3IOMA

Crystal structure of purine nucleoside phosphorylase from mycobacterium tuberculosis in complex with 2'-deoxyguanosine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
b'DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystallographic and docking studies of purine nucleoside phosphorylase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 80
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iomA00
4LZWA 3KVYA 1ZL2A 5F77A 1RR6A 3KHSA 4BMXA 5KB3A 1OU4A 3DPSA 3FWPA 1V4NA 3UAVA 4LNAA 1PR1A 4TTIA 3LBAA 4DARA 1XE3A 4LNHA 4TXJA 3QPBA 3T94A 1YQUA 4WKCA 3O6VA 5DK6A 1TGVA 4LKRA 1JDUA 1RCTE 4QASA 4DAOA 1K27A 4ECEA 4UC0A 1JE0A 1TGYA 4M7WA 5CYFA 1Z38A 4TTJA 3LA8A 1LVUA 1Y6RA 1VFNA 4TS3A 3E0QA 1A9OA 1U1EA 2XRFA 3FAZA 2OXFA 1RXUA 3E9ZA 3OZBA 5C80A 4PR3A 1Z37A 1RFGE 1U1FA 2HN9A 1YR3A 1T8SA 5CXSA 4GKAA 1OUMA 5EPUA 4TS9A 1OTYA 1Y1RA 1SQ6A 3UT6A 1SJ9A 4WKBA 2RJ3A 4WKOA 4TYMA 1VHJA 2IQ5A 1TCUA 5JPCA 3OZEA 4L5AA 1LV8A 4F3KA 4PNPA 1Z34A 3UAWA 4L0MA 4F1WA 3KU4A 2QDKA 3EEIA 3P0FA 1TD1A 3GGSA 4R2WA 5CXQA 3FNQA 4JWTA 1SD2A 1OVGA 3MMSA 4U2KA 1ULBA 4OGKA 1M73E 1Z35A 2QPLA 1K3FA 3NBQA 2A0YA 5F7XA 1V45E 4DANA 3FB1A 1Z5OA 4MCIA 2HSWA 2OECA 4DA7A 3OF3A 3DDOA 2P4SA 4NSNA 3KUKA 1OTXA 3ONVA 5B7GA 3TL6A 4GLFA 1U1CA 5B7NA 1ODKA 1Q1GA 2PGAA 1NW4A 1RYZA 2AC7A 2H8GA 5EFOA 1OV6A 3O4VA 5F7JA 1JDVA 4NY1A 1JYSA 5F73A 5CYGA 3EUEA 2ON6A 4QAQA 4YO8A 1PW7A 3DP9A 5F78A 4G41A 3OPVA 1PBNA 1Z33A 1JE1A 2A8YA 1PKEA 3OZDA 1A9SA 1LX7A 4KN5A 4QEZA 4OGLA 1B8OA 4DA6A 5FAKA 4DA8A 2Q7OE 1WTAA 4D9HA 4GMHA 5IFKA 1N3IA 1Y1QA 1VMKA 1JDSA 3P0EA 1VHWA 4F3CA 1QE5A 3UAYA 5B7QA 1U1DA 4QATA 4R2XA 4OF4A 3DF9A 3IEXA 1FXUA 1ULAA 4TXNA 2QSUA 4WKNA 3EMVA 3FOWA 1RT9A 4L5YA 4OEHA 5CCEA 3OZCA 3BJEA 4EB8A 3INYA 3PHCA 1YBFA 4MCHA 4TXLA 3DJFA 3OOHA 1JDTA 2AI3A 3K8OE 1PR5A 1Z5NA 1RSZA 3PNPA 4YMLA 3FUCA 1A9RA 2HRDA 5K1ZA 4D8YA 3C74A 1CG6A 1A69A 3BSFA 1Y1SA 4BMZA 3GB9A 4L6IA 1PF7E 4EARA 4F2PA 3D1VA 4BN0A 2OC9A 4LDNA 5B7PA 1Z5PA 5I3CA 2I8AA 1G2OA 4JP5A 1PK9A 2QTTA 1NC3A 3F8WA 2B94A 1V2HE 1A9QA 1V3QE 3ODGA 4RJ2A 3U40A 1JPVA 2A0WA 3LGSA 1ODLA 1Z39A 4BMYA 2A0XA 1SD1A 1T8RA 1ODIA 3NM6B 1PR4A 4M3NA 4YJKA 1K9SA 4M1EA 4D98A 3UAXA 3NM5A 4WKPA 1C3XA 4GLJA 3MB8A 4IP0A 4TTAA 1ODJA 4DABA 4OY3A 1JP7A 1Z36A 3IOMA 3NM4A 3BL6A 4E1VA 3EUFA 4NS1A 3SCZA 1YQQA 2HWUA 5F7ZA 3OCCA 1RXCA 5F7OA 1NC1A 4QFBA 5EUBA 1U1GA 3E9RA 1PR6A 4H1TA 5IU6A 4K6OA 2OC4A 3PNSA 5ETJA 4YNBA 3K8QA 1YRYE 1A9TA 1PK7A 1PR0A 4OJTA 5F76A 4I2VA 5CCDA 1PR2A 4G8JA 3PHBE 1RXSA 4F2WA 3OOEA 1TCVA 1PWYE 4TXMA 1A9PA 4D8VA 3BGSA 4G89A 1I80A 4P54A 1V41E 2GUWA 1V48A 4X24A 1B8NA 1T8YA 1Y6QA 1Y1TA 4DAEA 1JDZA 3ENZA 1T0UA 2AI1A 4TXHA 1CB0A 2I4TA 2ISCA 2AI2A 4FFSA 4MARA 4JOSA 4QARA 1ZOSA 4L5CA 4R31A 3KVVA 1RXYA 2BSXA 3UAZA 4D8XA 1ECPA 3KVRA 1T8WA 2QTGA 4DA0A
chains in the Genus database with same CATH superfamily
5KMGA 1FP6A 3VNAA 1YS7A 3IPYA 5DCLA 2J5QA 4F8YA 4YJ3F 3WK4A 3PFFA 1B42A 1CR0A 1O96A 2JFOA 3VM6A 1V1RB 3E5MA 1TKBA 1OZGA 1K6IA 3QVJA 1M2FA 4DIDA 1C2YA 4HQOA 3EVEA 1V11B 3Q7PA 1ZXLA 1KJIA 4IDEA 3RUCA 1QYXA 3I37X 3VI4B 1PFWA 2H9YA 1INLA 3IQEA 2WTMA 4B3BA 1CQIA 1GYRA 2G0AA 3FCUB 2F48A 2PUVA 4RU1A 4U5QA 4D79A 1XCPA 1JSRA 1X7ZB 1YZUA 1HT2E 2GDZA 2AMVA 2PZBA 3O3NB 1BE0A 1U8TA 2UVDA 4S24A 3OC0A 5LD2B 1SIWA 2VF7A 5JAUA 2OG2A 1ABBA 2ZCJA 1LPAB 4LOAA 5ECWA 2WUWE 4OKIA 5TPWA 1EFVB 4J1NA 3UJPA 1ZHOA 3CLTD 3SXUA 2VP5A 5DNDA 1BJTA 2ESRA 4B46A 1SEPA 4ZJPA 3JQ7B 4F71A 1R8QA 4P38A 4MVWA 2PRYA 5HE8A 1C4XA 2OZLA 3QVSA 1Z5WA 4K9LA 4AECA 1KZYC 3QG1A 3G0BA 5CYFA 1LK7A 3MIIA 1QONA 2LTAA 2J41A 1BO6A 3CX3A 4PSCA 4PSKA 3U62A 2ZUEA 4PYNA 4J0FA 1O8CA 3PI6A 5KIAA 2Z3WA 5G2OA 2P67A 1FUUA 3MINB 3WGQA 3WFZA 1DARA 3INRA 2ZIGA 1GCAA 2ETVA 3ADKA 4DR6B 2F43A 4KZKA 2J7KA 1N6LA 2RCNA 3TLMA 2YRWA 5DTJA 1SBTA 2IIPA 3D7SA 3EFOA 3G2HA 3NPMA 4BZXA 1RC8A 5LJLA 5IP5A 1ZU4A 2N9UA 1RDFA 1Z6PA 3IOCA 1C9DB 2B92A 4E4TA 3HRIA 3OT5A 4E11A 3AKYA 5D1NA 3AHIA 1DWOA 3HDYA 3U6KA 3U7JA 2A9VA 3A9WA 4IFBA 4OFBA 5AM5A 4BV2A 1FRQA 1KZ6A 1PV2A 2OILA 2EVWX 5E1DA 3RU9A 4F38A 2AQHA 3RE1A 4GKAA 4ROTA 1CCWA 3UYKA 2GJAA 2BP7A 4L3WA 5H4HA 3ZH9B 3L04A 4JD5A 3LVFO 4LRSB 4ZV7A 5THQA 8LDHA 4OX9B 1JJFA 4A73A 3HFRA 1VJRA 4H35A 1P3JA 4CR6A 2OWEA 3E3OA 4JB3A 3VSBA 1SXPA 1M2VB 2X86A 4IDGA 3M4YA 5LOVF 4Q3EA 5ALZA 3ZD8A 4B71A 2PH7A 1BMFD 2HIGA 3M1LA 3EW9A 5K4GA 4MW5A 1SU8A 4C20A 1R27A 3K9HA 3D1JA 3K0AB 1CLUA 4HL6A 4GR9A 3ZPXA 1L7OA 3C3YA 4DVGA 4NQZA 1T8PA 1PZFA 3IULA 1PSDA 1ZK1A 3WE7A 4PNPA 4ERNA 4F1WA 3IMKA 2BF7A 1W46A 2AE1A 5KNDD 2DR0A 1E3IA 2F3UA 2J3HA 3CUUA 5E2IA 4IZIA 3OF2A 1H23A 4HYEA 2O8NA 4KOAA 4XPIA 4EW6A 5CXQA 2FETA 4FS8A 3FCOA 1GLGA 3V1UA 3VAZA 3ZU2A 5BV2P 2Z08A 1SKBA 3ANSA 4M1KA 4I4LA 5AUPB 5INTA 1UK9A 4MGYR 3F5DA 5ABPA 5BWOA 1U7ZA 1NFRA 4R2LA 2RBKA 3PFHA 4X84A 4GGOA 3G17A 1SCBA 1QS0A 3LKBA 4X7BA 5BWCA 2ZCVA 5AKZA 4MJLA 4QRDA 1GGMA 1Z35A 1FDSA 1NURA 1OJLA 1KETA 4RLSA 2QZSA 2G88A 2GRUA 1WF3A 3NALA 4JODA 5BSTA 4LYEA 4MA5A 4YVFA 4Y98A 5KCMA 5ULLA 2Q5LA 2ECKA 1UBRS 4E2WA 1CY4A 2OMEA 3HR7A 1NY5A 3W5CA 3KJGA 