3IOKA

2-aminopyrazolo[1,5-a]pyrimidines as potent and selective inhibitors of jak2
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
289
structure length
285
Chain Sequence
TQFEERHLKFLQQLGKGGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tyrosine-protein kinase JAK2
publication title 2-Aminopyrazolo[1,5-a]pyrimidines as potent and selective inhibitors of JAK2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 97
structure length 285
sequence length 289
ec nomenclature ec 2.7.10.2: Non-specific protein-tyrosine kinase.
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 3iokA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 3iokA01
3BYSA 3PP1A 4IB0A 2UZWE 2XM9A 2VTMA 4KABA 4LGGA 2WELA 2C5OA 3BIZA 4RG0A 5HKMA 3TTIA 5KMLA 3MSSA 3HV7A 1I44A 3A7HA 3PPJA 4L6QA 2GQSA 2X7GA 3IG7A 2HELA 2Z7LA 2QONA 2BZJA 4GMYA 3S3IA 1ZY5A 3I7CA 2YERA 2CN5A 3ZFYA 4C33A 1UU8A 1YDRE 4RRVA 5AX3A 3Q4ZA 4ZJJA 5DMZA 5CWZA 1CM8A 2W5BA 3Q4CA 3QGWA 5HBEA 4PUZA 3V5PA 4F4PA 2RGPA 3PSCA 4S33A 3LQ3A 4M8TA 3S1HA 4WG4A 4D0XA 4DEBA 2ETRA 1P2AA 4KIKA 4DEDA 1YW2A 2BKZA 3E93A 3SLSA 1RQQA 3W33A 3TL8A 2QD9A 1ZYDA 3UPXA 3DFCB 4O0XA 5HG9A 5EKNA 2NNWB 3SG9A 4G31A 4YBJA 4YJPA 3TZ9A 4EOPA 5JMSA 4LG4A 2B1PA 4E1ZA 3ZOSA 4MNFA 3QXOA 5I9XA 3C7QA 3I0QA 2JITA 5BUEA 3QFVA 2BCJA 2V7AA 2C5VA 4IB1A 4MAOA 5HU9A 1WZYA 3LLTA 1YI3A 1ERKA 3MY5A 2QG5A 2ITTA 5B2LA 1A48A 5AP5A 4DGMA 4EUTA 2PHKA 5BVNA 3VBQA 4FTTA 5EYMA 1VZOA 4GEOA 3VF9A 5CEOA 2QO9A 4M69B 3VBXA 5C9CA 3ACJA 3PJ3A 3GBZA 4XOZA 5B0XA 3R9HA 3REPA 5FLFA 3V8TA 2XIKA 4PQNA 4F7LA 4O6LA 4XG6A 3F3WA 4A7CA 4WG3A 4YBKA 4A9YA 2OF2A 1YXUA 3KRLA 5M07A 4CD0A 5FTGA 4QOXA 3QC4A 2EXEA 4ID7A 3MH1A 5JH6A 3K5VA 3ACKA 4I4EA 1H25A 4IAIA 3U51A 4JIKA 2J2IB 3BBTB 3C0IA 4PDOA 5J7BA 3PSBA 4BCIA 4TTHB 4RX9A 5EM8A 4O22A 5IKWA 5A46A 3R28A 3QRJA 4KBCA 4FV9A 4IC7A 3HDMA 4M3QA 2ERZE 2X6EA 2UZEA 5EFQA 4UWYA 5C27A 5BUJA 5M57A 4KIQA 4TT7A 4KIOA 1S9JA 2WIHA 4B6LA 3HKOA 5AMNA 3OP5A 4C62A 3ULZA 5FXRA 3R7VA 3ZMMA 4GG7A 3MVHA 2BKKA 1ZMUA 3SW7A 3OS3A 4XS2A 5F94A 3R7UA 1GZ8A 5I9WA 1UVRA 4E6CA 4X21A 4AU8A 3D9VA 1PYXA 4MYGA 5F95A 4UYNA 4KWPA 4DBNA 3LFDA 2WPAA 4KBAA 2JKQA 3LHJA 3S95A 4DH3A 3DXPA 4ACCA 4UXQA 5TOZA 2QO7A 2BILB 2ZYBA 3QKMA 4DEGA 1DI9A 1XBAA 2HENA 4ANMA 4R6VA 3TV7A 2PVFA 4Y5QA 3MPTA 4UXLA 3RWQA 1IR3A 3FQSA 4ZLYA 2W1GA 3LFCA 1K3AA 2JD5A 2WZJA 3R63A 4BCGA 4EJNA 2VTSA 4B99A 3L8PA 2BRMA 3H9OA 3KMUA 3ZFXA 1ZOEA 4M7IA 4G5JA 4BF2A 4KRDA 5L2TA 4YO6A 3MN3A 5CAUA 2P2IA 2X39A 3QLFA 4L53A 1Q41A 1XH7A 3FHRA 3MV5A 3BPRA 3OZ6A 3OVVA 4QYYA 4EOIA 2OF4A 2O65A 2UV2A 2NP8A 2ZJWA 2W0JA 5EHYA 3VBVA 1OUYA 3WE8A 2ZMDA 3PPZA 4DFLA 4PDSA 4PRJA 4EYMA 4ONAA 5HCXA 3UOJA 4ZY4A 3ZSHA 3E63A 2UZUE 4FT3A 3R8UA 3ZDIA 3B8RA 3FMEA 1H26A 3PVBA 2OSCA 3NSZA 3ZEWA 3SKCA 2VO3A 1WBTA 4ZSGA 2CKPA 4ZMFA 4R77A 4UMQA 2B0QA 5D10A 3EN6A 3HZTA 5CSHA 2PE1A 2WIPA 4TXCA 5J8IA 1CMKE 5AP0A 4F7SA 4RVLA 2OZOA 4EQUA 3RPSA 3IW5A 2JIIA 4YHFA 3V5TA 4EOOA 1NVRA 3JR1A 4K77A 3ZZWA 3WZUA 1XHAA 4X6QC 5HTCA 4BGHA 1XO2B 4E5WA 2OIDA 4QQJA 2PMOX 4RA4A 2Q83A 3NWWA 2GHGA 4KS8A 3LMHA 1U4DA 3AD5A 4G3DA 3I60A 2WTJA 4FT7A 5LCKA 2XCKA 5AP7A 4BBFA 5HVKA 2DQ7X 2YDIA 3CQEA 2RIOA 4DT8A 4LRMA 3NNVA 4ACDA 2IW6A 2W1EA 4QP2A 3MFRA 5DPVA 2YN8A 2XNGA 1FVVA 4QO9A 3TUDA 2VWXA 2XRUA 2F9GA 2A4LA 4QMUA 4XLIA 4AAAA 4DGLC 5IQGA 4KAOA 4LUEA 4XV9A 3C4WA 4GUEA 3A99A 3M11A 4OTQA 4YUQA 3P5KA 2X0GA 3R01A 4FV1A 4NTTA 4PL3A 2JAVA 4BBEA 4DEHA 4CYJA 2J5FA 4FEUA 2UW8A 2ZV2A 4IQ6A 3ZRKA 4USDA 2GFCA 3ANRA 3BGPA 3MA3A 4QTDA 4WRSA 2VX1A 1OPJA 3W8QA 3HP5A 3PIYA 5AUWA 3GENA 1WFCA 3VQHA 3EFJA 1XH4A 4E3CA 4RIWB 3FL4A 3FQEA 3EFWA 3W8LA 3DKFA 3IKAA 4P5QA 3ZBXA 4ACGA 4EONA 3CGOA 2R3KA 3A4PA 4QT1A 4RC4A 4WRGA 3R9DA 4YO4A 5GZAA 3SG8A 2R3RA 4WBOA 3N9XA 2WO6A 3V6RA 2PY3A 4GU9A 2XZSA 1V0PA 1KUTA 3TZ8A 4GT4A 4MEDA 3L9LA 4MNEA 4WNOA 4AA5A 2J51A 4BI0A 5H8BA 4C0TA 2VU3A 4O84A 3CXWA 4RWKA 4XEYA 3RGFA 4W4WA 1M2RA 5AUXA 1XQZA 1T45A 5FXQA 3DLZA 1SZMA 3OWJA 4U9AA 2HZ4A 2PVYA 1LEWA 2PK9A 4BVUA 5EYKA 4APPA 4OBQA 4E5BA 4CYIA 3ROCA 2ESMA 2W4OA 2YM8A 3VUTA 5JGBA 3DB8A 2YZAA 2GNIA 3CTJA 5FP6A 4BDDA 2CKEA 3PIXA 3F7WA 3GQLA 4IX3A 4JXFA 2HZNA 3PXZA 3BEAA 1W8CA 2BROA 2CDZA 3PA5A 4BDKA 2Y9QA 5C8NA 4DEEA 1OVEA 2XJ1A 2XNOA 4DCEA 3EQHA 1Y91A 3VJNA 4TN6A 5J5SA 5GNKA 4RFZA 4XCUA 4HNFA 4C37A 5IPJA 3QKLA 4IZ7A 5E8ZA 2VD5A 5AP3A 1SNUA 5E4HA 2XEYA 1G3NA 3LLAA 2UUEA 3M42A 4QPSA 2EU9A 5BMMA 4Z55A 3AQVA 4IAZA 4RQVA 5CVHA 1YXVA 5ANOA 4II5A 4AE6A 2IWIA 4K33A 1Q61A 1L3RE 3HUBA 2W1CA 4N70A 4B8MA 3FBVA 2GNJA 4NW5A 4A9TA 4D9UA 3I79A 2PVNA 4FI1A 4HOKA 3U9NA 1J3HA 5M08A 3ZC6A 2NRUA 3KU2A 1RW8A 3PZEA 3AMBA 2XYUA 3MFTA 4NM5A 3HEGA 1FGKA 3LM0A 3A4OX 4GJ3A 4JQEA 4YTIA 5HESA 4OUCA 3RJCA 3UZPA 5IQHA 2BRHA 3GC0A 2RKUA 3RINA 2IJMA 3UO5A 5DNRA 3OCBA 1JPAA 2PMLX 4IANA 3VW8A 4L42A 4QMSA 4AN2A 2XKFA 3NW6A 3NYNA 3H4JA 4I1ZA 4CKIA 4CMTA 2GTMA 3EZRA 3I5NA 4YLKA 4D4VA 4ERKA 4DTBA 3GVUA 2OJJA 2X1NA 4R7HA 5EK7A 5AUVA 4TWNA 3QZIA 2OIBA 3II5A 3PE1A 4D1ZA 1ZZ2A 3NNUA 2XJ0A 1SVGA 5CNOA 5D7VA 2EB3A 4DCAA 2XIZA 4XG8A 3V5JA 4OTRA 3KK9A 4G34A 1T46A 2BZKB 