3IOSA

Structure of mtb dsbf in its mixed oxidized and reduced forms
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
134
structure length
134
Chain Sequence
b'TVPAQLQFSAKTLDGHDFHGESLLGKPAVLWFWAPWCPTCQGEAPVVGQVAASHPEVTFVGVAGLDQVPAMQEFVNKYPVKTFTQLADTDGSVWANFGVTQQPAYAFVDPHGNVDVVRGRMSQDELTRRVTALT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Disulfide bond forming protein (DsbF)
publication title An extracellular disulfide bond forming protein (DsbF) from Mycobacterium tuberculosis: structural, biochemical, and gene expression analysis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Oxidoreductase
total genus 40
structure length 134
sequence length 134
ec nomenclature
pdb deposition date 2009-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.30.10 Alpha Beta 3-Layer(aba) Sandwich Glutaredoxin Glutaredoxin 3iosA00
1T4ZA 1XPVA 2XPDA 4OFMA 2TRXA 2YJHA 4WF4A 1SJIA 4WR5A 2VIMA 1YY7A 3F6FA 3I9V2 4V2LA 2FA8A 4WETA 1Q4JA 3VPTA 3TKQA 3F6DA 4ZB9A 5A4VA 17GSA 4K8MA 4PXOA 2FUG2 1J08A 2XBIA 1U3IA 3HJMA 2P0GA 3DVWA 1VF2A 3EE2A 4K2DA 1X5EA 2H70A 2EIRA 1PSQA 5H5QA 3E9JB 1VF1A 4O32A 3VLNA 1FB6A 1FHEA 3MAKA 4POMA 1A2JA 1ZCPA 2OBIA 3KIJA 4MJEA 5IO2A 4O7HA 1NSWA 3NOFA 4P3YB 2DJJA 2CZ2A 5ID2B 4YAPA 1TKDB 2RM6A 2K6VA 2CVKA 4Q5FA 4TRXA 3NZNA 1SD8A 1JLVA 3H1NA 2DLXA 5G5FA 1F9MA 4QQ7A 4DSQA 1WMJA 4MH3A 5CREA 2MBTA 3TRPA 1M99A 3WYWA 4POLA 2CX4A 3TRQA 1QFNA 1M7TA 2MMOA 3GKKA 3WT2A 4OFNA 4HZ2A 4L5LA 3V1WA 2RIIA 3ME7A 5DQYA 1GNEA 3APSA 3LORA 3KGKA 2VCQA 4TW5A 3L4NA 2LQOA 3P7XA 1K0OA 4EE0A 4QL9A 1XZOA 2YZUA 4MZCA 4ML1A 3QAGA 1B9XC 2VCWA 2PU9C 4NHWA 2I3YA 1V58A 2OADA 2FA4A 2YCDA 2CVBA 2YV9A 4NV2A 2H19A 2BMXA 2C80A 5IMFA 1UC7A 4K0GA 4KNDA 4IJ3A 2XBQA 2DIYA 3LYPA 4HU9A 1J9BA 3W8JA 2B3SA 4ECJA 3FR3A 4N0ZA 2GT5A 5DQSA 5EPFA 2YN1A 2IJYA 4IGJA 1B4QA 4AJ8A 5J3RA 2ON7A 4PUFC 2B1LA 5ECHB 1QUWA 4RI7A 1VF3A 20GSA 4JZQA 3VFIA 1S3CA 1XFLA 5KN3A 3FKFA 5GZZB 3F4RA 13GSA 4JR4A 2WZ9A 4XIHA 4IQ1A 2EC4A 1BX9A 3IAS2 2YJ7A 2B1KA 4LA1A 1Z6MA 1H4OA 4MK3A 1WOUA 4BL7A 3IHQA 2OACA 3HVSA 4L8EA 1A8YA 2LKUA 3U6VA 2JZRA 5B6NA 1O73A 2H6YA 2VOCA 1JLWA 4PNGA 3RPNA 2VUPA 1TK8B 4TR1A 3ERFA 3DVXA 4OWYA 3AY8A 1HYUA 5KN0A 1EOGA 2ALBA 3PINA 2MYGA 1OKTA 2X8GA 4BPYA 3TRXA 3LQ7A 3KTLA 1SD9A 5ECKB 2O87A 1Z9HA 1QMVA 4CHSA 5IOXA 3IDVA 5JCGA 4F9ZA 2A4VA 3HZ4A 2M80A 5GSTA 4MF5A 2I1UA 4JR6A 3ZVJD 1SKWB 4K1FA 3GX0A 4G10A 2N5FA 4IQAA 1ZYEA 8GSSA 1EOHA 3GTUA 4KCAA 2PGTA 4JEDA 1R5AA 3WT1A 3W6GA 4FYUA 4HU7A 4IELA 1K0NA 1THXA 2AUVA 2OA7A 1W4VA 1XVWA 2O7KA 2YPMA 2KP2A 1QK8A 5IM9A 1DBYA 4LL1B 2L4CA 2LRNA 2GTUA 5G1KA 3GURA 4TN8A 4PQIA 5JWQB 1H75A 5IMZA 22GSA 3CSJA 1YEXA 2WRTA 2F3MA 1PX6A 5HFGA 1S3AA 1T00A 2E2MA 1OC3A 2R5GA 4GLTA 