3IOMA

Crystal structure of purine nucleoside phosphorylase from mycobacterium tuberculosis in complex with 2'-deoxyguanosine
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
262
structure length
262
Chain Sequence
DPDELARRAAQVIADRTGIGEHDVAVVLGSGWLPAVAALGSPTTVLPQAELPGFVPPTAAGHAGELLSVPIGAHRVLVLAGRIHAYEGHDLRYVVHPVRAARAAGAQIMVLTNAAGGLRADLQVGQPVLISDHLNLTARSPLVGGEFVDLTDAYSPRLRELARQSDPQLAEGVYAGLPGPHYETPAEIRMLQTLGADLVGMSTVHETIAARAAGAEVLGVSLVTNLAAGITGEPLSHAEVLAAGAASATRMGALLADVIARF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Purine nucleoside phosphorylase
publication title Crystallographic and docking studies of purine nucleoside phosphorylase from Mycobacterium tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 80
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 2009-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 3iomA00
4TYMA 4RJ2A 3DF9A 4L0MA 3LA8A 1YQQA 3DP9A 1M73E 4WKBA 1PK7A 1RR6A 5JPCA 3EUFA 1JYSA 1JE1A 1V48A 1Z33A 3UAWA 1T8RA 4MCHA 4YO8A 1U1CA 1V45E 4YJKA 3TL6A 5CYFA 5F78A 4DAOA 3ODGA 3DPSA 4PNPA 1JDSA 1PBNA 3MMSA 4D9HA 3DJFA 4TXHA 4MARA 1NC1A 4OJTA 2I8AA 4G89A 4ECEA 4JWTA 5F7OA 2AI2A 3NM6B 3PHBE 4TS9A 2A0WA 5F77A 2HWUA 5IFKA 1NC3A 3EMVA 1ULAA 5F76A 1K27A 4TXLA 1ULBA 4DANA 4NSNA 1OUMA 2PGAA 4F3CA 4LNAA 2HRDA 3KHSA 4G8JA 4DABA 5ETJA 1PR5A 3ENZA 4IP0A 3O6VA 1FXUA 1ODLA 4R2XA 1Z37A 1JDZA 3BSFA 4QAQA 2AI3A 4GKAA 1LVUA 1WTAA 2OC4A 3PNSA 4D8YA 1PR6A 4E1VA 4MCIA 5K1ZA 3GGSA 4DARA 1ODKA 2I4TA 4M3NA 2ON6A 1K9SA 1TD1A 1G2OA 2HSWA 1A9QA 1Z5NA 4QASA 4PR3A 1U1EA 3EUEA 3QPBA 1RXCA 4OGLA 1B8OA 1I80A 4YNBA 4QEZA 1TGYA 4EB8A 3OCCA 1ZOSA 4R2WA 1PR0A 2A8YA 1A69A 3F8WA 3FNQA 1T0UA 1CG6A 4BN0A 4GLJA 3KUKA 4K6OA 2ISCA 1T8YA 4DA8A 3NM4A 1YR3A 5B7NA 5C80A 4NS1A 1V3QE 3PNPA 1B8NA 2OECA 2B94A 1RXUA 1PR4A 1Y6RA 3OOHA 4BMYA 3UAYA 4OF4A 1YRYE 4DA7A 2QTTA 1RXYA 3BJEA 4L5YA 3NM5A 4M7WA 2QSUA 3OZEA 3FOWA 2QDKA 1OU4A 1OVGA 1RXSA 4WKNA 4P54A 3K8OE 1YBFA 3K8QA 4BMZA 5B7PA 4BMXA 1TCVA 1A9OA 1TGVA 1SD2A 1Y1QA 1XE3A 2BSXA 3D1VA 4R31A 2OC9A 3E9RA 4G41A 1Z5PA 3KVYA 3DDOA 1VFNA 1QE5A 1LX7A 1VHWA 4F2WA 1V41E 1OTXA 4LZWA 1RT9A 3OF3A 4WKPA 2AI1A 2OXFA 1VMKA 1V4NA 1Z34A 2IQ5A 4M1EA 5CXQA 3UAXA 3E9ZA 1JE0A 4TXJA 1RCTE 4L6IA 1JPVA 4JOSA 4TTAA 1Q1GA 1SD1A 4DA0A 3UT6A 1PW7A 1PKEA 5CYGA 4TTIA 1A9RA 3KVVA 4OEHA 1PR1A 4L5CA 4TXNA 1ECPA 1JDVA 1YQUA 4L5AA 2GUWA 5F73A 1RFGE 4NY1A 4TTJA 4F1WA 5F7XA 5F7JA 4EARA 1OTYA 4LKRA 4F3KA 3PHCA 3SCZA 1LV8A 4TXMA 4GMHA 5CCDA 4H1TA 4KN5A 4TS3A 1JDUA 1ODJA 4F2PA 3O4VA 1CB0A 5FAKA 1SQ6A 1A9PA 1VHJA 1TCUA 5EPUA 1Z36A 2QTGA 3T94A 3OOEA 3IEXA 1U1FA 3FB1A 2P4SA 4WKCA 3OPVA 3LGSA 3BGSA 3FWPA 3OZDA 3MB8A 3EEIA 4OY3A 4OGKA 4YMLA 4LNHA 3BL6A 4DAEA 2Q7OE 5F7ZA 5I3CA 5B7QA 2HN9A 2H8GA 2A0XA 4QARA 3NBQA 5EUBA 1Z39A 2XRFA 1Y1RA 1PR2A 1PWYE 1U1GA 1JDTA 4UC0A 3OZBA 1A9SA 1U1DA 3C74A 4D98A 1ODIA 5KB3A 3IOMA 4FFSA 1Z5OA 3FUCA 1T8SA 1SJ9A 2QPLA 1N3IA 1Y1TA 3OZCA 3GB9A 3U40A 4I2VA 1PK9A 3E0QA 1Y6QA 4X24A 4WKOA 2RJ3A 5B7GA 4U2KA 4D8XA 1V2HE 4D8VA 1OV6A 4JP5A 5CCEA 2AC7A 1ZL2A 3ONVA 4QATA 1RYZA 3FAZA 3KVRA 4LDNA 1A9TA 1JP7A 5EFOA 5CXSA 3P0FA 2A0YA 1PF7E 3UAVA 5DK6A 3LBAA 1Z38A 1C3XA 1K3FA 1T8WA 3INYA 4DA6A 5IU6A 1RSZA 1Z35A 1Y1SA 3P0EA 4QFBA 3UAZA 4GLFA 1NW4A 3KU4A
chains in the Genus database with same CATH superfamily
2DG2A 3EXHB 5EJ2A 5CB6A 3EFHA 2GESA 4I1RA 2NYUA 4FEAA 3RHTA 4PX5A 3GDFA 4Q4JA 2LP4Y 3ULKA 5JYCA 5AVYA 5IUNC 3IUEA 1OWLA 4AP5A 4HQOA 3BZUA 4CFSA 2GD0A 5LCXA 1F0YA 3GHHA 3TW6A 1EFVB 2LNDA 4UATA 4YJFA 4ZVSA 1H8HA 3UHJA 4KDCA 1GN9A 1ZNQO 4PSUA 4XE5A 1FFDA 2WIDA 4B4UA 3KUDA 2YWFA 1Y9ZA 5EHIA 4XYBA 4UTZA 2PA0A 1TA4A 5AIAA 4IXWA 4GI7A 5K09A 3N7AA 4GOMD 4O8CA 3NBUA 5GMOA 1YHYA 1RYHA 1AQIA 3QKRA 3HK2A 4OYYA 2NO1A 5CJ2A 4M1YA 1Q50A 5K5EA 3OA0A 3IA2A 4L4ZA 2JLSA 4TX1A 3HVIA 5DN6A 2ZRPA 4FJ1A 3UGTA 4A6DA 4A8PA 4BFSA 4D0GA 1XCPA 3IMCA 4DDTA 2G5TA 3EVTA 4RCZA 1SA0B 1Y1KE 3F1KA 4RO0A 3SBEA 1M72A 3DCIA 3V4VB 5K0JA 2DXIA 3JZAA 3U3OA 1FDRA 5D3MB 4OFXA 5LQJA 1OC2A 4FXOA 4BQEA 3HPQA 1TZ2A 5AKEA 3T4XA 3MELA 1ZL0A 4HNVA 3ZDAA 3D2LA 2P30A 1NNLA 4OTZA 3R6DA 3C1OA 2OM2A 4C7XA 2FSHA 4BGIA 3GGGA 4M49A 1KK2A 1M5RA 2GSDA 1Z5VA 3YASA 2PEZA 1Z4QA 4F06A 1NUSA 3IO5A 4P34A 4C6HA 3T9FA 2L69A 5BMVA 1YBAA 2JIZD 2QRUA 2XA2A 5EFZA 2FKNA 1AKUA 3PXCX 4NSNA 3MXTA 5EP3A 3DOIA 4DCGA 5FTLA 2Y0PA 3KTFA 1JJFA 1NATA 4JB2A 4QBIA 2C5BA 3ZV6A 5CB4B 3M7IA 1X42A 1X87A 2FJ0A 1YL6A 3H99A 4HAWA 1MC4A 4US1R 4N5MA 5ETJA 5FBQB 1WF6A 2ORVA 4YCCA 5TSDA 4GM4A 3NTOA 2PLWA 2GVDC 4H0NA 5ESDA 5BWOA 2IODA 3H11A 3PCTA 3HP4A 3GLFA 4W8GA 3K9QO 4JB0A 4UM8B 1P31A 1I7LA 5BWBA 3VNSA 2C2BA 3RM3A 1LDYA 2ID4A 3VGPA 4LGMA 3MMZA 3KOYA 1RMTA 3GUUA 4L8LA 3DBRA 2JC3A 3HBLA 3KEFA 1AS3A 4U39A 2W6PA 4JT8A 1QX4A 3OX2A 4KE6A 5JNUA 4D57A 3DTYA 2JZOA 5SICE 2CHGA 2AOTA 4XQEA 2I8LA 3GC6A 3AY3A 4UULA 1UFQA 1EFLA 4MCIA 2GK4A 4XTRA 3DR5A 4ZOBA 4DIDA 3CNQS 4HB4A 5BN5B 1PT9A 5MFPA 1KP9A 1R74A 1LD3A 2I1VB 4R9VA 2WUDA 4FW8A 3ZCUA 5LSAA 3SYRA 3PD7A 3VYVA 3EZFA 4XJSA 4FSXA 1OFHA 1DJMA 3MWDA 1UJ5A 3N5KA 1PT5A 3QNWA 3ZHUA 2W98A 2GJ4A 2L82A 4J07A 5KYKA 2L0XA 