3O7LD 4OTPA 3AC3A 4AOJA 2GNHA 4EZ3A 5AV2A 1UNLA 2QU5A 2YIXA 4JBQA 4OTHA 5L2IA 1STCE 4BR3A 3PFQA 2H34A 4FF8A 2VTIA 2GCDA 2GHMA 3GXLA 4QMVA 3SV0A 3TM0A 5C8MA 3CD8A 3MWUA 3W18A 2G1TA 4YJVA 4AT4A 5LVNA 1YOMA 3UIXA 3EYGA 2WTKB 3ELJA 3F9NA 3DAEA 4CEGA 4CFWA 4NWMA 3GU8A 3QWJA 4M66A 1JKSA 4FVQA 4IX5A 4LL0A 2JDSA 2PE0A 4FIGA 5BVWA 3GI3A 5DWRA 4FZAB 2XKCA 3OG7A 3VUDA 4B9DA 1REJA 4D2SA 2LAVA 4V0GA 4AFEA 4BICA 4JAJA 3KCKA 4R3RA 4N6ZA 2VX3A 2PULA 4XMOA 2W7XA 3OD6X 2W5AA 4AOTA 2QNJA 1X8BA 4F9WA 5M09A 3IOKA 3IW6A 4CLJA 2B9JA 3FHIA 4K11A 4FKJA 5HX6A 4J53A 4U81A 4DH5A 4G17A 1NXKA 3EL8A 5ACBC 3VULA 1OM1A 4G16A 1FOTA 4QTBA 3OF0A 1LPUA 3RPOA 3ID6C 4FIEA 3UVRA 4MWIA 5M4UA 3GCSA 3HMIA 1P14A 1U54B 2WOUA 3QCQA 4G5PA 4GT5A 4RJ8A 2XYNA 5DT4A 5I3OA 3GCUA 5GJDA 3R8PA 3RM7A 1GIJA 4O0UA 2DWBA 3QUDA 3COIA 3PJ1A 4IAAA 4M97A 3DDQA 2EXMA 5F1ZA 4CT1A 5A4TA 3PDTA 1MUOA 4HW7A 5EDQA 3A7GA 4WNPA 4YZ9A 3UTOA 4QQTA 3VUHA 2X4ZA 2O2UA 2YA9A 4MVFA 3ALNA 3CGFA 2BRNA 3BLQA 4FV2A 5EHLA 4UMUA 3BGZA 5DOSA 4ZS4A 3FKOA 1H1WA 2C5XA 4FYNA 2VTQA 3OWKA 1GY3A 3OEFX 3G90X 4Q9ZA 2X2LA 4IWPA 4RX8A 3W2OA 2C5YA 2QURA 2WQOA 5CU0A 3P7AA 5FUTA 4GS6A 3I6WA 2CLXA 2YABA 4QYFA 3FZOA 4YHJA 2OZAB 5KMOA 4DFZE 5L6OA 1JSVA 1OKWA 4H3PA 3R8ZA 3ZZEA 5IEYA 4BTJA 2Y4IB 4GJ2A 3P23A 5CLPA 3DFAA 2Y7JA 2CN8A 2PL0A 5M51A 3HUCA 3F69A 3C9WA 3ORKA 5EQEA 3D7TA 5HX8A 1OZ1A 4AOIA 4BTKA 4P5ZA 5HBJA 4P2KA 5EYDA 4GK2A 2GPHA 3ZSIA 1V1KA 4RC3A 4JR3A 2O64A 3CJFA 3IDBA 5AP4A 5HCZA 4CRSA 4E5AX 2ZOQA 4OTGA 3E7VA 3GUBA 1PXPA 2YCQA 1TQPA 3IDPA 3M2WA 4TYEA 2JIVA 4RGJA 4AWIA 3PJ2A 4USFA 4XG9A 4KKGA 2EUFB 5IQBA 2PVLA 3H3CA 4J7BA 3TNIA 4A4LA 4EOLA 2WTCA 5E8WA 2VNWA 2C4GA 1FPUA 1OIUA 3H9FA 4KKEA 4RJ7A 3HRCA 4IH8A 1W0XC 4L8MA 3P78A 3FMDA 5AM6A 5CI7A 4Q9SA 4I5PA 4E4LA 2YM6A 2YLEA 4FTJA 3FY0A 1M17A 2R3GA 2I40A 4QMNA 4TY1A 5JFWA 1WBWA 2PZYA 2QKWB 3VUMA 3GGFA 4L44A 1YXXA 2UZOA 4FNWA 3QTUA 3OXTA 4XG4A 3E92A 4W8DA 4XNEA 5DRDA 3R83A 1UNHA 2UVYA 3PUPA 4BI2A 1BX6A 3G9NA 3MS9A 3TACA 4EK6A 4ZJIA 2J0MB 3ZLXA 4O83A 2P33A 4HCUA 3NYXA 4CZTA 4IWQA 3CIKA 5KE0A 4IBMA 3BHUA 4MD8E 4UZHA 3KRXA 3NW5A 2UW5A 1KE5A 5HE1A 3B2TA 4A4XA 1RE8A 3MI9A 4EOSA 3POOA 3UQCA 3BGQA 3AD4A 3VHEA 1KSWA 4RJ5A 3B2WA 3BE2A 4IZYA 4QQ5A 5L6WL 3UYTA 2VWZA 2W05A 3OOMA 5TE0A 5B2KA 4FIJA 4TYJA 3PZHA 2HK5A 4TYIA 3GC8A 2C3JA 4HZRA 3P7BA 3MDYA 4TNBA 5HVJA 4ASDA 4KUJA 5LVMA 5C03A 4YLJA 2VWUA 2C0TA 4D2PA 4CXAA 4F64A 3ZSGA 4NM3A 2CGVA 4USEA 3DA6A 5J9ZA 4H1MA 1ZRZA 4AGDA 3FJQE 1OIQA 3HMMA 3KULA 4BKJA 5IISA 5L2SA 4DA5A 5FBNC 4LM5A 4LMNA 2W1DA 2V62A 3HDNA 3UDBA 1WBVA 3OY3A 1WAKA 3MW1A 1WVXA 5CQWA 4BB4A 4B8LA 2YDJA 5I4NA 3LW0A 3FSFA 4YURA 3UG1A 4DTKA 3OWPA 5CZIA 4OGRA 5ANDA 2R64A 3GU7A 1H28A 4I3ZA 4WKQA 4X3FA 4CNHA 3RAHA 3NX8A 1ZWSA 3FZRA 2HYYA 4CZYB 5I5ZA 4S34A 2CNUA 3PA3A 4BFMA 3WF9A 3C4CA 4BN1A 3CE3A 4JVGA 4FSZA 3BU5A 4H3QA 3BV2A 4F08A 3KMMA 5M56A 3BYUA 3NIZA 4FOCA 5CF8A 4C8BA 2B9HA 3MPAA 1KOAA 3UOHA 1WBNA 2ITVA 4LOQA 5BVEA 4D0WA 5GIOE 4FV6A 4FV4A 4XHKB 3BHYA 4NIFA 4EWHA 3LOKA 2CKQA 5FEQA 2HXLA 5K4JA 2X2MA 4O86A 3SOAA 5KZ0A 4C61A 4O0SA 3LKMA 2W4KA 4U3YA 3KL8A 4PNKA 5KO1A 3QXPA 4PP7A 3PLSA 3QA8A 1ZYJA 4FTIA 2VN9A 4ZTLA 3E62A 4BDIA 2REIA 2VZ6A 4RIXA 3RHKA 2KULA 2IN6A 2ZV9A 4O0YA 1FQ1B 3FMJA 4HVDA 3FPMA 3T8OA 1PF8A 4E7WA 4WNMA 4EKLA 4ALUA 1BUHA 3CEKA 2ZDUA 2BVAA 4IVAA 4XV3A 4KKHA 4QNYA 3ERKA 4I6HA 1OB3A 3O51A 4LGDA 3ZU7A 3O8UA 5HOAA 4IB5A 3LMIA 4M14A 3I1AA 3JVSA 1GIIA 4PPAA 4IM3A 4NFMA 4M13A 2QOCA 2YM4A 4ANNA 4FTKA 2CHLA 3DJ5A 4PP9A 5DBXA 4NYEA 4EOJA 4HYIA 4QP1A 1UWJA 4F63A 4Y73A 4GFGA 5CU4A 3TV6A 2R9SA 2XIXA 4C4JA 1ZLTA 4AZVA 1JKLA 3ORPA 4KNBA 4MHAA 4NT4A 5FWKK 3AXWA 5A54A 4K2RA 4N4SA 3FMLA 3MGYA 2B55A 2PVJA 3ORMA 3CKWA 3DOGA 3MIYA 2HZ0A 4QP8A 4R8QA 3TNPC 3CS9A 3RALA 4F1MA 1E1XA 3UZTA 3QTRA 3DTCA 4R7BA 3I4BA 4JDJA 5EG3A 3FC2A 3AT3A 4RZVA 3RBWA 4BCJA 3TUCA 3CR0A 3N51A 4KINA 4IM0A 3DBFA 1YHWA 4G3CA 4O7VA 1OL5A 3VBWA 4YJQA 5AUZA 1H1SA 3ETAA 3FL5A 4O91A 4EL9A 2XA4A 3MFUA 5KMMA 2X7FA 2YITA 2VWYA 1FVTA 1ZMWA 4HGLA 2Q0NA 1TQMA 5BNJA 3GFWA 2VTLA 4BHZA 2YAAA 2CPKE 2GNLA 4EOQA 4BI1A 3FMMA 4ZTRA 3WYXA 2R2PA 2HCKA 4K8AA 5E8SA 3D0EA 2AYPA 4N6YA 1VEBA 4C59A 4RIYB 4DFNA 3RPVA 3H10A 2UW7A 3C5UA 4I0TA 4QYHA 3QHWA 5F9EA 3AOXA 2VWWA 2GQRA 2YISA 1QL6A 3GQIA 3OTUA 4EH2A 5ICPA 4EI4A 4FZDB 4FGRA 4QMZA 4I6BA 4JG6A 4CFMA 3BZ3A 2C69A 2O0UA 3O2MA 2ZM4A 4F0GA 1QPEA 2UW3A 4CFXA 3IK3A 3OROA 1YQJA 3FI4A 3KA0A 3AGLA 5CSXA 5FEDA 5EI2A 3EN5A 4ZZNA 1BL6A 1AD5A 1URCA 2IO6A 4KS7A 4BTMA 1UKIA 4WUAA 5L8JA 4Y72A 2RFEA 3Q9YA 2G9XA 3HAVA 4HGEA 3UVPA 3P7CA 4RWLA 3A2CA 3FZTA 5F4NA 3ZXZA 3FI8A 5HE2A 1Q8WA 4GV1A 2JKMA 4OT5A 4TWCA 1DS5A 3ALOA 4QD6A 4TYGA 4H3BA 1ZOHA 4YZDA 4EHEA 1J7UA 3VN9A 5I9UA 5GIPE 3CQUA 5JZNA 1TVOA 2WMTA 4O82A 3SRVB 3BLRA 4LOOA 4AN9A 4IMYA 3QTQA 5C8KA 4O21A 5E8YA 3V6SA 4WNKA 4Y46A 3KFAA 5IH4A 4GIIA 1GNGA 4M0ZA 3BWJA 2F7EE 5EW8A 4DGOA 3FEGA 2J0KA 3EMGA 4CMOA 2PPQA 4FKSA 4JOAA 4X2JA 3QQLA 3JPVA 4BCNA 1U59A 1Q8TA 3ZFMA 4ZSEA 4IJ9A 5JQ5A 3GNIB 3ET7A 1B38A 4NW6A 3UNKA 3PY3A 3NPCA 2ITQA 2XKDA 3BQCA 4RLLA 4UN0C 2VTOA 5DEYA 5ETAA 4U40A 3QTXA 4QMYA 