4EABA 2I4NA 3VKUA 4NAHA 4IILA 4A5OA 4XWTA 5LYYA 1YUBA 1DO8A 1QYVA 3ONFA 1SOMA 3KUKA 3NB0A 1M10A 2QAGB 1H4QA 2UUBB 2YVKA 3NI2A 4HEA1 4PV7A 4INZA 4TLAA 4YUVA 5GM2A 1UKEA 2H2AA 4HQ0A 3EPPA 3ZWOA 1UZUA 4D6PA 2GN8A 2H31A 3JQCA 3P9RA 3VYVA 2TMGA 3K2BA 3SSOA 1UEIA 4R8LA 3WC4A 1HZZC 1O2DA 2ADOA 2V6GA 4DIUA 3HVJA 4PHFA 3MPUA 4EJSC 5IXYA 1MU0A 3IQHX 4ZALA 4G4SO 1AB5A 5A3RA 4C6TB 4CKZA 1DKPA 2OGUA 3T7JA 2W37A 4Q37A 1UP7A 4FILA 1JDBB 4XCQA 1IEQA 3MUNA 1RYZA 3ECSA 3MRSA 1WKCA 2WTNA 4YUXA 4P6VF 4UE3S 1EGQA 2YVLA 2FB9A 3HJBA 4OMCA 1OV6A 1RAEA 1YZKA 1ZIDA 4JLSA 3W2IA 2HLNA 2H29A 3ASYA 3N05A 1L7QA 2ZUVA 1G9SA 1V37A 1I2DA 1WXQA 5EZYB 2GJ4A 4A0QA 2NX2A 5HUQA 3AFIA 1XRPA 3W6PA 3CZPA 1UC8A 1FBNA 2WA2A 2DUWA 1FPQA 3FVVA 3A2LA 4XARA 5G40A 3ZDDA 2CVZA 3FKQA 3R7FA 4J90A 4BQFA 2HNKA 2QSYA 3KDSE 4QAQA 2PUGA 2WKQA 2FSSA 4PO3X 4UHCA 2SCUB 4K87A 4NE9A 5C7LO 5SYMA 3GFGA 2PWPA 4AS1A 4YCCA 1S6YA 1C9MA 3H5OA 1D2HA 3HYCA 4RJIA 4IUBS 1YIAA 2BEVA 2YS6A 1YF3A 4REMA 1J2TA 1QIEA 4LDPA 1J2RA 3KDAA 3OZDA 1F2TB 4KQ6A 4HWKA 2AFHB 1MX9A 1SVMA 1M2OB 2XLBA 1EB9A 1ITZA 1XDGA 3CONA 3DMFA 3HA3A 4MW7A 4WX2B 2XUIA 3U4IA 4KOEC 1CF2O 3S27A 5LMZA 2QTVA 5CR9A 2QX8A 3ABZA 4E5PA 3FTEA 4G5RA 3S8YA 4J0IA 5CDYA 5KKCA 1ES9A 4IQ0A 4YRPA 3AESA 4AJ1A 1H8HA 1LNZA 3AHGA 1PNRA 4BNGA 1UDWA 2IOHA 3B13B 4GMHA 4GL4A 4LI0A 1P6QA 5AK6A 4DSTA 1R8XA 4JA2A 1MA0A 1R4MA 2ZRIA 5G0UA 3R7SA 3V97A 1X7HA 4DOMA 5K0JA 4YP9A 4B75A 3GLHB 3B3AA 1YMVA 5CBPB 5BUQA 1FLNA 1Y8RA 2HGZA 4V0KA 4Z0HO 2VUTA 1YTLA 4F3CA 2JGAA 2DU8A 4XQ0A 2PX8A 5GJVC 4H7FA 1D1TA 4Z0NA 5B7QA 2Q9UA 3UJBA 3OQBA 1JBKA 4B7UA 1EUZA 1H2YA 2BFPA 3H83A 3NNNA 1BYIA 2OR3A 2ZYRA 3I9V1 3M5DA 1CY8A 2VI5A 5JSZA 4E51A 1LV7A 1YS6A 4JHXA 2IYEA 2Q1YA 4FHCA 2C3PA 3HJNA 3FROA 4M49A 1T9DA 2K2WA 1E2PA 4PC3A 4DS3A 1Z8FA 3BMXA 3G2JA 3CVYA 3RSOA 2YUIA 3U0VA 1ZGJA 2GAIA 2HF7A 2O48X 4FX5A 4EW2A 4F56A 1H5UA 1LLFA 4N5IX 1G0OA 3HACA 3K8YA 4GPBA 4U9HS 2WZDA 2W2LA 4BNZA 1PFUA 2CNKA 2GQ0A 2ZUBA 3Q5EA 3S81A 4H3SA 4OEHA 2YBDA 2ZAGA 7ABPA 3WISA 6ABPA 3ZR4B 1TKAA 5IK2A 3ZVRA 3ETEA 4B6EA 3HS3A 2WHEA 3H99A 4ND3A 4B31A 4L8GA 2AK3A 3CVVA 3CW2A 2R65A 5AOBA 1GUDA 5EZ5A 1DBWA 5FFFA 3LS2A 4GSYA 3Q4GA 4DR2B 1WETA 1JEEA 1F8FA 5FOXA 4RM2A 1RJ9A 1MG5A 1PS8A 4Z4GA 2OUIA 2QD1A 3GDWA 3HO6A 3PNPA 1T9AA 4QYTA 1HLFA 4FHZA 4TUYB 3TD9A 5JBQA 2JFPA 3C74A 1J07A 3AL0C 1D2CA 1P1BA 3C1OA 5C8YA 4EECA 1Y8QB 3EPRA 1YV9A 3W2FA 3W6UA 4P7FA 4CKEA 5EP3A 3PGA1 2ERYA 3ZHQA 1JUDA 1MX1A 3UQYS 5ERXA 1MIOA 1EH5A 4NBTA 5BSVA 2BE9A 2FRDC 4I55A 5TXGA 4MWDA 1KC1A 3SYLA 1LW6E 3ZWMA 3OA0A 1UPAA 1HA3A 4U6QA 2PEZA 5EJAA 4BRSA 2WJGA 4EG3A 1I7NA 3REFA 3F9IA 3GEMA 4JZYA 5EYPA 1QAQA 1FFSA 3DNPA 3OT1A 4Q3KA 1T29A 3ETCA 3HXKA 5EXXA 3TQIA 3ZNPA 2QF7A 5CYPA 4XCXA 4M0DA 4BV3A 3UCEA 5HNKA 3O7WA 2EOAA 2VYVA 2EARA 3BE5A 4QHYA 4R7TA 1JQDA 3RHZA 3IAHA 4RMNA 4MV5A 4B4OA 1S1CA 4B6PA 1R0LA 2JKZA 5IT5A 4OM8A 5I47A 4QPZA 4GUAA 4CIBA 1P77A 1DG9A 1JKJA 1QFSA 1UP4A 4WXHA 5BT9A 3NAMA 5IKEA 4ZODA 5L6MB 4ZKDA 4TQGA 1B6GA 1Z4KA 2BFCA 1YXMA 2P1DA 4ZVMA 1G5PA 1I9CA 1P5RA 1YS4A 1QK3A 3GAAA 4H3VA 2XTMA 5B1DA 5T7BA 3WL3A 5CB4B 2XGMA 3VOTA 1PG2A 1IH8A 1R4ZA 4CG0A 1JPVA 4FZ3A 2Z1NA 1H0RA 4ECAA 1MH1A 1GZHB 5EJ4A 1GNTA 2AW5A 1TU3A 3LCUA 3M82A 1C7ZA 1IMOA 1R0YA 1UXKA 1C41A 4H7DA 2NZ2A 2R1UA 2BFEA 2W90A 2Y4NA 4FEYA 4OIMA 1T8RA 4RA9A 5HIIA 2DH6A 4BRWA 4CMEA 3LKZA 5A1TA 2GLUA 2FUCA 3NGLA 1NI3A 2O2IA 4YMUA 5CA0A 3TRIA 5AHWA 2BLLA 2H2WA 4YRLA 4EJFA 4PIMA 1NV8A 2Q49A 2ZIVB 4L72A 5LZ7A 2CV1A 4WERA 3JYPA 1H3NA 4Y2XA 4NX2A 4WNIA 2ZUDA 4NAVA 1O6CA 4FUTA 3TEFA 5I7FA 3U3OA 1B76A 5JCJA 1G2QA 1TZJA 3LBFA 3MG9A 4RE5A 5KHAA 4HPWA 1VKHA 5B3LA 1NWHA 1IZ8A 4K9PA 1TT5A 2AQIA 1MC4A 4R68A 3T9EA 1Y3CE 3LDHA 2GBLC 4ZKEA 4KUEA 3OY2A 2H5EA 3HFJA 4G1EB 1JP7A 1MAVA 4U4AA 3RABA 4IIFA 4Z4FA 1Z22A 3I34X 4JBXA 4WNCA 3P5BA 3ZHVA 1CUAA 4YCBA 4DBVO 7AT1A 3SJ7A 2VR1A 3AUTA 4Q4AB 9ATCA 4TYPA 4EK9A 1EM8A 1QTNA 2QBYB 3TNDA 1NXVA 1YQQA 2XNCA 3PNYA 4DE5A 3INGA 4LG1A 4QGFA 2EDCA 3FDXA 3NT4A 1US8B 3U7HB 1J8VA 2C82A 2OXRA 4EB6A 2YWXA 4U1RA 1JIKA 5EUBA 1RPTA 5M29A 1OYYA 4E03A 2QJFA 3GCDA 3N2YA 5TGDA 4OO3A 2Z83A 2O20A 3SOZA 2BGGA 3B9PA 4HQKA 1Y5MA 2GF0A 3R4CA 4LWOA 3ELDA 3A3PA 3JATB 4Y6GB 3PRKE 4L4RA 4F7DA 3D7LA 4PC1A 5CMLA 2P9HA 3DVLA 2GK6A 2JHGA 2QPAA 4DA9A 3CF4A 5BN5B 4P4SB 1AB6A 3I62A 2Z1DA 2Z09A 2KQUA 1OFUA 1EFLA 4AX8A 3Q8MA 1D0IA 3DOEA 1E5TA 3AFNA 3CVJA 5KREA 1Z7YA 3K96A 4I9NA 2UDPA 1URPA 3HPRA 2IZOA 3CLUD 4DYHA 2NNWB 3P9PA 4Q0MA 1UKYA 3GP3A 4GNRA 4TV8A 1Z73A 3O4GA 5EC8A 3VZSA 1M75A 2VHEA 5EXSA 1BE6A 2D2XA 1Z2EA 1KJ8A 3NKVA 3V2HA 4MDYA 1V2GA 4NCIA 5IBRA 1MO6A 3NDPA 1QDLB 2NVUB 3JRXA 2I66A 1JFRA 4IJKA 3KSZO 1DKUA 2Q3CA 2JFUA 1CWUA 4Y6RA 3K73O 4ZCRA 5E7JA 1BFUA 3HQ4O 4II3A 3DZCA 2IFTA 4KGVA 5IJAA 1V41E 3D8RA 3KXKA 3BILA 2XYPA 3HO8A 4KVZA 1MTZA 1TT7A 1WPRA 2ZT5A 3JYOA 2XAUA 3VHRA 1SBHA 4IY1A 4K2HA 1QIGA 2QTCA 4CF3A 3LPCA 1AE1A 1YMUA 1ZRMA 4WFKA 1W4CA 3G3EA 1GV1A 2GHQA 1KJNA 2HF9A 4YI3A 3SYNA 4HH4A 1J9EA 2UYYA 1QYWA 1T0UA 4TRMA 1U9IC 3CUSA 1AGPA 5BR4A 4Y7DA 4EYKA 1Z17A 3PDCA 3G8BA 4NMLA 