1SJZA 2PWJA 2CAIA 10GSA 3UARA 1MTCA 2DJ1A 4HI7A 3GYKA 1FB0A 1U87A 3FZAA 4HJ2A 1AIUA 1LU4A 1SL1B 3CYNA 3LXZA 2H75A 2GT6A 1K0DA 4BWSA 2DJ3A 3O3TA 2B5XA 1O7UA 4EDZA 1EP7A 2IL3A 1IYHA 4I2TA 4TR0A 4X1UA 1ACVA 2B5EA 6GSUA 4MF7A 3Q19A 3IA1A 3M1GA 2C3QA 1SJ6A 3A3TA 4PURA 4WKWA 1SKSB 5B8BA 2B6MA 6GSWA 3BOAA 4OO5A 4PGTA 2X8HA 1A2LA 3LJRA 1O6JA 5L71A 1R4WA 3HA9A 3KP8A 5DAKA 3UAPA 4WXTA 1C72A 1ERVA 4HQZA 4YQUA 19GSA 2H71A 1YDKA 4TVEA 4TR4A 2P5RA 2I9HA 3GHAA 1XW9A 1B48A 1F37A 3CBUA 4MZBA 4OO4A 3TJKA 2H1BA 1V9WA 2GQKA 4K0NA 5D8IA 3GSTA 1JZRA 2C0DA 1V2AA 2LUSA 2V1MA 4IVFA 5DALA 1SU9A 4WBJA 5ID2A 1KNGA 4F0CA 1TOFA 4IJIA 2I81A 3RAZA 1M0UA 4Q5RA 4I5QA 1PQNA 5IMDA 4MH2A 5D9TA 5D93A 3DIEA 1NW2A 6GSXA 3G7JA 3IOSA 1TXXA 3DWVA 2V32A 1BJXA 1R7HA 1G6YA 3ERGA 1PGTA 2YANA 2OJLA 5IPGA 2LJAA 2K9FA 4ZL8A 2HRFA 4ACSA 2B7JA 1GTIA 2MBSA 2E7PA 4YAVA 2V6KA 4I6XA 1X5CA 2WGRA 4WF5A 12GSA 2WS2A 2B5YA 1PD21 3KCMA 3GIXA 1GLPA 3C8EA 2H76A 4XRDA 3CTFA 4PX1A 2GZPA 2VCTA 4MF6A 4KAEA 2H0IA 5KEJA 1YQ1A 4KE3A 3VWVA 2FGXA 1DE2A 3UBLA 1TRSA 4ZL9A 1AQVA 2LS5A 3KMOA 3FZ4A 3LEFA 6GSVA 2AAWA 4EO3A 1K0MA 2FNOA 4L5OA 1W89A 3EU3A 1K0CA 4FYCA 7GSSA 2LNSA 2RUEA 2VD1A 2CA8A 4MJAA 1GLQA 1ZYQB 5D96A 1TU8A 2HT9A 5KN2A 5ECMB 3W8SA 1BG5A 4ISDA 4JU5A 1GH2A 2EIOA 5HR0A 4ZL7A 4CDOA 4BA7A 3L0HA 1F2EA 2H72A 3HY2A 4EL1A 1V40A 2O8VB 1OVNA 4EF0A 3PGTA 2LJRA 4GSNA 3APQA 3ZTLA 4E8HA 2J9HA 3TKPA 2LSTA 2CVDA 2JACA 3K8NA 4WR4A 1TJDA 2LRTA 3QCPA 5DAKB 4BVYA 2ZCTA 4H86A 2CQ9A 3ERWA 2H66A 2IFQA 3F9UA 2FD3A 3VWUA 2O85A 2HRNA 2YWNA 5DJLA 1FVKA 5B8AA 5IMVA 3I69A 2HYXA 5LCZA 3L9SA 2L4QA 2WB9A 4TKYA 4HZ4A 3IK7A 1U3AA 2CZ3A 2KUCA 1NM3A 1PL1A 5DALB 5ELGA 2CX3A 2X64A 3RHBA 1YZXA 2C0GA 2YNXA 4HOJA 5JCWA 2WCIA 3GRXA 4I2UA 4O92A 3E3EA 1GTBA 1USBA 5INYA 5JWRB 5KN1A 4Z7XA 3P2AA 4MPFA 1NHOA 3FZ9A 4HJMA 3US3A 1JZDA 3F4SA 3QOUA 4X0XA 3KXOA 4PNFA 3GKXA 4ZBDA 4WEYA 3FYGA 3N9JA 2P31A 4DSSA 4OMVA 2GQLA 3A2XA 2J23A 1ST9A 5AIXA 4ILFA 3DEXA 3Q18A 3GKNA 1ZOFA 1T1VA 1I5GA 1BQ7A 4IW9A 3LGCA 5DCHA 1FW1A 2X99A 3ISOA 2DMMA 1AC1A 1Z5YE 3GSSA 3QMXA 5IMAA 2KP1A 4MDCA 1X9MB 3QFBC 1PKWA 2YWMA 5AN1A 4EC0A 3GH9A 4RQRA 4KDYA 1HD2A 3FR9A 3TKSC 2JADA 1CQGA 4AJ7A 2YWOA 1X9SB 3FY7A 2E2GA 1AQWA 2IN3A 3EMPA 4EKZA 3Q6OA 4TXOB 3QD9A 1UVZA 3ZRDA 2K8VA 1I9DA 2AYTA 3JCML 2C0EA 1CQHA 3GFKA 1MD4A 4XS1A 2L6CA 2HFDA 3CMIA 4KGIA 2VCZA 5ECRB 3TKRA 3HYPA 3WGXA 2YZHA 4L0UA 5F8BA 3TB2A 3L9UA 1PX7A 1QGVA 4ZILA 3FHKA 2O89A 4NXIA 4V1Ap 1RQMA 4KDXA 3UL3A 5DJMA 2JSZA 2KOKA 2H1DA 2LV3A 2H73A 5A4WA 1ZZYA 3EYTA 3C71A 1U88A 2IFQB 2H6XA 3M9JA 1SYRA 3F0IA 4BVXA 4EVMA 2QC7A 4KH7A 3F63A 3GMFA 1Z6NA 4IP6A 1G7EA 1TP9A 1ZL9A 1MD3A 2H8LA 1N2AA 4ZB6A 1TW9A 2WFCA 1GP1A 1E6BA 1Z7RA 3HXSA 4KCEA 4XRAA 3KH7A 