2YWVA 5C01A 1OECA 3Q32A 2R3QA 1YVJA 2R3FA 3KF7A 5AP2A 3QF9A 4JDKA 4M84A 5HQ0A 5IA2A 3KC3A 4BY9E 1OPLA 4E73A 4FIHA 4DT9A 3ORXA 3EH9A 3TCPA 3OCSA 4BIDA 5BMSA 3OCGA 4AFJA 4EBWA 5KHWA 4IWOA 3PVUA 5DYJA 4BHNA 4YZMA 5AR5A 4UWCA 3V5LA 1JSUA 1JAMA 3HMOA 3QTWA 3RPRA 3UQFA 3ZYAA 2BAQA 3KREA 1Q4LA 5JK3A 1J7IA 4DHFA 2QCSA 3HYHA 3ROYA 4GCJA 5G1XA 5HO8A 4ZS0A 2X7OA 5CU3A 4ZTHA 5HEZA 1UA2A 3KQ7A 1BL7A 4G2FA 2XK4A 3UNJA 3SXFA 5LCJA 4J95A 5L3AA 4YJOA 4FICA 4D2RA 5FBOA 5E9EA 4FL2A 2WMSA 3Q96A 1BLXA 2XKEA 4RBLA 3LCKA 3MBLA 2C1BA 5IMXA 3OHTA 4ZTNA 5DEWA 3UMXA 1IAHA 2E9OA 2FVDA 2WMQA 3NEWA 5HNGA 4E6DA 4Z3VA 4NU1A 3HLLA 5L8LA 2UVZA 3AC1A 4UBAA 1MQBA 3TDWA 2XVDA 4D2TA 4CCBA 5IQFA 1R0PA 1IEPA 3BHVA 2Z8CA 3R02A 2R5TA 4YZNA 2R3JA 3W2SA 2BDJA 3FV8A 2BFYA 3QHRA 4K6ZA 2Y4PA 3FKNA 4DH8A 4ZSAA 3ZUTA 2XNNA 2RF9A 5M53A 2YEXA 5LMKA 5IA3A 4FZFB 2R3OA 3R0TA 4PTCA 3TEIA 2SRCA 4MBLA 4J1RA 4C3FA 1FVRA 3COHA 4DN5A 1GJOA 4C2VA 4AX8A 3Q53A 5CEMA 1O6KA 3U87A 4F6WA 1PJKA 3QTZA 2RSVA 5AUUA 3EQPA 5HBHA 4ZTMA 2GU8A 2BHEA 2C1AA 4FTAA 3I81A 4EKKA 4R78A 2WAJA 4YC8A 3UP7A 3R71A 4M15A 4L3JA 3ZONA 1SVEA 4AZEA 1IA9A 5TR6A 3PXKA 2I0EA 2QHMA 3F82A 4FNYA 4HPTE 4I93A 4L52A 2ITNA 3CP9A 3NS9A 4O7SA 1O6YA 4DEAA 3AC4A 4NH1A 4EHZA 5A4CA 4OW8A 5DT3A 3R7EA 4D5KA 5HTIA 3F5XA 3ZS5A 5DRBA 2VRXA 1PW2A 2X9EA 5D11A 4TNDA 2BZHB 2WFYA 3ZLYA 4J96A 4TPTA 1Z9XA 3CD3A 3G6GA 4LGHA 1OBGA 3O17A 5DR2A 4ZOGA 2BTRA 3RCJA 4ORKA 3WI6A 3Q9WA 1ZXEA 2QI8A 4Z7HA 1BI8A 4O7TA 3TXOA 5TO8A 4ERWA 1QPJA 4RC2A 3G2FA 5ANIA 4C2WA 3B8QA 2YCSA 5GHVA 3FLQA 5AUYA 2A2AA 3D94A 4EZ7A 1PXMA 4FEWA 5FM3A 4WD5A 4ITIA 3GOPA 3O23A 2V7OA 1LEZA 1OIYA 4FK3A 3UIUA 3EN9A 5EOBA 5B2MA 4O1OA 4DGNA 2J5EA 4FTMA 3Q2MA 4C35A 4IADA 1Z57A 2P3GX 3W10A 5BVFA 2EWAA 2R7BA 2Z2WA 1SNXA 4GH2A 1PXJA 2C30A 3AC8A 4NTSA 4BDJA 4WG5A 4DAWA 4D9TA 5M44A 1AQ1A 4GYGA 4RLKA 4YPSA 1FGIA 4XX9A 1HOWA 3DBDA 3TV4A 3V5QA 4RQKA 3NVKI 2W4JA 4O27B 1J91A 2RG5A 3PIZA 3ZO1A 4P7EA 2BHHA 3VUGA 3E87A 4GT3A 4BC6A 4EK8A 4NUSA 1YWNA 3W2CA 2V0DA 2ITOA 3FLSA 4CMUA 4QP7A 3CBLA 4BWPA 2YCFA 1BKXA 4E20A 2ONLA 5AR8A 2XBJA 4UWBA 3V04A 2C6LA 2Z60A 5M4IA 4HVSA 2PUNA 3R1NA 3LJ1A 4O0TA 5CEKA 1OKVA 4RIYA 3FMKA 2NPQA 3GFEA 4FMQA 3HGKA 2BRBA 5K5NA 2PUUA 4J71A 3CJGA 1R3CA 3HECA 4FKLA 2UW4A 3KVWA 2JBPA 1JWHA 3GB2A 3HVCA 5E92A 4OAVB 3R22A 4FEQA 5A3XA 4AG8A 3TTJA 2E9NA 4K18A 4HGTA 3R7GA 3FPQA 3TZ7A 3DNDA 5EDRA 3A62A 3VS7A 2R3NA 3F66A 3AG9A 2I7QA 4OR5A 4RJ4A 4XRJA 3OTVA 3D14A 3QQHA 3R7OA 3PXRA 2QODA 5FTQA 2JLDA 5LWMA 3PA4A 4R1VA 5L6PA 4EZ5A 1PKDA 2X2KA 3Q52A 2YWPA 2VV9A 3R1SA 4KB8A 5HO6A 5IQAA 3DZOA 1K2PA 4GK3A 3SC1A 4E6QA 3RWPA 3JYAA 2AC3A 2P0CA 3ZDUA 4MD9E 4U6RA 3SRVA 4F7NA 3JY9A 2H96A 2W1IA 4RPVA 3BLHA 4WA9A 2OIQA 5EM5A 1Y8YA 4YP8A 4M69A 5IDPA 3UC3A 3FZSA 3PJCA 4FTNA 4IXPA 4UALA 2B54A 1MQ4A 1NT2A 3FC1X 3QA0A 2PE2A 3IS5A 3DJ6A 4OT6A 2A0CX 5K9IA 1GIHA 1IASA 2UZLA 3Q6UA 4FBXA 2WXVA 3OBGA 3C13A 4H39A 5J7HA 4NFNA 2X6DA 3R21A 2CCHA 2BAJA 3BEGA 3GU4A 2QOFA 4U42A 5IDNA 5JRQA 3BV3A 4X3FC 2UW9A 5M55A 4C4FA 3WF8A 2YHVA 1P4FA 2UZBA 1NVSA 3HA8A 2PVRA 3DKOA 3FAAA 3RKBA 2PWLA 5FEEA 4BDCA 1QPCA 3VRYA 3BRBA 4RVTA 3H0ZA 4FOBA 4CV9A 4NM7A 5IEXA 4MQ1A 2H8HA 1U5QA 3DTWA 3QX2A 4FIFA 4JJRA 4L3LA 4FYOA 1YWRA 3P0MA 3MH3A 3SXSA 4DG2E 3C5IA 4I24A 2VTNA 4ZZOA 4PDYA 2W96B 5H8EA 1W84A 4EHGA 5E7RA 4QYEA 1O9UA 4O7RA 2WMVA 1APME 3Q60A 4PTEA 3UGCA 4DEIA 5A6NA 1CDKA 1M7NA 5AP6A 4DLIA 5CALA 5IUHA 5M4FA 4GSBA 4NM0A 4WHZA 4QMTA 4UYAA 5CT0A 5JKGA 4AXAA 3AT4A 4HJOA 4U5JA 5AX9A 5KHXA 3BELA 2QOKA 4XV1A 4FA2A 1P4OA 4LQMA 4O7YA 3DAJA 3HMPA 4EK5A 2PMIA 3D7ZA 2WHBA 4Q5EA 5LOHA 2UVXA 4FT0A 3AC2A 4N57A 4FG8A 1J1CA 3P79A 3ORIA 3ZO3A 1Y57A 4I94A 3R9OA 4FVPA 5IA5A 4XP3A 2PZPA 2JKKA 5CASA 1ZY4A 4EOKA 3C4FA 2C6TA 3D2IA 3QCSA 4Z16A 1Y6BA 3TIZA 5KKRC 1CSNA 4AS0A 4Z7GA 4RMZA 5D12A 3RZFA 3ZUUA 4G6OA 2VO0A 4CVAA 2F57A 3A8WA 2UZNA 2VGPA 2OG8A 2HW6A 4U44A 2GQGA 4W9WA 5CEIA 3L9NA 4W4XA 3DK3A 5AV3A 3R7YA 3SVVA 5FG8A 4KA3A 4MXZA 3UBDA 3OW4A 2VX0A 2OXXA 3LCTA 5KMJA 4NKAA 4Y5HA 4MBJA 3EQIA 2CMWA 5GZ9A 5LWNA 2WU7A 2V55A 3MH0A 4LMUA 4FODA 4AN3A 3ORZA 2XK9A 4S32A 4AZTA 2WOTA 4DITA 3LFSA 5CQUA 5FDPA 3R1YA 4K1BA 3O0GA 4FVRA 5FXSA 3DB6A 3RCDA 3TIYA 5AM7A 3PXYA 3QRKA 5DG5A 3OT3A 2ZV7A 4E93A 5LARA 4F6UA 5AV4A 5ITAA 3KXHA 2IZUA 1YI4A 2LGCA 3FXZA 3SW4A 5J9YA 5KMNA 5I0BA 3G6HA 4KIPA 2BTSA 3LFQA 2XNMA 3MY1A 1OL1A 3TJCA 2GNGA 5FRIA 4BDGA 4BKZA 2YM5A 5AADA 1JBPE 3VIDA 4JX3A 1YHSA 4RVMA 4BCHA 3DY7A 3MJ2A 2ZAZA 4FV5A 3DKGA 2I6LA 3QCXA 3FSKA 4I5HA 4YJTA 3SDJA 4RVKA 3LFNA 1W7HA 4ITJA 1OUKA 2WMUA 3D15A 4BDBA 3WE4A 2W5HA 5CSWA 3LXKA 4GW8A 2ITXA 4XUFA 3QYZA 3BHTA 4CKRA 1DI8A 4FTRA 2R0IA 3H9RA 4FKVA 4AGWA 3F6XA 5GZ8A 3R9RA 3QQKA 2G2HA 4Y95A 4JL9A 1YDTE 3FLWA 3VW6A 3K3JA 4M68A 3HRFA 4DGGA 3E3BX 3PYYA 5CI6A 5EW9A 3D83A 5JSMA 4FL1A 3EIDA 3TT0A 3FYKX 4I6QA 4RIWA 5AA8A 1Q3DA 3QX4A 4O81A 5HIBA 4BIEA 1JVPP 2YCRA 4AA4A 2WEVA 1QCFA 1G8SA 3COKA 3F61A 2OXDA 4FR4A 2NRYA 4HCVA 3ORLA 4JLCA 2DYLA 2R3PA 4BWKA 2IW9A 4FV3A 2VWIA 3KMWA 4YNEA 4GG5A 4ALVA 5IQIA 3FYJX 5F20A 2J6MA 3TKIA 3E5AA 1ZYCA 4EK3A 3DZQA 5M06A 4HYSA 4PNIA 