5IJ9A 3PVCA 4WSOA 1Z06A 1CZHA 1G5QA 3K70C 3KELA 4M88A 2DTDA 1QIDA 4PRYA 5EP2A 1TZBA 3Q0EA 4JOSA 1SVSA 1ZK0A 2HXSA 1FTQA 3G5TA 3K0SA 3BG5A 3BWMA 3H2YA 1D4FA 4KBFA 4YFYA 3DWFA 2YHUA 1M7GA 1RRVA 3NBKA 3AI7A 3A6LA 1UR5A 2PO5A 1U1IA 4V0RA 5CNKA 4RGQA 1ILWA 2YVAA 5M3BA 4G5GA 2I33A 4Z51A 3U48A 3CQ9A 4MVJM 2V65A 3GJ5A 1T4MA 3PQ4A 1KKLA 2OV4A 4HTFA 3C5VA 1FFWA 3PTLA 4F11A 1A4XA 5A1JA 5EJ5A 5DLEA 4WFJA 3HKEB 3KVYA 4AZWA 2W6JD 5BSFA 3A3OA 3QX8A 4JEUA 4JQZA 4M22A 4YDHB 4D97A 3KHSA 1ETHA 1VG1A 1GCGA 3U3XA 1C8LA 3MLAA 4B47A 4ZEOA 3ZX5A 1J2EA 1JR2A 2VCYA 2VOEA 3CO5A 4Q1DA 2JFBA 2FUG6 1NW5A 2ZDHA 4BJHB 2IEAA 4LNAA 4UTVA 4TTIA 4LZZA 5CCBA 2ECFA 2CLFB 2OCGA 4JT2A 2WZQA 5AM0A 3STWA 1UFOA 5LPNA 4NS4A 3ZW8A 3T3NA 2VF8A 1XE3A 4KBYA 1KI3A 1L7NA 4RTPA 4HGZA 4PYKA 4TLBA 3O6VA 1QUEA 1SURA 3AF1A 3I2YX 2FGJA 4PGFA 4UEKA 1K63A 3E9CA 4IF4A 4LE2A 5CVDA 3DEAA 2PD3A 3ME5A 2X2OA 3V8RA 4KI0A 2H1RA 3QEAZ 1J49A 2FK7A 3QPVA 5TNXA 5GONA 5A7FA 1X7XB 1W36B 5KYWA 3AFHA 2O0MA 3AOGA 1FMLA 4F6LA 5ALKA 3QKRA 3JYQA 2PZLA 2ZSEA 3A3KA 1D03A 1SUIA 3ER8A 1F6WA 1XUOA 2I3DA 2WFAA 3ILHA 3KSMA 4MWTA 4R1NA 4C0LA 4D02A 4JJ4A 4PS1A 1YB4A 2GYYA 3IAS6 4PBRA 2DLNA 4OL9A 1ISPA 3C48A 3B8EA 1KI6B 3PB3A 4MWSA 5CNMA 1AGXA 3IAM6 3O4JA 2C5AA 5BSGA 1N32B 3R7LA 3FAZA 3JQBA 3O82A 3GZTB 1ZD8A 2JIZA 3OQIA 4FLMA 4A0SA 2MSEB 1RXUA 4QOIA 1UMKA 3OZBA 4UNNA 4Y2QA 4AP9A 2P6UA 3R9XB 1ULZA 3KAKA 1NJSA 2J9XB 4KWIA 3W5IA 1XRMA 5AW3A 1EQUA 5HEKA 2I78A 4PQYA 5JRJA 4NLLA 3Q15C 3D2AA 3SIWA 3BMOB 4IUDS 1XPJA 1AU9A 2WYHA 3OESA 3TAUA 3C6QA 1J20A 4NARA 1IHPA 3RT7A 1IHUA 4KQWA 2VZ9A 4LISA 2QTWB 3ONDA 4NBWA 3V4OA 1D8AA 3ZD9A 1OTYA 5L7WA 1IBSA 2BMDA 1K86A 3T7AA 3UVEA 2EERA 2UVPA 2YW2A 3G9XA 3KYBA 4HAVA 1X9HA 2X42A 3GG2A 2HUNA 2P9JA 1ZJ4A 4RD6A 3NEPX 3OUTA 3FNEA 1DJLA 4PZCA 4JCOA 4C07A 2HWXA 4DG5A 2QTAA 2QTNA 5LLDA 1PJBA 4MIYA 3FHJA 3ADPA 2JFZA 4AQYB 4B4UA 1TMGE 2HUPA 5I8ZA 2XE8A 4H7PA 3GBVA 4RANA 5SZJA 3UGQA 5DNCA 3UAWA 4L0MA 2CNLA 2PUWA 4I3GA 5CFZA 5MF6A 2KYRA 4E2XA 4KGDA 3D2CA 3MOSA 2R6AA 5FUYA 2P3SA 3PXXA 4R2WA 4ZI7F 5B30A 3L02A 1SHJA 1OXKB 2HMWA 3ZDBA 1EXDA 2C4KA 3LHKA 3LTEA 3WFJA 4ZHQF 4D26A 2FEAA 3ID6C 4I4IA 3EN0A 2FR0A 1IZZA 3SKYA 3OM1A 3IL2A 2LIPA 1EVQA 2I76A 3DFZA 1L3BA 2F1HA 4NBVA 1AO0A 2VNHA 4ZIRB 2DXIA 4AF8A 3DT8A 1RE0A 4TMZA 1W581 1N5JA 1TM4E 2BKLA 4BLWA 5DV9A 4M54A 5AUOB 2GB4A 4UUQA 3G13A 4BGUA 1W9HA 2X58A 4BNFA 4LOLA 4LTDA 4RXUA 4TWJA 3WLKX 2KSQA 2AJCA 3LHFA 4JKYA 3U19A 3DTVB 1E2BA 1N8SA 3V7NA 1GL6A 1GM5A 2ZWOA 5F5XA 2D2VA 3QH4A 1L7AA 4Z2YA 4B80A 4DRXB 2DETA 4Z53A 3TSZA 2REQB 2TMDA 1JT9A 1LY1A 4B79A 3FETA 4ISCA 3PICA 1GZUA 4I19A 3STUA 1H2EA 1GRCA 2ZR8A 4ZQCB 4JC4A 5KDOA 2E4AA 4PSAA 4OK5A 1AK2A 1MZVA 3HVRA 1WOYA 2Q4TA 2W2NA 4LSWA 4HUQB 3R76A 4JUDX 1DC5A 1WXEA 1YUNA 2W5UA 1GR0A 1R6UA 2PBFA 2WWRA 2X1HA 5EZSA 5HILA 5SZIA 1RZRD 4J0CA 1QYCA 3PHLA 3I4FA 4HMQA 5LB2A 3G2QA 1FFDA 3D4OA 4R2MA 2FJ0A 5SYNA 1H8ED 1Y9DA 3PWSA 4KX3A 1J23A 2A9FA 1HMPA 1LS1A 3G0GA 1Y1KE 1RMYA 1GITA 2P4QA 2QUJA 5EHXA 3R6TA 1YB5A 3O38A 1PSWA 1M7HA 3ZY3A 1G6KA 1UKVY 2J59A 1XCLA 2B21A 1N2IA 1Z68A 3Q3HA 2AZTA 5ESDA 2B4QA 3JV7A 2NUTA 1LTKA 4UDNA 1KAGA 1RM0A 3PPIA 2JD0A 2R48A 4FN4A 4K6KA 1ESZA 4RVUA 1S01A 1UBTS 2H7VA 4TKLA 5D85A 1CRQA 5DSZA 1JYSA 4PLWA 1I9GA 5IULC 3GNLA 1Z4PX 4BZWA 3ZW7A 4RFSB 4ARUA 4M46A 3VR6A 4NYJR 4Z7JA 1P6UA 2ON6A 3HU1A 2DVMA 1DWQA 3DBHB 3KPYA 3PFNA 2FI1A 4HPXB 2Q6IA 4NHOA 3LUDA 4OP3A 4Z9XA 1J0CA 4MI9A 5JY6A 1D2EA 4EOGA 1XJQA 1YQEA 1XDUA 1BRTA 2FEPA 3BVPA 4LCBA 3IA7A 3ZNOA 4FXOA 4IL5A 4K86A 3T12A 2KLBA 1J1UA 1QZZA 3TOSA 1POWA 3ZYCA 2L69A 1I3LA 3LQ4A 3KO8A 3ISVA 3WV4A 3WL8A 4EA7A 1ZXBA 2X6RA 3BZWA 5B1SA 2V7WA 4C2TA 2A9KA 5EXEA 4URUR 1K5HA 1VQ1A 3DFUA 3G6KA 4C7BA 1MZPA 1K68A 3L92A 4MQ5A 1QCCA 3S4YA 2M6LA 4U2EA 3MJHA 4RIIA 4E3ZA 3KYDB 1K8RA 1U6IA 1S9HA 1TYEB 1Y8AA 2W93A 1I4LD 2OV3A 3T4EA 4CIWA 1EX1A 2VYCA 1HNXB 2MMCA 2MSNA 1VMKA 3EGXA 4KXFB 5H9WA 4L5BA 1QGED 1TW3A 5C1IA 3K9CA 3DBVO 2AMYA 1O95C 4ID3A 2X2FA 2ZKIA 3TCXB 4CLRB 2WLSA 3S5JA 5C35A 4BJ6A 4AKEA 5JNUA 2GLXA 2QPTA 3CR7A 3TW8A 2J1LA 1ISRA 2C2ZA 2QNRA 4EO9A 1JFSA 5CM8B 2PRJA 1FU4A 5GWXA 5DN6A 4RVCA 3TQOA 2A5DA 5I7WA 1OQAA 4DWOA 3H2JA 4L7QA 1E3WA 1A8HA 2CMKA 1LH0A 4GUDA 1A5AB 4IIUA 1PS0A 3I4CA 2PWZA 3MIZA 4GRDA 3FFWA 2VG8A 4FQ7A 1KVRA 4ZVPA 1ACMA 4Q4JB 3CX4A 1EI9A 3NV7A 4M60A 5A4DA 4EG7A 1RT9A 1JN0A 1QM5A 4E14A 1DZIA 1ZD9A 1LNQA 2Q5EA 1Q3KA 2ZJ5A 3PKIA 3G7SA 4IEIA 4PX9A 4X45A 2XMPA 4GGPA 1UMCA 1N6KA 2XCIA 3LWBA 4O02B 1E62A 2VJBA 3OO1A 3VHLB 1PAUA 1A88A 4CV2A 1AKRA 3HLTA 1SKQA 1DNPA 2VHXA 5BWMA 1MVNA 1VLVA 3ESBA 4HZUB 2AOUB 3PDHA 4N47A 5JISA 3AC0A 4JC0A 3CH7A 3P2OA 4JJKA 5B1YA 1SKYE 2AI3A 1NP3A 4HGOA 4YJ3A 3UKDA 1EE9A 2FA9A 4ZDIA 1E1CB 4FGZA 3WMFA 3AJEA 4CKCA 4OHYA 2VUSA 5EN4A 4HRAA 5CPFA 1BXZA 1HOTA 1K8YB 2X3FA 3N3AC 1M76A 1SVNA 3HCRA 3PKJA 2I6GA 3RBVA 2QX9A 3DO6A 3A31A 3R6LA 5SZHB 1WHSA 1HL3A 3PQEA 3GZNA 3IQXA 3WSWA 1GCIA 1NW9B 3GB9A 5B2FA 2RGAA 3TM4A 4B7XA 3IT0A 3IEUA 4C2UA 4C76A 3IHLA 4BP3A 4HJRA 4UATA 1Y7HA 3OPXA 1PF7E 5TJ9A 1VL5A 3M4ZA 2WHPB 1WZUA 4GBJA 