4Y2JA 2CKMA 3DFFA 1T29A 4FGSA 3V9PA 3COZA 5B58T 3C39A 4O1MA 3ITKA 3CZMA 4ZYWA 2Q3MA 4KXXA 4QOFA 2P1ZA 3OIDA 5FBKA 3BZWA 3TE7A 3ZZMA 4FLEA 5JD4A 4GRAA 4EITA 2AOWA 1UC5B 2CNWA 4DF3A 5JZSA 1LX6A 1CQIB 4TSFA 2IUFA 1Z2CA 2QVZX 1V1JA 4EEXA 3CG4A 3ILVA 4I9HA 4HXEB 1B8OA 1MPXA 5LBIA 1VJ5A 1K5DA 4CFYA 5D3ZA 4HB0A 2G5GX 4IDDA 5JD3A 2V3CC 3HB7A 3O8QA 1GYPA 1R4NA 2Q62A 4WZAA 4BGVA 2GBLC 1I3LA 4G6ZA 3HNOA 4IDBA 3BQMB 1KK3A 4PN3A 2WJHA 2H7YA 3ZDXB 3GEEA 3E3MA 5JAPA 2D74A 1BH2A 1G5PA 3TRJA 3QF4A 1NVEA 1OXBB 3D8BA 3OECA 3V6LA 3ZQJA 1DXOA 1QIKA 2YWDA 1K08A 3GW8A 1FSPA 5AI8A 1G1MA 4IDPA 4OXIA 4ACAA 1CDOA 3HVKA 1U2GA 1IK6A 1P5RA 5HFAA 3UUEA 2EBUA 1A2BA 2VHCA 5CPFA 3TD2A 3TOZA 3VBCA 2C2WA 2Z43A 2MSNA 4RJIA 4L0CA 4Z54A 1ETHA 4NDZA 4OHMA 4TM7A 1IBCA 1IVNA 2B4RO 1QTQA 2FQQA 2HTFA 3WLMA 4KPGA 1I0ZA 1TMYA 3ZWDA 1R6UA 3K0FB 5FNVB 1YR3A 2OUIA 4AYWA 1BDBA 3HUUA 3JW8A 3KJEA 3K16A 5ALWA 1DAFA 3E22B 3RWBA 4DZTA 2D00A 1KMMA 2VUIB 1YNOA 1K2VN 4S2UA 4P86A 1FUIA 2V9ZA 5DHFA 4JT4A 3RAFC 4I4CA 1VM6A 4BNXA 3NI2A 3HB9A 3R7LA 3D6NB 5P21A 4K46A 1ZONA 4ZAFA 3T41A 1I3KA 2XKKA 4DPLA 3PNKA 4HLNA 3H1BA 4ZEWA 5DH9A 3R74A 2XXAB 3TN7A 4KXYA 5HE8A 2CDNA 3FLMA 5G0TA 5JJLA 3RC3A 1GG9A 5DHUA 4CV1A 4U2DA 3BD9A 3H4IA 1SUBA 3M33A 4PZUA 4HGYA 5DNUA 3NDIA 1EFKA 2ZAGA 5LDGA 3LPAA 2PVCA 1RRGA 2E1RA 3A9UA 3BMOA 3FRIA 1E1CA 1F3LA 2FSPA 3A1FA 3C98A 3Q3VA 3RFTA 3GRCA 4C20A 1WMEA 4IV8A 3I42A 2MIIA 5C2JB 1WKCA 5EXEA 1OJLA 4DMMA 5CA1F 1UIRA 1B2LA 1UJ4A 3DMRA 4JB3A 3VAZA 3OJEA 4LRQA 1VYHA 3BIOA 5T3YA 3UGQA 4RWEA 5B1IA 4RELA 3W7VA 2E6KA 1OROA 3UH1A 2Z5FA 1LS1A 3OM0A 1AB5A 3QJ5A 4I1VA 2C9DA 3CE6A 4EVRA 3SKXA 4BQSA 1N75A 1WLSA 4OLHA 4IF4A 3TTSA 3ZE2B 1N36B 1XNJA 3GELA 4OQ4A 2CHVA 1QTRA 4DLKA 3ML1A 1ESCA 3H87A 3EC2A 3QHAA 4KIUA 1VP3A 4MKGA 1SD2A 2O7SA 3CLSD 4I2NA 3EIFA 5I9TA 4AZ3B 3AM1A 1ZIXA 1E99A 4F46A 4ZALA 1W36C 5AKZA 3CFYA 3TQFA 2QN9A 3EBLA 2ZYAA 5EHNA 2FLVA 1AMNA 2GMWA 4NONA 2BN4A 1MEOA 1P2SA 1PX2A 2CF5A 3NHYA 4PHGA 1H5NA 2B8WA 4ZDWA 2HIMA 4OQDA 3KB1A 1JFFB 4N3BA 2GEFA 7GPBA 2J3DA 4HF7A 4YV1A 3R9IA 1YV9A 1IL0A 3GRUA 3U7HB 2JFHA 3BUSA 1HXHA 3Q72A 4DIBA 3IBTA 1OH7A 4GWGA 2GPBA 4IZOA 5F2NA 3WXMA 1JR6A 3HB4X 1NY5A 2X19A 2AMYA 1W8DA 3K1AA 2I3DA 4D99A 1MEEA 2CUNA 2CNWD 3LKZA 1T9GR 2JBAB 2QX6A 3PXUA 2XQJA 4KN8A 1W1IA 5EIOA 1SVUA 1YIDA 1MQ8B 4M1WA 3N2LA 2NVUA 4A6EA 5LOVA 4G0YA 2MMGA 1M2KA 2OHHA 3RK1A 1VBKA 1ZD5A 4BN5A 3HACA 4UPDA 5C52B 1U9YA 1Q0HA 2MT9A 3LDAA 4LJKA 4XLZA 4E30A 4BY9E 1YQ9A 2I7VA 4HDMA 4P4SA 3R9XB 5AI0A 2FPPB 3G5AA 4LSMA 3NETA 4ZOLB 3TAXA 5AUOB 4US0R 5GM1A 4BKPA 5CDHA 2C7VA 4MVJG 4JDPA 1UMDA 2CJPA 2B25A 3AERB 4JFRA 2AEEA 4NBVA 2R48A 5JS6A 3F9IA 3KTOA 5BR4A 1JEQA 1BH6A 1M2FA 4UHBA 5CDUA 1P2BA 1UZLA 4I50F 5SV2A 5LQRA 4E4RA 1VLHA 2X4GA 3MJ4A 3ISVA 3AEUA 3H2GA 5EWMA 1T1IA 3G7SA 5I7VA 2QT0A 5KWIA 1BMDA 2D2XA 3UN1A 4B9EA 4NJMA 2W83A 2JGLA 5C8DA 4AKHA 3OOWA 4MOWA 3KVNA 5BQXA 1X86B 1OZGA 1X7GA 3WLRA 2X5XA 2ZWMA 2QLLA 3ILXA 4JEUA 2FRVA 2X7XA 4C87A 3CVXA 1WO8A 4RTRA 3HSSA 1HE1C 4P6VF 4HN2A 4FYPA 1P1JA 1RP1A 4PC3A 1BJTA 3HFGA 1CQZA 1ZICA 1F2TA 1G6KA 3A4NA 2BL4A 2JGKA 3PYMA 1ORIA 1RBZA 2M1XA 3RC9A 1SB8A 3CBGA 2IS4A 3B6JA 2ERYA 4G4GA 3K94A 3ZQUA 4EJFA 4NV1A 1W0KA 1XZQA 5KVCA 1NRJB 4GP9A 1SZCA 4NS4A 4CNQA 2W6OA 2WJAA 3QVUA 1M67A 3QX9A 4IVNA 1O58A 4M8IA 3ZEIA 5JECA 1DKUA 3QLTA 2M6LA 1YQUA 2XMSA 4OBXA 3UTDA 2MYUA 5B6IA 3FPBA 2FPGA 3AHIA 5J58A 1UK8A 5KDOA 1V8FA 3P32A 1RWOA 4PYNA 4TTJA 3NEYA 3ICQB 4MR9A 3Q6NA 4X7PA 5LQNA 3GFGA 3HBFA 4WA7A 3KZXA 2XR1A 1OYOA 2P9QA 1GUAA 2WD7B 2XBUA 3NP7A 5F3DA 1L1RA 1FS5A 2CEAA 2H4YA 2PUHA 3CWCA 5F5LA 3RRYA 4E14A 5B57C 2VO1A 2GEVA 2ZRDA 1ADYA 2ZIVB 1W35A 1E0JA 2O3JA 5FBLB 2BEVA 1NUQA 2RAFA 4Z9XA 1R4AA 4EHFA 5BQ3A 1K6JA 4CLXA 3SYMA 1ANKA 4XWWA 2GR9A 3IKVA 4E09A 1VSBA 1Z25A 2GXUA 2QUJA 5EOVA 2NYRA 3IHKA 3CW2A 2BKAA 3CM0A 3KOZA 4C9BA 4YMTA 1SQ6A 2AW5A 2GN8A 2VK1A 1NJ1A 2YTZA 4KU4A 1I7SB 3ZY3A 2OESA 1J1IA 1IVYA 1WV0A 2Q3LA 2IC5A 1N9ZA 2AG6A 4JYCA 4LXGA 2FZ4A 3DLTA 1NSFA 4PTZA 4HMQA 4WCVA 1PK8A 3L7KA 1OBVA 3MB5A 1UAAA 1I2ZA 5A7HA 4F4DA 4H1VA 1CP2A 1FTGA 3RIGA 1PFGA 2M1ZA 2YUTA 2IPOA 4UNIA 5JRZA 3GOHA 4YA6A 3P5SA 1OHHA 5DGXA 3GLGE 1A8UA 2E37A 2G4LA 2H5IA 3AOEA 1Z12A 5FOTA 1NSTA 1OX4A 1RHRA 2G77B 2Q2OA 3D6FA 3DBLA 3C3WA 4IMJB 4OFBA 2NV2B 3QU4A 3WRYA 2WWWA 4J2HA 4Y6PA 3SJCA 5LP6F 2FETA 1P1RA 1D6NA 1MB3A 1V4BA 4NP6A 2NSLA 2CL7X 1EQ2A 4O59O 4ZU1X 4UMEA 2JFBA 3RUEA 2EX4A 2JLCA 2XRZA 1W0JA 4LYAA 3AEQA 3RSCA 3V7UA 3LPDA 3WZMA 2ZBVA 2NU8B 3K30A 3NHWA 3NRCA 4JJEA 4Y6LA 2A0XA 2O2GA 4ADSG 2PA3A 3BWXA 2RH4A 1KERA 3COYA 3H3FA 4FZJA 2GAAA 4O2AA 4Q12A 5EUBA 5ALNA 5A2GA 2XGJA 3C97A 4MVXA 1KR2A 2H9IA 4N8EA 3RUCA 5AI4A 4B7UA 5L3SA 3O84A 1YHNA 5L9AA 3AVYA 1D9XA 2YHSA 3AP2A 1N6LA 1K86A 4YP7A 1BE1A 1DHTA 4G1MB 3WLQA 3RYFA 1AH2A 1XEXB 3QA3E 1LVHA 3P9ZA 4GR4A 4RVFA 4Y3UA 3A31A 1JHUA 2YR0A 2Y0EA 2ZYDA 4ZA2A 2R66A 2YJNA 1H6AA 2GCIA 1GUZA 2OMKA 1GRNA 3QFRA 4PSAA 3VU8A 4E1AA 1M6VA 1HURA 4M0LA 1PNVA 2OQ2A 1GGFA 2Y9PB 3JQ8A 1N2OA 1QX3A 5ES3A 3AIKA 3DAFA 3ND8A 5TIIA 2X5JO 3KR9A 1SXIA 4IL5A 4BFLA 1OF1A 1DOHA 3T1HB 3EDMA 4HNSA 3PL1A 5HIAA 3QKIA 