3GA4A 2VCVA 3TDGA 3FW2A 2CT6A 2QSIA 3QR6A 5H5RA 1GULA 1OE8A 1XWAA 4PQ1A 3HD5A 1M9BA 1O81A 2E0QA 4RUVA 2K18A 3WD6A 3Q74A 2HXKA 3TUEA 1EZKA 3QDNA 4LMWA 3J7Yb 1A0FA 4RI6A 3O6TA 4TR3A 5CAXA 4G19A 3GUSA 3H93A 5JWOB 5ECIB 1GRXA 2VLTA 1BEDA 2LNTA 2OE0A 5DCGA 3VI7A 5CP1A 2V6OA 1XCCA 2PVQA 3KM6A 4JE1A 1AQXA 2K8SA 2H1GA 4ULXA 1X0RA 4DSSB 1XIYA 2IPAA 4PUAA 2JZSA 3H4KA 1SKRB 5CRDA 3N5OA 4MJCA 2NVLA 4MLYA 5F0GA 3A2VA 1U6TA 4G2EA 2VL9A 4YQMA 5A5KA 2GSSA 1OYJA 4OCEA 4Q5NA 1TK0B 4QL7A 3IK9A 2YP6A 5J5NA 5ECNB 2H74A 1EV9A 2L57A 5F05A 4IP1A 1F3BA 3TGZA 3DD3A 4NV5A 5ECQB 2M72A 3HVVA 4K7NA 1T8EB 3D0ZA 4N30A 4YQVA 2HE3A 1BYEA 16GSA 4OCFA 2KLXA 1YJ6A 1JZOA 3BCIA 1G0TA 1HNBA 2IWTA 6GSTA 3C1RA 1GSDA 3G9BA 1F6MC 2GDRA 3H79A 1EGRA 2XPEA 5IOWA 1QQ2A 4N10A 1DE1A 5CRHA 4ECBA 4FO5A 1T4YA 6GSYA 5GSSA 3IRAA 4F03A 5EVOA 5ELAA 1EEJA 3UBKA 1TI1A 3HDCA 3UEMA 3D4TA 2NBSA 1X5DA 2VD0A 1M2DA 5ECOB 1B9YC 4GCIA 1Y6EA 2ES7A 3IXRA 3I6AA 4F82A 1GL8A 5LD0A 5J9CA 4GQFA 3M0FA 2HNLA 3P8WA 3F4TA 5EY6A 2C8UA 4MPGA 1SK2A 2G0FA 2QGVA 3QPMA 5ECLB 5ECSA 3TCOA 1RK4A 1G7OA 4AGSA 3GX8A 1YKCA 4I97A 4KUNA 2C1YA 2IMFA 2X8CA 1TRUA 4KSOA 2EIQA 2GQMA 1Z3EA 4DEJA 3GH6A 3CSHA 3TOTA 4O5RA 2DBCA 6GSSA 1ZGNA 3RDWA 5E59A 4AJ6A 2F8FA 2VL2A 4IN0A 2GLRA 1URMA 3GV1A 1SK1A 1HNAA 1OC9B 1OAZA 1MDJA 3IE3A 4POBA 3OR5A 1M2BA 4MMMA 5CNWA 3S9FA 1MDKA 1UA5A 4XS4A 2P5QA 2HLSA 3WGEA 3TJFA 4K7IA 1A8LA 3QFAC 1ABAA 3CSIA 11GSA 1K0AA 5IPHA 1SENA 3HJOA 4IKHA 4TOPA 2JZTA 1HNCA 3DRNA 5A4UA 1YF0A 2FCHA 5CRGA 4I8BA 3ZIJA 4DSRA 2PBJA 1ERUA 3ZFLA 2DMLA 1XW6A 4IHUA 3RBTA 1EP8A 3EVIA 4TXOA 5C04A 2YWIA 2VAFA 3ZIVA 2XHFA 4K6XA 2NDOA 3EWLA 4V2NA 3QAWA 3TKSE 3ZVJA 5J4UA 5H5SA 2BJXA 3D22A 5FWGA 2GZYA 2H01A 2VL3A 4GXZA 4N11A 3TJJA 1WIKA 2L5LA 2FHEA 3IBHA 3KTBA 2L6DA 2DJ0A 1J0FA 2MMZA 5G31A 9GSSA 4XCSA 3O76A 1XWBA 1SL2B 2HI7A 1MDIA 3HJPA 1KEBA 4GTUA 1OC8A 2JU5A 1GNWA 2WULA 4FH8A 4MP4A 4Q5QA 2PUKC 2JSYA 3C7MA 2GS3A 4DVCA 4NMUA 1WP0A 1LJRA 4NHZA 3BD2A 5CO3A 2OE1A 1VRSD 3DYRA 1X9WB 1M9AA 2H0GA 2H6ZA 2PPTA 2R3XA 2AHEA 4XS6A 1O8XA 2AJQB 4MA9A 4WBRD 2C0FA 3C73A 1XVQA 1A23A 1GTAA 1S3DA 2R2JA 5AIVA 5LNKe 4J56E 2H1AA 3CRTA 3ZZXA 2ZUPA 2WDUA 1AAZA 3TKSA 4KSMA 2F9SA 4HEA2 4E8EA 2I4AA 14GSA 1XOAA 2FWHA 5GAND 3GNJA 3CXGA 5C00A 1K3YA 3I43A 2RUFA 3CRUA 1HQOA 5FT3A 3FR6A 4D73A 3A5WA 4K9ZA 5HR1A 2R37A 3ZMKA 2FLSA 1ERWA 2VM1A 2JL4A 4MJBA 5D9WA 2V2GA 2HSHA 3M8NA 2AV4A 2R6KA 3TJGA 1XXUA 4V1Ag 2IMDA 3HCZA 1ON4A 1GUHA 4GF0A 5IMCA 4MABA 3U5RE 1GSSA 1F3AA 1JFUA 3MDKA 4GQCA 4TXVA 3VWWA 4ZB8A 1YEPA 2Z9SA 3F3RA 4LL4B 4ZIJA 4XS4B 1V98A 3SWLA 2MMAA 2REMA 1KTEA 1PA3A 4N0VA 1VF4A 3GKMA 5IO0A 3WGDA 3LXTA 2FWFA 1XW5A 1MEKA 2HZFA 5HFKA 3FEUA 3LFLA 5JCUA 2IMEA 3TOUA 1FOVA 1OE7A 2LEGA 5G5EA 2C3TA 