1ZOPA 1F06A 4V03A 4AJPA 3X44A 2WF5A 1M33A 2IWRA 3SS8A 4HNRA 4AURA 2HM7A 2HA2A 2FDRA 2HA5A 3PNQA 3ZV7A 4Z1MD 1DAPA 4AP5A 2Y9MB 3UWMA 2WKSA 2QSJA 2H0QA 3CLSC 3S3TA 1QG6A 1KKMA 1WZEA 3I9V6 3QA9A 4IDQA 4WXPA 3KZCA 4G86A 2CWDA 3S99A 3VYUB 4DNOA 3PEWA 3H3FA 4CQNA 4JP5A 1YVDA 5K51A 3V2UA 2AXNA 4YPVA 2PUFA 2ZYUX 1KC3A 5L3ZA 4IHJB 4M1ZA 2O8DB 1L5OA 1C5KA 1CERA 4R40A 1F3OA 4WY5A 4ASUA 4OMUA 3EXFA 1NR5A 2J31A 2GF9A 4ZU6X 4S1WA 3FRIA 4B5LA 2PLRA 3DE3X 2YMLA 3M7IA 3NRJA 3O83A 1Q17A 5FLKA 1FFHA 3R9KA 5CGQB 5FKJA 1SCQA 4ZGWA 3DPUA 1OC4A 3OOJA 1DRVA 4XVQA 2BJHA 3TW0A 2IP2A 2WHXA 1W4RA 4BNVA 2TS1A 4F60A 4LQLA 1QG0A 2JIQA 2P4EA 1UXHA 3ZI4A 4CTNA 5IEBA 2C2WA 3P26A 4LOJA 4TL7A 3SJZA 5JNTA 2W6IA 4MS3B 1D6NA 1CLEA 3KJEA 2VT3A 2Q8QA 1CUZA 3K9BA 4C4AA 1UMBB 1NKSA 5LOVA 2JGKA 3JVIA 1ADFA 4TPKA 5LLSA 2B7LA 4NRDA 1MB9A 3DDNA 1XZCA 4TVKA 4NH0A 1HNZB 4UAUA 4YV1A 2OE2A 3UW3A 3TLCA 2NGRA 3RVSA 2EGUA 3O8QA 4KP7A 4PFKA 2X6QA 4QUEA 4AF7A 4MDFA 1A4IA 2REOA 2CC2A 3LXMA 3NQ41 3ZZNA 2C7GA 1EGAA 3IJ5A 4TGLA 2IC5A 4ACBA 5I01A 5KQPA 3SSMA 3SIRA 3WTCA 1AKTA 2QWXA 3I01A 4J1SA 3G02A 1A5SB 1NE7A 3MGAA 4LC9A 5AKGA 5HTKA 3OCUA 4YMHA 1TF2A 2JDIA 2P9CA 1U1GA 1YL5A 1U5BB 1FDVA 2GWRA 1UCFA 2NUAA 3L8CA 3PJEA 4ZZ2A 4DXDA 2V6IA 2I4LA 3WX0A 4BE9A 2D4AA 5B6PA 2KBFA 4C88A 3NHZA 1XDBA 4O1MA 4O3FA 4RK6A 3AVXA 1RTKA 3WIUA 1XNHA 4N6OA 2BCJQ 2CDAA 1QRRA 2I7VA 3FCSB 3N2GB 5AK3A 1A9TA 1GVNB 1ML3A 4D4MA 4NYMR 1JL3A 2VVTA 3A9CA 4B4DA 2ZTUA 3SEQA 1SVIA 4KH0A 5CJJA 2HT1A 2DBRA 1KA9H 3NJ4A 2IHYA 1SC1A 1VRCA 1ZSVA 3AP1A 1NSFA 2J48A 4F12A 3OZXA 3S2YA 4IDBA 2ZPTX 4P80A 4RC9A 2C20A 3BXHA 4HGNA 3VAAA 3SWWA 3MOIA 4CGZA 1I3CA 2FQXA 1J22A 3LG2A 1XXLA 2PT5A 4WJZA 3W05A 3NNSA 1BW9A 1DEAA 1N9KA 1I7PA 2C98A 3COSA 4RNDB 4DW8A 3EAFA 3GMDA 3VH4A 1AQUA 4DLZA 1PJLA 3DB1A 4HAIA 5JYDA 4TXMA 5B6JA 3A36A 1PJRA 1V1MA 2CMDA 3EFHA 3QVLA 1ZJ5A 4P3XA 4D8UA 3OJOA 3COJA 1UDAA 1NYLA 3RIEA 3O1JC 4INAA 5HR5A 4WNAB 4FJ0A 3W8DA 2PUAA 3NBZC 4OQ4A 4H0NA 1QLWA 2OAQ1 1QB8A 3O4HA 4GZLA 4ZVVA 5DNYB 1KYQA 4PBTA 3PFGA 2IP4A 3P8ZA 2BN4A 1V0JA 3HP4A 2O6HA 2DYKA 4CTJA 4BQPA 1FTWA 4IICA 1W5AA 1IRXA 3UMRA 5E4JA 1RJGA 5DGIA 4GD3Q 1QHFA 1XMOB 4IYRA 4LE0A 3DOCA 3N39C 4NPAA 3GPDG 3MRXA 4KIGA 3QEOA 2KW5A 4I1SA 4JX9A 3R0VA 4HDQB 5B2EA 1JRLA 3PUIA 4BBAA 8AT1A 1KY5A 2I3AA 4L5IA 1CUEA 2CFRA 1UT8A 3AH8A 3L07A 3A1TA 3ILSA 5CNJA 4AO6A 2PXXA 2CXPA 5JSFA 4C0WA 5KJ1A 1JQKA 3N2LA 5FUWA 4H1WA 2H11A 3DO5A 5T4HA 3TUIC 3VNRA 1W73A 3AJ8A 2C4WA 1XI2A 5KHLB 5CYOA 2WJYA 3WZ2A 1RFLA 2YVUA 4JLNA 4RPGA 1U2EA 5HQTA 3AB3A 4BFXA 4H7JA 4BAUA 2VHUA 3T1NA 1NVGA 3OPNA 3T7IA 5L6LB 1UAYA 4C89A 1OXBB 1RR6A 5LIRA 4LY0A 4RY8A 1SQ0A 3ELYA 1K08A 1GQ2A 2G5GX 4PX3A 3UXMA 1LBEA 5C46F 5KTPA 1UMDA 1CUGA 4O2BB 5AI8A 2V6JA 4PFJA 3X1XA 3I32A 3FZYA 3HN6A 3MBIA 4MYCA 5HRCA 1HSZA 2QY9A 3PFCA 2QZ4A 5EIXA 1G0NA 2P79A 2HSGA 4IM7A 2EG9A 4Y18A 1DOAA 1ZNQO 2CFCA 2N1BA 4KLCA 1OH6A 3F9CA 2YWFA 1IZ7A 3GRCA 3TTUA 3B5IA 3LBAA 3E7DA 1JX6A 4L4ZA 1XPUA 2O8FB 4OXXA 1XCJA 2W71A 1Y0BA 4JI6B 4EM6A 2F67A 1NVKA 3KQWA 1E94E 1YBVA 3UATA 4U7GA 2O0HA 5F9HA 2GCPA 1JHQA 3QF4B 5EWMA 5LWQA 2VHYA 3FTNA 3AGQA 2W8BA 3K0CA 3KXIA 5EIEA 4K9NA 2F4VB 3FVRA 3QFSA 3WGIA 4FDTA 1U5CA 1Q16A 3FWYA 4DRYA 1PSZA 4HCJA 9GPBA 3QE4A 3SZLA 4ECEA 2IOFA 1Z8HA 5FA8A 3WNBA 4NXMB 2Q1SA 1LSJA 2VQ3A 4GLLA 2X5JO 1TGYA 3NBXX 4M6WB 3TKAA 3TX2A 1SG0A 5I8PA 3K09A 2BMVA 2GO1A 2QTBA 1VBKA 1BKDR 1ZVJA 1B43A 1JA1A 1BVRA 1KPHA 1PJSA 3ASZA 5DZSA 4GMKA 4R71A 1SRQA 3FOEC 3K6SA 3GLIB 2JFGA 5CW1A 1XZKA 2BCGY 1AX9A 4A2WA 2BEKA 3G68A 4C01A 4EMSA 4V1CI 1GGFA 3NHUA 3DMTA 1QIJA 3SLRA 3L46A 4LMBA 1CJMA 1T9KA 3EGVA 2MINA 4M38A 4KR9A 4QWMA 3N9IA 3FDJA 2D4HA 4FLFA 4FU0A 4NQRA 4A8HA 2XQVA 1G98A 3E9ZA 1XTUA 4PYMA 3SJCA 1A5ZA 1PZNA 1TADA 3R3HA 1T3ZA 2V3CC 1Z2AA 4IXMA 3GQBA 4DMHA 5ILGA 4GGMX 1P7VA 3VR1A 3JARB 4EJSB 1Z0FA 1KI1A 3PC6A 4NPHA 1NG1A 3T5DA 3RIGA 1C80A 2OB1A 4EGQA 3D6FA 2V0CA 3HP7A 3K5WA 4MR8B 1U3VA 4FEEA 4K88A 4NU0A 2YZNA 4G09A 1XQXA 2IV7A 3OH8A 2RB4A 5JMWA 2D1TA 1LLUA 3R9IA 2IF2A 2AEFA 3K94A 5LZ9A 5F9FA 4N48A 4LA4A 3HXTA 4AZSA 2FZCA 3WVNA 1O9HA 2YFQA 1N34B 1V3UA 2PJZA 3DBLA 1HE8B 1KFKB 2EFDB 2OHFA 4B4WA 2VAVA 3AR6A 4BVLA 1QC5B 2CGEA 1DKOA 4R5MA 4OHCA 5IH7A 4PYIA 1A97A 1CZKA 2DUJA 1I2ZA 1LWNA 1IQRA 3CRMA 3HY6A 5D3MA 1E2NA 1JHZA 4KTVE 1QZ3A 2ZT7A 1BMDA 4M9QA 2HRQA 5ALXA 3V8VA 4O8CA 4XX1A 3KQPA 3VVLA 3UIEA 1UXOA 2IVZA 3H5VA 3HZRA 3AQ4A 1G6HA 1IHYA 3OEHA 5KOYA 2J9ZB 4HB2A 3I04M 4QYSA 5KAPA 1GVHA 1YONA 2QN1A 3BF8A 2P77A 1UEJA 2ZI5A 1RI3A 4DC9A 2QR3A 4IDNA 2AF4C 4MVCA 1GTMA 4FDMA 2IYOA 2XDQB 3CH5A 1P2TA 1EGHA 1PK8A 1A7AA 4JMLA 4LBYA 3JU3A 3C15C 3X2SA 4HH3C 4JI4B 2XOKD 1FDIA 1I4EB 1PZGA 2FEWB 2P3LA 3V46A 4F8EA 1CYDA 3TSAA 1SXHA 1RIFA 5J2UF 1SULA 2GZ2A 5FJIA 4HX2A 3KHTA 3OZVA 5EMKA 1RHMA 3B1XA 1I4OA 1VL8A 3I1JA 2BI8A 1VE9A 4NV3A 2HDNB 1YRHA 5BW8A 5HTOA 3ZD7A 1DTEA 5FL7A 3ERCA 3AWDA 3DHWC 2YXPX 4B8WA 4RQUA 2B35A 2QROA 2ZJ6A 1XVLA 3AIKA 2NOAA 4K26A 4C0HA 1C4KA 2R47A 4HP8A 4IG9A 4EHLA 3CNOA 2O9JA 2XQJA 2VSQA 4PZUA 2VN8A 1WQ3A 4HWRA 3ZJTA 2PKRA 4MKXA 4HGRA 