2ZP1A 1JR2A 4O5OA 2O48X 3DZHA 4O25A 5FOUA 1BFKA 3MIIA 1HDOA 3IOCA 1CFJA 1TTPB 4ECAA 1G7TA 4YJ3B 3EK2A 1RTKA 2HIGA 2OCIA 1PU2A 5FV7A 5AVKA 5I51A 5IMSA 2RHLA 3QEJA 4B6QA 1UT6A 3LRTA 2OORC 4N7MA 3C8DA 2WKWA 2ZEJA 2K7ZA 5KKAA 4D46A 3OCUA 3RRXA 3L8HA 1W0KD 2XBLA 4BNLA 2QMUA 1Q3TA 3MMPA 7ADHA 4NKRA 1PR9A 5BW4A 2JLVA 5KHLB 1ONNA 2CLHB 4EGSA 4UAUA 1YHZA 1WUYA 3LPLA 3TGWA 5FPYA 4G4SO 1NVVR 3OQHA 1XTUA 4M9XA 4CDGA 3EQ9A 4MINA 5U4XA 2ONJA 3CEHA 3ZEAA 1WS6A 4IV5A 3SJUA 1ZITA 1A5SB 4OKSA 5EE9A 1DRVA 2FW9A 4UEWA 2OXTA 4PYQA 3FUUA 5DHQA 1RPTA 1WZEA 4LS3A 4PWZA 1BFDA 3CF6R 3H8WA 4QTTB 4UDYX 5BSMA 3WGOA 1Z35A 5KYWB 1Y1SA 1TMOA 1JI0A 2I34A 1JHXA 1JH9A 1UT5A 5JNWA 1XWFA 2HA6A 3AR5A 5K0FA 1EGQA 3WRVA 2FGKA 1M1NB 5F1OA 1JXOA 3EASA 3SYNA 2E5FA 3RD5A 1H2EA 3GZJA 3WO1A 2EWVA 2NXEA 2POQX 4N18A 1W4CA 4NCNA 4WECA 3I0NA 4MI3A 1MGPA 1PK7A 1TT5A 2HJWA 3NXSA 4RZIA 4FB5A 1BYUA 1D2CA 3BWCA 3E27A 3EUFA 5JS8A 3BD6A 2PQ0A 4PQYA 4NRDA 1SBHA 2BKEA 4GXRA 5JXHA 3B60A 2DTDA 5FUVA 1UQUA 5KOJB 3NUZA 1KNQA 4NYMR 3OIGA 4GQBA 4ISBA 1OZFA 4UAGA 5E8RA 2H1HA 3D4PA 3SJZA 5C8YB 5EC8A 1OHHD 2BSAA 4JBXA 2VNKA 4PLVA 1TO1E 2BEJA 3EVDA 1WHTA 3X1XA 2AXNA 1OE0A 2FUG1 2UKDA 3ES9A 1HNXB 2PKRA 1K0UA 4Y2PA 4LYEA 1JZQA 1X74A 1A50B 1UDRA 2J9GA 3DO8A 4ZVVA 2OCXA 4INOA 1JHZA 4DL9A 1TUGA 1ZN2A 3LC0A 4V0OA 4BKUA 3JD3A 1HYEA 1LPSA 3WMFA 1OLXB 1UDCA 2VI5A 3H8SA 1W0JD 2DPMA 4WLFA 4YAWA 3VR6H 1WNTA 7ABPA 3LYUA 2LZ0A 2VJOA 2W2KB 2EFJA 3WGLA 1SC9A 5CURA 5HTOA 3B70A 4ALNA 3QV1A 3RSOA 1SBZA 4IQFA 3K05A 1MQ9A 1Q11A 3NXKA 1DTSA 4HX2A 3F5SA 4MNTA 2FR8C 3LDGA 5E2BA 3RUHA 3QVVA 4INPA 4HWSA 3WXBA 5JMWA 1OH8A 4NAUA 1RAFA 3LS2A 4Z0HO 3L4BC 1D5WA 4BRUA 1N8SA 1NXWA 2JAXA 2EU8A 4MVJD 4EKDA 2Q5FA 3PR2B 1PYGA 4IEEA 1ULAA 5I7SA 1YI8A 4AY2A 4JX8A 4U0KA 4U3JA 4A36A 5HP4A 1GLGA 1XTTA 4LZAA 3PQ2A 3HL4A 3RRZA 3BWBA 1XK7A 3B2QA 3ICPA 2CLMB 2XXBA 1M5TA 4UVIA 1ZISA 4K9DA 1K1EA 2VTEA 1NN5A 4GE3A 5AOAA 3W5JA 2XUGA 3AF6A 5HYVA 3QE9Y 2UUCB 4LF5B 3GD7A 5AKYA 5HKKA 2DT8A 5EQDA 5KZMB 1ODLA 2QLJA 3FKSA 3LU1A 3BXPA 3PITA 4UHEA 1N4AA 4MRMA 1PG0A 4MUGA 4D3SA 4ILEA 4AKTA 5KSYA 3FPKA 4RKQA 4BMSA 5IJ0B 5EQFA 3BKWA 3RK4A 3UPUA 1E1DA 4Q9HA 1LI4A 3KBOA 2M2IA 4UUMA 1EP9A 2QMOA 5CVEA 2TSYB 1T5HX 2NU9A 1VJRA 2C0CA 3ELUA 1MVLA 4ND7A 4Q3AA 1B7GO 2HEIA 4XFKA 3D7SA 5D8DA 5IKMA 1O5OA 1KOLA 4BFUA 2AQIA 3D54D 3MGBA 2QRZA 3PRJA 1W85A 4D9CA 3CUSA 2JAHA 2AKAB 2FN3A 4FUTA 3K0CC 3W34A 4C0HA 1C0EA 4B6RA 2RKBA 4UBKA 1KF0A 3TB4A 3BICA 3DMHA 4IF6A 5BWMA 1Q92A 5CFNA 3R23A 4FMDB 3FI9A 4G0ZA 4UHCA 3U4QA 3F6SA 4CV0A 3UWOA 1X80B 2QX8A 1VOTA 2DFVA 4C7VA 5G2OA 1ORHA 3HPRA 4QASA 1UPCA 3T8YA 4JLMA 3FA2A 1YOBA 5CH3A 2X13A 2PH7A 2IYYA 1E63A 2JHAA 3K35A 3IELA 4FU0A 3T54A 2V7GA 2MU1A 3PC7A 5M5BA 1E9CA 4GMDA 2GBPA 4TZTA 4DMUB 3E9YA 5EE3A 3SU8A 3L0OA 4PZEA 3VGJA 4DYVA 4BYMA 4QEZA 4KGDA 3EGXB 2HQRA 3KJHA 2G28A 4O2BF 1KYWA 2KHZA 2IVZA 1E1NA 3KEGA 1U9IA 2BMWA 3X1DA 2Y6VA 3F8WA 4R69A 3ONNA 2YXEA 1WIWA 3HFRA 4NNJA 1SZDA 4DM4A 4RY0A 4GZ6A 1XQ9A 3RODA 3FPEA 2AFHB 3VR5D 4Z9FA 8ABPA 1KMNA 2BI7A 2XDAA 4Y9DA 1L5ZA 1XKTA 3DHNA 3U80A 3L0BA 5I01A 2CNDA 3BVPA 4TVOA 4WZBE 4YQFA 1XA3A 1O77A 2BSQA 3JAKB 1GV1A 2KQUA 4J4TA 4IZ6A 1U7HA 3A1CA 3MA0A 1QH8A 2FN8A 2FUNB 2XAUA 3BFKA 2WILA 5H5JA 3SC6A 2FPLA 1UZUA 3C7AA 3MJEA 3O94A 3CW8X 4OHUA 2JCBA 4JVMA 3UHFA 2E82A 3QVOA 2DHDA 4ARCA 3IQFA 1RAIA 2LBPA 4Y0VA 2OXRA 5IK2D 1N2BA 4MGIR 1YZQA 3R3UA 3FOEC 4QFDA 3JYOA 2WRZA 3QVSA 5C80A 3QJYA 3F46A 4MCJA 2WTEA 5CBPB 1D9ZA 4GOJA 5HJ5A 2P2NA 3LKVA 4L28A 1C8KA 5JHHB 1GCAA 1HEYA 4F4CA 1O9BA 4MUXA 4B8WA 5B2ZA 3U26A 3VZBA 2GRJA 3UOGA 7REQB 4HRAA 3E35A 4DGQA 4EHIA 1VSUA 3HN7A 4UUAA 5TMEA 2WAAA 2WWYA 5EJFA 4BNUA 5E95A 1E5LA 5ITVA 5CD9A 4M8SA 5FTMA 4A0RA 1TM4E 2G67A 3WFZA 1WXIA 3DD5A 4M7WA 3VSDA 2PMKA 4KZKA 3T38A 2EJTA 2OFPA 1Y8QA 2R1UA 2PRYA 4K86A 3UZUA 3KHTA 1KDPA 1PUJA 1SCDA 4LDJA 5J5AA 5IZCA 1U9JA 2QY6A 1ZH4A 4IINA 2F43A 4L50A 1CJMA 4PR0A 5HKKD 3K8OE 1FMJA 2OG1A 1N9GB 2FPOA 3P0IA 2XV1A 2BRUC 3FKSD 1E2MA 1C9EA 3GU3A 2OWEA 1G21E 4EYGA 1I6LA 2FW1A 4NHEA 3ZHOA 1E61A 2QV7A 3T0GA 2O23A 2X7JA 1HR0B 1TKAA 3BHIA 1H2FA 3E53A 3QQPA 1B6RA 4M9SA 4C0LA 3PZRA 3MGGA 5A3SA 1PDOA 3V4SA 3G9TA 1CR6A 1ZVQA 3B6KA 3LUHA 2D5CA 4ZRNA 3T95A 1JMKC 4C4ZA 4DM3A 1XVAA 1SC1A 2FMFA 3E5HA 1P1IA 3ZOKA 2R00C 2B7LA 3DEAA 2VHWA 4O4LF 2J41A 2R25B 4NNOA 4OXKA 2YY5A 3R3YA 3BSWA 3KYDA 1P0QA 3F5DA 4ZV7A 1MR3F 4ZCPA 3E9RA 1FFXA 3RLIA 4JI0B 5SY4A 3D4NA 5BV1A 1O89A 2GAJA 1WDLA 3PEVA 5KOHB 5A7FA 3KLOA 3I6QA 3VSAA 1P2FA 1Y48E 3BG5A 3PJDA 2QPOA 4HY3A 4A7PA 5AW7A 2CJFA 3T61A 4RLFA 1QHEA 3WB9A 4F4IA 3UCFA 1M9NA 1K6IA 1UANA 5PNTA 2CC2A 4OAQA 4RXUA 1CF2O 1BROA 1E5XA 3G5UA 4JL8A 1BG6A 2G9UA 3OZXA 4E2WA 4ARZA 3DAYA 1DCMA 3NMUF 3I5XA 3STWA 1L5RA 1RRFA 1LSSA 4EM6A 5AJVB 3X0DA 1EWRA 1UKAA 4ZO9A 1QYDA 1JAHA 2OG2A 4CFZA 3H2HA 3NTXA 2OKGA 4KBYA 2AI1A 4N9QA 3V2IA 2CL6X 1YCDA 4C2BA 4DNOA 2R7LA 4FGLA 4PG7A 5LA6F 5BT8A 1K75A 5B1DA 3GLIA 1EEXB 4QTYA 4KCGA 3H83A 1JG2A 3V5NA 1F8FA 1YR9A 2EWWA 4QLBA 3CO5A 1EE2A 1QZUA 3EZXA 2ZBFA 1V35A 2JGEA 5ARBA 2HTEA 4TXJA 1HDYA 2FZKA 4L6IA 1YDFA 4OK3A 2NTNA 3Q8MA 4DNFA 5IDXA 4UPVA 