYYA 2WU8A 3QM1A 4HYTA 1UC4B 3PNPA 4BOYA 3LT2A 4C2BA 3KSRA 3IJRA 2D06A 1XNQB 3VSDA 1DKNA 5K20A 1E4OA 1OVMA 1DKLA 3DONA 4KSYA 5FD8A 3R74A 5K8IA 4AJ4A 4BRUA 3B53X 4DCGA 4C9BA 5AW1A 1XG5A 3NI2A 1BYIA 2FR1A 2W8BB 4XUDA 1JHXA 2CXOA 3RUPA 5AVZA 1U9CA 1HBJA 2GYYA 3T7JA 2IEGA 5AW3A 3Q10A 2B25A 4XA8A 3B9BA 3QTBA 5FADA 4G2TA 2CJYA 1SVNA 1I13A 4I19A 4B3GA 1D6SA 1BKSB 1DWPA 4RKEA 3AEXA 3VPAA 4EY6A 3N2NA 2GN6A 4AB1A 1A7AA 1HZZC 2PRZA 2GRUA 2FZCA 4XFJA 4D92A 1QOPB 2CLCX 4DY6A 3DOUA 2NXCA 2PGIA 4LQDA 3LZ6A 4FLEA 3KZCA 4Q19A 2WIGA 1AM4D 2C5GA 3M6UA 4RCVA 3VO9A 3JRNA 1R15A 5BN3B 3DLBA 1BAPA 3MGAA 3AQIA 5H4HA 3KAKA 2AN1A 4OYYA 1A5ZA 3V97A 3MBOA 5TLSA 4HJXA 5KNCH 4Z4HA 1NQUA 1YNOA 3T5DA 2OHHA 3CH4B 4ZAWA 4BX8A 1N2JA 3OEWA 2V58A 2H7YA 1A2QA 3BMQB 2NIPA 2FSVC 1P2VA 1M2VB 1K6IA 1AS0A 1LSUA 2YBEA 4UUNA 1DC3A 1Y9ZA 1PI3A 1KGDA 4L0QA 2IUUA 4DEXA 5A0TA 2A8YA 4AY3A 1M1YB 1OREA 1SKAA 4NBVA 1QRRA 2O1SA 4ND3A 3RC1A 4BNGA 1U9IC 3KPJA 4LDNA 3ML1A 4LF6B 1NT4A 4J0KA 1JEEA 4M4SA 4TVBA 3UJHA 1QRTA 1TLFA 2PX3A 4F2DA 3BGOS 4OBXA 1XJCA 1N2OA 4WKNA 2QRKA 1ZRMA 1ADCA 2OG2A 4AZ0A 1G8GA 1Z12A 5NULA 1NF2A 1NW3A 1A0OA 3D6HA 3TN7A 2IY8A 3EZNA 1XK7A 2D0DA 3IQEA 4FU0A 4EGJA 5EE5B 1PDOA 1WW8A 3BJMA 3ISTA 1PGQA 2JCVA 3P9YA 4PYNA 1WU7A 5DCYA 4Q7JB 4U9IS 1R8JA 2ON6A 3REQA 4BNXA 4RVNA 1GNPA 3PQCA 5C7IO 4I1YA 3H9CA 3IPAA 2H2GA 1JW9B 3AR7A 3S81A 4EW1A 3EUEA 4GPD1 2IYLD 2A6PA 3K6SA 1GZDA 4PPQA 4MUEA 1KPHA 2FFQA 4BKMA 5HRUA 3NHKA 1KFJB 1RRFA 2LR0A 4YJGA 1GPKA 1K68A 3SD7A 3AEKA 5DP2A 4AZ3A 5F2OA 4B3DA 3U9TA 1NMQA 3LX6A 4K46A 1SIWA 3HWRA 4G9BA 4WD3A 4KYIB 5G0UA 4RJJA 2IPOA 1FVXA 1ECGA 4X24A 1T2NA 3LCCA 4OV6B 3H04A 2Y9PB 4J6EA 5IXYA 3BXPA 4D7AA 2IOFK 3FGOA 4JLJA 3LBFA 5LOVA 2QLLA 3BCRA 3JTMA 5BN4B 1GRVA 1R4MB 4CMKA 3A4VA 3NIWA 4TTJA 5BNZA 2BEVB 4UBMA 1S2IA 2X0IA 4EA9A 3QENA 4FDTA 4REOA 3MFYA 1GM5A 2QRZA 3G2JA 2H31A 5IDXA 1TTQB 1Y8RB 1BRTA 1Z5ZA 5ENZA 4RTOA 1JEQA 4FIDA 