2CV4A 1NHYA 2RLIA 2C4JA 4RQXA 1TDIA 4CW9A 5IQYA 2A2RA 5CYYA 1A24A 1WE0A 5HR2A 1N8JA 3BCKA 4KDUA 1K3LA 3HZ8A 5AGYA 3KD0A 3M3MA 5COHA 1ERTA 1TU7A 5B7CA 3LWAA 3IAM2 3KP9A 3ZFBA 3KEBA 3IV4A 4EXJA 2VO4A 4KX4A 1BAYA 4EDYA 2LQQA 3EU4A 2PERA 2OBKA 2LJKA 4FIWA 4IBPA 4BWQA 1WPIA 2FWEA 3KJYA 3KH9A 4YH2A 2GSRA 3D21A 4NAXA 3D5JA 1R26A 3KMNA 1AXDA 1XOBA 5D73A 5ECPB 3SBCA 1ZMAA 2DJ2A 3APOA 4POKA 1Z7PA 3DXBA 4X43A 2V41A 1GTUA 5GAPD 2M46A 2NTOA 2YV7A 4JBBA 3UMAA 4HS1A 1B4PA 4G9HA 1SK0A 1FG4A 5F07A 1SYXA 4V2MA 3ZREA 2N5AA 5ABRA 1GSUA 5DDLA 3ED3A 4GRFA 1IYIA 3UOMA 2GGTA 2ZNMA 2GVPA 3DKSA 1OC9A 3UVHA 3IC4A 3MWHA 1JHBA 3HVXA 4ID0A 3G7YA 4D73B 1E2YA 1Q98A 4JRRA 1GSFA 2YOIA 3BBYA 2NPBA 3F3QA 3L9VA 3ZYWA 1TRWA 3VPQA 3ZL5A 1QXHA 1FVJA 1EWXA 1FAAA 4GSTA 2TRCP 3LYKA 3EURA 1XWCA 3EINA 1DUGA 3J7Yk 3D6IA 4NPBA 2N5BA 4PQHA 2OKAA 2IIYA 1O8WA 4KA0A 3KZQA 2PVOC 1T7PB 3VURA 1OKDA 1Y25A 5HFIA 3UIWA 2BTOT 1GUKA 4NWYA 3VWXA 5F06A 2LTKA 3G7IA 3P90A 2R4VA 5G2ZA 2KHPA 2PN8A 5AISA 1XBSA 2RM5A 4AF2A 1SL0B 5FHIA 2TIRA 1YKAA 4F2IA 1WJKA 2L59A 3L78A 5D9XA 1EGOA 4MCUA 3RHCA 2HZEA 2F51A 3EMXA 1EV4A 4ECIA 3GN3A 2L5OA 3PR8A 2C3NA 4J57E 1O85A 5J41A 5DBQA 3PH9A 4ZBBA 1FO5A 2H30A 5HQPA 2AB6A 3C1SA 4GWRA 5CRWA 5HR3A 4XHMA 3ZITA 3R2QA 1A2MA 4L0WA 1YF1A 4HUAA 4LLRA 3ZLPA 2DJKA 1DSBA 1TRVA 4OD7A 3GL5A 3LSZA 1JZWA 2DSAA 3F8UA 2PMTA 1PMTA 1THOA 5D9VA 1K3OA 2QKEA 2LRCA 4OFTA 3QAVA 2F8AA 5E4WA 3RPPA 3UVTA 4ECCA 1ILOA 2DIZA 3DMLA 4EUYA 1WWJA 2FWGA 1KBNA 3IR4A 2GZZA 5EL8A 1PN9A 1AW9A 2VLVA 4TR1B 3UJ1A 3HHVA 3MNGA 1G6WA 3H8QA 2B7KA 3BJ5A 1PL2A 3FK8A 2ON5A 1GSQA 2GSTA 3TJBA 3VI5A 1ML6A 2D2ZA 4K7OA 3MSZA 1K0BA 2WJUA 1A0RP 1UN2A 2VLUA 2IMKA 4FYBA 5B6MA 2MMNA 2CAQA 1VGLA 2VCXA 5G1LA 1GWCA 2IMIA 2DC5A 3GTUB 3HKRA 4HDEA 1PRXA 4J2FA 5IIZA 18GSA 3IPZA 1TTZA 2XC2A 2HSYA 3FRCA 1R5PA 1EEMA 4GSSA 2H0HA 3A2WA 1WRYA 3LG6A 5ENUA 4ML6A 4ZXGA 1B8XA 5DVBA 1TI3A 1PKZA 4LMVA 1M2AA 1V57A 3ZMLA 1GSYA 1TK5B 5J9BA 1LBKA 1GSEA 4HQSA 3VK9A 2FY6A 1XWKA 3CTGA 4F0BA 2G2QA 4MZWA 4KB3A 1AUCA 4ZBAA 3DGQA 3NIVA 3ME8A 4XTSA 3M9KA 5G30A 3E0UA 4IS0A 3FZ5A 1GUMA 2HZEB 3D4MA 2VM2A 1T3BA 2MZCA 1XWGA 3EC3A 2A2SA 2OE3A 1RW1A 2VL2C 3GL3A 2GSQA 4KW6A
chains in the Genus database with same CATH superfamily
1T4ZA 1XPVA 2XPDA 4OFMA 2TRXA 2YJHA 4WF4A 1SJIA 4WR5A 2VIMA 1YY7A 3F6FA 3I9V2 4V2LA 2FA8A 4WETA 1Q4JA 3VPTA 3TKQA 3F6DA 4ZB9A 5A4VA 17GSA 4K8MA 4PXOA 2FUG2 1J08A 2XBIA 1U3IA 3HJMA 2P0GA 3MIXA 3DVWA 1VF2A 3EE2A 4K2DA 1X5EA 2H70A 2EIRA 1PSQA 5H5QA 3E9JB 1VF1A 4O32A 3VLNA 1FB6A 1FHEA 3MAKA 4POMA 1A2JA 1ZCPA 2OBIA 3KIJA 4MJEA 5IO2A 4O7HA 1NSWA 3NOFA 4P3YB 2DJJA 2CZ2A 5ID2B 4YAPA 1TKDB 2RM6A 2K6VA 2CVKA 4Q5FA 4TRXA 3NZNA 1SD8A 1PFOA 1JLVA 3H1NA 2DLXA 5G5FA 1F9MA 