2VF2A 2YBEA 1Q50A 3UNXA 4EELA 4EJMA 3BH6A 5JBIA 3A2KA 4J1QA 3S2SA 2XMZA 3GDGA 4ZYTA 1B15A 1X1RA 2XODA 2RKWA 2QRVA 3UENA 4D46A 5IVKA 2XQKA 2HLPA 4B0OA 3R0QA 2EBHX 1WO8A 1S3GA 1YASA 3QVGA 4UTOA 1QHGA 4K8RB 4MCJA 5B53A 3F6RA 3I45A 5IHXA 1MO5A 5KTMA 5M34A 3FFXA 3OJXA 4KXMA 2RAVA 1KK2A 4J16C 1YQ9A 1QK5A 4MSUA 4M8NE 2Y05A 4JYZA 3UH0A 3JWEA 2DX7A 3EWIA 1VIDA 3C3KA 1KSGA 4YJHB 4W9MC 1CR2A 1MABA 2MT9A 3DZBA 3P9YA 3LVQE 3RRNA 1CUJA 2JATA 2ZYTX 3IP9A 4FVTA 5EHZA 4IKOA 3UUFA 4DG9A 2R8OA 1OXSC 4WCDA 3PFWO 4DIMA 5HZMA 3KKQA 3EZYA 2G06A 4QAJA 5BVHA 2QP3A 3KR9A 1CS4C 1J09A 1P1JA 4CFYA 1Z0UA 5EP1A 3V7YA 3BTSA 3NHSA 4II2A 3TYXA 3A1FA 2QV0A 3ZK9A 5JXGA 3D1LA 4UVGA 2B1GA 2ZJ3A 3BZBA 3CXRA 1M1NA 1R4NA 4JVLA 1NQTA 1FJXA 1L7RA 2NXJA 2AKYA 3PPVA 4ZEXA 3UFXB 4MKRA 5LL6P 3F73A 4TZTA 5K4AA 2OK7A 7GPBA 2NXNA 1AK1A 2FMIA 1HYEA 1UC5B 3VUEA 2UZ3A 2R44A 5CLGA 3WYNA 3EEBA 2CLOB 2Q7DA 4UCWA 4AUKA 2QN8A 4U7DA 5F21A 4BYMA 1D2RA 1YRLA 5E7MA 1L9KA 3FKSD 3QENA 4QEZA 3UOWA 2O2JA 1ZR2A 1TO6A 2FQWA 2WU8A 2Q9BA 4HGQA 4DA8A 3KXLA 4RCZA 1L5QA 3LKVA 2KWIA 5DIZA 3W4IA 1Y3HA 5BORA 2ABWA 3KV3O 4L2IA 1WHTA 5AVJA 1FNMA 2ZANA 3K0BA 4BQRA 1FP1D 1N2CB 1KERA 1TLTA 2XNDA 2X14A 1GADO 3SHVA 3TLBA 5IPFA 2QXYA 4HDCA 4HDRA 5J2TB 2ONJA 3DSRA 4AS2A 1P8AA 3LTNC 2FPIB 4QQKA 3DKKA 1K89A 1PP4A 4G4SP 1U65A 3Q88A 2HWWA 4I46A 1YA4A 4Z2AA 2PUBA 4M0EA 3QFCA 3VJLA 1QFYA 4YQFA 1KMHB 1N2ZA 1P4RA 2MYUA 3MAGA 3RJ9A 1C50A 4COKA 3VR6H 5TQJA 4CYMA 4QA9A 2JAXA 1L5YA 3TD6A 4QATA 3E1SA 1JFLA 3QKSA 3RGGA 2PQ2A 1TJ4A 3H2SA 3ZTWA 2BGLA 5DBOA 1ZEJA 1FLAA 1P1IA 3G8AA 2EYQA 3SZ3A 4ACAA 1T1JA 1HNWB 4YJGA 5CK5A 2GUGA 4PZPA 3FRJA 2C7PA 3TRFA 3MM4A 4PO1A 1CIJA 4JJFA 4ZU1X 2GJKA 4EB3A 2YXLA 2LRHA 2VXCA 2Y27A 5FXMA 1GZ5A 1Z3CA 4WFIA 5E9JA 1IMJA 4GI7A 5E1OA 4C0JA 4DM7A 4PQRA 5KWJA 2C8LA 2IK8A 4PLTA 1I01A 3AHDA 4ZXPA 1Q1QA 5CGZA 1YBFA 1TYDE 3H1AA 3PYMA 3SP1A 1TRHA 4RVOA 4M89A 4PYOA 4XRGA 1Q14A 4L3VA 1ZBDA 2YJZA 2GA8A 1O6GA 3HC7A 1NR7A 1VB3A 3F5SA 3JD2A 2IA5A 1C1XA 1OCEA 2LD4A 1GDHA 2K2QB 4M8IA 2GN0A 1PT7A 4RV5A 4LSGA 4R2HA 1ML4A 4MS1A 2I87A 2NU6A 2NU8A 4LNUB 2DKOA 2VDKB 1O9GA 4A8JA 5KWSA 4PGGA 2XA9A 3C5CA 4Y1GA 1AMUA 1O08A 1G8SA 1GPYA 2RHWA 1MC5A 2I34A 4ZOEA 4C6RA 2NN3C 2PLAA 2BHSA 2C1XA 3RUHA 3FTFA 1AM4D 3IILA 2AK2A 1FZQA 3B1VA 5KYXB 1DT3A 1KDPA 2I4MA 1X0XA 2XNSA 4NG5A 5DBEX 3RSFA 3WK8A 3HUFA 1FY2A 2E4VA 2VZ0A 4FYMA 3Q3IA 4CEHB 2BEUB 3M70A 4LVOA 4RYDA 1V7ZA 1L8AA 1GZSA 3IP7A 3V7UA 4JBYA 3U1BA 8ABPA 3CLVA 1BGXT 3R7WA 3H2HA 3CLHA 1IXZA 4OSEA 4UTNA 4EI8A 2V4UA 2WFZA 1D6JA 3WLMA 4C5AA 1MQ9A 2WIAA 3QUQA 5J63A 2Q6OA 5C32A 1W6RA 3E18A 4JENA 1JKXA 3EMBA 4IH1A 5FEMA 4AJ4A 1NW3A 3PUYA 3FOCA 1K88A 3WGYA 2WA1A 5CFNA 1P9LA 1FNBA 2JKYA 3HTXA 3TNYA 3PQCA 2R6HA 2A6PA 4PTLA 4ON9A 2MSDB 5D51S 2ZIXA 4NMXB 4RJ2A 4WAUA 3D8NA 4JBLA 3VJKA 2QGFA 3IJEB 3AJAA 5HF9A 4LIPD 2GO7A 1D09A 4QDZA 1O97C 2G5CA 5C4IA 1OYOA 4L6CA 3WWCA 5KOHA 2HZ7A 4J7XA 3VTKA 2GXAA 2B7BA 1NYTA 1Z5ZA 1I1HA 3OE1A 3RFXA 4ONEA 4G2TA 5DLQC 1L0BA 5KNDA 1OHHA 1QIHA 3CRVA 4DSNA 3VJRA 1YCDA 1N2GA 1XZMA 2FFHA 2OSVA 3CMCO 1J06A 4M9RA 5REQB 5UKDA 4OUKX 3VU0A 2R11A 1N92A 2CJYA 3LK6A 2AJDA 3Q3JB 4YRSA 3PJDA 1HT0A 2ZRCA 2WT9A 5DHPA 4BV9A 2AA3A 2D06A 2NUPA 3LFTA 3L06A 1HDCA 3EDYA 3RC3A 1L4KA 1VHDA 2W4MA 1NPTO 3QOYA 4KO2S 3TTXA 4DLWA 4HDKA 5IJ0A 4ZVTA 2JI8A 3K70B 1CNMA 1M6WA 4DABA 1UC9A 1FFEA 3Q9LA 4E5SA 1Z36A 2CBXA 4NBKA 3UICA 3CUEF 4L16A 3NHAA 2P27A 5C1DA 4F9EA 2WOOA 4TQAA 2BGKA 2PA0A 3NAZA 1U31A 4P1ZA 4RKFA 3PQ8A 1S8OA 1C7QA 2FP3A 3BF7A 3D7RA 2XCUA 4HGPA 2NVBA 1V8DA 3SKVA 3TNFA 1G1MA 2AOTB 3N6RA 4CWAA 3W1EA 1HM5A 2Z5GA 2B4YA 3FN4A 4ZHQA 1N5LA 2WAXA 1U6KA 1LBSA 2I6FA 1K75A 5L40A 1E6EA 2WVHA 3E9RA 3HB5X 3TSOA 1Q1EA 1TJPB 4ENTA 2EGHA 3KPUA 3MMXA 1XMXA 1XWIA 4GYWA 1CZRA 1UQRA 4HGYA 4IXDA 2OLKA 2W9XA 3CEJA 3HBNA 2O05A 4A91A 3JCZA 4AO8A 5B55A 1ZUNA 4MGZR 3QY9A 1NJFA 2DUUA 1MAWA 3U09A 1D3AA 3SF8A 3LHSA 1KY2A 1F2UB 4ZOCA 3TQRA 4CKWA 1U8ZA 1DGQA 4KQHA 2XNJA 1OI2A 4AY6A 1OKKA 2V9CA 2ZI7A 1ATZA 5EI5A 1EQAA 4QNMA 3MJCA 1IBRA 1C8VB 1XD9A 1XAJA 2DC1A 2J7PA 3E22B 3FPSA 3SZUA 4B81A 4YQZA 3IERA 3DOJA 3A6ZA 4CW7A 4LYDA 2ZBVA 1JLMA 3IUEA 2FEMA 2OAEA 4KPUA 1L1QA 5JROA 4RHXA 1EVJA 1PYDA 2RSLA 3ML1A 3ROPA 1U8YA 3TOCA 4ZMBA 5JAHA 3V32A 4IWNA 3UJAA 4KLAA 1ZGGA 3L4BA 4FI3F 5AIBA 1RWPA 5CG2A 3ZHSA 1Q12A 3OOEA 5KVCA 2J0UB 3BGSA 5J3JA 2DEUA 1E1RD 4Q4HB 4QJ5A 2J09A 3F5MA 2QJWA 2IVFA 2QVBA 4HKTA 1S2IA 2J07A 2GTPA 4FXPA 5AUQA 1KP9A 2BRUC 2FSGA 4XUEA 2CLEB 2YXBA 1XDZA 3MTJA 1U2GA 3BHMA 3N76A 4NESA 3F4KA 4C3ZA 4MHTA 2CHVA 1E7MA 1MEJA 2ECPA 3BORA 4J8PA 2ZPUA 4M1MA 2YNMD 5DCUA 4NECA 3WLJA 4UQPA 1JDPA 4DAEA 3KSDO 1J39A 2PR7A 4YDQA 4DQDA 3KQQA 2VYQA 2B4AA 2I2DA 2XZPA 5ENVA 5BWLA 4BNXA 2RI6A 1YIOA 3LT1A 3NTUA 4BP8A 2PGDA 2R2AA 2FMKA 5FHQA 4NK5A 4RHUA 1Q2UA 4DQVA 1CJKC 1KYIA 3O8OA 3RTDA 1VPTA 3CS3A 4QARA 3RWBA 2R66A 3C3XA 1CUSA 4X3CA 3AVTA 3QU9A 3AERB 1L7VC 3KM0A 5JNWA 2CVHA 2Q0HA 4JLDA 2I7XA 1K98A 1MXFA 4OB8A 3LRTA 3WLHA 1ODFA 1PQ4A 1N57A 3AVWA 1E3JA 3CX8A 1XL1A 2PL5A 1RZVA 1R74A 5AYVA 5KYUA 4AJEA 4DEXA 4RW0A 