4KIKB 4BBMA 3L1SA 4CTCA 3EQDA 2WTVA 1XBBA 2YIWA 4TWOA 5EDPA 5DT0A 2OWBA 2G01A 1MRUA 3LFBA 1H00A 2CJMA 3PY0A 2ZV8A 5E90A 3VUIA 5DE2A 2CLQA 4LRJA 3UE4A 3WIKA 4RZWA 2VAGA 3D5WA 1WBOA 4ZTQA 4JNWA 1BI7A 5K0XA 3EQCA 5E91A 5KBRA 2IVSA 4YTFA 3FXWA 3UQGA 2C6MA 1OKYA 3MB6A 3G33A 3NNXA 3OEZA 1U46A 3OCTA 3EJ1A 2GTNA 1UNGA 4GVJA 2C68A 3RP9A 5CAPA 2JDOA 3VS4A 1YHVA 2HY0A 2WNTA 1PY5A 3AD6A 3UODA 5CAQA 3UIMA 4GKIA 5FTOA 3MH2A 4YHTA 2ACXA 4FKUA 4PMPA 4I6FA 3UPZA 4RSSA 3OC1A 4D58A 3KXZA 2OW3A 3CQWA 3M1SA 2VTTA 4RA5A 5AV0A 4MK0A 3BYVA 1WBPA 3RK7A 4LRKA 4F9CA 3DV3A 3EQRA 1Q62A 3CPCA 4WSQA 2CGWA 4J8NA 3MY0A 2JBOA 3O50A 4I22A 4XJ0A 1OIRA 5DR6A 3JY0A 5H8GA 3WZDA 4BKYA 5BVOA 4IM2A 5IMEA 2YACA 1KE9A 2VTAA 3W55A 3TJDA 3CC6A 1OBDA 4U80A 5LVPA 3LJ0A 3NW7A 4E8AA 4L45A 2WTDA 2BDFA 4CV8A 4FSTA 4RWIA 5BYZA 4C34A 2ITPA 3DBQA 4FV0A 2UZDA 3ZXTA 4C02A 3QD2B 5CS6A 2H9VA 4AGUA 5IQDA 1TQIA 2HZIA 4RIOA 2VO6A 2QOHA 3C50A 1DAYA 3ZO4A 4DC2A 3C0HA 2YJRA 3FZPA 4YR8A 3LCSA 2OFVA 4EBVA 5J5TA 2Y8OA 3CTQA 3WARA 4ANQA 3FLNC 3V3VA 4E6AA 3KB7A 3QD0A 4F1OA 5IU2A 4J97A 4J98A 2FA2A 2F2CB 1WCCA 5DR9A 4CQGA 4QMWA 3EFLA 4PTGA 4W8EA 2RFSA 3CKXA 4QTCA 4ENXA 4MWHA 5J95A 3VS2A 5LMKC 2YFXA 4FTLA 4Q5HA 1RDQE 3ORNA 2JIUA 2R3LA 4JBVA 4Y85A 5CNNA 3U8WA 3QCYA 4AW5A 3E7OA 4J99A 1ZAOA 4IW0A 2ZB1A 2OK1A 5K3YA 2W1ZA 4EH7A 3THBA 3QZHA 4PL5A 2BUJA 2VWVA 4I23A 3SHEA 4YJSA 4ZLZA 5AUTA 1J1BA 5A14A 4JRVA 4NL0A 3ENMA 4HPUE 1YI6A 5H3QA 3SX9A 1PXLA 4D1SA 4AGCA 4ZZMA 1PMVA 4BYIA 4EH4A 3DK6A 4DG0E 3TNHA 1OPKA 3DS6A 2P4IA 2ZB0A 2OJIA 5ACKA 2GFSA 4C57A 4EEVA 4EOMA 5I3RA 4RWJA 1V0BA 3QALE 4BZNA 4QMXA 3NUNA 5HI2A 5CAVA 2E2BA 4WSYA 5HG7A 2X81A 3ZHPC 3OXIA 5IEVA 4MQ2A 4CFUA 4FKOA 2WEIA 4FV7A 3Q9ZA 3UIBA 5EHOA 4PY1A 2J4ZA 4OAUC 2R7IA 2C6IA 4MD7E 4U43A 4DBXA 3DXNA 4CFVA 4G6LA 2NO3A 2ETMA 4FZ6A 4HVGA 3W2PA 3V5WA 3VO3A 3ZM4A 4I20A 4IAYA 4I41A 3JXWA 4ZK5A 5IA0A 2HAKA 4GRBA 4DFYA 2OJ9A 1Q8YA 1R1WA 5LJJA 1IA8A 3TUBA 1REKA 1YDSE 1ZYLA 2HXQA 3QUPA 1Q24A 2OGVA 2IZSA 3QRUA 3FUPA 3QUEA 4XP2A 5AR3A 5HCYA 4HYUA 3UOKA 5IH6A 5J1WA 2OO8X 4NCTA 4X2FA 4EH3A 2F49A 1KOBA 4MF0A 2F7ZE 1U54A 4IZ5A 3UYSA 4AT3A 3QRTA 3F2AA 2PTKA 1JOWB 2QR7A 3SA0A 3AMAA 5BVKA 2I1MA 4UX9A 3ZEPA 3FWQA 3IGGA 3QRIA 3VNTA 3Q04A 4D4RA 4F9BA 1VYWA 4ARKA 2E9VA 3BKBA 5FM2A 3BCEA 2QQ7A 5DA3A 3F5GA 3S0OA 3HMNA 4EH9A 3P08A 4B4LA 4FKIA 3KGAA 2OICA 2IZTA 3ODZX 2IVTA 1XR1A 2WTIA 2R3HA 4R3PA 4O38A 5GJFA 4HVIA 2ONLC 3RAWA 3C4EA 5KZIA 4ZP5A 1YOJA 2FYSA 4AW1A 4C58A 1SM2A 1VYZA 4OLIA 4KD1A 2XB7A 4ASXA 4IC8A 2OZAA 3ZH8A 2O8YA 4BIBA 5JFVA 3W2RA 4AW0A 4FKTA 4OBPA 3OXZA 1VJYA 3PWDA 2OBJA 3GCPA 3R8LA 1PXIA 2FSLX 3PPKA 4IDTA 5ANJA 1CTPE 3Q3BA 5ETFA 1JLUE 3WZKA 5DIAA 2ITWA 2W1FA 2XK3A 4PL4A 5EKOA 2J50A 4MNEB 2B4SB 3FXXA 5ETCA 4R5YA 1WVYA 4FUYA 2GS6A 2CKOA 3PE2A 4G9RA 4ZY5A 3NUPA 4TL0A 3F5PA 2QLQA 5HHWA 3PG1A 5BYYA 5EM6A 4GK4A 3IW7A 2RL5A 3D2KA 3DBEA 1Y6AA 3TN8A 3U4UA 3V8SA 3KY2A 4OTFA 4MXXA 2C47A 2OKRA 4A06A 1URWA 4PMMA 4G1WA 5AWMA 3ZM9A 2V5QA 3AT2A 4ZTSA 1CKIA 3VBYA 5AR2A 4ZAUA 5IG1A 3VUKA 4RFYA 3NLBA 2XNEA 3MTFA 2QLUA 5CY3A 4EH8A 5IA4A 2QHNA 3D4QA 3UP2A 2JDRA 2Z7QA 3ZLSA 2J0JA 2YIRA 4TYHB 3WBLA 5HORA 4X0MA 4PPBA 5L2WA 1ZMVA 5C4LA 3K54A 4MXAA 4V01A 5HLPA 3V8WA 4C4HA 3E8EA 4O7ZA 3PY1A 3N4TA 1M2PA 1UKHA 2I0HA 3I6UA 5CTPA 4EJ7A 4XOYA 4FE2A 4GFOA 4L3PA 4FEVA 3I0OA 2XK7A 4FSRA 3F5UA 3E3PA 4FTOA 5TKDA 5AAEA 4AF3A 3BU6A 3NUUA 1CKPA 3FI3A 4FKWA 4NKSA 5JGDA 2W17A 3IECA 2I0YA 4FNXA 5LVOA 3QQJA 5IQEA 4GU6A 4M12A 4NK9A 4FSMA 4U7ZA 1RJBA 1L8TA 3MVMA 1YXTA 4JG7A 4JR7A 4BWXA 4GKHA 3HV5A 2C3KA 3KXNA 4C4GA 2ETKA 4CKJA 2C0OA 4IAFA 1H1PA 3BX5A 4JDHA 3D5VA 4D2WA 3F2NA 4F6SA 3NVMB 3LXNA 4QTAA 2R3MA 3RK5A 5HZNA 3F88A 3R9NA 3OOGA 2ZM1A 4LFIA 4XG3A 2Z7SA 5HVYA 3ZUVA 4YMJA 5DFPA 2O3PA 3FQHA 1OI9A 4FKPA 5A4QA 4LL5A 4QP9A 5JZJA 3TI1A 3U6JA 4X2NA 3IPHA 5D41A 5E1EA 4JAIA 4C3RA 5KBQA 2FSTX 3MB7A 3FMHA 3MJ1A 3NZ0A 3HP2A 3D5XA 2Z02A 1J7LA 3QWKA 1B39A 3K3IA 2XF0A 3A7JA 3AC5A 3W1FA 5FP5A 2PZIA 1PMUA 3S00A 5CEPA 1MRVA 5BPYA 4BDFA 3DBCA 4YZCA 2R3IA 3R00A 3A60A 4QP4A 2GDOA 4PMSA 1FMOE 2QOOA 4W9XA 5EQYA 2YDKA 3O8PA 4IJPA 4BCOA 3P86A 2CGUA 4CT2A 3VS1A 4QPMA 4BGGA 2F2UA 4F09A 2HWOA 5J87A 3ZCLA 4FUXA 2QVSE 3TKHA 2QO2A 3EYHA 4AACA 1XH9A 1H08A 4L7FA 4CZUA 5CANA 4I5MA 4EYJA 3U9CA 3VRZA 3EQBA 3K2LA 3OWLA 3BWFA 3NUYA 4AUAA 5DH3A 3ANQA 4BCKA 3G15A 3POZA 4L43A 3RTPA 4F1TA 4GIHA 2C5NA 5AIRA 3DDPA 3FMNA 1ZYSA 2FO0A 3C1XA 3VVHA 5AV1A 5EH0A 2H6DA 4IHPA 1KE7A 2IW8A 3IO7A 3C0GA 3TWJA 2YIYA 5DHJA 5E1SA 4L68A 4WUNA 5C26A 5CAOA 3U55A 1W83A 5JFSA 4V0GB 1H0VA 3LFFA 3MTLA 4CFFA 2W1HA 2J0IA 2XP2A 2OXYA 3RAIA 4BDEA 5GJGA 3GOKA 3NIEA 4GFMA 3UOLA 4O2ZA 3Q6WA 5HICA 1TKIA 4BRXA 1KV2A 1ND4A 2EXCX 2VTPA 2WTWA 3E8NA 4JBOA 1QPDA 4D28A 2B9FA 3DNEA 4FG7A 1XJDA 3QD3A 4QYGA 4AZWA 3PXFA 2PZ5A 1W98A 3IQ7A 3PP0A 4YJUA 4NJDA 2VNYA 1F5QA 4ZLOA 4I0SA 2GMXA 2CCIA 2JDVA 5CU2A 3R8MA 1H01A 5EM7A 2YJSA 4X2KA 2W06A 2XCHA 3Q5IA 4PDPA 3NRMA 4C3PA 4AZSA 4CQEA 4U0IA 4CSVA 2BDWA 5HTBA 3JS2A 4B7TA 4IE9A 1H27A 4JX7A 5HGIA 5FGKA 2XIYA 5CVGA 4QMOA 5C4KA 2EVAA 2OI4X 5D9HA 4QTEA 4O7LA 1FMKA 3LPBA 4P4CA 