4QQ7A 4DSQA 1WMJA 4MH3A 5CREA 2MBTA 3TRPA 1M99A 3WYWA 4POLA 2CX4A 3TRQA 1QFNA 1M7TA 2MMOA 3GKKA 3WT2A 4OFNA 4HZ2A 4L5LA 3V1WA 2RIIA 3ME7A 5DQYA 1GNEA 3APSA 3LORA 3KGKA 2VCQA 4PTSA 4TW5A 3L4NA 4K2XA 2LQOA 3P7XA 1K0OA 4EE0A 4QL9A 1XZOA 2YZUA 4MZCA 4ML1A 3QAGA 1B9XC 2VCWA 2PU9C 4NHWA 2I3YA 1V58A 2OADA 2FA4A 2YCDA 2CVBA 2YV9A 4NV2A 2H19A 2BMXA 2C80A 5IMFA 1UC7A 4K0GA 4KNDA 4IJ3A 2XBQA 2DIYA 3LYPA 4HU9A 1J9BA 3W8JA 2B3SA 4ECJA 3FR3A 4N0ZA 2GT5A 5DQSA 5EPFA 4X4JA 2YN1A 2IJYA 4IGJA 1B4QA 4AJ8A 5J3RA 2ON7A 4PUFC 2B1LA 5ECHB 1QUWA 4RI7A 1VF3A 20GSA 4JZQA 3VFIA 1S3CA 1XFLA 5KN3A 3FKFA 5GZZB 3F4RA 13GSA 4JR4A 2WZ9A 4XIHA 4IQ1A 2EC4A 1BX9A 3IAS2 2YJ7A 2B1KA 4LA1A 1Z6MA 1H4OA 4MK3A 1WOUA 4BL7A 3IHQA 2OACA 3HVSA 4L8EA 1A8YA 2LKUA 3U6VA 2JZRA 5B6NA 1O73A 2H6YA 2VOCA 1JLWA 4PNGA 3RPNA 2VUPA 1TK8B 4TR1A 3ERFA 3DVXA 4OWYA 3AY8A 1HYUA 5KN0A 1EOGA 2ALBA 3PINA 2MYGA 1OKTA 2X8GA 4BPYA 3TRXA 3LQ7A 3KTLA 1SD9A 5ECKB 2O87A 1Z9HA 1QMVA 4CHSA 5IOXA 3IDVA 5JCGA 4F9ZA 2A4VA 3HZ4A 2M80A 5GSTA 4MF5A 2I1UA 4JR6A 3ZVJD 1SKWB 4K1FA 3GX0A 4G10A 2N5FA 4IQAA 1ZYEA 8GSSA 1EOHA 3GTUA 4KCAA 2PGTA 4JEDA 1R5AA 3WT1A 3W6GA 4FYUA 2UZ8A 4HU7A 4IELA 1K0NA 1THXA 2AUVA 2OA7A 1W4VA 5KOWA 1XVWA 2O7KA 2YPMA 2KP2A 1QK8A 5IM9A 1DBYA 4LL1B 2L4CA 3A5IA 2LRNA 2GTUA 5G1KA 3GURA 4TN8A 4K5RA 4PQIA 1H75A 5JWQB 5IMZA 22GSA 3CSJA 1YEXA 2WRTA 2F3MA 4MNNA 1PX6A 5HFGA 1S3AA 1T00A 1PN0A 1OC3A 2E2MA 2R5GA 4GLTA 1SJZA 4USSA 4CY8A 2PWJA 2CAIA 10GSA 3UARA 1MTCA 2DJ1A 4HI7A 3GYKA 1FB0A 1U87A 3FZAA 4HJ2A 1AIUA 1LU4A 1SL1B 3CYNA 3LXZA 2H75A 2GT6A 1K0DA 4BWSA 2DJ3A 3O3TA 2B5XA 1O7UA 4EDZA 5BRTA 1EP7A 2IL3A 1IYHA 3MYDA 4I2TA 4TR0A 4X1UA 1ACVA 2B5EA 6GSUA 4MF7A 2R0PA 3Q19A 3IA1A 3M1GA 2C3QA 1SJ6A 3A3TA 4PURA 4WKWA 1SKSB 5B8BA 2B6MA 1ZYPA 6GSWA 3BOAA 4OO5A 4PGTA 2X8HA 1A2LA 3LJRA 1O6JA 5L71A 1R4WA 3HA9A 3KP8A 5DAKA 4G0LA 3UAPA 4WXTA 1C72A 1ERVA 4HQZA 4YQUA 19GSA 4BIKA 2H71A 1YDKA 4TVEA 4TR4A 2P5RA 2I9HA 3GHAA 1XW9A 1B48A 1F37A 3CBUA 4MZBA 4OO4A 3TJKA 2H1BA 1V9WA 2GQKA 4K0NA 5D8IA 3GSTA 4BL7B 1JZRA 2C0DA 1V2AA 2LUSA 2V1MA 4IVFA 5DALA 1SU9A 4WBJA 5ID2A 1KNGA 1XG8A 4F0CA 1TOFA 4IJIA 2I81A 3RAZA 1M0UA 4Q5RA 4ICYA 4I5QA 1PQNA 5IMDA 4MH2A 5D9TA 5D93A 3DIEA 1NW2A 6GSXA 3G7JA 3IOSA 1TXXA 3DWVA 2V32A 1BJXA 1R7HA 1G6YA 3ERGA 1PGTA 2YANA 2OJLA 5IPGA 2LJAA 2K9FA 4ZL8A 2HRFA 4ACSA 2B7JA 1GTIA 2MBSA 2E7PA 3EPTA 4YAVA 2V6KA 4I6XA 1X5CA 2WGRA 4WF5A 12GSA 2WS2A 2B5YA 1PD21 3KCMA 3GIXA 1GLPA 3C8EA 2H76A 4XRDA 3CTFA 4PX1A 2GZPA 2VCTA 4MF6A 4KAEA 2H0IA 5KEJA 1YQ1A 4KE3A 3VWVA 2FGXA 1DE2A 3UBLA 1TRSA 4ZL9A 1AQVA 2LS5A 3KMOA 3FZ4A 3LEFA 2X4AA 6GSVA 2AAWA 4EO3A 1K0MA 2FNOA 4L5OA 1W89A 3EU3A 1K0CA 4FYCA 7GSSA 2LNSA 2RUEA 2VD1A 2CA8A 4MJAA 1GLQA 1ZYQB 5D96A 