1COWD 2BF4A 2XZDA 4EQ6A 1IB6A 4IDAA 3WYCA 3HCBA 5DHRA 1JVBA 3UWPA 1AE1A 1MNQA 2OILA 4KYVA 4YFYA 1UBJS 4D82A 1XTZA 1E77A 3C8ZA 1TQHA 5A62A 4P7GA 1FXWF 4EJMA 3OICA 4QKQA 3ETCA 4C6SA 2X40A 3UMRA 4BRWA 3F7NA 3QELB 1AXRA 5C8XA 1X3SA 2D2IA 3LF1A 3THYB 4F56A 3VKGA 2YVKA 2WY2D 1RI4A 3QVMA 5JW6A 1E9BA 2O52A 3R5SA 5BVHA 1JT2A 1I7DA 3AUFA 4JLPA 4WUVA 1Z15A 4KBGA 1D2HA 2GOYA 3EVEA 4TXNA 4WH0A 3WLIA 3Q88A 2BFFA 3ISJA 3KXKA 3X3HA 1ZUD1 4Z4GA 1PJAA 2QEQA 3I92A 3QBTA 5KOYA 1QDLB 3C3CA 3IKLA 2Q5JA 2X2EA 1XA4A 4KR0A 2Z8ZA 3ASVA 1EWVA 2Y1GA 2XH8A 2CB0A 3ZLUA 4J0CA 1O1YA 2LUOA 4Y6SA 3G3EA 5K4HA 1BA3A 1X1SA 3K9LA 3D31A 3ZU6A 4EARA 5BORA 1YJ5A 4ARIA 3AHJA 3O4IA 1ATIA 3SM9A 2PD4A 4FEEA 4LJ6A 2CLOB 3STXA 1XZNA 2D0IA 1JNYA 4WE3A 1KY2A 2BHNA 1CZUA 1QANA 1QMPA 1R00A 3GNTA 2LE0A 1PEDA 4PLFA 1WG8A 1UKZA 3DXZA 2FDXA 1KRHA 2X0FA 1LDBA 1RLTA 2WVHA 4BDSA 4YAKA 1A96A 1S0UA 2G80A 2JJQA 4FGWA 5L4LA 3O4VA 4JBGA 3HJUA 1HI9A 3TK1A 1ADFA 5CLHA 1I7PA 1SHLA 2FDCA 2FEPA 3L4KA 5A4MS 1HO3A 3M34A 3JD2A 1JIIA 3GIWA 3FJOA 5FL3A 2Z6QA 2HK8A 3FNFA 4JH0A 3QLEA 4ND8B 4OJYA 3RCBA 4RF5A 4OHYA 3ROPA 4FMCF 5KYXB 5EPUA 3HU5A 3CRMA 4HLUA 4RHTA 1ZH2A 5BQ5A 5G0SA 1FTQA 1WRBA 2E2WA 2GEJA 2FLKA 2WAXA 4G4SP 5SZJA 4AY5A 3JPYA 1OWOA 1HETA 2C83A 3CNHA 1BQ3A 2MR5A 2HBZA 6GPBA 4HDSB 4J0GA 1PG5A 1FPMA 1F06A 2ZBRA 3ETEA 2QTNA 3MJFA 4H7FA 4NAHA 4WKCA 3WZ2A 4GWKA 5KTRA 2AT1A 2R8BA 2ZSEA 1H4SA 3ANYB 5KJCA 1I4EB 4YDQA 4D1YA 1Q12A 2WM2A 3I05A 1DAHA 2RG7A 3GRYA 1PT8A 3IPLA 2QTFA 4G2NA 1XC7A 4JLKA 2ID7A 4A0SA 5BV0A 2ZJ7A 4I9UA 2IEIA 3JATA 3QP9A 2FUKA 4LYYA 2IA5A 4IEIA 1NDUA 4PIMA 3NHPA 4UE6A 5CNJA 3RRJA 2ZG6A 1OFUX 1WVMA 2AG0A 1FYEA 2PMWB 4X7BA 3T0FA 2POCA 1HT2E 1V8DA 3DBVO 3G2HA 3EDCA 2YWXA 4CM8B 2X4DA 3MBKA 4MVJE 4C43A 2XUOA 3UV6A 1YL7A 3L07A 3NRJA 4NNPA 5JASA 3ADCA 2PZGA 1Y9JA 3R4VA 4B3SB 3FGNA 2EBWA 3S40A 4Z2AA 2XRFA 3IEVA 3SZGA 3EZNA 2ILVA 1FUUA 2IT1A 2HLPA 2XMZA 4MTLA 3MTEA 2RH9B 4QXOA 2I03A 1JDTA 3GYGA 3VC2A 1RBQA 1YAJA 4L3VA 1YZLA 5AWFC 3RIXA 3IMGA 1IM5A 1H6DA 3U39A 3EZ6A 3V34A 3UWSA 4TWIA 3I4CA 3HHEA 5GONA 5DNYB 4QJIA 1GUFA 1A4RA 4H3HB 3V1UA 4D98A 2IS2A 1EZZA 2FK7A 3NP9A 5EEHA 4D9EA 1RWKA 4CQNA 2NSYA 4HNAA 1DRJA 1IQRA 2CDBA 2Q8PA 3A25A 1OXUA 2QW0X 5EZQA 2XEXA 1Z0IA 4AG5A 1QG6A 2Q5IA 5FPHA 3D6VA 1BVUA 4EO7A 1UPFA 2AUTA 3RS5A 4LOIA 3RVRA 13PKA 4KLRA 4P58A 1C30B 3PNQA 4IJVA 3LTNC 1T9DA 2XUQA 4GI1A 4UNSA 1OIVA 3W8NA 3RTCA 1G3QA 2V7EA 1QO0A 1HDZA 3R76A 5B7GA 4BMCA 5BN4A 5JSZA 1UH5A 3HJAA 4BNIA 3T5AA 2H1VA 2I4RA 2ES4A 2R7KA 1CHDA 4YCDA 4BZQA 3ADBA 2RAUA 4LNUB 4UE3S 1YR8A 1QQ6A 2P67A 3JPWA 2AC7A 4PLYA 1XDZA 2HF9A 4TV8F 3PQEA 4LYJA 4EHNA 1KWGA 3B9RA 4NU8X 1TE2A 1HYQA 4XW2A 1ORRA 1U0GA 5F23A 3P0FA 1BDHA 1KJ9A 6NULA 5A0VA 4J43A 2VK4A 3F6EX 2B3TA 3L6DA 4FB4A 1I4OA 1K7CA 1VIVA 3GLKA 3KSBC 5L3QA 1BMQA 4RPIA 3W06A 4QFMA 1JAXA 1OXXK 4V0LA 2PH1A 3WC4A 2Y77A 5BNIA 2ZIWB 2OHOA 3L7AA 3QPAA 4QHTA 1OX6A 2ZRGA 1AZTA 3G85A 5H70A 1FYXA 1WL8A 1Y82A 4KK3A 1PLLA 3IAUA 3L1IA 4C5CA 2EKBA 5EZSA 1ZA2A 2EATA 3NYWA 1P4JA 2KWIA 4V2UA 4WN9B 2I66A 4WEOA 2A5DA 3IEPA 4FYYA 3FCSB 1YQQA 4WKGA 3PEWA 1IYZA 1YRWA 2UUAB 1PFKA 3O2SB 1QCDA 3FFTA 3HJFA 4W8OA 1U4SA 4BMVA 1VDZA 3ODPA 1KYYA 4LZNA 1AF4A 1T1SA 1Z33A 1V48A 1I51A 5AHKA 1PQUA 1XZAA 2P9HA 4YAOA 1NOKA 5AIBA 4DLAA 4MEJA 5FOVA 1GDHA 1OILA 1TKRA 1VGRA 1BW9A 2FMHA 2GCPA 1RBMA 1KFKB 2CN1A 1I5OA 2NXCA 3O9MA 5CPBA 1F17A 1PSWA 4OK5A 5FPPA 1XOIA 4NYJR 3HA5A 2C00A 3M70A 3A27A 5SYAA 2A0KA 4WNCA 3QSYA 2DJ5A 1JDSA 2C95A 2QVCA 5LBUA 2X0KA 5AJXA 2WINI 1YJCA 2GZ3A 1M1UA 4CUJA 4INJA 3AZPA 3TLGB 3S1AA 3SQLA 4FT2A 4ZK6A 1GAEO 1N2JA 2NZ2A 3VI4B 3PXXA 4WGFA 4I4TF 4LISA 4X3OA 1DO8A 4R3WA 4NPCA 4Q03A 4TT8A 4DDWA 4BQIA 1OGYA 2D6FA 3QX8A 1GZUA 1BOOA 2FSSA 3OPYA 1CZKA 3P9XA 4AURA 5TQ2B 3DV0A 4CIXA 5FWXB 3JV7A 1SKUA 3HEMA 3NM6B 3IA7A 5EI5A 2OE2A 3CG0A 4L2IB 4JI2B 5IFKA 1RI5A 1Z4LA 2BEWB 1IZ7A 1I2CA 2OBMA 4TYQA 4ZZ0A 1OAOC 3Q5DA 1OXTA 2CLKB 3OQNA 3TMYA 1FP6A 2BBSA 4X94A 3V4PB 5JR3A 4LGCA 1QF6A 2PG3A 3K6RA 3N9IA 4GMGA 4Y1RA 4EO9A 4G0MA 2OHFA 1OUMA 3ZIAA 5FPQA 5A0FA 1EWQA 3LVRE 3F96A 2Y1WA 4RHCA 4URHA 3JVDA 5TQJA 2Q9AA 2FHSA 2R9VA 1T3LA 1RM0A 1T9BA 3NUGA 1XXHB 1FL9A 2VSXA 4BP8A 3QEOA 4D79A 2FPXA 4IJKA 2PWBA 4J75A 2QY9A 3WLHA 4C6TB 4QEKA 3K53A 5AW8A 2JFVA 1Z47A 1DJQA 3NG1A 1P7WA 2FEOA 4B46A 4TUYF 2WUFA 5A5DA 2D1FA 1QO0D 1CUXA 1M2VB 1GJRA 4JHLA 4TMYA 5LWQA 5T7BA 3OT5A 3R5FA 4KQ2A 4O0MA 3OKPA 5DLPA 2OZPA 1XZBA 4DV3B 5DM1A 1CQJB 1NFQA 3UJBA 4NBWA 4PCAA 3LUCA 1KYIA 1NDHA 2W2VA 4G85A 3OD5A 5DEOA 3A9TA 4MVJP 4C4OA 3LCJA 1MRSA 4OGFA 3WLTA 1KETA 1ZS9A 1UZAA 2I4TA 3GGCA 5ALLA 2A59A 2ZBGA 3GXBA 1EWYA 1WP4A 3S0JA 3AEKB 1H1DA 4NIMA 1ZA1A 1XPJA 1DC3A 2Y93A 2CV1A 2QP3A 5EGNA 4RZ3A 2BMVA 3PUVA 4HHEA 5F2KA 5AD1A 2X15A 1DNPA 5KWJA 1AQLA 2O14A 4CKEB 1O57A 1NVFA 5B3JA 4CIWA 3TR5A 1KAHA 1S2GA 1JEYA 3NHUA 4TZKA 1THZA 4PXAA 1UMBB 3H2JA 1RC8A 4UFPA 2R65A 4P3XA 3K0AB 4OXQA 1SHKA 3ESZA 2FTKE 3GLUA 2NTYC 3ZWNA 3X1JA 4BMDA 1Z4JA 2PWAA 4XGIA 4K7JA 5GVRA 1GPBA 5JSKA 3QXJA 1COZA 1L8QA 1N0IA 2YASA 3G68A 5ICEA 4IV0A 1IRXA 2GD6A 1A7UA 5IT9A 3LD9A 4J91A 4N0EA 2B0JA 1V11B 1N2EA 4V38A 