3WIGA 2XEZA 1PXNA 4JQ8A 2XRWA 3KN6A 5T3QA 5DGZA 4OBOA 4EWQA 4LV5A 5E8VA 3KK8A 1XH8A 4I0RA 1JSTA 1U5RA 2Z7RA 1V0OA 4L00A 2RFNA 4Z9LA 4JG8A 3NUAA 2PUPA 5A9UA 2PVHA 5CF4A 5J1VA 4MX9A 2PU8A 3ZBFA 1ZOGA 5K5XA 2J9MA 3Q4UA 2F7XE 3HV3A 5DI1A 5K0KA 5LMAA 1JQHA 3W2QA 4ASEA 3DXQA 4IB3A 4PMTA 3LQ8A 4L67A 4IZAA 3VS6A 2W9FB 1BMKA 2P55A 3QQFA 3S2PA 1H8FA 1MRYA 5IH5A 1ATPE 5AFVA 1F0QA 3UC4A 3C4ZA 3EWHA 2B9IA 3Q5ZA 4G3GA 4U41A 5JRSA 1YXSA 3K5UA 2XBAA 2XH5A 4IEBA 3TDVA 3EFKA 3QL8A 4YSMA 3MFSA 4MXYA 2YIQA 3D7TB 2WKMA 3G9LX 4IIRA 3ENHA 3AMYA 3R73A 4PF4A 4RX5A 4EH5A 4LUDA 1OL2A 2QG7A 1DAWA 1F3MC 5CF5A 2WMWA 3DQXA 2YM3A 3R1QA 3NYVA 3W32A 4FKGA 4JBPA 5HE0A 3D5UA 2WQEA 3VS0A 4XLVA 2DUVA 2OJFE 4UEUA 4UMTA 5ANEA 3DPKA 4U45A 5E8UA 2A1AB 5KMKA 4CLIA 4DFUA 1GZNA 2QOBA 3O96A 2HW7A 4QP6A 3NGAA 3U4WA 3AGMA 4FK6A 3QBNA 3JUHA 2FUMA 3VF8A 3P9JA 3PVWA 1LUFA 2FGIA 4C7TA 1OMWA 4A9SA 4BZOA 4DTAA 5CU6A 5A4EA 3MPMA 3LFAA 3TNQB 1KWPA 4XRLA 3EHAA 3VC4A 2E9UA 3U54A 2WMBA 1PHKA 4EQMA 1XKKA 4F65A 3LCDA 3H30A 3NCZA 5HIDA 2CSNA 5JFXA 4KSQA 4FG9A 4M67A 3GP0A 5M4CA 1XBCA 4BYJA 3WF6A 4UMPA 4CTBA 5AR7A 4O2PA 3VAPA 4TYHA 2I0VA 1Q3WA 3CTHA 4V04A 5G6VA 3EL7A 1HCKA 4Y83A 3GEQA 4EORA 5AA9A 2CGXA 1FINA 4TW9A 1UV5A 4MF1A 2J0LA 4YPDA 4C38A 1DM2A 3QQGA 4G3EA 4ZXTA 4FL3A 3RI1A 1OL7A 4BZDA 4F9AA 3OBJA 3BYOA 5FQDC 4P90A 3MIAA 2G2FA 2XIRA 2Y6OA 4F70A 4I4FA 3RZBA 3GT8A 4JQ7A 3NMUF 2W99B 4IAKA 4KBKA 5ANGA 5HG8A 2IG7A 2RFDA 3MVLA 3HRBA 1LP4A 4YNOA 4HYHA 3I5ZA 4CFNA 4JRNA 1HCLA 2YLFA 3EB0A 4R3CA 4U8ZA 3RNYA 3KULB 4A9UA 4C4EA 4Y8DA 4DH7A 3MESA 3CSVA 5ANKA 5FD2A 2UW0A 3SGCA 4YU2A 4YZBA 4BGQA 2C6KA 4OTIA 3CY2A 3F3TA 4N0SA 4IX6A 3RPYA 2B52A 2FSOX 2QC6A 4NZWB 5BUIA 3QYWA 2BZIB 4IDVA 2ITZA 4FV8A 4UB7A 5IF1A 4X3FB 1UU9A 5JQ8A 2HWPA 3UVQA 4TWPA 3ATSA 4C4IA 3PXQA 4DYMA 2HOGA 4L01A 2JDTA 3KF4A 3P4KA 4AZFA 2C3LA 3HL7A 3I7BA 1OGUA 4AT5A 4O0WA 4WBBB 3ORTA 3C51A 4FNZA 3OUNB 3PJ8A 4I92A 3UJGA 5HU3A 1PRYA 3KCFA 1UU7A 4RFMA 3ZC5A 4ANLA 2XM8A 2J90A 3DAKA 2WTKC 3LXLA 3VJOA 4U3ZA 3QQUA 5FDXA 2XMYA 1XWSA 4YLLA 3BHHA 4A07A 2XS0A 2YAKA 5BX0A 1NVQA 2P2HA 1A9UA 2DS1A 1M14A 4WO5A 2XUUA 3T3UA 4ITHA 4U79A 4RJ6A 4S31A 5DLSA 3QTSA 4NIFB 5HD7A 5IUGA 4IVBA 4DF3A 2B53A 5KMIA 3KRRA 3LE6A 4D4YA 2CNQA 4JI9A 2G2IA 4MCVA 4ZMEA 5CX9A 3GCVA 3VHKA 3BYMA 4DFBA 1OL6A 4EH6A 3A7IA 4ANOA 4IX4A 4RIXB 5LVLA 2PUIA 2ZDTA 5EYCA 5BYLA 2GS7A 1H4LA 3V01A 4K9YA 3U6HA 4F99A 2ITYA 2WMAA 4GVAA 4JT3A 4BDHA 3ATTA 1YWVA 2XNBA 2AC5A 4XH6A 1SYKA 5IA1A 4X3JA 1EH4A 2XK8A 4YC3A 4GUBA 4NCTC 4DINA 2OLCA 3SQQA 2JAMA 4G9CA 1G5SA 2B7AA 2RG6A 1KE8A 2GSFA 2XJ2A 3FE3A 4PV0A 4S2ZA 5TF9A 3ZRLA 5KKRB 4YJNA 3WF5A 3V51A 4NSTA 4D4SA 4O7NA 4CRLA 1GAGA 4QMLA 2UZTA 3EKNA 4D5HA 3EZVA 5CSVA 4OTWA 3WF7A 4F0FA 5K4IA 5CENA 2BMCA 5KX8A 3Q4TA 3NUXA 2VO7A 4FSUA 1H0WA 3LM5A 3T9IA 2X9FA 5CT7A 4BTFA 3PTGA 4DG3E 4MKCA 2HIWA 3KKVA 4GL9A 4XBUA 4MXCA 4ACHA 2VTRA 4H05A 3T9TA 2IZRA 2WQNA 3P1AA 3H0YA 4IVCA 2C6OA 4O0RA 4UV0A 3ULIA 5BVDA 2A19B 4XG7A 2EB2A 1IG1A 3G51A 1LR4A 3OY1A 4QPAA 5AJQA 1I09A 2OJGA 2BRGA 3FLZA 4XG2A 2F4JA 3WZEA 4GYIA 1NA7A 4ZY6A 2OU7A 3QGYA 4FSYA 4TRLA 1G8AA 3IOPA 5HG5A 5HD4A 5J9LA 5CF6A 1Y8GA 4EC8A 3RNIA 4PWNA 5L4QA 3NNWA 3HV4A 3KVXA 3ZRMA 3A61A 4FSQA 2Y4IC 2ZM3A 3QU0A 5D7AA 5HO7A 3ITZA 2WB8A 5KCVA 2OH0E 2IVUA 3EQGA 3LMGA 4DH1A 3MVJA 2BPMA 2ZVAA 2ITUA 4O6EA 5BQ0A 2WU6A 2PYWA 3PG3A 4OTDA 2PVMA 4XV2A 4FIIA 2R0UA 1M52A 4RX7A 1UWHA 4APCA 4UMRA 3BI6A 5JEBA 2WD1A 2A27A 4ZIMA 3L8SA 3IONA 1GZKA 4R5SA 4TKSA 1R0EA 2AUHA 4B0GA 3QZFA 1IRKA 5CVFA 5E8TA 5J79A 3IW4A 5IZFA 1QMZA 4XP0A 5AR4A 5H2UA 4FX3A 2O63A 4ZSJA 4CGAA 5ETIA 4IACA 3CLYA 2E9PA 4X6RA 3KXXA 4BCMA 3NYOA 4K0YA 3N4UA 4L7SA 3GC9A 3DT1A 4FSWA 3VQUA 1H07A 4FC0A 4E4MA 2YZLA 3ZTXA 1JKKA 4ANBA 5A4LA 1S9IA 1AGWA 1UU3A 5CXZA 2X8EA 4AP7A 4ZSLA 4W4YA 4AA0A 3C4XA 2C0IA 5IUIA 3TG1A 4JS8A 5I9YA 3CY3A 3DU8A 4FSNA 5CXHA 2Y6MA 3KXMA 5CYIA 5T68A 3ZO2A 1JNKA 3UNZA 1KV1A 1E9HA 1O6LA 3EOCA 4R7IA 4AE9A 5AP1A 4ENYA 2Y0AA 4EK4A 4F0IA 3KXGA 1CKJA 2IVVA 5I9VA 2QOQA 3FDNA 2GS2A 4CG8A 2OH4A 4A9RA 4HCTA 1IAJA 1M2QA 3G5DA 2ERKA 2QKRA 4UZDA 3VS5A 4ACMA 4HVHA 3GU5A 5HNIX 4KRCA 1NY3A 4FTUA 3DJ7A 3RHXA 5H9BA 3PRFA 4J8MA 4BCQA 3IGOA 3E8CA 1PXKA 3A8XA 3NCGA 2JKOA 3PSDA 4D1XA 2Q0BA 3DGKA 3OW3A 3G0EA 3R2YA 4UY9A 3QZGA 5HIEA 3QC9A 3BU3A 4YC6A 2X4FA 3BQRA 4KSPA 3L8XA 3E8DA 3F3UA 3QAME 3UG2A 2PVKA 5AAGA 3DCVA 2BIYA 2BALA 4TZRA 4E26A 4QP3A 4MH7A 4LOPA 1Q8ZA 4H1JA 4IVDA 1Q5KA 1WVWA 3GU6A 4LYNA 4QQCA 2GHLA 4NEUA 4ZJVA 1SVHA 5EI8A 5JGAA 3FI2A 4ANSA 3LVPA 4YGAA 5CZHA 3R7IA 3FLYA 1Q99A 4X2GA 3R8VA 3VWAA 4YSJA 5LXMA 1M7QA 2J7TA 3ZLWA 2CNVA 3PRIA 2ZMCA 3LFEA 4XYFA 3HAMA 5AEPA 4X7QA 5CEQA 3SOCA 3RM6A 3U6IA 1K9AA 3UO6A 1SMHA 4IFGA 4H36A 4I21A 2XK6A 2QOLA 3LXPA 4A4OA 4EHVA 1BYGA 2HY81 2PSQA 2C3IB 4L9IA 2V22A 4ZEGA 5LMBA 3NDMA 1GOLA 2FB8A 2X8DA 3FZ1A 3NR9A 3TZMA 5E8XA 4FGBA 3VBTA 2WQMA 3G0FA 2XNPA 4LV8A 2VWBA 3COMA 4Q2AA 1Z5MA 4FKQA 3UZRA 1GZOA 1PXOA 3A7FA 2UZVA 3NUSA 4YTCA 4AQCA 2BAKA 1KE6A 4E4XA 4MBIA 5HNBA 5EI6A 3RK9A 3SXRA 1H24A 4FZ7A 5C1QB 2VTHA 3KRJA 2QOIA 4H58A 4NJ3A 3N4VA 2WMXA 4QRCA 4DE4A 