1TU8A 2HT9A 5KN2A 5ECMB 2X49A 3W8SA 1BG5A 4ISDA 4JU5A 1GH2A 2EIOA 5HR0A 4ZL7A 4CDOA 4BA7A 3L0HA 1F2EA 2H72A 3HY2A 4EL1A 1V40A 2O8VB 1OVNA 4EF0A 3PGTA 2LJRA 4GSNA 3APQA 3ZTLA 4E8HA 2J9HA 3TKPA 2LSTA 2CVDA 4Z2TA 2JACA 3K8NA 4WR4A 1TJDA 2LRTA 3QCPA 5DAKB 4BVYA 1M3IA 2ZCTA 4H86A 2CQ9A 3ERWA 2H66A 2IFQA 3F9UA 2FD3A 3VWUA 2O85A 2HRNA 2YWNA 5DJLA 1FVKA 5B8AA 2A4HA 5IMVA 3I69A 2HYXA 5LCZA 3L9SA 2L4QA 2WB9A 4TKYA 4HZ4A 3IK7A 1U3AA 2CZ3A 2KUCA 1NM3A 1PL1A 5DALB 5ELGA 2CX3A 2X64A 3RHBA 1YZXA 2C0GA 2YNXA 4HOJA 5JCWA 2WCIA 3GRXA 4O5QA 2QA2A 4I2UA 4O92A 3E3EA 1GTBA 1USBA 5INYA 2HSMA 5JWRB 5KN1A 4MPFA 4Z7XA 3P2AA 1NHOA 3FZ9A 4HJMA 3US3A 1JZDA 3F4SA 3QOUA 4X0XA 3KXOA 4PNFA 3GKXA 4ZBDA 4WEYA 3FYGA 3N9JA 2P31A 4DSSA 4OMVA 2GQLA 3A2XA 2J23A 1ST9A 5AIXA 4ILFA 3DEXA 3Q18A 3GKNA 1ZOFA 1T1VA 1I5GA 1BQ7A 4IW9A 3LGCA 5DCHA 1FW1A 2X99A 3ISOA 2DMMA 1AC1A 1Z5YE 3GSSA 3QMXA 5IMAA 2KP1A 4MDCA 1X9MB 3QFBC 1PKWA 2YWMA 5AN1A 4EC0A 3GH9A 4RQRA 4KDYA 1HD2A 3FR9A 3TKSC 2JADA 1CQGA 4AJ7A 2YWOA 1X9SB 3FY7A 2E2GA 1AQWA 2IN3A 3EMPA 4EKZA 3Q6OA 4TXOB 3QD9A 1UVZA 4YKGA 3HVNA 3ZRDA 2K8VA 1I9DA 2AYTA 3JCML 2C0EA 1CQHA 3GFKA 1MD4A 4XS1A 1S3RA 2L6CA 2HFDA 3CMIA 4KGIA 2VCZA 5ECRB 3TKRA 3HYPA 3WGXA 2YZHA 4L0UA 5F8BA 3TB2A 3L9UA 1PX7A 1QGVA 4ZILA 3FHKA 2O89A 4NXIA 4V1Ap 1RQMA 4KDXA 3UL3A 5DJMA 2JSZA 2KOKA 2H1DA 2LV3A 2H73A 5A4WA 1ZZYA 4CY6A 4BVYB 3EYTA 3C71A 1U88A 2IFQB 2H6XA 3M9JA 1SYRA 3F0IA 4BVXA 4EVMA 2QC7A 4KH7A 3F63A 3GMFA 1Z6NA 4IP6A 1G7EA 1TP9A 1ZL9A 1MD3A 2H8LA 1N2AA 4ZB6A 1TW9A 2WFCA 1GP1A 1E6BA 1Z7RA 3HXSA 4KCEA 4XRAA 3KH7A 3GA4A 2VCVA 3TDGA 3FW2A 1ZYNA 2A2PA 2CT6A 2QSIA 3QR6A 5H5RA 1GULA 1OE8A 1XWAA 4PQ1A 1M3JA 3HD5A 1M9BA 1O81A 2E0QA 4RUVA 2K18A 3WD6A 3Q74A 2HXKA 3TUEA 1EZKA 3QDNA 4LMWA 3J7Yb 1A0FA 4RI6A 3O6TA 4TR3A 5CAXA 4G19A 3GUSA 3H93A 5JWOB 5ECIB 1GRXA 2VLTA 1BEDA 2LNTA 2OE0A 5DCGA 3VI7A 5CP1A 2V6OA 1XCCA 2HRKA 2PVQA 3KM6A 4JE1A 1AQXA 2K8SA 2H1GA 4ULXA 1X0RA 4DSSB 1XIYA 2IPAA 4PUAA 2JZSA 3H4KA 1SKRB 5CRDA 3N5OA 4MJCA 2NVLA 4MLYA 5F0GA 3A2VA 1U6TA 4G2EA 2VL9A 4YQMA 5A5KA 2GSSA 1OYJA 4OCEA 4Q5NA 1TK0B 4QL7A 3IK9A 2YP6A 5J5NA 5ECNB 2H74A 1EV9A 2L57A 5F05A 4IP1A 1F3BA 3TGZA 3DD3A 4NV5A 5ECQB 2M72A 3HVVA 4K7NA 1T8EB 3D0ZA 4N30A 4YQVA 2HE3A 1BYEA 16GSA 4OCFA 2KLXA 1YJ6A 1JZOA 3BCIA 1G0TA 1HNBA 2IWTA 6GSTA 3C1RA 1GSDA 3G9BA 1F6MC 2GDRA 3H79A 1EGRA 2XPEA 2HRAA 5IOWA 1QQ2A 4N10A 1DE1A 5CRHA 4ECBA 4FO5A 1T4YA 6GSYA 5GSSA 2DKHA 3IRAA 4F03A 5EVOA 5ELAA 1EEJA 3UBKA 1TI1A 3HDCA 3UEMA 3D4TA 2NBSA 1X5DA 2VD0A 1M2DA 5ECOB 1B9YC 4GCIA 1Y6EA 2ES7A 3IXRA 3I6AA 4F82A 1GL8A 5LD0A 5J9CA 4GQFA 3M0FA 2HNLA 3P8WA 3F4TA 5EY6A 2C8UA 4MPGA 1SK2A 2G0FA 2QGVA 3QPMA 5ECLB 5ECSA 3TCOA 1RK4A 1G7OA 4BVXB 4AGSA 3GX8A 1YKCA 