3V80A 1BOFA 2ACVA 3GGDA 4BAGA 1LQTA 2DE0X 1CUWA 4KI7A 1IDOA 2FPMA 2YOFA 5A0TA 5DP2A 1BHQ1 3LYHA 5KNLA 3D8RA 1HZZA 1T10A 3NT5A 4CM7A 4A92A 1F6BA 4JL5A 1KXZA 1JDBB 4OOFA 3X1MA 5AW2A 3F6YA 3DM5A 3GPCA 1AUVA 2QAGA 3DMDA 4QRDA 4IJQA 5DPMA 3V7FA 4ATNA 4OVKA 2W6IA 4RU1A 1SZPA 3RVQA 4ZYTA 5CFZA 4JROA 2WWIA 3VFDA 2IHJA 3EOZA 4F5WA 3AP1A 4KUHA 1DQRA 3V7WA 4DA8A 1MW9X 3RTDA 3G9XA 1R0LA 5P8WA 4EY3A 2GT1A 3PA6A 4MS4B 1FZQA 2AWNA 2AK2A 5CAEA 5JIBA 1E6LA 1OYWA 3OOSA 2E85A 4TRNA 3PKZA 4C1NA 2A5YB 3GJYA 2WP0A 3SLRA 4WUTA 1KH1A 1UBTS 3WMGA 3AL0C 4LJ7A 1S89A 3D6HA 2WF6A 2P6OA 3LBFA 2GASA 1TJYA 3PP8A 5C4MA 4JYZA 1WMFA 3HV0A 4KXQA 2F4NA 4Q19A 3N05A 1FP4A 4BMYA 4H1WA 2QRJA 4BX2A 4PS0A 1M0TA 2NP6A 2AC4A 3ZY6A 3PNBA 4DC1A 1SO8A 4WD3A 1UOEA 1Z28A 3DUFA 4ML3A 3UMJA 1Q5PA 4B3CA 2WJZB 5ALPA 3CY6A 2C7PA 2JD2A 2QG9A 3BTOA 1VL1A 2D7CA 4MW6A 1OXMA 4LC9A 2I80A 1MBZA 2EG5A 2GSWA 2OEPA 5FHQA 5H3HA 4NCAA 3PC8C 5D87A 4ALLA 3GA0A 3O1JC 3FSRA 1GZ3A 4MWEA 1D5CA 1UBLS 1Q0SA 3SQDA 5ED4A 2OGTA 3KQOA 2EG9A 5E0OA 3OJFA 4QREA 1BJKA 5AUPB 3O8CA 2P1RA 5ICSA 2XWBF 3NX4A 4C0KA 2O5VA 1C3EA 1N1EA 1NJFA 2XX3A 1VBMA 1LJUA 3BFJA 3I3SR 4YJFB 4YCLA 2BM1A 4IIGA 1PFQA 1D2NA 1ONPA 2XMRA 4OCZA 4BLRA 4POOA 4Q9LA 4K9LA 3RH0A 4AZVA 1CJSA 5FRDA 4QVIA 1M3SA 3B1JA 1WHSA 1X7HA 4QTXA 2J0VA 3EY9A 3IMFA 4K05A 2QU8A 1F1JA 2PX6A 2ONYA 1P1BA 4DQVA 1IXZA 3ORFA 5DOVA 3DOEA 3E7XA 1YMVA 1X0VA 3OBBA 2I9PA 3ZCPA 3H19A 4UBJA 1T5TA 3S2IA 3IODA 4QXPA 1EHCA 4PAMA 1NQWA 1AGPA 1V5EA 4NG4A 3AF0A 2I1WA 2WG2A 2J09A 2Q4BA 2VUUA 3K6KA 1IXRC 2GPYA 3KVYA 3OY7A 3QPWA 4ZHQF 2BFOA 3NAMA 3HU3A 4QJBA 4KIGA 2G7ZA 2QT1A 1X7ZA 3L0PA 4EYOA 4CL8A 4AT1A 4H1HA 4Y6RA 2G06A 3LHFA 5J2UA 2Z3WA 1YKSA 3HR7A 4LW8A 3S44A 3UG6A 1ISGA 4WK0B 2AJDA 3AM3A 4B32A 5KYYB 4MQ5A 2CUTA 4BKQA 2X1HA 4OHRA 4NBSA 4ZMSA 4BNTA 5BMVB 3WP0A 1QRAA 2G82A 3MUOA 2D1SA 3DCJA 2K87A 4GZ3A 1VJGA 1HEIA 3PKIA 4CT5A 5IM4A 3B9BA 3NZEA 1XTRA 3MLAA 5JLAA 5TGZA 1Y8ZA 4IKEA 2ZI4A 2BFBA 3M5PA 3A3PA 3NBAA 3B8EA 3IAFA 4ZVOA 1A8QA 1T9KA 3L6BA 3U49A 3RVMA 3QH4A 4EFNA 1A8SA 1UKBA 3ELBA 3OE7A 4CL2A 3I64A 4RX1A 1P4SA 1IONA 3SHTA 1J9EA 3H11B 1CUEA 1QTNA 4DRYA 3R3SA 1ACMA 3KETA 3K0BA 3GLFB 2VDUE 3NWPA 3ABIA 4A3SA 3VAYA 3IBYA 2C98A 4XDHA 1PAUA 3WGMA 2P9ZA 4I8DA 4KEAA 1XFAA 4MKXA 3UT6A 4XGRA 2AA3A 1J21A 2QZSA 2X8LA 1ZUIA 5ALYA 2W6ID 3CZAA 3DBRB 3E7FA 1JWLA 2UZ3A 4RHYA 1KAMA 2ZFUA 1VE9A 2AOTB 2FMXA 2UVQA 5LYJA 5AESA 2ZRFA 3SXJA 3KVVA 1KY4A 1IZZA 5HZGA 5CFRA 4RQAA 4BBJA 2V7XA 1IZ0A 1II8B 3AINA 3G0CA 4OEHA 3WNBA 2DZDA 1XJWA 1E59A 2YMLA 2CFOA 3CLUC 3PGLA 4FHFA 4KX3A 5H16A 3R8CA 3R44A 4EB6A 3PWTA 2VF8A 4N48A 2C4UA 1LGYA 3MWDB 4NOKA 3RU7A 3VTKA 4AJ2A 4C1BA 4EL0A 3PNLA 1J8YF 3K71B 2R87A 4RS3A 1VCHA 3PRKE 1ZVJA 4UZEA 1Z2NX 1NR5A 1YRHA 5FBWB 1YUMA 2VCYA 2X3UA 4CM9A 4YO7A 4I55F 1VJDA 2YUIA 3OFNA 2OQRA 3JWHA 1LFAA 1E9VA 1T0JB 1P0MA 4YRQA 5C31A 2PAAA 4K8RB 4PXYA 3RS9A 4NE2A 3TKYA 3T5GA 5EIAA 1YQTA 1GTVA 1QV6A 4BE4A 1GG2A 2VDNB 1NLFA 2ZATA 4JJ8A 5IAAA 1R4NB 4PIPA 2P2YA 1KY5A 2VJDA 1P3Y1 4WZAB 5KVSA 4RADA 2NO7A 3KWMA 2H1OA 4TS3A 4AN4A 3TQSA 2PWZA 1LBEA 3PHHA 4GYYA 2CL0X 3LGXA 3ZLVA 4C03A 1UBEA 4MDFA 4BLUA 2Y1LA 1DC4A 1V2GA 3LC1O 4YC7A 1FMFA 2PX5A 2HBYA 1PSZA 2WMYA 3QF4B 3QYPA 4E5NA 2REBA 2XOKD 2Q3DA 4RVCA 2AK3A 4Z2YA 2G1AA 3T1NA 4N5NA 1NRXA 1TCUA 4EYQA 3B3AA 3GMIA 3A4LA 1I7NA 3A0RB 3BJZA 3KKPA 4P3PA 5H0IA 1HDEA 3WKBA 4A8TA 4OPMA 2JCSA 2V7VA 3C6KA 3TIIA 2AG5A 4FILA 1IMJA 2V5UA 1BDMA 3UV7A 4HNUA 4NQRA 1ITZA 1DV1A 2O2EA 3SSAA 4B2LA 3KJQA 5AP9A 1PGJA 4R9RA 4FNAA 3SS9X 3EDOA 4M38A 1C1XA 1GZDA 3TTUA 4OQQA 1BXZA 1EXNA 1RXIA 3WHIA 4JCOA 4QEDA 1ZK4A 1L4BA 4XWGA 4Y9UA 1TU4A 4LMRA 1T24A 4PV7A 1DAKA 2I2FA 1YC5A 3FNEA 5JC8A 1R8QA 3II6X 3LY8A 1TYEB 3A6HA 1C80A 2ZIXA 2Q7OE 4RHEA 2P4HX 5F7ZA 2OXIA 5KNCA 4P0PB 4YRPA 5K8UA 4I8XA 1BX3A 3ILHA 4B6FA 1X92A 2CW5A 4P1ZA 1NXVA 2JGIA 2R8ZA 3ANMA 5CGZA 2QN8A 3TTVA 4XJVA 4MCAA 4WZ6A 5ALMA 3T9EA 5KMGA 3Q8XB 1Z8NA 2QUIA 1ZI8A 5BWCA 3I6MA 3Q0EA 1FLAA 2G71A 3TEFA 1K4YA 2PAFA 3R0QA 1S8OA 3BMOB 3BB1A 1A9SA 1E1CB 5JCXA 1E60A 1HBJA 1MFPA 1QH1A 4AJ4A 4CV3A 3OE7D 3QLUC 1UODA 5K2MA 2V55B 2PRKA 4BO7A 4D02A 4CWAA 4Q6BA 4EW1A 2H48A 1VB3A 3GDWA 1RJ9A 3OIYA 4NI5A 3DKKA 7AT1A 1THMA 3DFIA 4IHKA 2CMGA 3JQGA 3S8YA 3QMPA 2HNKA 3T3HA 3WKEA 1EFRA 4CCYA 3T5TA 3QEMA 4ON9A 3TSYA 3WY9A 2I6GA 1Y1LA 1Z06A 2D59A 2YHIB 1OWMA 1TUBA 3P20A 4I99A 4LOAA 4OFZA 4WBXC 5TQ0A 4CM1A 1WOMA 3NDBB 1YA8A 1GGJA 1UKYA 3VZPA 3EA4A 1D1PA 1M2WA 1V3VA 2P1DA 4JBWA 2Y1FA 1I4WA 3V8PA 4ZICA 5JQWA 1NIJA 3RSHA 2L18A 1BVRA 4G56A 5GTDA 1JHMA 1TFRA 1YUNA 3HKCA 3G2PA 4EUSA 4C4SA 2CSXA 1KZYC 3KC2A 4S1TA 2HMUA 3S2ZA 5ERGB 5E7IA 1JQ5A 3EQ6A 3WG9A 3SSOA 4L75A 3ACBA 3K1AB 4CM9D 3AH8A 1AKVA 2A94A 3OFND 4HEA1 4L16A 4LHWA 2VTDA 5EIWA 5J2TF 2AL7A 1WW2A 4J8PA 1L5FA 4FPXA 1P7PA 2C4WA 2J3JA 1TJPB 1KYZA 2LXNA 4M0DA 2NVUB 1FA9A 5LOVB 4A82A 1UT8A 2EZ4A 1MLDA 3K20A 3PX3A 2I2CA 1L5YA 1IH8A 2V7QD 3M49A 2V6IA 2BCGY 4P4SB 4HDMB 1UUFA 1Z5ZA 1MVNA 1WE2A 1NVVQ 2OMEA 3OLVA 3LL4A 4CHGA 4ESOA 5EHXA 3A1UA 3NVMB 1UMDB 2OPBA 2IITA 3G2KA 3P26A 3ZNNA 1V9SA 4CRWB 2W2LA 3BH6A 1DEHA 1JEQB 3GRAA 3WBJA 1OT3A 3EAFA 