1ZARA 4DLJA 2JFLA 3QKKA 4V05A 1PMNA 2JEDA 4IFCA 4O0VA 5HLNA 4QMQA 1W82A 5CSPA 3WOWA 5HLWA 3DLSA 3O71A 4BCFA 3BE9A 5AAFA 2R4BA 1Q97A 2FH9A 1YKRA 4JIAA 1E1VA 3LZBA 3GC7A 4F9YA 4BL1A 3W16A 5GINE 4WOVA 4D2VA 1P5EA 5TT7A 4EC9A 4JDIA 2GNFA 5T6KA 1OKZA 3IW8A 2IPXA 1Q8UA 3WZJA 3QD4A 5JT2A 4LI5A 2C6EA 3GCQA 3E88A 1FBNA 1H1RA 4QNAA 2VTJA 5KNJA 4HGSA 3OT8A 5EW3A 3HV6A 2WQBA 4L46A 5IQCA 5L2QA 4G6NA 4O1PA 2BIKB 3F2RA 4YTHA 2PZRA 3KRWA 3HX4A 1A06A 1B6CB 3T3VA 4BCPA 1NW1A 3Q2JA 2BFXA 2KTYA 3R04A 3WYYA 4RT7A 1MP8A 3KEXA 3BBWA 3DK7A 4U97A 4DFXE 4O7WA 5LQFA 3LCOA 3S4QA 4EUUA 3E64A 5D1JA 3NAXA 3TNWA 5JN2A 3OMVA 4I5CA 3MA6A 5HE3A 2WGJA 3EN7A 4M0YA 4C36A 4WIHA 5EQPA 3FKLA 4FT5A 3JVRA 3HNGA 4MTAA 4AW2A 3HA6A 3L8VA 2BR1A 4YJRA 1ZZLA 3SD0A 4CCUA 5DN3A 4ASZA 3F3ZA 3L9PA 3ODYX 4BDAA 2YM7A 3O8TA 3R2BA 4PPCA 5B7VA 2FSMX 3QTIA 4HNIA 5L8KA 4J52A 3UMWA 4QMPA 1PKGA 4S30A 5DVRA 4FTCA 2QR8A 4ALWA 5AIKA 4HZSA 1XH5A 4FTQA 4XBRA 2VUWA 3Q9XA 2WMRA 3RMFA 3SAYA 3VS3A 4E4NA 2W9ZB 3F3VA 4IWDA 1WBSA 3PVGA 4D55A 3CCNA 2G15A 2JGZA 4F7JA 4FEXA 1R39A 3LAUA 3RVGA 3OFMA 3IDCA 4R1YA 1WMKA 5KUPA 3F7ZA 3LJ2A 2QU6A 1OITA 5A6OA 2O5KA 2OFUA 3R30A 3CPBA 1PYEA 3OUKA 3FY2A 4FT9A 4EQCA 3DQWA 4O96A 1YOLA 1PMEA 4PX6A 4RJ3A 1R78A 3O7LB 5EOLA 3UO4A 3QLGA 3R6XA 4QMMA 3WILA 2JFMA 2VGOA 4WT6A 1JKTA 2PMNX 3MYGA 3EKKA 2X8IA 3LIJA 3DKCA 4G3FA 4MXOA 3TKUA 3PWYA 4CG9A 3LQ5A 2UW6A 3NAYA 2C6DA 4FKRA 1H1QA 1VR2A 1YRPA 3L9MA 3PLAE 5I9ZA 3EQFA 2JC6A 1XH6A 3EN4A 4W4VA 3RAKA 3KN5A
chains in the Genus database with same CATH superfamily
3BYSA 3PP1A 4IB0A 2UZWE 2XM9A 2VTMA 4KABA 4LGGA 2WELA 2C5OA 3BIZA 4RG0A 5HKMA 3TTIA 5KMLA 3MSSA 3HV7A 1I44A 3A7HA 3PPJA 4L6QA 2GQSA 2X7GA 3IG7A 2HELA 2Z7LA 2QONA 2BZJA 4GMYA 3S3IA 1ZY5A 3I7CA 2YERA 2CN5A 3ZFYA 4C33A 1UU8A 1YDRE 4RRVA 5AX3A 3Q4ZA 4ZJJA 5DMZA 5CWZA 1CM8A 2W5BA 3Q4CA 3QGWA 5HBEA 4PUZA 3V5PA 4F4PA 2RGPA 3PSCA 4S33A 3LQ3A 4M8TA 3S1HA 4WG4A 4D0XA 4DEBA 2ETRA 1P2AA 4KIKA 4DEDA 1YW2A 2BKZA 3E93A 3SLSA 1RQQA 3W33A 3TL8A 2QD9A 1ZYDA 3UPXA 3DFCB 4O0XA 5HG9A 5EKNA 2NNWB 3SG9A 4G31A 4YBJA 4YJPA 3TZ9A 4EOPA 5JMSA 4LG4A 2B1PA 4E1ZA 3ZOSA 4MNFA 3QXOA 5I9XA 3C7QA 3I0QA 2JITA 2XARA 5BUEA 3QFVA 2BCJA 2V7AA 2C5VA 4IB1A 4MAOA 5HU9A 1WZYA 3LLTA 1YI3A 1ERKA 3MY5A 2QG5A 2ITTA 5B2LA 1A48A 5AP5A 4DGMA 4EUTA 2PHKA 5BVNA 3VBQA 4FTTA 5EYMA 1VZOA 4GEOA 3VF9A 5CEOA 2QO9A 4M69B 3VBXA 5C9CA 3ACJA 3PJ3A 3GBZA 4XOZA 5B0XA 3R9HA 3REPA 5FLFA 3V8TA 2XIKA 4PQNA 4F7LA 4O6LA 4XG6A 3F3WA 4A7CA 4WG3A 4YBKA 4A9YA 2OF2A 1YXUA 1TFFA 3KRLA 5M07A 4CD0A 5FTGA 4QOXA 3QC4A 2EXEA 4ID7A 1ST4A 3MH1A 5JH6A 3K5VA 3ACKA 4I4EA 1H25A 4IAIA 3U51A 4JIKA 2J2IB 3BBTB 3C0IA 4PDOA 5J7BA 3PSBA 4BCIA 4TTHB 4RX9A 5EM8A 4O22A 5IKWA 5A46A 3R28A 3QRJA 4KBCA 4FV9A 4IC7A 3HDMA 4M3QA 2ERZE 2X6EA 2UZEA 5EFQA 4UWYA 5C27A 5BUJA 5M57A 4KIQA 4TT7A 4KIOA 1S9JA 2WIHA 4B6LA 3HKOA 5AMNA 3OP5A 4C62A 3ULZA 5FXRA 3R7VA 3ZMMA 4GG7A 3MVHA 2BKKA 1ZMUA 3SW7A 3OS3A 4XS2A 5F94A 3R7UA 1GZ8A 5I9WA 1UVRA 4E6CA 4X21A 4AU8A 3D9VA 1PYXA 4MYGA 3O5AA 5F95A 4UYNA 4KWPA 4DBNA 3LFDA 2WPAA 4KBAA 2JKQA 3LHJA 3S95A 4DH3A 3DXPA 4ACCA 4UXQA 5TOZA 3UDTA 2QO7A 2BILB 2ZYBA 3QKMA 4DEGA 1DI9A 1XBAA 2HENA 4ANMA 4R6VA 3TV7A 2PVFA 4Y5QA 3MPTA 4UXLA 3RWQA 1IR3A 3FQSA 4ZLYA 2W1GA 3LFCA 1K3AA 2JD5A 2WZJA 3R63A 4BCGA 4EJNA 2VTSA 4B99A 3L8PA 2BRMA 3H9OA 3KMUA 3ZFXA 1ZOEA 4M7IA 4G5JA 4BF2A 4KRDA 5L2TA 4YO6A 3MN3A 5CAUA 2P2IA 2X39A 3QLFA 4L53A 1Q41A 1XH7A 3FHRA 3MV5A 3BPRA 3OZ6A 3OVVA 4QYYA 4EOIA 2OF4A 2O65A 2UV2A 2NP8A 2ZJWA 2W0JA 5EHYA 3VBVA 1OUYA 3WE8A 2ZMDA 3PPZA 4DFLA 4PDSA 4PRJA 4EYMA 4ONAA 5HCXA 3UOJA 4ZY4A 3ZSHA 3E63A 2UZUE 4FT3A 3R8UA 3ZDIA 3B8RA 3FMEA 1H26A 3PVBA 2OSCA 3NSZA 3ZEWA 3SKCA 2VO3A 1WBTA 4ZSGA 2CKPA 4ZMFA 4R77A 4UMQA 2B0QA 5D10A 3EN6A 3HZTA 5CSHA 2PE1A 2WIPA 4TXCA 5J8IA 1CMKE 5AP0A 3AKJA 4F7SA 4RVLA 2OZOA 4EQUA 3RPSA 3IW5A 2JIIA 4YHFA 3V5TA 4EOOA 3TMOA 1NVRA 3JR1A 4K77A 3ZZWA 3WZUA 1XHAA 4X6QC 5HTCA 4BGHA 1XO2B 4E5WA 2OIDA 4QQJA 2PMOX 3AKKA 4RA4A 2Q83A 4AXCA 3NWWA 2GHGA 4KS8A 3LMHA 1U4DA 3AD5A 4G3DA 3I60A 2WTJA 4FT7A 5LCKA 2XCKA 5AP7A 4BBFA 5HVKA 2DQ7X 2YDIA 3CQEA 2RIOA 4DT8A 4LRMA 3NNVA 4ACDA 2IW6A 2W1EA 4QP2A 3MFRA 5DPVA 2YN8A 2XNGA 1FVVA 4QO9A 3TUDA 2VWXA 2XRUA 2F9GA 2A4LA 4QMUA 4XLIA 4AAAA 4DGLC 5IQGA 4KAOA 4LUEA 4XV9A 3C4WA 4GUEA 3A99A 3M11A 4OTQA 4YUQA 3P5KA 2X0GA 3R01A 4FV1A 4NTTA 4PL3A 2JAVA 4BBEA 4DEHA 4CYJA 2J5FA 4FEUA 2UW8A 2ZV2A 4IQ6A 3ZRKA 4USDA 2GFCA 3ANRA 3BGPA 3MA3A 4QTDA 4WRSA 2VX1A 1OPJA 3W8QA 3HP5A 3PIYA 5AUWA 3GENA 1WFCA 3VQHA 3EFJA 1XH4A 4E3CA 4RIWB 3FL4A 3FQEA 3EFWA 3W8LA 3DKFA 3IKAA 4P5QA 3ZBXA 4ACGA 4EONA 3CGOA 2R3KA 3A4PA 4QT1A 4RC4A 4WRGA 3R9DA 4YO4A 5GZAA 3SG8A 4DHIB 2R3RA 4WBOA 3N9XA 2WO6A 3V6RA 2PY3A 4GU9A 2XZSA 1V0PA 1KUTA 3TZ8A 4GT4A 4MEDA 3L9LA 4MNEA 4WNOA 2IF8A 2J51A 4AA5A 5H8BA 4BI0A 2VU3A 4C0TA 3CXWA 4RWKA 4XEYA 3RGFA 4O84A 4W4WA 1M2RA 5AUXA 1XQZA 1T45A 5FXQA 3DLZA 1SZMA 3OWJA 4U9AA 2HZ4A 2PVYA 1LEWA 2PK9A 4BVUA 5EYKA 4APPA 4OBQA 4E5BA 4CYIA 3ROCA 2ESMA 2W4OA 2YM8A 3VUTA 5JGBA 3DB8A 2YZAA 2GNIA 3CTJA 5FP6A 4BDDA 3AKLA 2CKEA 3PIXA 3F7WA 3GQLA 4IX3A 