4I97A 4KUNA 2C1YA 2IMFA 2X8CA 1TRUA 4KSOA 2EIQA 2GQMA 1Z3EA 4DEJA 3GH6A 3CSHA 3TOTA 4O5RA 3IHGA 2DBCA 6GSSA 1ZGNA 3RDWA 5E59A 4AJ6A 2F8FA 2VL2A 4IN0A 2GLRA 1URMA 3GV1A 1SK1A 1HNAA 1OC9B 1OAZA 1MDJA 3IE3A 4POBA 3OR5A 1M2BA 4MMMA 5CNWA 3S9FA 1MDKA 1UA5A 4XS4A 2P5QA 2HLSA 3WGEA 3TJFA 4K7IA 1A8LA 3QFAC 1ABAA 3CSIA 11GSA 1K0AA 5IPHA 1SENA 3HJOA 4IKHA 4TOPA 2JZTA 2R0CA 3IC8A 1HNCA 3DRNA 5A4UA 1YF0A 2FCHA 5CRGA 4I8BA 3ZIJA 4DSRA 2PBJA 1ERUA 3ZFLA 2DMLA 1XW6A 4IHUA 3RBTA 1EP8A 3EVIA 4TXOA 5C04A 2YWIA 2VAFA 3ZIVA 2XHFA 4K6XA 2NDOA 3EWLA 4V2NA 3QAWA 3TKSE 3ZVJA 5J4UA 5H5SA 2BJXA 3D22A 5FWGA 2GZYA 2H01A 2VL3A 4O5UA 4GXZA 4N11A 3TJJA 1WIKA 2L5LA 2FHEA 3IBHA 3KTBA 2L6DA 2DJ0A 1J0FA 4G0KA 2MMZA 5G31A 9GSSA 4XCSA 3O76A 1XWBA 1FOHA 1SL2B 2HI7A 1MDIA 3HJPA 1KEBA 4GTUA 1OC8A 2JU5A 1GNWA 2WULA 4FH8A 4MP4A 4Q5QA 2PUKC 2JSYA 3C7MA 2GS3A 4DVCA 4NMUA 1WP0A 1LJRA 4NHZA 3BD2A 5CO3A 2OE1A 4KF9A 1VRSD 3DYRA 1X9WB 1M9AA 2H0GA 2H6ZA 2PPTA 2R3XA 2AHEA 4XS6A 1O8XA 2AJQB 4A5PA 4MA9A 4HSCX 4WBRD 2C0FA 3C73A 1XVQA 1A23A 1GTAA 1S3DA 2R2JA 5AIVA 5LNKe 4J56E 2H1AA 3CRTA 3ZZXA 2ZUPA 2WDUA 1AAZA 3TKSA 4KSMA 2F9SA 4HEA2 4E8EA 2I4AA 14GSA 1XOAA 2FWHA 5GAND 3GNJA 3CXGA 5C00A 1K3YA 3I43A 2RUFA 3CRUA 1HQOA 5FT3A 3FR6A 4D73A 3A5WA 4K9ZA 5HR1A 2R37A 3ZMKA 2FLSA 1ERWA 2VM1A 2JL4A 4MJBA 5D9WA 2V2GA 2HSHA 3M8NA 2AV4A 2R6KA 3TJGA 1XXUA 4V1Ag 2IMDA 3HCZA 1ON4A 1GUHA 4GF0A 5IMCA 4MABA 3U5RE 1GSSA 1F3AA 1JFUA 3MDKA 4GQCA 4TXVA 3VWWA 4ZB8A 1YEPA 2Z9SA 3F3RA 4LL4B 4ZIJA 4XS4B 1V98A 3SWLA 2MMAA 2REMA 1KTEA 1PA3A 4N0VA 1VF4A 3GKMA 5IO0A 3WGDA 3LXTA 2FWFA 1XW5A 1MEKA 2HZFA 5HFKA 3FEUA 3LFLA 5JCUA 2IMEA 3TOUA 1FOVA 1OE7A 2LEGA 5G5EA 2C3TA 2CV4A 1NHYA 2RLIA 2C4JA 4RQXA 1TDIA 4CW9A 5IQYA 2A2RA 5CYYA 1A24A 1WE0A 5HR2A 1N8JA 3BCKA 4KDUA 1K3LA 3HZ8A 5AGYA 3R3EA 3KD0A 3M3MA 5COHA 1ERTA 1TU7A 5B7CA 3LWAA 3IAM2 3KP9A 3ZFBA 3KEBA 3IV4A 4EXJA 2VO4A 4KX4A 1BAYA 4EDYA 2LQQA 4Z2RA 3EU4A 2PERA 2OBKA 2LJKA 4FIWA 4IBPA 4BWQA 1WPIA 2FWEA 3KJYA 3KH9A 4YH2A 2GSRA 3D21A 4NAXA 3D5JA 1R26A 3KMNA 1AXDA 1XOBA 5D73A 5KOXA 5ECPB 3SBCA 1ZMAA 2DJ2A 3APOA 4POKA 1Z7PA 3DXBA 4X43A 2V41A 1GTUA 5GAPD 2M46A 2NTOA 2YV7A 4JBBA 3UMAA 4HS1A 1B4PA 4G9HA 1SK0A 1FG4A 5F07A 1SYXA 4V2MA 3ZREA 2N5AA 5ABRA 1GSUA 5DDLA 3ED3A 4GRFA 1IYIA 3UOMA 2GGTA 2ZNMA 2GVPA 3DKSA 1OC9A 3UVHA 3IC4A 3MWHA 1JHBA 2DKIA 3HVXA 4ID0A 3G7YA 4D73B 1E2YA 1Q98A 4JRRA 3FMWA 1GSFA 2YOIA 3BBYA 2NPBA 3F3QA 3L9VA 3ZYWA 1TRWA 3VPQA 3ZL5A 1QXHA 1FVJA 1EWXA 1FAAA 4GSTA 2TRCP 3LYKA 3EURA 4G0IA 1XWCA 3EINA 1DUGA 3J7Yk 3D6IA 4NPBA 2N5BA 4PQHA 2OKAA 2IIYA 1O8WA 4KA0A 3KZQA 2PVOC 1T7PB 3VURA 1OKDA 1Y25A 5HFIA 4FQUA 3UIWA 2BTOT 1GUKA 4NWYA 3VWXA 5F06A 2LTKA 3G7IA 3P90A 2R4VA 3LW9A 5G2ZA 2KHPA 