1TMKA 3IVRA 5KTSA 3FOZA 2YWDA 4FN5A 3DMDA 3OIFA 5MFZA 1RVV1 2XGSA 3JALA 1BDBA 3TW4A 3UEOA 4AB1A 2QZ9A 3FMFA 3NIFB 1M8KA 4Q9NA 2J0VA 5GJWC 3DL4A 4GDFA 2XZTA 1OAKA 2BF4A 5FYQA 4BFVA 4EVRA 2PKWA 1FJGB 1B00A 3AVYA 1BH2A 1OGJA 1P0IA 2Z95A 3LJKA 5FOSA 2CT8A 4NMHA 1V8ZA 4KDEA 1LA2A 3C1UA 1KZ4A 4PR0A 3HZZA 5H80A 3VMFA 1B6TA 1PVDA 2QVLA 2V5VA 3IVAA 4URFA 4IIJB 1PR1A 4CM9A 1U02A 4ZZIA 4IGEA 3KT8A 5FNVB 3FSJX 5G0VA 3AEQA 1EG7A 4B3CA 1TU0A 3IXMA 4GZMA 1L1EA 2HA0A 3AR5A 2PT7A 3BTOA 3D7KA 3DXZA 3KRTA 4Q7JB 3W04A 5D5HA 4JSRA 4R2KA 2VK1A 2E37A 1TQ8A 2XF8A 2HSJA 4W5WA 2XYVA 2G8NA 1KTVA 2H2IA 5TMBA 3VO9A 2WW8A 3EYAA 5I8WA 2QTLA 2HFKA 3A32A 1QE3A 3C6ZA 5JMPA 1PYGA 5C4GB 1ZZEA 3O21A 3DW3X 1GPDG 2EWWA 3BMQA 3I05A 1EFRA 1PEYA 3PDUA 4FGKA 4RJJA 4AULA 1JMYA 3HKCB 4RGYA 1XZEA 3HEMA 3OE7A 3SDSA 4DLAA 2ZLBA 3MMNA 3RAEC 4UARA 5D2CA 2ZIFA 2PS0A 2J0EA 4DMKA 4W9NC 4O2AB 1MAUA 4QBGB 1HTBA 3HRHA 1FX1A 1V35A 1OT3A 1WP4A 1S2NA 3EODA 1POXA 3H5RA 3Q2OA 1EUYA 3E2PA 4LV6A 2ACWA 1RTTA 5DBIA 3A6GA 1SCKA 3HMQA 3VC1A 1N6IA 3OAAA 4A6PA 4CLOB 3RJTA 4YMSA 1J8FA 5A6SA 4P0QB 5CHEA 2PT6A 3DYIA 1DINA 3LY8A 1E61A 2PGLA 2QN9A 3GRRA 5AI0A 3UZUA 3PDIB 3TAXA 2C8VA 4CLEA 1HYGA 3GLGB 3CU5A 5K3DA 1IPFA 1V16A 4KQ2A 3V8QA 3CXUA 1XGKA 1WP9A 2FG7C 5JSKA 4FLEA 4EUSA 3N7TA 2AT1A 5CXSA 2G0TA 1TB4A 3WDLA 1ZWKA 1EX7A 1G21A 2JLAA 2VJNA 3EJWA 1XDWA 4OFZA 4D80A 3HLYA 5A2GA 5LP6C 4NVRA 1WV0A 4PC2A 1J2JA 3ZQUA 4BU0A 5L3SA 1H05A 4DIBA 2X2PA 3JZDA 3Q10A 4BWFB 4UD6A 1FVXA 3GJ6A 2CD9A 4EHKA 4KSYA 2AFIA 1U4OA 3BULA 1T6BY 2W6MA 3R6DA 4JIMA 4PGMA 4WKOA 3RT9A 3DZ8A 3O9MA 4L07A 2A3NA 5K3FA 1LSOA 1CD5A 4M37A 4YJ2F 2F3TA 3UB3A 3EGIA 3K71B 3VH2A 4M0FA 4HN2A 1E2EA 1LV8A 1VG0B 2DF8A 2YHIB 1MV8A 3N2KB 3O8DA 3ZEAA 4EPTA 2C3YA 4PQFA 1JSLA 3LVRE 4U7HA 3WMWA 4B2IA 5ALDA 1HLPA 4YP7A 4LXIA 4IDDA 1EEHA 2PNJA 1YO6A 2ANBA 1TTTA 2X4LA 4KXLA 3UMCA 4C5BA 3O95A 2WQZA 4P31A 3RU2A 3QWFA 2WM9B 3TECE 2QG4A 1UXJA 2PCJA 1H6BA 3ILXA 4KWTA 5FO1A 4ZK6A 2AVNA 5AH0A 2B4RO 2AYZA 1OWPA 3GD7A 4LQ4A 1GT91 4MR9A 5JIBA 4IVPA 3F5FA 3OC6A 3DA8A 3FYHA 3WQQA 1P4SA 1ILEA 3R8FA 3UBMA 1WKVA 3NBQA 3VYTB 3B1KA 3E23A 5AXDA 1IB6A 2NT4A 3UMSA 4KHPB 4DANA 2GVZC 4QHSA 3IB6A 3FVTA 4DYDA 1Z5OA 3DJYA 3LYHA 3ZKAA 4I4TF 1JMKC 4YCLA 1WOMA 2IDZA 2R8PA 2WSLA 4YP5A 4HB0A 1I2AA 2VHQA 3UA4A 1FFCA 2DE0X 2R60A 3DMGA 4PPQA 3DDOA 4O0LA 3JTMA 1RACA 1Y7PA 2QMOA 1TC2A 3CV3A 5F2NA 3QLVA 2REBA 1PZHA 4YXWD 5T3YA 3NFYA 1T13A 2WSIA 3T6KA 2H2FA 3EXAA 4EGCB 4Q6BA 4WN9B 2OEPA 3ABRB 3HYRA 1S7CA 1N2BA 3BMCB 4AI6A 2GFHA 3ANYB 2A9PA 2A57A 5A4IS 1VGQA 4DV2B 5M04A 1X9IA 2X5NA 3B9QA 4OL0A 1KDVA 4AIIA 1HWYA 2BDTA 4FYVA 2XIQA 3VZRA 1KP2A 1JIIA 3OUUA 4QXPA 5HX7A 1JJBA 4O1IA 5L7YA 3P9NA 4NK4A 3JQFA 3FYUB 1SA0A 4M55A 4KYTA 4N54A 3V4LA 4D4IA 1ESEA 4W63A 4KFCA 1BKYA 4JYAB 2XZOA 4MKZA 5B3AA 1V8BA 3FPFA 2RAPA 1BEUB 1Z08A 3DZIA 4FSHA 4M2LA 3BX1A 3H1GA 1O4VA 1E7RA 4NTZA 4AF6A 1RBYA 4ENSA 1OR8A 1DO2A 3QFRA 4HYYA 2MSCB 2P8SA 5IM5A 1MT0A 3VO8A 2D5BA 4FC7A 4UEQA 3REGA 1MG0A 1EHCA 2PFGA 3H04A 2XXJA 3NEJA 4FW8A 2ZJ0A 2A94A 4DLUA 1U8FO 3TTTA 5DI9A 4QGGA 4A1FA 3GLUA 4NJEA 4HMOA 1DIBA 1CUFA 4IX9A 1FRVA 1P39A 1NTRA 4G0OA 2IHUA 3LQ1A 3M4NA 4WXEA 4JYCA 2P2YA 2IYUA 3KWLA 4G1VA 1SVOA 4MP8A 3PNMA 3QU2A 1N5DA 1Q7RA 1UPUA 2OM6A 5B4UA 3D4IA 3MTGA 2FW1A 1PBNA 4U63A 4G07A 2L17A 3A8TA 1L3CA 2HPVA 2FN8A 3C3MA 3NTXA 4QG7A 3VKVA 4EF4A 2ANCA 3GELA 4NMWA 5FPYA 3OZWA 4P5DA 4IW3B 1GTJ1 3PPWA 5BNZA 1USWA 4JI7B 3HCDA 3VOSA 2FPUA 2FUNB 2PEYA 4ND6A 4YYEA 4FFDA 5K8VA 3MWDA 2F3SA 2QM0A 4KK4A 1F17A 1V71A 4DR5B 3MGGA 2ZRPA 3IPRA 3THOA 4JUFA 3DEFA 3MCZA 3PS9A 5FAKA 3IP8A 3T4PA 4F8JA 3RYCA 3KTDA 3X3HA 3ICVA 3IS3A 1ZYUA 3BD9A 4CLDA 4LQCA 4G65A 3THYB 4C7OA 3GDFA 1MO2A 2IEGA 2O4UX 3BH0A 5GIPE 4KPFC 4LJLA 2BV3A 3WL7A 4FR2A 1AG9A 4JP1A 4KXNA 2HHHB 4QT0A 3P0EA 1E9SA 3CG4A 3HCPA 3MD0A 3PRYA 1GPUA 1OLXB 1TDJA 2QNIA 4LZLA 3ZCUA 4D4HA 1QFXA 1USGA 2O2XA 3DNFA 3AILA 2C2YA 3QY0A 5E6UA 5LFAA 2R85A 1ULSA 3RTEA 3GLKA 5JBNA 3AUUA 3ZGXA 1G20E 1P4JA 4DKJA 1EJ6A 4MVJG 3MZ0A 4E22A 5CFMA 2OORC 1QJCA 4EAQA 1E98A 2D0IA 4XIYA 5KJCA 1TF5A 1QTIA 3TQHA 1FXUA 1ULAA 1TVKB 2OCYC 1TZ2A 2WIJA 1PJQA 1M1ZA 1RKBA 2HOQA 2PPLA 2YDYA 4IVRA 4KE7A 4WK0B 1UQUA 3PEEA 2WAOA 4WKNA 4IH4A 1X3LA 3OZTA 2NP7A 4QRHA 4G0NA 4DJDC 1K7CA 2FVYA 3G7UA 2YOGA 1H1LA 4B6OA 1YZGA 3M2PA 1CZLA 1QQ5A 2B2CA 4WXRA 4GI5A 2M1ZA 1BIFA 1IN5A 1IWBB 1XEXB 4JT4A 2HLHA 1LPNA 2QM7A 4O4LB 3SN6A 4F06A 2GCOB 2ZT6A 1QQ6A 3OCYA 1FXWF 1II8B 3MFQA 4B84A 3RVQA 3T99A 4DUPA 4A6EA 2B98A 5ED0A 2FJUA 4HEHA 4IV5A 3W77A 3WB1A 4ITVA 1IAQA 1DL5A 3AETA 5HRUA 2JLBA 1ULUA 2OFXA 3BWCA 3JQGB 3I6MA 2WTAA 1Z5NA 3S40A 1CQWA 4MUIA 4ZT6A 4E7PA 2Z0MA 1PU2A 2GPTA 3LYAA 1NMSA 3UPUA 1T2VA 3AP3A 1OIVA 4P4GA 2F1OA 4NPCA 2Q0XA 3GZJA 4FWIB 3B9BA 2C9YA 2ZRBA 4GYKA 3MCWA 5YASA 1D1PA 5FPQA 2XYHA 4NZPA 2DAPA 3V1KA 4NCNA 3E0XA 4ARBA 1RZUA 5BNWA 1RQNA 4AZ0A 1YH3A 2Y2UA 2VO1A 1E89A 2FWRA 4Q82A 1A71A 3LI2A 4ZCIA 3A6JA 3M9XA 4PXAA 3S1AA 2IYXA 1VXRA 1P0MA 4EPYA 5KC8A 3W3AD 3LO8A 2XRYA 5TQ0A 1FVOA 4QM6A 2ATXA 2F8LA 4QUHA 4N3AA 3SC6A 1MV5A 