2WKPA 4IIUA 4BNNA 4D0LB 1PFVA 4KITB 3Q9UA 1T1RA 1GZHB 3AEUB 3AQIA 4XUGB 2VP2A 5EWMB 3RYHA 1QZZA 5IBRA 4JELA 1EQAA 1QFSA 3L1KA 1NXOA 3I04A 3A6ZA 4H31A 1T8RA 2RHJA 2VHUA 1UBGA 1QRRA 3DEYX 1U1CA 5AM1A 5I7AA 3VU9A 5BOSA 5KNDA 3DHEA 1GQQA 2QTLA 2ACWA 2IPMA 3FYDA 3O5AA 5CM2Z 3OWOA 2EL9A 2CFTA 4DQ0A 5K6AC 3HV2A 1H6BA 1EHIA 4OREX 1K63A 5CX1A 1KI8A 2W2PA 3K5IA 3RS0A 2GH1A 5JDCA 5LXTA 1F2TB 3MRTA 4YQEA 4Q7KA 1JH8A 1I9CA 1WXDA 5DT9A 2GPJA 3SPXA 2DCMA 4LGYA 4YI5A 4D9HA 3GVIA 2HMSA 3MTDA 4G5SA 4QBTA 1PNRA 3M3PA 3G9QA 4L22A 4E1BA 4NYMQ 1DLJA 1XZDA 4IICA 3TPCA 1JI3A 4QHYA 5KNCD 1X3LA 1QP0A 1U4NA 2QTAA 3C24A 4RHXA 2PZAA 4H7HA 4X8LA 1LTQA 5JTUA 3LUGA 1GVNB 4BLSA 4W5QA 3G6WA 3SIWA 4DCCA 2RD2A 4MR9B 4C0XA 1VLVA 2V0GA 3QSGA 5MGBA 1SU4A 2YXDA 4LTMA 3LGAA 2WNSA 1C9KA 2H2HA 2Q6TA 1NC3A 4LRWA 1HKHA 4KVAA 5FBHA 5IC5A 1CRLA 1M34A 2GBIA 3Q12A 5EIHA 4TZ0A 3I73A 2B8TA 1HTTA 2IYEA 2OLJA 4JKIA 4HAYA 4U8GA 3VPCA 3ZXSA 2PR2A 5CBKA 3L7DA 4D0SA 1WXGA 2IH4A 1IY9A 1E92A 3B13B 1JIXA 1KHTA 2BEVB 2QM0A 1YJAA 3DB1A 3QWFA 3R09A 4MVJM 3EPRA 3STVA 4U7WA 4CG0A 5DN9A 1T6NA 3DWIA 1TM1E 2QT9A 4L5BA 3ZWWA 3FBWA 1NOIA 3FIUA 1JKJA 1INLA 4R05A 4R6XA 4ZT3A 3ZIDA 3V9AA 4YT5A 2ADFA 4BIMA 1NQXA 1UM8A 2FV8A 4OJQA 2HJHA 4KJZA 1DJNA 1N0UA 1SU8A 1V16A 2WPDA 3ILYA 3OFJA 4DXAA 1UPAA 2H9YA 3I9V1 2DTEA 3IRUA 3ORSA 4HNRA 4UUOA 2C5GA 5TX7A 3NPMA 1NW8A 1JRLA 2I7DA 2JVJA 5AVVA 1Y8AA 2VUHB 1Q6ZA 2EHJA 3T4PA 4HPXB 3X1WA 4P7BA 1CUFA 3F98A 5JMOA 4Q9JA 2YCBA 3PNSA 4FFBA 2O5CA 4WACA 3GG9A 3ZQ6A 3QFFA 1JQDA 2BMJA 4NFYA 4ZD6A 2ASVA 2WHPA 1CR2A 2BPOA 4DNXA 4PYLA 1Q15A 5I9BA 3HQ4O 2OGWA 2OHVA 4YCMA 2HMYB 3LWBA 4OHFA 1OX4B 2PRIA 2ZUBA 3DBLB 5F2OA 3JTMA 3VYTB 4ICIA 3WADA 5DNCA 4KMRA 4DRZA 2B1JA 4GMFA 4QZVA 2H54A 1ODKA 3UXMA 1IK4A 2ZWOA 2E18A 3DVLA 4PRYA 2IWRA 9GPBA 3U37A 3UY4A 4D4IA 2NX2A 3QG1A 3B36A 3EIXA 3HJBA 4AK9A 3MWLA 1KQNA 3U4HA 2BYTA 1AVTA 1U6KA 3AEQB 4I4LA 4MPDA 1V3TA 5JWHA 2B30A 1C29B 1K97A 2P0AA 3FYUC 5EKDA 1D2MA 3HMQA 1NIPA 3LJKA 3TL3A 1E0DA 4O4JF 5F64A 5KNBA 2FK8A 4BO6A 2C5LA 5J4HA 3A3YA 1SCNE 4JLSA 1U1EA 5L3SB 2RK3A 4DY4A 4CG3A 4A0HA 1HLDA 2G0AA 3QOYA 4TROA 4YDHB 3ZQKA 4ER7A 2FXIA 4YNBA 3RYFB 1HRDA 3K72B 2G08A 3JZFA 2J6HA 4F4FA 1WPRA 3TLCA 1QFYA 4F5DA 4JD5A 3U4MA 1M6VB 2K2WA 4GQAA 4IXMA 4LF7B 1PWHA 3VYSB 1HY3A 2ICAA 5DBOA 3JQ8B 4DABA 3GP8A 3WGKA 1RCUA 4X1YA 4U02A 3RQIA 4KRFA 4J3FA 2HGSA 4CMEC 3G9ZA 3HRIA 5JBIA 2B34A 1ZWLA 1BCRA 3D3KA 4QJ4A 3UJ7A 2BHRA 4OHBA 4HP8A 1XXLA 2WIKA 2XUDA 4XB2A 4XKJA 3WNQA 3UXEA 4EZBA 1C7EA 2DY0A 3RHFA 1KI3A 1LC0A 1L2TA 4MQMA 4I81A 3BILA 1XCBA 3G6KA 3MSCA 3HFSA 4NL4H 4QRHA 5H83A 3S5UA 4C0WA 2ISCA 5FL7A 5JXJA 3ECCA 2CDCA 1EBUA 1IM2A 1E5TA 1S2MA 3K4QA 4R16A 2C59A 3TGLA 3ROFA 4CL0A 4YRIA 1W73A 4JUFA 1NJ2A 1CDDA 1P6QA 1DRKA 2ZE8A 4WK4B 1X1AA 3G8CA 3GJ3A 5CXUA 1D4AA 2GZ1A 4RULA 2RBKA 4M0KA 3JWJA 2UUBB 2J0UA 4ZPJA 5DXFA 4KFCA 2VDLB 2GBLA 1P5JA 4ED9A 1U0BB 2L2QA 2GZSA 2MDTA 2Q1SA 3I2HA 3K1YA 4II7A 4JT9A 3HJGA 4J3NA 2ZLBA 5E6UA 1R6BX 1WP9A 2D5IA 4AM8A 1FMTA 1IG3A 2HWXA 3EA0A 4FR0A 4ZJZA 2ZSFA 4G07A 4W5TA 2AJ8A 4HPWA 1RXYA 4L5YA 4Y1GA 2PUGA 4HEQA 5AQEA 1GRVA 2PT6A 4IZIA 4QECA 4UDXX 5KOIA 5ALFA 2QW1A 1KFJB 4ITRC 3ZK9A 2O1WA 4DNPA 2PGXA 5FADA 2QSUA 2ZZKA 1D09A 1O6GA 3KQYA 3T5DA 2WOOA 2HO5A 1RD4A 2QRMA 3N6VA 1Q2XA 4B81A 2YICA 3ONEA 3IDZA 3RJMA 1QR6A 2R1ZA 4US2R 2EP8A 4KLCA 1ZD4A 2F8TA 4ZYXA 1WB5A 4CMIA 2XGSA 2P5UA 3DTVD 1TT5B 3MUNA 3KTDA 1IXKA 3TDMA 3VPDA 4EBBA 2V1UA 4GD3Q 4GPAA 3LBYA 3N6RA 2WYUA 4I7EA 5GONF 3SKYA 1SVIA 1C1HA 4H59A 2MJLA 3PHLA 1IN6A 1B3BA 1U8TA 3FHLA 4KYUA 4MWSA 1E7QA 5AK4A 2C5EA 5ELMA 5LB2A 1ICIA 1TCVA 2PFGA 2IZ1A 3M0EA 4A91A 3SLGA 2FDRA 5KHOC 3W6ZA 1A1SA 1S6YA 4EEZA 3IILA 1KAEA 3QOWA 1T9HA 5BPFA 3AVWA 2EZUA 4DC0A 3DCYA 3D1VA 2XGGA 1JDBC 4N0QA 2FG7C 3DV2A 1JHPA 1LY1A 2R1VA 2ZT5A 1WPXA 3HP1A 3I5MA 5KX5F 3C5EA 3D2BA 4EYKA 1Z5PA 4A2PA 4EG8A 4IEFB 1TM7E 1GTZA 2CCGA 4MV9A 1AUQA 3DF7A 5DJ5A 5E4FA 3L05A 4Q3LA 3VDNB 2FWMX 1AXGA 1E62A 2YHUA 5KNBD 3W2IA 2OBYA 4D81A 3H2IA 3ME5A 4HD8A 1ES9A 4HZIA 4KQ6A 3KK0A 5DBEX 2QRGA 4KAXA 1KI6A 4Y0NA 3NIFB 1ADGA 4D9GA 2QMHA 5FULA 5HTKA 1VKJA 3FPGA 2QROA 3C3BA 4FOPA 3IUMA 5CM8B 4I5GA 5KVAA 1H4QA 2JH8A 1XEFA 1XZFA 5EXXA 3OUTA 3C1TA 3P5BA 1RT9A 2HLNA 2OFWA 1P4GA 3AB7A 4WKPA 4ALIA 2AYYA 2YZGA 4B48A 4BGEA 1E2HA 1U0OC 2ZVQX 4Q16A 2XE8A 3C3DA 2AJLI 4TLDA 1NBIA 3LCVB 3JTEA 3OPXA 4GMXA 4H7JA 4PPGA 3FTFA 1K5PA 5CNMA 1U2QA 4BZWA 1QKKA 1ZH8A 1K98A 1II0A 3E9ZA 4M1SA 3U1BA 2C9MA 2IZ6A 3PK0A 1JPVA 1Z8DA 3WNVA 4MRMB 1JIJA 1Y80A 5BSRA 1KIAA 3W1WA 3CMMA 1G19A 3BF8A 3V8BA 1GGVA 1RWPA 1XQWA 3RWMB 4Z7OB 2AOUA 2ORYA 2HO4A 3HVHA 2VCEA 4LZPA 4OQXA 1M2GA 1VJ0A 4MI9A 4MRPA 4GBMA 2D1QA 3FDXA 2XTAA 4M1ZA 1GAWA 5LA6A 1KZGB 5FL7D 2NU9B 3DAHA 1OY1A 3IIEA 2P65A 1XQYA 3TLAA 1U63A 1RJWA 5BSVA 1AV6A 5GP1A 2ZSAA 3ZU4A 2CVFA 1YSCA 4FOLA 4WJLA 2COKA 1P75A 2V6MA 3RVBA 1AN9A 1W85B 1FNNA 3N6XA 4G5XA 3PFBA 3T9DA 1Z74A 3ZWKA 1MH9A 3KE8A 4FONA 4M8KA 4CMJA 5HF8A 3WX0A 5KO2A 5EVCA 3VM6A 4ABTA 3MINA 5F5NA 3PNMA 1HGXA 1J0DA 3M5WA 3O8OB 4R81A 2I2WA 1E3SA 2LIVA 1YQWA 3R7BA 2AZDA 3H13A 1UMCA 3HBAA 4NECA 5F51A 1KA9H 2XDQA 