4JXFA 4O4EA 2HZNA 3PXZA 3BEAA 1W8CA 2BROA 2CDZA 3PA5A 4BDKA 2Y9QA 5C8NA 4DEEA 1OVEA 2XJ1A 2XNOA 4DCEA 3EQHA 1Y91A 3VJNA 4TN6A 5J5SA 5GNKA 4RFZA 4XCUA 4HNFA 4C37A 5IPJA 3QKLA 4IZ7A 5E8ZA 2VD5A 5AP3A 1SNUA 5E4HA 2XEYA 1G3NA 3LLAA 2UUEA 3M42A 4QPSA 2EU9A 5BMMA 4Z55A 3AQVA 4IAZA 4RQVA 5CVHA 1YXVA 5ANOA 4II5A 4AE6A 2IWIA 4K33A 1Q61A 1L3RE 3HUBA 2W1CA 3NFFB 4N70A 4B8MA 3FBVA 2GNJA 4NW5A 4A9TA 4D9UA 3I79A 2PVNA 4FI1A 4HOKA 3U9NA 1J3HA 5M08A 3ZC6A 2NRUA 3KU2A 1RW8A 3PZEA 3AMBA 2XYUA 3MFTA 4NM5A 3HEGA 1FGKA 3LM0A 3A4OX 4GJ3A 4JQEA 4YTIA 5HESA 4OUCA 3RJCA 3UZPA 5IQHA 2BRHA 3GC0A 2RKUA 3RINA 2IJMA 3UO5A 5DNRA 3OCBA 1JPAA 2PMLX 4IANA 3VW8A 4L42A 4QMSA 4AN2A 2XKFA 3NW6A 3NYNA 3H4JA 4I1ZA 4CKIA 4CMTA 2GTMA 3EZRA 3I5NA 4YLKA 4D4VA 4ERKA 4DTBA 3GVUA 2OJJA 2X1NA 4R7HA 5EK7A 5AUVA 4TWNA 3QZIA 2OIBA 3II5A 3PE1A 4D1ZA 1ZZ2A 3NNUA 2XJ0A 1SVGA 5CNOA 5D7VA 2EB3A 4DCAA 2XIZA 4XG8A 3V5JA 4OTRA 3KK9A 4G34A 1T46A 2BZKB 3O7LD 4OTPA 3AC3A 4AOJA 2GNHA 4EZ3A 5AV2A 1UNLA 2QU5A 2YIXA 4JBQA 4OTHA 5L2IA 1STCE 4BR3A 3PFQA 2H34A 4FF8A 2VTIA 2GCDA 2GHMA 3GXLA 4QMVA 3SV0A 3TM0A 5C8MA 3CD8A 3MWUA 3W18A 2G1TA 4YJVA 4AT4A 5LVNA 1YOMA 3UIXA 3EYGA 2WTKB 3W0RA 4AXEA 3ELJA 3F9NA 3DAEA 4CEGA 4CFWA 3W0SA 4NWMA 3GU8A 3QWJA 4M66A 1JKSA 4FVQA 4IX5A 4LL0A 2JDSA 2PE0A 4FIGA 5BVWA 3GI3A 5DWRA 4FZAB 2XKCA 3OG7A 3VUDA 4B9DA 1REJA 4D2SA 2LAVA 4V0GA 4AFEA 4BICA 4JAJA 3KCKA 4R3RA 4N6ZA 2VX3A 2PULA 4XMOA 2W7XA 3OD6X 2W5AA 4AOTA 2QNJA 1X8BA 4F9WA 4QDEA 5M09A 3IOKA 3IW6A 4CLJA 2B9JA 3FHIA 4K11A 4FKJA 5HX6A 4J53A 4U81A 4DH5A 4G17A 1NXKA 3EL8A 5ACBC 3VULA 1OM1A 3W0MA 4G16A 1FOTA 4QTBA 3OF0A 1LPUA 3RPOA 3ID6C 4FIEA 3UVRA 4MWIA 5M4UA 3GCSA 3HMIA 1P14A 1U54B 2WOUA 3QCQA 4G5PA 4GT5A 4RJ8A 2XYNA 5DT4A 5I3OA 3GCUA 5GJDA 3R8PA 3RM7A 1GIJA 4O0UA 2DWBA 3QUDA 3COIA 3PJ1A 4IAAA 4M97A 3DDQA 2EXMA 5F1ZA 4CT1A 5A4TA 3PDTA 1MUOA 4HW7A 5EDQA 3A7GA 4WNPA 4YZ9A 3UTOA 4QQTA 3VUHA 2X4ZA 2O2UA 2YA9A 4MVFA 3ALNA 3CGFA 2BRNA 3BLQA 3P5JC 4FV2A 5EHLA 4UMUA 3BGZA 5DOSA 4ZS4A 3FKOA 1H1WA 2C5XA 4FYNA 2VTQA 3OWKA 1GY3A 3OEFX 3G90X 4Q9ZA 2X2LA 4IWPA 4RX8A 3W2OA 2C5YA 2QURA 2WQOA 5CU0A 3P7AA 5FUTA 4GS6A 3I6WA 2CLXA 2YABA 4QYFA 3FZOA 4YHJA 2OZAB 5KMOA 4DFZE 5L6OA 1JSVA 1OKWA 4H3PA 3R8ZA 3ZZEA 5IEYA 4BTJA 2Y4IB 4GJ2A 3P23A 5CLPA 3DFAA 2Y7JA 2CN8A 1W2DA 2PL0A 5M51A 3PUFC 3HUCA 3F69A 3C9WA 3ORKA 5EQEA 3D7TA 5HX8A 1OZ1A 4AOIA 4BTKA 4P5ZA 5HBJA 4P2KA 5EYDA 3TYKA 4GK2A 2GPHA 3ZSIA 1V1KA 4O4DA 4JR3A 2O64A 4RC3A 3CJFA 3IDBA 5AP4A 5HCZA 4CRSA 4E5AX 2ZOQA 4OTGA 3E7VA 3GUBA 1PXPA 2YCQA 1TQPA 3IDPA 3M2WA 4TYEA 2JIVA 4RGJA 4AWIA 3PJ2A 4USFA 4XG9A 4KKGA 2EUFB 5IQBA 2PVLA 3H3CA 4J7BA 3TNIA 4A4LA 4EOLA 2WTCA 5E8WA 2VNWA 2C4GA 1FPUA 1OIUA 3H9FA 4KKEA 4RJ7A 3HRCA 4IH8A 1W0XC 4L8MA 3P78A 3FMDA 5AM6A 5CI7A 4Q9SA 4I5PA 4E4LA 2YM6A 2YLEA 4FTJA 3FY0A 1M17A 2R3GA 2I40A 4QMNA 4TY1A 5JFWA 1WBWA 2PZYA 2QKWB 3VUMA 3GGFA 4L44A 1YXXA 2UZOA 4FNWA 3QTUA 3OXTA 4XG4A 3E92A 4W8DA 4XNEA 5DRDA 3R83A 1UNHA 2UVYA 3PUPA 4BI2A 1BX6A 3G9NA 3MS9A 3TACA 4EK6A 4ZJIA 2J0MB 3ZLXA 4O83A 2P33A 4HCUA 3NYXA 4CZTA 4IWQA 3CIKA 5KE0A 4IBMA 3BHUA 4MD8E 4UZHA 3KRXA 3NW5A 2UW5A 1KE5A 5HE1A 3B2TA 4A4XA 1RE8A 3MI9A 4EOSA 3POOA 3UQCA 3BGQA 3AD4A 3VHEA 1KSWA 4RJ5A 3B2WA 3BE2A 4IZYA 4QQ5A 5L6WL 3UYTA 2VWZA 2W05A 3OOMA 5TE0A 5B2KA 4FIJA 4TYJA 3PZHA 2HK5A 4TYIA 3GC8A 2C3JA 4HZRA 4BJJA 3P7BA 3MDYA 4TNBA 5HVJA 4ASDA 4KUJA 5LVMA 5C03A 4YLJA 2VWUA 2C0TA 4D2PA 4CXAA 4F64A 3ZSGA 4NM3A 2CGVA 4USEA 3DA6A 5J9ZA 4H1MA 1ZRZA 4AGDA 3FJQE 1OIQA 3HMMA 3KULA 4BKJA 5IISA 5L2SA 4DA5A 5FBNC 4LM5A 4LMNA 2W1DA 2V62A 3HDNA 3UDBA 1WBVA 3OY3A 1WAKA 3MW1A 1WVXA 5CQWA 4BB4A 4B8LA 2YDJA 5I4NA 3LW0A 3FSFA 4YURA 3UG1A 4DTKA 3OWPA 2X0PA 4OGRA 5CZIA 5ANDA 2R64A 3GU7A 1H28A 4I3ZA 4WKQA 4X3FA 4CNHA 3RAHA 3NX8A 1ZWSA 3FZRA 2HYYA 4CZYB 5I5ZA 4S34A 2CNUA 3PA3A 4BFMA 3WF9A 3C4CA 4BN1A 2ZFYA 3CE3A 4JVGA 4FSZA 3BU5A 4H3QA 3BV2A 4F08A 3KMMA 5M56A 3BYUA 3NIZA 4FOCA 5CF8A 4C8BA 2B9HA 3MPAA 1KOAA 3UOHA 1WBNA 2ITVA 4LOQA 5BVEA 4D0WA 3NFGB 5GIOE 4FV6A 4FV4A 4XHKB 3BHYA 4NIFA 4EWHA 3LOKA 2CKQA 5FEQA 2HXLA 5K4JA 2X2MA 4O86A 3SOAA 5KZ0A 4C61A 4O0SA 3LKMA 2W4KA 4U3YA 3KL8A 4PNKA 5KO1A 3QXPA 4PP7A 3PLSA 3QA8A 1ZYJA 4FTIA 2VN9A 4ZTLA 3E62A 4BDIA 2REIA 2VZ6A 4RIXA 3RHKA 2KULA 2IN6A 2ZV9A 4O0YA 1FQ1B 3FMJA 4HVDA 3FPMA 3T8OA 1PF8A 4E7WA 4WNMA 4EKLA 4ALUA 1BUHA 3CEKA 2ZDUA 2BVAA 4IVAA 4XV3A 4KKHA 4QNYA 3ERKA 4I6HA 1OB3A 3O51A 4LGDA 4MUQA 3ZU7A 3O8UA 5HOAA 4IB5A 3LMIA 4M14A 3I1AA 3JVSA 1GIIA 4PPAA 4IM3A 4NFMA 4M13A 2QOCA 2YM4A 4ANNA 4FTKA 2CHLA 3DJ5A 4PP9A 5DBXA 4NYEA 4EOJA 4HYIA 4QP1A 1UWJA 4F63A 4Y73A 4GFGA 5CU4A 3TV6A 2R9SA 2XIXA 4C4JA 1ZLTA 4AZVA 1JKLA 3ORPA 4KNBA 4MHAA 4NT4A 5FWKK 3AXWA 2XALA 5A54A 4K2RA 4N4SA 3FMLA 3MGYA 2B55A 2PVJA 3ORMA 3CKWA 3DOGA 3MIYA 2HZ0A 4QP8A 4R8QA 3TNPC 3CS9A 3RALA 4F1MA 4DHZA 1E1XA 3UZTA 3QTRA 3DTCA 4R7BA 3I4BA 4JDJA 5EG3A 3FC2A 3AT3A 4RZVA 3RBWA 4BCJA 3TUCA 3CR0A 3N51A 4KINA 4IM0A 3DBFA 1YHWA 4G3CA 4O7VA 1OL5A 3VBWA 4YJQA 5AUZA 1H1SA 3ETAA 3FL5A 4O91A 4EL9A 2XA4A 3MFUA 1OGYA 5KMMA 2X7FA 2YITA 2VWYA 1FVTA 1ZMWA 4HGLA 2Q0NA 