1VLMA 4TKVB 3D6TB 4FD3A 3P5SA 4A0FA 4R8VA 2UUOA 1NN0A 1YR2A 3CMMA 1M2WA 4KN8A 4ER3A 1U80A 4D41A 5LLTA 2P6NA 4QOEA 2CUTA 4CMEC 3EXHA 4NYIR 4GPD1 4JXJA 2J9RA 2RARA 4PQGA 4BLOA 4D43A 1LNSA 1FFGA 1JXQA 3RS7A 1KJWA 3EW7A 1V7QA 1N6RA 4FFLA 4N9WA 4WRRA 5B37A 5JFGA 5CLIA 2FP4A 3F4LA 5F12A 3TTWA 4RZQA 4UU7A 3E2IA 2FFRA 5B2ZA 4YXFA 1PJ8A 1JPJA 1Y9AA 1UBGA 3PNLA 4A82A 5L45A 5JQGB 3DVSX 3NR2A 4U5XA 3K1AB 3DFFA 1GU1A 1UODA 1FJ2A 3OEWA 3HVHA 4S2UA 1OAOA 2WD7B 4HNHA 1RLTA 1ZOOA 2IZ7A 2YTZA 3DB2A 3NM6B 3HWSA 5H3HA 3UWPA 1LQ2A 4BVGA 4ZYWA 2O50A 4M1WA 2OGTA 2FLWA 4DFDA 4MYUA 1G17A 1QGUB 3OKCA 4F5YA 4HNAB 4QXOA 1O6BA 1YQTA 1Z2OX 4WMLA 3A4LA 5JCXA 1VKRA 3L7MA 5ISMA 3AHHA 1AN9A 5BN3B 2AW3A 4CM3A 2Z2XA 4KREA 4CCYA 1XQWA 3BKXA 3UANA 1RYBA 2G6BA 1R6AA 2JBAB 1E58A 1TJNA 1N7IA 1Z0SA 2BW0A 2X0JA 3IFSA 3QHQA 3QU7A 2ZUWA 1PGNA 4ZYUA 2VWGA 5K6RA 4OYHA 3Q41A 4U02A 3KXPA 1AK9A 1PDOA 2LVBA 4OY3A 3L8FA 5FTLA 2F55A 2Q3JA 2QLBA 1K6EA 1VKJA 1ZP6A 4Z49A 3GFPA 1W85B 1EFPB 3Q3EA 1TAGA 4H4CA 1PUIA 3EDRA 4ESOA 4DSOA 1W47A 4BVFA 3SCZA 4WBNF 4CU5A 3L0SA 3ISJA 3NS7A 3TRDA 2WAAA 1QKIA 3MILA 4UW9A 2AUTA 5LNK1 1IE3A 2IZ0A 3CUTA 1PE0A 1B1AA 1X14A 3OCCA 1NR1A 2JIBA 2ZROA 5G0SA 1KO8A 3QUSA 1K6MA 2Q2VA 2BBSA 1VPLA 1BEEA 2EW2A 3E9EA 4FZJA 4MQ6A 3ZXUB 4NCHA 1EP3B 1NQXA 3KOXA 1E2MA 4RFLA 1H8HD 2JAUA 2GBFA 1WUKS 3HE3A 3ZWKA 2FAXA 3LPDA 4BWVA 4UBOA 4ZOLA 5CEFA 1SC6A 2AHOA 2X5OA 2OQ2A 2AJTA 3EZXA 4DYVA 5IU6A 3H3XA 1ECCA 4RORA 5T3UA 3QPAA 5TQVA 2XMBA 1I2BA 4LBZA 2X9GA 4B9EA 4QGSA 5J2UA 2YC4C 4W1RA 1QHIA 1T2NA 1T36B 2ZVJA 3D4PA 4JBHA 5K0GA 4I2VA 1I30A 1ZNXA 2G82A 3I5UA 4UCXA 2GPAA 3R1IA 4NZOA 2OLJA 4NZNA 4YT2A 1M1YA 3FBGA 1DMRA 1R16A 1FFXA 1W76A 3DBRA 4BBZA 3FHOA 2E5WA 1ZW1A 2OGSA 1EUDA 1R37A 3CCFA 1KIAA 3K6RA 4G8JA 3WLEA 4AZ3B 4NCBA 1ZPDA 2PU7A 1Z47A 1ABEA 3F47A 3N07A 5MGBA 3EXIB 5A9SA 3U39A 1GTRA 3MS2A 1U2PA 4BNUA 1GFSA 1FTYA 4BN4A 4OREX 2WWFA 1P2UA 2HMYB 1JS1X 2W2LD 4ND2A 4Q19A 4HDOB 3T0IA 3BMNB 2QRGA 5I4CA 1HT3A 3A3NA 1YFLA 1ST3A 4ZCPA 4Y1RA 3C3WA 5IK2D 3A6FA 2V59A 3KVNA 4JYMA 1YE3A 2VAWA 4JL5A 4KNVA 4R4JA 4C4XA 2V97A 4CV1A 4ARCA 2C4MA 2BISA 1Z15A 8ATCA 1MB0A 2PX4A 3G2LA 2CUKA 4DBLC 3S1LA 4DIFA 3ZZUA 2O6LA 2PL3A 2QYHA 3WAKA 3SFVA 4EBBA 4HVLA 3F1LA 1K9VF 2YWRA 3WAJA 1V9SA 5F5LA 2PMKA 1HGXA 2B0CA 3V1MA 1GQFA 5HQ3A 3AEUA 4H27A 1ZK2A 3O92A 3M33A 1NU8A 3LPLA 1EM6A 3L0CA 4WESA 5G41A 2CXQA 2OCXA 3I72A 1Z8DA 3L7YA 4I6GA 3T5MA 4XGIA 3GT7A 3I5AA 3CZ4A 1PJ4A 3ZE7A 3P0JA 3ZE8A 2I55A 1QBGA 4DT1B 5FTNA 2IOQA 4Y67A 1XYGA 4Z4QA 2SNIE 1NWCA 1QG2A 1M8FA 2Z56A 3V34A 4UREA 2K5UA 1WS6A 3T5TA 4YQYA 1XDSA 3OJCA 3OURA 4WDRA 3ZY2A 3G2NA 3JQ8B 5LA6A 2LKCA 3FDIA 2I71A 1P0PA 5TMPA 3NKLA 3IQDB 1P5FA 1OYVA 4KIFA 1BXKA 1XRLA 2PIDA 4RDIA 2RJOA 1C0LA 2HNBA 3F2IA 2VYVD 2G8LA 2R62A 1WULS 2GAFA 4EX7A 1T2CA 2AJ8A 4F4UA 1XJWA 3HGTA 1P33A 1GG9A 2OHIA 3GUCA 3KJXA 3GP8A 1SUBA 1VPVA 2RGRA 2JGMA 3AR2A 1DXYA 1R5BA 2FW7A 4L02A 4BX2A 1Y6FA 4GKJB 1UC4B 2E49A 1DCFA 1BVUA 3CIOA 5HKOA 3K7EA 3EBLA 4CIAA 5IT9A 5I3ZA 4Y2JA 3II6X 1T6YA 3IP1A 4I3HA 4DARA 3L0ZA 3UTCA 4DCUA 2QN6A 3D31A 5BQ3A 1TFRA 4FD2A 4PRZA 4Q48A 3MW8A 5K3CA 5DK6A 1BJKA 1FJHA 3FPLA 1TGVA 4PYJA 1O94A 1GQSA 3R24A 4R1MA 4XQGA 5DBGA 5H1YA 4K9KA 2HA6A 3ZBQA 3FGPA 1C9KA 5HIMA 4LBVA 5AI6A 3R41A 1ZM3A 1XXHA 1ESDA 1IN8A 1FUEA 3INNA 3VYSB 3FNGA 4FS3A 2RKBA 1H6DA 1NONA 3D4BA 2Z3VA 3WQHA 1OH8A 1NN3A 1NUUA 2ZAIA 3BD7A 4JDPA 2H7YA 3NBAA 5JLAA 2ZUTA 5L8VA 2BGJA 1LVUA 4OVKA 2R7LA 4FYKA 1JLHA 1G60A 4TT8A 5FLEX 4CQLB 5IZ4A 1R0CA 1HRKA 3U4QA 4JH0A 1FBTA 3QITA 3FHTA 1MJGA 3BWBA 3CZQA 3HDHA 2BTQB 2DT8A 3QKTA 4P81A 4KG7A 3C8UA 3M6VA 1NLMA 3FIUA 1JEAA 1XNJA 2WWHA 4RKEA 4QECA 5BN4B 1ZSYA 4RIEA 1ISHA 4ZK2A 4QUBA 3M0EA 2CMHA 3FPHA 2NTEA 1PCXA 1RWXA 2W22A 4UZSA 3EXG1 2OXFA 3T06B 3TCNA 4B6JA 4H31A 1GPBA 2B36A 2JH3A 3EZLA 3JWHA 5JV5A 2RI0A 4GMFA 4R0VA 3SEFA 1RFGE 1L5NA 4HX5A 4U6NA 2GJSA 1ZW6A 2AKAB 4R6XA 3U4CA 3E35A 4I1YA 3KL4A 2XMDA 3O93A 1U7XA 5ALNA 1G4HA 1TCBA 3EMDA 1O8BA 3LBYA 1WB9A 4CE6A 1K5GA 4CEJA 3EH2A 1KQPA 1G4AE 4MV9A 4EP1A 3IUMA 3ND8A 4A26A 1YR1A 4O4IB 2Y1XA 3SS9X 3HKBA 1ATIA 3DHNA 4F5DA 3BEDA 4PSVA 2QVZX 3IYLW 2KM1A 3EQ7A 2YIDA 3GLVA 4GLOA 1PVVA 4PAQA 4A2CA 3R3YA 1QGDA 1Y42X 4TRNA 3FGOA 4HR7A 1UIRA 4FMBB 5EE5B 1W94A 1Y5IA 3TPZA 4L5AA 1FS5A 2G77B 1W2WB 4H77A 4KK3A 1B8PA 3FCXA 3FUUA 4MQ4A 4N5NA 4QYIA 5GZ6A 5BXQC 1OX4A 1PQUA 3P0IA 1VLLA 4I81A 1QKJA 2VZEA 4PHGA 1SVKA 3T4XA 2BFFA 2YZMA 1VJ0A 3CFYA 4ZAVA 1VE5A 3DEJA 2A88A 2C0CA 2OQRA 3KETA 4CV3A 2EJUA 2DFVA 3JVVA 2IQIA 4URHA 4Q1CA 1QIIA 1Z0DA 5F51A 1XYYA 2NO0A 2ZJOA 2BR3A 3KHKA 2WFLA 4MWZA 4M1OA 1KDYA 3WK9A 3CF0A 4HAUA 5DIFA 2E5FA 3OE4A 1LSUA 2WVJA 5DK4A 2JEZA 2XCOA 1SBZA 2P0EA 3BIWA 4H7KA 4HN9A 2XT0A 5ICEA 1MNQA 4ZRDA 1GAQA 1N1EA 1N6PA 3QNMA 4TMKA 2G9ZA 4JXXA 2RBGA 4GXTA 1XZJA 1V45E 3AIOA 1CIVA 2LCFA 2VK4A 5F23A 3QTBA 1T8TA 3GEHA 3TL2A 2QRJA 1AKUA 1R9GA 1XZBA 4DCGA 5DW3A 4X66B 2OECA 1E9FA 2IBTA 2NZWA 1NP7A 3NOQA 5ALWA 1U90A 2Q2OA 1PTJC 3A1CA 4MWCA 4AC9A 4ND8A 5ARBA 3NTVA 2ARKA 2QX7A 1R3DA 3K9GA 4G36A 1W88B 1RKUA 4QFMA 2W6NA 