2HK7A 3QMWA 2BW0A 5EY5B 4AZSA 4DLUA 2MR6A 2ZCVA 4TKVA 2B61A 1KNXA 2VQ3A 4KP7A 4AKIA 5DBFA 1QRUA 3D4LA 4PIVA 5CLJA 3LT0A 3N7UA 3P27A 3HEAA 2W9XA 1PS0A 1D0SA 2Z5LA 2BDUA 5IAEA 4ZC1A 1QONA 3QRWA 3NYIA 5ALSA 4OYRA 3QVWA 3HJRA 2IOHA 3IUQA 2V6JA 3DE2X 1MXHA 4EG4A 1MEJA 5DGTA 4JC0A 5DXJA 3U19A 3LXMA 2WAOA 3CJRA 5BXYA 2Z4SA 1MDFA 3HNPA 3VNVA 3GFQA 3UJ6A 2BC9A 5IBQA 3V55A 1L5OA 3SGLA 1RYYA 4Y9RA 1T5SA 3CE9A 3HA3A 4JP1A 4RQUA 4KXUA 5AKLA 5AKJA 5EGSA 1UPTA 4ES6A 1QQAA 1N5MA 3C6BA 4OJMX 5ALUA 5AO9A 5L4NA 4B3DA 2IDKA 3PJGA 5C81A 1HE5A 3COSA 4FKZA 2OENG 3CPHA 3FMIA 3NWEA 3Q6MA 3SS8A 2DBZA 5MHTA 3NASA 4WOCA 3OQJA 4BUZA 5B30A 4PRLA 3AEYA 1CPYA 2C2HA 4D4HA 1PEKE 4FDUA 4MDEA 4OYHA 4UBIA 2I6SA 2F67A 1QH8B 4L8VA 2ZB7A 3OM8A 3P71T 2ODPA 3FB1A 4MKZA 3EVFA 2JEZA 3DTTA 4LKOA 3S8MA 4FD3A 3HY3A 1RPAA 2H1WA 3A1WA 2VBGA 3ZVRA 4PG5A 1J23A 5IJWA 3O8BA 4HG2A 2F9MA 2IYQA 4BQOA 3OJ0A 1U80A 1O9GA 5LB4A 2OP0A 1EAYA 2WJIA 4BFCA 1SIWA 4C0QC 2ZZNA 3CZ9A 2AHOA 2H2DA 2PZMA 3NR2A 2EQAA 4P5EA 2VSFA 2C7QA 3Q7TA 4HH4A 3WJ7A 3IQWA 3OWXA 4CUZA 3LQYA 2H4HA 2QJFA 4QYXA 5IMBA 4WTOA 3W8DA 3NT4A 5DBGA 4RTLA 2QB5A 3VNBA 2GTPA 3LIPA 2X8AA 2BGKA 3OIFA 1RMYA 4DBVO 2X77A 1EPUA 4TLAA 2RGNC 1J5EB 4IMIB 3RYTC 1POXA 3ZDEA 1Y8QB 3ACDA 1NUTA 2CXSA 3JASA 4G26A 2IU4A 3P9IA 4PBSA 4KXWA 3KOOA 4JJFA 4AIIA 2F43B 4RM2A 5JOQA 3E61A 4M22A 1TMGE 2WTNA 1S8FA 3HI4A 1C1DA 2NZUG 2X0DA 1I1OA 2PKXA 3BEOA 1V7PC 3FVQA 4S0XA 1E79D 2Y3IA 3R7NA 4C14A 5JCOC 3GGPA 3BEDA 1D0VA 1JLHA 4DMFA 2PHZA 4G1BA 4IHJB 4P84A 4DLWA 1BX0A 1XMPA 2DWQA 4ABYA 2PT9A 1V8BA 5FXMA 3VTFA 2IBMA 2VPWA 5COAA 1N2CE 4UEKA 2HUPA 1J0AA 1UJNA 4HYEA 1P0FA 1ZRSA 1O8CA 5FI0B 1PK9A 2B0CA 3FROA 3HO8A 3PQ8A 2HCJB 4XLLA 4PPYA 5DTIA 5FQNA 1R5JA 1SR8A 3FKJA 3EYWA 5TEVA 4EJ6A 4GEGA 1F0PA 1QTIA 3W8FA 5KEIA 4D8XA 4PYRA 2JLXA 3KYDB 4QODA 2JGRA 3FDIA 1FFXB 4D3DA 1L7AA 1AKTA 1MT0A 4D0NA 4R01A 3T7CA 2P9TA 4YUWA 3GUYA 1I94B 1QWSA 5JNVA 4XYMA 2OBLA 1L6RA 3ZI0A 5KC8A 1F8XA 2KYRA 1P2VA 2PL1A 4QRIA 1XCMA 2YVLA 1S1MA 3LXRA 2HQ1A 3OJWA 3QVXA 5DSTA 2Z9BA 2Q6IA 5HCUA 1DIOB 2YXNA 1T4MA 1QO7A 3AR9A 3PHGA 3KAQA 4KHZA 4ARZB 4OGWA 2PMFA 3C6QA 3LLUA 3L79A 4PQFA 4BNFA 1J70A 2GM9A 2DHEA 1ZAYA 2IPAB 3WQQA 2IYAA 3TINA 3P0EA 4MJLA 4J4HA 3UAOA 1IUPA 1OXSC 4P9NA 2P0EA 4UZFA 3BZBA 3KU4A 3GLIB 2XNDD 4R0MA 3ZJUA 4D9BA 4HOYA 4TV8A 4TMTA 3C8MA 2JATA 3OM9A 3ZBQA 3ZDQA 2XB9A 3PF9A 3TQHA 3VYRB 2OORA 2Z04A 2Q5CA 2OGZA 2VHQA 2YQ5A 2UZAA 1WDMA 3AL3A 1ZJ6A 5CDGA 2DUJA 2EJVA 2WV7A 3FCXA 3KLMX 2G40A 1XTSA 1DINA 5ECDA 5IC4A 4S05A 1YB2A 3TCXB 2JI7A 4KV9A 2D3WA 1BGVA 4N6GA 3LLMA 4YACA 5CB8A 1G17A 2Q6VA 3FCYA 3LQ1A 5ULLA 4BATA 1SVOA 4RQTA 1VRVA 4UXHA 2QE7D 3V8RA 4IGEA 4EQ6B 3H9BA 1M0EA 3WLKX 4AS1A 4KLZA 3DSRA 5ECYA 2VDKB 5EZYA 3EW9A 3G7NA 2OCYC 4CTJA 4CI9A 1FNBA 3GUZA 1XI2A 1Y7IA 4RW0A 4JJ7A 1FPQA 1V71A 3IR5A 4G9GA 4F86A 1M7BA 4MLPA 4BO4A 5LQMA 1P60A 2INGX 3ACCA 5TV2A 1QKJA 3AZQA 1Z2PX 1JHOA 1ZMRA 4LRYA 2VWPA 3T4UA 1XMSA 5BVHB 1J25A 4I3FA 4B2YA 5F12A 4NJEA 1P1FA 2XSZA 2YV2A 3PZBA 4MV5A 1NF2A 4EECA 1Z4MA 2E6UX 2HQOA 1S2IA 2FQWA 4X7RA 4Q15A 4FQ7A 4IVQA 5BRNA 2I8AA 3GROA 3M6WA 4MGHA 1CULC 4LXHA 4XWAA 3V1TC 4NYJQ 1JWBB 4AULA 4C88A 4L1KA 4U1RA 4QDUA 4JA2A 2HCTA 3IP7A 3TBKA 1T0HB 1DELA 3K32A 1NE2A 2RARA 1L8AA 4F9GA 4Q7JB 6REQB 2IYVA 3H42B 2H5JA 3NGLA 2HZBA 4EX6A 2A0WA 3NHFA 3DDNA 3LHKA 3D59A 2XYHA 5HF6A 1SUDA 2R3SA 3PDUA 3DOHA 2XA9A 4JASB 3GLHA 4PLCA 3MT9A 1ZU4A 2G76A 1TQ4A 3BTUA 4DWJA 2XUZA 1H1TA 1ZD1A 2PO5A 2PS0A 3E7DA 1FDIA 3KHSA 4GOKA 1LZLA 3DB2A 3I1YA 1SELA 1BDJA 1Q91A 3AV0B 5A9SA 1A1VA 4UCXA 4EJSC 2B7CA 3HM9A 3OCYA 1M6NA 4NH4A 4WERA 3U13A 1J2JA 1KQPA 2UYYA 3EDQA 3CT6A 3UVEA 1O4VA 1LI5A 1QDUA 3K1TA 4EUHA 1Z37A 2M6RA 3KPWA 4BC1A 1T36A 5HOQA 4IJ5A 5CFQA 2GF9A 4G9BA 4QGGA 2I2XB 1WULS 1JQBA 1JBQA 1G63A 2GCNA 4H4DA 4ZQIA 5PGMA 4LFCB 2FR8A 2FRXA 3O82A 4JYAB 3GRPA 2EEZA 2GXAA 5KU7A 1PZHA 3L4BA 3MTJA 5EMNA 3WLAA 4ZC8A 5JJBA 2GCOA 2D5LA 4MV1A 1BN6A 3E82A 5FPTA 5FTJA 3WA6A 4A0QA 3VO9A 1GEEA 1Q7EA 3ENVA 1TMKA 3WBKA 3SQWA 4DLSA 1FU7A 1Z22A 3UKDA 2BOVA 2CXPA 1SULA 3U81A 1HA3A 3JATB 4EABA 5CW2A 1QE0A 1PZXA 2WYWA 3HY6A 1UKCA 4LXYA 2GILA 4FE7A 4RJLA 1L7MA 4JUCA 2XZTA 3VHRA 1Y63A 2ZIZA 3BAFA 1O03A 2JIRA 4X41A 4R1TA 1G8MA 1GPLA 1U7ZA 2HH9A 5FEMA 3ZH9B 2D7DA 4JAVC 4P3OA 1T8TA 5JH7B 1GU1A 2BHSA 1I0LA 4QXQA 1P8AA 2WJ3A 2OGSA 4GEKA 1PTKA 4HDKA 1U0LA 1C0KA 4RK5A 3R77A 3PJFA 1RZVA 2W2MA 2Z2ZA 5DI3A 3ROXA 4XVCA 1ZRMA 3VO1A 3JRWA 4Z99A 3V8EA 4N9WA 1HT1E 4XCVA 3HCNA 1I80A 1H4TA 2HLHA 3CO0S 1E6UA 5IKXA 4IGFA 2JAQA 3QFCA 3IHTA 3KJXA 5T5QA 6AT1A 3BXZA 4WQMA 4AWXA 3BCSA 2O4UX 3ELDA 2R85A 3OHSX 1VLQA 1CEYA 3D1JA 1DWQA 1G20E 1SUIA 3AHFA 1MX5A 3RROA 2XQFA 2PKQO 2KS6A 2ZANA 3CLVA 3NIGB 4IGIA 5HZKA 5JBNA 1BS2A 3K0CA 4ZMRA 4HNAB 4E94A 4GAEA 2C2OA 3R0XA 5LQSA 4PYJA 5LNK6 4IIJF 3WWYA 4G5GA 1MTZA 3AB8A 3FPHA 1ICEA 2DKFA 2I87A 3Q15C 2PMEA 2C2MA 3NKVA 3QUTA 1J8MF 5BQFA 4CIDA 3ZGNA 2ALJA 3ESCA 2VYND 2JGFA 1H2AS 4JL6A 4X20A 1RXEA 1YDMA 2EKLA 4IDGA 3CRRA 1SA0A 2PL5A 2X4IA 2D5AA 3MWFA 5CT9A 1N7HA 1OD6A 5BN4B 4EG1A 2R7MA 4S24A 2NPFA 1P9RA 1MXFA 1Z68A 5C1IA 1GCOA 3UEOA 1QVZA 3M81A 