1TQMA 5BNJA 3GFWA 2VTLA 4BHZA 2YAAA 2CPKE 2GNLA 4EOQA 4BI1A 3FMMA 4ZTRA 3WYXA 2R2PA 2HCKA 4K8AA 5E8SA 3D0EA 2AYPA 4N6YA 1VEBA 4C59A 4RIYB 4DFNA 3RPVA 3H10A 2UW7A 3C5UA 4I0TA 4QYHA 3QHWA 5F9EA 3AOXA 2VWWA 2GQRA 2YISA 1QL6A 3GQIA 3OTUA 4EH2A 5ICPA 4EI4A 4FZDB 4FGRA 4QMZA 4I6BA 4JG6A 4CFMA 3BZ3A 2C69A 2O0UA 3O2MA 2ZM4A 4F0GA 1QPEA 2UW3A 4CFXA 3IK3A 3OROA 1YQJA 3FI4A 3KA0A 3AGLA 5CSXA 5FEDA 5EI2A 3EN5A 4ZZNA 1BL6A 1AD5A 1URCA 2IO6A 4KS7A 4BTMA 1UKIA 4WUAA 5L8JA 4DDGA 4Y72A 2RFEA 3Q9YA 2G9XA 3HAVA 4HGEA 3UVPA 3P7CA 4RWLA 3A2CA 3FZTA 5F4NA 3ZXZA 3FI8A 5HE2A 1Q8WA 4GV1A 2JKMA 4OT5A 4TWCA 1DS5A 3ALOA 4QD6A 4TYGA 4H3BA 1ZOHA 4YZDA 4EHEA 1J7UA 3VN9A 5I9UA 5GIPE 3CQUA 5JZNA 1TVOA 2WMTA 4O82A 3SRVB 3BLRA 4LOOA 4AN9A 4IMYA 3QTQA 5C8KA 4O21A 5E8YA 3V6SA 4WNKA 2XANA 4Y46A 3KFAA 5IH4A 4GIIA 1GNGA 4M0ZA 3BWJA 2F7EE 5EW8A 4DGOA 3FEGA 2J0KA 3EMGA 4CMOA 2PPQA 4FKSA 4JOAA 4X2JA 3QQLA 3JPVA 4BCNA 1U59A 1Q8TA 3ZFMA 4ZSEA 4IJ9A 5JQ5A 3GNIB 3ET7A 1B38A 4NW6A 3UNKA 3PY3A 3NPCA 2ITQA 2XKDA 3BQCA 4RLLA 4UN0C 2VTOA 5DEYA 5ETAA 4U40A 3QTXA 4QMYA 2YWVA 5C01A 1OECA 3Q32A 1G8KA 2R3QA 1YVJA 2R3FA 3KF7A 5AP2A 3QF9A 4JDKA 4M84A 5HQ0A 5IA2A 3KC3A 4BY9E 1OPLA 4E73A 4FIHA 4DT9A 3ORXA 3EH9A 3TCPA 3OCSA 4BIDA 5BMSA 3OCGA 4AFJA 4EBWA 5KHWA 4IWOA 3PVUA 5DYJA 4BHNA 4YZMA 5AR5A 4UWCA 3V5LA 1JSUA 1JAMA 3HMOA 1W2FA 3QTWA 3RPRA 3UQFA 3ZYAA 2BAQA 3KREA 1Q4LA 5JK3A 1J7IA 4DHFA 2QCSA 3HYHA 3ROYA 4GCJA 5G1XA 5HO8A 4ZS0A 2X7OA 5CU3A 4ZTHA 5HEZA 1UA2A 3KQ7A 1BL7A 4G2FA 2XK4A 3UNJA 3SXFA 5LCJA 4J95A 5L3AA 4YJOA 4FICA 4D2RA 5FBOA 5E9EA 4FL2A 2WMSA 3Q96A 1BLXA 2XKEA 4RBLA 3LCKA 3MBLA 2C1BA 5IMXA 3OHTA 4ZTNA 5DEWA 3UMXA 1IAHA 2E9OA 2FVDA 2WMQA 3NEWA 5HNGA 4E6DA 4Z3VA 4NU1A 3HLLA 5L8LA 2UVZA 3AC1A 4UBAA 1MQBA 3TDWA 2XVDA 4D2TA 4CCBA 5IQFA 1R0PA 1IEPA 3BHVA 2Z8CA 3R02A 2R5TA 4YZNA 2R3JA 3W2SA 2BDJA 3FV8A 2BFYA 3QHRA 4K6ZA 2Y4PA 3FKNA 4DH8A 4ZSAA 3ZUTA 2XNNA 2RF9A 4QEBA 5M53A 2YEXA 5LMKA 5IA3A 4FZFB 2R3OA 3R0TA 4PTCA 3TEIA 2SRCA 4MBLA 4J1RA 4C3FA 1FVRA 3COHA 4DN5A 1GJOA 4C2VA 4AX8A 3Q53A 5CEMA 1O6KA 4JMQA 3U87A 4F6WA 1PJKA 3QTZA 2RSVA 5AUUA 3EQPA 5HBHA 4ZTMA 2GU8A 1XMLA 2BHEA 2C1AA 4FTAA 3I81A 4EKKA 4R78A 2WAJA 4YC8A 3UP7A 3R71A 4M15A 4L3JA 3ZONA 1SVEA 4AZEA 1IA9A 1ST0A 5TR6A 3PXKA 2I0EA 2QHMA 3F82A 4FNYA 4HPTE 4I93A 4L52A 2ITNA 3CP9A 3NS9A 4O7SA 1O6YA 4DEAA 3AC4A 4NH1A 4EHZA 4FRFA 4OW8A 5A4CA 5DT3A 3R7EA 4D5KA 5HTIA 3F5XA 3ZS5A 5DRBA 2VRXA 1PW2A 2X9EA 5D11A 4TNDA 2BZHB 2WFYA 3ZLYA 4J96A 4TPTA 1Z9XA 3CD3A 3G6GA 4LGHA 1OBGA 3O17A 5DR2A 4ZOGA 2BTRA 3RCJA 4ORKA 3WI6A 3Q9WA 1ZXEA 2QI8A 4Z7HA 1BI8A 4O7TA 3TXOA 5TO8A 4ERWA 1QPJA 4RC2A 3G2FA 5ANIA 4C2WA 3B8QA 2YCSA 5GHVA 3FLQA 5AUYA 2A2AA 3D94A 4EZ7A 1PXMA 4FEWA 5FM3A 4WD5A 4ITIA 3GOPA 3O23A 2V7OA 1LEZA 1OIYA 4FK3A 3UIUA 3EN9A 5EOBA 5B2MA 4O1OA 4DGNA 2J5EA 4FTMA 3Q2MA 4C35A 4IADA 1Z57A 2P3GX 3W10A 5BVFA 2EWAA 2R7BA 2Z2WA 1SNXA 4GH2A 1PXJA 2C30A 3AC8A 4NTSA 4BDJA 4WG5A 4DAWA 4D9TA 5M44A 1AQ1A 4GYGA 4RLKA 4YPSA 1FGIA 4XX9A 1HOWA 3DBDA 3TV4A 3V5QA 4RQKA 3NVKI 2W4JA 4O27B 1J91A 2RG5A 3PIZA 3ZO1A 4P7EA 2BHHA 3VUGA 3E87A 4GT3A 4BC6A 4EK8A 4NUSA 1YWNA 3W2CA 2V0DA 2ITOA 3FLSA 4CMUA 4QP7A 3CBLA 4BWPA 2YCFA 1BKXA 4E20A 2ONLA 5AR8A 2XBJA 4UWBA 3V04A 2C6LA 2Z60A 5M4IA 4HVSA 2PUNA 3R1NA 3LJ1A 4O0TA 5CEKA 1OKVA 4RIYA 3FMKA 2NPQA 3GFEA 4FMQA 3HGKA 2BRBA 5K5NA 2PUUA 4J71A 3CJGA 1R3CA 3HECA 4FKLA 2UW4A 3KVWA 2JBPA 1JWHA 3GB2A 3HVCA 5E92A 4OAVB 3R22A 4FEQA 5A3XA 4AG8A 3TTJA 2E9NA 4K18A 4HGTA 3R7GA 3FPQA 3TZ7A 3DNDA 5EDRA 2XAMA 3A62A 3VS7A 2R3NA 3F66A 3AG9A 2I7QA 4OR5A 4RJ4A 4XRJA 3OTVA 3D14A 3QQHA 3R7OA 3PXRA 2QODA 5FTQA 2JLDA 5LWMA 3PA4A 4R1VA 5L6PA 4EZ5A 1PKDA 2X2KA 3Q52A 2YWPA 2VV9A 3R1SA 4KB8A 5HO6A 5IQAA 3DZOA 1K2PA 4GK3A 3SC1A 4E6QA 3RWPA 3JYAA 2AC3A 2P0CA 3ZDUA 4MD9E 4U6RA 3SRVA 4F7NA 3JY9A 2H96A 3UDZA 2W1IA 4RPVA 3BLHA 4WA9A 2OIQA 5EM5A 1Y8YA 4YP8A 4M69A 5IDPA 3UC3A 3FZSA 3PJCA 4FTNA 4IXPA 4UALA 2B54A 1MQ4A 1NT2A 3PFYA 3FC1X 3QA0A 4DDIA 2PE2A 3IS5A 3DJ6A 4OT6A 2A0CX 5K9IA 1GIHA 1IASA 2UZLA 3Q6UA 4FBXA 2WXVA 3OBGA 3C13A 4H39A 5J7HA 4NFNA 2X6DA 3R21A 2CCHA 2BAJA 3BEGA 3GU4A 2QOFA 4U42A 5IDNA 5JRQA 3BV3A 4X3FC 2UW9A 5M55A 4C4FA 3WF8A 2YHVA 1P4FA 2UZBA 1NVSA 3HA8A 2PVRA 3DKOA 3FAAA 3RKBA 2PWLA 5FEEA 4BDCA 1QPCA 3VRYA 3BRBA 4RVTA 3H0ZA 4FOBA 4CV9A 4NM7A 5IEXA 4MQ1A 2H8HA 1U5QA 3DTWA 3QX2A 4FIFA 4JJRA 4L3LA 4FYOA 1YWRA 3P0MA 3MH3A 3SXSA 4DG2E 3C5IA 4I24A 2VTNA 4ZZOA 4PDYA 2W96B 5H8EA 1W84A 4EHGA 5E7RA 4QYEA 1O9UA 4O7RA 2WMVA 1APME 3Q60A 4PTEA 3UGCA 4DEIA 5A6NA 1CDKA 1M7NA 5AP6A 4DLIA 5CALA 5IUHA 5M4FA 4GSBA 4NM0A 4WHZA 4QMTA 4UYAA 5CT0A 5JKGA 4AXAA 3AT4A 4HJOA 4U5JA 5AX9A 5KHXA 3BELA 2QOKA 4XV1A 4FA2A 1P4OA 4LQMA 4O7YA 3DAJA 3W0OA 3HMPA 4EK5A 2PMIA 3D7ZA 2WHBA 4Q5EA 5LOHA 2UVXA 4FT0A 3AC2A 4N57A 4FG8A 1J1CA 3P79A 3ORIA 3ZO3A 1Y57A 4I94A 3R9OA 4FVPA 5IA5A 4XP3A 2PZPA 4QDVA 2JKKA 5CASA 1ZY4A 4EOKA 3C4FA 2C6TA 3D2IA 3QCSA 4Z16A 1Y6BA 3TIZA 5KKRC 1CSNA 4AS0A 4Z7GA 4RMZA 5D12A 3RZFA 3ZUUA 4G6OA 2VO0A 4CVAA 2F57A 3A8WA 2UZNA 2VGPA 2OG8A 2HW6A 4U44A 2GQGA 4W9WA 5CEIA 3L9NA 4W4XA 3DK3A 5AV3A