4P8RA 2E49A 1EHYA 2HLHA 3DNMA 2II6A 2REOA 1XZNA 3D5TA 5KNDA 1K75A 3GLRA 5J2TB 1W4CA 2XHEA 3DWEX 1QZTA 4FEEA 4LTNA 1XV5A 3MMZA 3CVXA 2Z95A 3V2UA 3LCRA 4X8HA 4DJTA 3M3PA 4ERNA 4C7KA 1Y6GA 4M54A 2HHAA 4QUEA 1Q0ZA 1KBQA 2GYUA 3PIIA 5CGZA 2IZOA 4OK6A 2WE7A 2BGMA 4Q93A 3K31A 4YV7A 4JYZA 1Z0AA 2AQKA 3HCFA 5G0SA 4ZDKA 3WKBA 3EMOA 4LGYA 3C6KA 1RMQA 3N2YA 1XHLA 4M0PA 4EG6A 2C92A 3H3XA 4BN4A 4QXOA 1CUIA 4MVJI 2BM1A 3VVLA 2D8MA 4NOMA 1UXIA 2ASEA 1KXJA 5ICCA 3TQIA 3E0XA 2E7ZA 2UU9B 1II0A 5T64A 3KXPA 3GU3A 1KYVA 1E5VA 3OJWA 3B78A 2CJXA 1SIUA 2OO5C 2XGMA 3LF2A 2J4DA 3UJDA 4HAZA 4FYIA 3TTSA 1KYQA 1GQ2A 1T2DA 1Y7PA 1FLNA 2I55A 2G16A 4MYUA 1EM8A 2OV4A 1CUAA 3ZHOA 4PS1A 5HGJA 4OJYA 3A3NA 1IOLA 1NJGA 2HIMA 4XIGS 2DHCA 3IP7A 2VDLB 1NVTA 4Z0NA 1YA6A 2BI8A 2RK6A 1Q83A 1Y4SA 2DHEA 2XT6A 3ZVRA 3JVDA 4WXPA 3MCTA 3UEOA 4BL5A 4CCWA 2R96A 1ADBA 3LPDA 4YIHA 4YAWA 3M5WA 3HU2A 2BFEB 5DE3A 1UBCA 4Y9RA 3RQSA 3T61A 1F2VA 1Z8NA 4LE0A 3RROA 2I62A 2SBTA 3LQ1A 4FR0A 1A96A 2H0RA 4L2IA 5BUCA 3RIHA 1WABA 1TJPB 4CM3A 4NK5A 1OKKD 4Q9NA 3U4QA 5KVQA 4Y1FA 3BG5A 3Q8MA 1PT6A 2DUWA 1ID1A 2EXXA 2CLFB 4AICA 1CBUA 3ZZNA 3E61A 4KXMA 5HK9A 5E1DA 4F60A 3NHJA 1Y42X 3M81A 2ZYAA 3Q9LA 2R44A 1IBSA 4J3FA 5U4QA 2ZR7A 3SKVA 1KMMA 2EYUA 2BMEA 5DLPA 3A1CA 4YT8A 1L7PA 1VLQA 3GO4A 1XDUA 1A69A 5FRDA 4B6PA 2H29A 3P9QA 4IHJA 1NUAA 1II9A 2G7ZA 4OMFG 4QJ3A 4U8GA 3H7AA 5CG2A 5FQNA 1PEAA 2ZIEA 3RYCB 4MUMA 2K2QB 1GEEA 1FSGA 3I2KA 3QA3E 3P8ZA 1R5BA 3JD1A 5HQ3B 1Z63A 2I9KA 4YMUA 1U8FO 3KPUA 2O3SA 3S8MA 4AYTA 4BIIA 3EIOA 3W4JA 1MT3A 5JYCA 1YR3A 3BFJA 1I2BA 3CF4G 3FDZB 1X74A 3CWCA 1Z8HA 1H85A 1QCDA 1ODKA 2PUTA 1W0JA 3V1UA 3WQHA 5MF6A 3ZYCA 1XHFA 3DUFA 2P11A 2X3FA 2Z2XA 4GYYA 1TF2A 4BO4A 2AMLA 1ONBA 5FIUA 2QP4A 2RHTA 3B1FA 4QQRA 1L4LA 1L3IA 3PNYA 3DEHA 5KKAA 3DO8A 3D6TB 3GI1A 4QXRA 3P2YA 1JPUA 1JFTA 3O7MA 3N2KB 2CVQA 1MJFA 1NVFA 1I0ZA 4BNJA 4L8YA 1R50A 5BR4A 1O0BA 4JI3B 3W06A 2DT8A