1NX6A 4XYEA 3SPXA 3N8NA 5E9WA 1SUSA 2EP7A 2JI9A 1YQGA 3M3DA 1ZVVA 1XDDA 3I0MA 4MQBA 5BNIA 2AG1A 5AK0A 2SHKA 2W6JA 1NW7A 5L3RA 4X1IB 4X1YA 2NIPA 2FWAA 5EPOA 3HHEA 1BE8A 4R54A 1ZBQA 5CAEB 3VISA 5HSGA 1U1CA 1Z5GA 1FSPA 2I4OA 5EE0A 2X7HA 3C97A 3FJ1A 5JMOA 1G2IA 3K5IA 2HMAA 4LXGA 2JB9A 5EHQA 1TZCA 5ALTA 4AAYA 3M4XA 2WM8A 3GFOA 1SHZA 5IRCD 3KZXA 1P0FA 1HORA 1X1BA 4F21A 1LX6A 3RRXA 4ARVA 2WICA 1FP7A 4M21A 5FWYA 2MR6A 2H1IA 3KPJA 3F1KA 5F73A 5C5DA 5EJ6A 1W52X 2E0IA 4DMCA 3CLKA 5KKNB 1E32A 1ZD5A 5FHRA 2H17A 3ELUA 4S05A 2EWMA 3HB9A 2ONZA 4IDFA 4D9FA 5F78A 1XAHA 3O3OB 1E4YA 1AKEA 1J0AA 1Y4SA 2ZSFA 4MQFB 2B61A 4UASA 3CKYA 1N3LA 3L0YA 1U2DA 4J0EA 4QGAA 5FWDA 1YVUA 1GNSA 4D4JA 5AW2A 2X0FA 4RVGA 3V4ZA 3EOBI 1DO0A 2AZXA 4UZEA 5ESWA 1H0SA 2QB5A 1IHXA 3BFJA 3NYRA 4H0FA 3N0VA 4EZEA 1J00A 3L8ZA 2ECOA 1C7JA 2HJRA 4BNKA 4YN3A 4WOBA 2YYZA 3NHKA 3VHXA 3O1IC 3WBKA 3LF2A 3TBKA 1X13A 4RHYA 1JJIA 1O5IA 3QW2A 3HUUA 1LWOA 2Q7OE 3UA3A 2P69A 5BN1A 4WOKA 4BQQA 1UAGA 2GI4A 1NOKA 3NVDA 4RHCA 2AFVA 3WNVA 2X8WA 3KZVA 4D3SA 4EKEA 1CZUA 1Y4AE 2PBRA 5G1PA 4E4RA 2WJJA 2P9TA 1K3TA 3D54D 3IQGX 3LNTA 3N2NA 1DIGA 2JCBA 4PLYA 5FBLB 3LUPA 4H9GA 5HK8A 4GEGA 2ZVDA 4A7PA 2OAGA 1JEOA 1VHWA 4MHSA 5BXYA 2F64A 4FHEA 4AU1A 2ZJ8A 3UAYA 1BXGB 4XVRA 1V7PC 4FR0A 3PGVA 1OFUX 5AKXA 2HJGA 3VXKA 1R5OA 1U1DA 3C3PA 2OV6A 3AIIA 1YDMA 4NEHB 1DJOA 4CMBA 1BMTA 2YHSA 1OBHA 4O4IF 3WMGA 1E7SA 2GZ1A 1FU7A 1T5DX 2EBFX 2VPYA 4FCWA 4XQ9A 2CLMB 1RRGA 5AW6A 1J0DA 5IYZF 4W5NA 3T54A 1VP3A 1Y5LA 5GZ1A 5U1PA 5DYGA 4FUQA 3LDUA 4IHAA 5EVCA 4O4JB 3ROEA 4G5QA 5JJCA 4RD3A 2GKGA 3PUWA 4P7GA 1XXHE 3T1QA 2BH2A 2PRZA 5A4FS 2FTKE 3CRQA 5J58A 2OZKA 2A33A 2VRNA 1FS6A 2QV7A 1UBMS 2I99A 3HSKA 2EW1A 4TMTA 3GUVA 3TIGA 3ZV4A 4EPRA 3UGTA 4X61A 1UJCA 2WYVA 1V1RA 1JR3A 1XX6A 3PL1A 1U99A 1VKZA 3A1UA 3NHYA 4UHFA 1CEEA 4BNDA 3SM9A 3CYFA 2ZJ1A 1GRNA 3GGCA 2Z57A 3JX9A 4FQ5A 4TL8A 3DJFA 1KEKA 5K8LA 4B0PA 2BFWA 3E84A 3F49S 1WXIA 2Z4TA 1JDNA 4FM9A 2AMLA 1KE2A 2JEOA 3O8CA 1LKZA 1CNEA 1B1CA 3TJZA 3ZQKA 3AW8A 5BW6B 1WXHA 2B30A 3SX4A 1GLVA 3PNKA 2XCRB 4L9SA 4WZAA 1RRPA 4X8LA 3I73A 4Y6PA 5GADl 5KTRA 3FZEA 4CLHA 4OXYA 4A15A 1MC8A 1HDZA 5AJUA 1VDMA 5BMVB 1G2PA 4BMZA 1UM9B 1K3UB 3JXEA 5L95A 4HLDA 1JTEA 1QQBA 3N1UA 2C7BA 3I09A 1SC9A 4KTTE 5DEOA 4IFIA 3SQOA 3T52A 3TEMA 4ZJUA 3H3JA 5I7AA 4DCOA 5BUZA 4MUNA 1T6ZA 2QVCA 3G5UA 1QXSA 2FKAA 3A1EA 1NXOA 4DMLA 1Q91A 3D4NA 3T7DA 2R5NA 2IH2A 3VYRB 4FFOA 3NLLA 1BOFA 1BNCA 1J2YA 4ILKA 2QMHA 4HLUA 1Z6AA 4Q15A 1EWRA 2QD4A 4U7PB 4AMGA 4EI9A 5DP1A 5LDDC 4D1YA 3ZU3A 3B85A 4B2LA 4F2GA 3L1IA 2BTOA 2FN4A 2XWPA 4GI3A 1QIFA 1FP2A 3IT3A 4GE3A 3GVIA 1P7YA 4LHXA 5I3CA 1YE5A 2Z5VA 4N12A 5I7RA 1AMOA 2JJ1A 1U7OA 2J6BA 2C5FA 2QTTA 4UM7A 3LUJA 1BDJA 3TFQA 2GTIA 1V2HE 3LWZA 5AVXA 1YZ3A 2KBEA 1H2AS 2QRZA 3U40A 3BXEA 5J1TB 1ACLA 5JJLA 5A3JA 1UOOA 3RWOA 1PX2A 4AXXA 3VU9A 4HB4A 1OA0A 1ZH4A 2Q27A 3NIDB 4HADA 1OBFO 1NRIA 3V9AA 3JW8A 4IQ4A 3USES 2E1PA 1I0IA 2O0JA 4TWZA 4Q03A 4DV7B 3A1DA 4BDTA 1TNDA 1XVIA 5IJWA 1ECGA 221PA 1AUVA 1RWNA 3U60B 1C14A 2RHBA 3L7DA 1CUDA 3HXMA 2FSVC 2WKRA 4G4IA 7MDHA 3S7TA 1N4AA 5F9MA 1MPXA 4JUIA 1F48A 4LDJA 3K9WA 4R84A 2IUTA 4Y9TA 4E12A 4AIRA 2I2XB 3LDAA 3CHYA 5I7OA 3VR6D 3C16C 3F96A 3FIJA 3NWPA 3U9TA 3O90A 2WDPA 1MOQA 4HK4A 5H81A 2NO9A 2YXDA 5KMGB 5C8VA 4X7MA 1H2RS 2GZAA 2ZIWB 5AKJA 2WWYA 1F38A 1ODJA 1T3SA 1O5OA 1O96B 3BB1A 5BNFA 2PJRA 4JBGA 1CZNA 1TUEA 1U7UA 4LPSA 2JASA 4NZMA 3TMYA 3SHOA 4GHWA 3IALA 2HIHA 2Q5QA 1HMYA 1TC1A 2P5UA 5BV0A 4YJ2A 3EUFA 4LC0A 1GKUB 2XUKA 3CIFA 4A8PA 3ZYZA 2WNIA 3SVZA 2VDPB 4QHTA 3QTLA 4YO7A 2P8JA 3IIEA 3GR6A 4X62B 1W49A 3NBYC 3IRVA 4Z1OA 2W70A 1X9GA 1F6BA 1XTBA 1XMJA 2ZS8A 4L15A 2XOEA 4WV3A 1GYQA 4IHQA 1AURA 2Q5FA 2X4GA 4Q3NA 4YCDA 4YRMA 5IDWA 3KYIB 5EIBD 5TPWB 2Y99A 4HS4A 5EWLB 2ZJFA 3D0RA 3PXUA 3LUGA 4X5OA 3NHJA 1N2HA 2VF5X 1E79A 1YJ5A 4Y6LA 2EG5A 4IJ6A 1AGNA 4X85A 3UHJA 5KX5F 4LTMA 5F76A 4Z7OB 1NV9A 2QAGA 3AFMA 2OGWA 1NF8A 3IX7A 4GZ3A 4I4TA 2EF1A 3W79A 4UU1A 5AD1A 4DL9A 3E4CA 1NZFA 3TRHA 1JWLA 1W6UA 3B9RA 1KFEB 5IWAB 4M53A 2ACEA 2CZQA 2QOEA 3TZCA 2I4IA 3IDAA 4IKPA 3RODA 1MRSA 1PR2A 3JRNA 3RJ5A 4CR8A 1I3KA 4JOCA 4O0MA 1QRAA 1TA0A 3B82A 3SC4A 3WLSA 1RWOA 2Z8XA 2ORWA 3EFOB 2FZEA 2MU1A 3QZUA 4Z4CA 1Y63A 3JRWA 4C6TA 2NYAA 1DDGA 3NEAA 4NNJA 4E5YA 3ADOA 3OHMA 5ESRA 4BMSA 4G89A 2K7ZA 2ONKA 1KI8A 3B1YA 1ABFA 4ZO6A 2J85A 2H5JA 2IOFK 1ZIOA 2V6FA 1SKAA 4OHXA 4EH1A 1HL7A 1FP4A 4JELA 4Q1AA 3T3EA 3V7FA 2Z6UA 3DDZX 2DPYA 2P6MA 4GMGA 4CIDA 3A4IA 2BP7B 1XTRA 4PNZA 3KSAC 1FNSA 5EZYA 4F4IA 1Y1TA 2NPIA 3RAFC 2AI1A 3DZHA 4PG5A 4HVAA 4PG6A 4UNPA 5GVSA 3RKUA 1P19A 4ZQHA 1U9JA 1NDUA 3DEYX 3TFOA 1S3FA 5BMVF 3GJ8A 2JGDA 1CR6A 1HETA 1U3GA 2W48A 3AM3A 1AKWA 1P31A 2VPPA 2CXSA 3IUSA 2YHAA 4FFWA 4R31A 1X92A 2O7RA 5AJVB 4ZA2A 3UAOA 2EBWA 3J7TA 3Q40A 4MLZA 3UAZA 5LNK6 1PHPA 1XQ1A 4A3SA 1T2FA 1F51E 2XVXA 3BRSA 2AEMA 4RZ3A 1GNVA 1P1FA 4L51A 4EO4A 2FQYA 4EYEA 4R2JA 4XOUA 2Z9BA 1M2OA 5E3IA 3B51X 1FC0A 4XPIB 1YOVA 4ED9A 3ER9A 1H4TA 2YICA 1N1DA 4AXBA 3A7EA 3O91A 3BFPA 2YOHA 3UUEA 3GT3A 4MULA 1ZICA