3NM4A 1MU0A 4M1KA 2R2GA 1J24A 4K2AA 3GLTA 1UBKS 2VHTA 4JJKA 5EE5B 2HHLA 2P7IA 1EZ4A 1DAEA 2QD2A 4FHGA 4GM1A 3EVAA 3OCJA 5DGIA 5EKXA 4DPMA 4YYZA 3ANLA 4A23A 1L5QA 2HRZA 2ST1A 3EMBA 4RD3A 3KOUA 1ABFA 5AM5A 2ZREA 1WKVA 2D8AA 4KODA 3NATA 1L8XA 2B2NA 3GJ7A 2BCEA 5JI3E 1P2TA 1XR3A 4LDZA 5C5CA 5L3QB 5GIOE 2ZYUX 3Q3IA 2QL5A 1C3JA 3P2KA 3OEHD 1YRYE 4JYMA 4MXDA 5A3QA 1FW8A 3VPFA 3PXGA 4D97A 2O2SA 3IB3A 2P4QA 4DLLA 2W6JA 4LVNA 4YXFA 3CUEF 3NHBA 3DL7A 3R5TA 4ZKEA 3E3AA 1OU4A 2WE7A 1OVGA 2C8LA 2Z2XA 1XIVA 4QQNA 1YVRA 3UHAA 2EQBA 3JQBA 1W5EA 4GC9A 5IH3A 3K8QA 1ZOPA 4YB8A 4BMZA 4Q9NA 4OI2A 4PFQA 1EEHA 1ORDA 5IAGA 5AVRA 5B7PA 5JCJA 1E5QA 2ZAIA 3PUZA 3T7RA 3K0EA 2VJAA 2QM8A 1ULHA 3KLBA 1BW9B 3PC6A 2AOXA 3S1SA 4RXMA 3ANXA 3IAHA 3CKKA 3GAMA 4UHFA 3FMGA 1WCV1 3QVGA 5SY6A 1UXGA 3CGGA 1QCYA 1AO3A 3CX3A 3NIWA 2Y67A 1CS0A 4JOCA 3MJCA 1HORA 1AKMA 3L82B 3CLTC 3WLEA 1G60A 4RFVA 3NJ8A 3N3BC 4L72A 4R2IA 3T7IA 3N28A 3S1AB 4EL5A 1PJTA 3I2KA 2E1PA 1MJ5A 3IS3A 1B0PA 3STTA 4YAFA 4L76A 5JNTA 3MTQA 4OX9B 2DGDA 1BRMA 1REQA 3EXG2 2XQKA 1I32A 3PC4A 2BRUA 4KO2S 3RF7A 5JISA 3G0DA 3OPYB 4P7JA 4MWZA 4WDQA 1WCWA 4IH4A 4UXJA 4C29A 2AHRA 3DV0B 5EJ9A 1F7VA 2RGBA 3WLSA 2Y1DA 4LJSA 5IP5A 4URVR 1D07A 3NDRA 2WT8A 4LJYA 1WABA 3C43A 3IOYA 1DHRA 4FT4A 2QTRA 4ENSA 2ATVA 4F2WA 3MW8A 4JYBA 2V7TA 4BFWA 2OBFA 2QVYX 2Q0SA 3B85A 3AFNA 4W6ZA 3C8UA 4H6VA 3TEJA 4Y1RB 3ROZA 2KBEA 3DDHA 3LUJA 3ZV5A 2OD7A 3U4GA 2BH9A 2R00A 3FPFA 3NKLA 2PIAA 1EM8A 5JSFA 2QYOA 3PQFA 3T7KA 4JY7A 3THRA 1GGMA 1Q1QA 4LCEA 4HGZA 5AM2A 5I4KA 5FOSA 1Z63A 3T1QA 2PV7A 2J31A 2O0HA 3BCUA 1VBNA 2XMDA 1CS4C 3Q10A 1QOQB 3GXOA 4JENA 5LL6P 1SCAA 1XDSA 3RQSA 3C3JA 4IH9A 2GHTA 3K0FA 3RAEC 5CX4A 3U9LA 1X9HA 1TM3E 2QNBA 3C7CB 3FR8A 3WLNA 3CRZA 4U8HA 3O31A 3VV2A 3E22A 3RKUA 4LPKA 5I9LA 5J23A 1DCFA 1JG7A 4IDQA 5DSXA 1TAHA 2JIBA 2NMVA 1HF3A 1P6XA 4RSRA 1GPAA 4ZOEA 1QNFA 1CDZA 2SECE 3SKVA 5LD2C 3ASYA 3MWKA 4RK1A 1P0PA 4TTVA 4ZVUA 1CP3A 1XL1A 3D7MA 4V02A 2Q0HA 5T41A 3KALA 5HJ7A 4GW3A 2OA0A 5KPJA 3AO0B 3RFCA 4BL5A 1L7RA 1QYIA 3D3WA 3KZNA 4OQFA 2QS9A 2BKXA 3S3TA 4CIVA 4PNZA 4EJ2A 2AR9A 5HDBB 1YMUA 2AC2A 2AD5A 5G53C 3PX2A 1FYFA 3OU2A 2LKDA 1JEYB 2VSYA 4RKFA 1RHUA 3LKDA 3ZJYA 2A88A 5IVPA 3ZGYA 1KAGA 1CX9B 4OQPA 2VNIA 1JS1X 1GKIA 3KT0A 3PHCA 1JTEA 2ZPTX 2NW6A 2R1TB 5H3LA 5L7YA 4EB0A 4CE6A 4MAAA 4B31A 1VIMA 3GR6A 5F5XA 1RLUA 3PXEA 1QH0A 2BMFA 5BV7A 3LOPA 2O0MA 5ERYA 4G01B 2P2CA 1T9AA 2FMKA 3KHKA 3MRVA 2WU4A 3COPA 4LBYA 1XMIA 1ODJA 4XIYA 3P0RA 3OZAA 5CMLA 5DWQA 4CKXA 3I0ZA 4M53A 3QE4A 1O6FA 4M88A 2HLDD 4OSOA 4V1CA 1J56A 4L6AA 3G1TA 4M9ZA 1SXGA 3R41A 1LLDA 4PC2A 2P0YA 5BSEA 1FNDA 1SXJE 3U9TA 1HRKA 5I7OA 4DLZA 3P2EA 1FJGB 1VHJA 5HK9A 1SOUA 3FUVA 1Y3IA 1A7JA 1TPYA 4KSCA 3V3TA 4NICA 4ZV4A 1J97A 2HJVA 1K8RA 5JVDA 2DHCA 2QHXA 4UXIA 1QG0A 1V3UA 2C78A 3GBVA 1DXQA 5I8WA 4YN3A 4LDQA 3KFXA 1AA9A 4AAYA 1U1FA 5HQ3A 3OJLA 4YCJA 4Z1MD 4FDAA 4BQRA 5LKRA 2QG6A 2A5GA 1Y1PA 5I7EA 1XN4A 5IKEA 1JGTA 1QPBA 1NBMA 5CAEB 1GSOA 2QI9C 1KEZA 1NULA 5IEBA 2CCKA 5GINE 3G89A 3WWOA 4UDOA 3DLHA 2R6JA 1ZCBA 3IEKA 4GPBA 1ZXBA 3D5QA 4R1NA 4TTSA 5GAJA 5L7TA 1B41A 3O91A 2EFYA 3HG7A 4JP3A 2ZSKA 4KVZA 2W2TA 2IS1A 1FP4B 3GT4A 2QTZA 2HN9A 2FPPA 4G4JA 4GFDA 2MSEB 4ZOLA 4DR4B 5T6MA 1TU0A 2AV6A 3NBQA 2JG3A 1HZJA 3CEPB 3DUFB 1RKUA 4ERXA 3TCKA 5IF3A 1XRNA 1LBSA 4CIYA 3SC3A 5ADUS 5FUXA 3QI7A 3HL0A 1M7HA 4XUEA 2VK2A 1YC2A 1NMQA 2D3TA 3HSYA 3QBDA 2ILTA 5FA5A 4A6PA 1IAVA 5H8WA 5DM60 2VRCD 4I5IA 1NXQA 5KAPA 2JB9A 2HDHA 2IHNA 3IBFA 3OTHA 3RUPA 3MM4A 1K5GA 3G7UA 1JPNA 2G9QA 2GAFA 3DOUA 3PQ3A 5T64A 3RK0A 1IXSB 2D2EA 4AJOA 2B36A 4LXUA 2V4UA 1WXXA 1VG9B 4HFNA 3CRQA 1HYHA 3WYFA 1K7SN 2I2AA 2X41A 4RFLA 4K5QA 2CV2A 1ZYUA 3S29A 1WHSB 1R6AA 1LKZA 2WHXA 5DLQC 3K1JA 4I2VA 1XQ1A 1KZ6A 1NUAA 4EI7A 1E94E 1JX6A 1KXJA 2I4IA 2RG1A 1GTL1 3K1ZA 3FB4A 3VPSA 2LPMA 3DEKA 5HXAA 1X14A 1WBDA 5AHWA 1JU3A 3K9FC 1D6MA 3MT0A 4TL9A 3KT8A 3EZYA 1OV6A 3NRBA 3HUEA 4CETA 1PNQA 2BTOA 3NEJA 3OOYA 2H8KA 4DBLE 3TRDA 1FP2A 2FEMA 2OLEA 4LDNA 3DE3X 4EHBA 2JKYA 1X7ZB 4J1NA 2WD7A 2EGHA 2ZAYA 1S3GA 3ROKA 4NZMA 4X1KA 1G5FA 2GFHA 4LHZA 3A9RA 1T3TA 2AZMA 2W2QA 2WIBA 3GPDG 2AXEA 5J2UB 1Z0JA 4YREA 3KZOA 1P0CA 5A4AA 3R24A 1XUOA 3I2FA 2X14A 3G5TA 3G2IA 3INYA 1A3CA 1VCNA 3MJDA 1TA9A 5HMLA 2PXHA 2ZI5A 3ZI7A 1WSAA 5CB4F 1D3AA 2V6BA 2UYGA 4KHPB 1C8LA 5ALJA 5L45A 3MOSA 3K2IA 2VDMB 4MI1A 2I3BA 3L6OO 3FNHA 1B3RA 2BFBB 1YB7A 2WSLA 1A4XA 5LU8A 1NXTA 4D0RA 4LRTB 1W4BA 1GZ6A 4IAOA 1WXEA 1FVOA 1X6VA 3A28A 3O9VA 4OLJA 4RIEA 3VR2A 3D2CA 4IMRA 4CT4B 1QYRA 4CTMA 5HRUA 4C7OA 5A06A 3KR2A 4EY4A 1Q1AA 3F6RA 2D1TA 2WB2A 1J7KA 1BWRA 2B1IA 4YMUA 2NO6A 3FDFA 4W7HA 3TM5A 4B3JA 3ZPXA 4B74A 4D3YA 3E58A 1DO0A 3BJRA 1G6Q1 2RKOA 3W5VA 4EPTA 2X0RA 3WL7A 3IUNA 4DAOA 2P6MA 5LYJB 1Z7EA 3HWSA 1KIMA 1RKXA 1QFXA 1M6YA 1VHDA 1NBMD 3D02A 1DS6A 1JKMA 3BJIC 1MG0A 5C1PA 4H7EA 4JMLA 4AJHA 3SIXA 3IVRA 2ZWPA 4D4GA 4XGQA 1Z08A 2G7MC 1N1MA 4Y2GA 4GX1A 1OASA 1YE3A 1SG6A 1Z0SA 4W5OA 1Q6YA 4PBRA 4EB6B 3QYAA 1VMAA 4CTOA 1YRAA 4BEVA 3JALA 4EG6A 3OQMA 5DNWA 7YASA 3LY5A 2A3RA 1MJGA 4OYLA 4HWRA 5BUZA 1Y6ZA 2Q41A 3QE0A 5A71A 4ARAA 4IIVA