2PN8A 5AISA 1XBSA 2RM5A 4AF2A 1SL0B 5FHIA 2TIRA 1YKAA 4F2IA 1WJKA 2L59A 3L78A 5D9XA 1EGOA 4MCUA 3PPUA 3RHCA 2HZEA 2F51A 3EMXA 1EV4A 4ECIA 3GN3A 2L5OA 3PR8A 2C3NA 4J57E 1O85A 5J41A 2R0GA 5DBQA 3PH9A 4ZBBA 1FO5A 2H30A 5HQPA 2AB6A 3C1SA 4GWRA 5CRWA 5HR3A 4XHMA 3ZITA 3R2QA 1A2MA 4L0WA 1YF1A 4HUAA 4LLRA 3ZLPA 2DJKA 1DSBA 1TRVA 4OD7A 3GL5A 3LSZA 1JZWA 2DSAA 3F8UA 2PMTA 1PMTA 1THOA 5D9VA 2QA1A 1K3OA 2QKEA 2LRCA 4OFTA 3QAVA 2F8AA 5E4WA 3RPPA 3UVTA 4ECCA 1ILOA 2DIZA 3DMLA 4EUYA 1WWJA 2FWGA 4K5SA 1KBNA 3IR4A 2GZZA 5EL8A 1PN9A 1AW9A 2VLVA 4TR1B 5BMUA 3UJ1A 3HHVA 3MNGA 1G6WA 3H8QA 2B7KA 3BJ5A 1PL2A 3FK8A 2ON5A 1GSQA 2GSTA 3TJBA 3VI5A 4EIPA 1ML6A 2D2ZA 4K7OA 3MSZA 1K0BA 2WJUA 1A0RP 1UN2A 2VLUA 2IMKA 4FYBA 5B6MA 2MMNA 2CAQA 1VGLA 2VCXA 5G1LA 1GWCA 2IMIA 2DC5A 3GTUB 3HKRA 4HDEA 1PRXA 4J2FA 5IIZA 18GSA 3IPZA 1TTZA 2XC2A 2HSYA 3FRCA 1R5PA 1EEMA 4GSSA 4Z2UA 2H0HA 3A2WA 1WRYA 3LG6A 4YKFA 5ENUA 4ML6A 4ZXGA 1B8XA 5DVBA 1TI3A 1PKZA 4LMVA 1M2AA 1V57A 3ZMLA 1GSYA 1TK5B 5J9BA 1LBKA 1GSEA 4HQSA 3VK9A 2FY6A 3CQFA 1XWKA 3CTGA 4F0BA 2G2QA 4MZWA 4KB3A 1AUCA 4EIQA 4ZBAA 3DGQA 3NIVA 3ME8A 4XTSA 3M9KA 5G30A 3E0UA 4IS0A 3FZ5A 1GUMA 2HZEB 3D4MA 2VM2A 1T3BA 2MZCA 1XWGA 3EC3A 2A2SA 2OE3A 1RW1A 2VL2C 3GL3A 2GSQA 4KW6A
chains in the Genus database with same CATH topology
1T4ZA 1XPVA 2XPDA 4OFMA 2TRXA 2YJHA 4WF4A 1SJIA 4WR5A 2VIMA 1YY7A 3F6FA 3I9V2 4V2LA 2FA8A 4WETA 1Q4JA 3VPTA 3TKQA 3F6DA 4ZB9A 5A4VA 17GSA 4K8MA 4PXOA 2FUG2 1J08A 2XBIA 1U3IA 3HJMA 2P0GA 3MIXA 3DVWA 1VF2A 3EE2A 4K2DA 1X5EA 2H70A 2EIRA 1PSQA 5H5QA 3E9JB 1VF1A 4O32A 3VLNA 1FB6A 1FHEA 3MAKA 4POMA 1A2JA 1ZCPA 2OBIA 3KIJA 4MJEA 5IO2A 4O7HA 1NSWA 3NOFA 4P3YB 2DJJA 2CZ2A 5ID2B 4YAPA 1TKDB 2RM6A 2K6VA 2CVKA 4Q5FA 4TRXA 3NZNA 1SD8A 1JLVA 3H1NA 2DLXA 5G5FA 1F9MA 4QQ7A 4DSQA 1WMJA 4MH3A 5CREA 2MBTA 3TRPA 1M99A 3WYWA 4POLA 2CX4A 3TRQA 1QFNA 1M7TA 2MMOA 3GKKA 3WT2A 4OFNA 4HZ2A 4L5LA 3V1WA 2RIIA 3ME7A 5DQYA 1GNEA 3APSA 3LORA 3KGKA 2VCQA 4PTSA 4TW5A 3L4NA 4K2XA 2LQOA 3P7XA 1K0OA 4EE0A 4QL9A 1XZOA 2YZUA 4MZCA 4ML1A 3QAGA 1B9XC 2VCWA 2PU9C 4NHWA 2I3YA 1V58A 2OADA 2FA4A 2YCDA 2CVBA 2YV9A 4NV2A 2H19A 2BMXA 2C80A 5IMFA 1UC7A 4K0GA 4KNDA 4IJ3A 2XBQA 2DIYA 3LYPA 4HU9A 1J9BA 3W8JA 2B3SA 4ECJA 3FR3A 4N0ZA 2GT5A 5DQSA 5EPFA 4X4JA 2YN1A 2IJYA 4IGJA 1B4QA 4AJ8A 5J3RA 2ON7A 4PUFC 2B1LA 5ECHB 1QUWA 4RI7A 1VF3A 20GSA 4JZQA 3VFIA 1S3CA 1XFLA 5KN3A 3FKFA 5GZZB 3F4RA 13GSA 4JR4A 2WZ9A 4XIHA 4IQ1A 2EC4A 1BX9A 3IAS2 2YJ7A 2B1KA 4LA1A 1Z6MA 1H4OA 4MK3A 1WOUA 4BL7A 3IHQA 2OACA 3HVSA 4L8EA 1A8YA 2LKUA 3U6VA 2JZRA 5B6NA 1O73A 2H6YA 2VOCA 1JLWA 4PNGA 3RPNA 2VUPA 1TK8B 4TR1A 3ERFA 3DVXA 4OWYA 3AY8A 1HYUA 5KN0A 1EOGA 2ALBA 3PINA 2MYGA 1OKTA 2X8GA 4BPYA 3TRXA 3LQ7A 3KTLA 1SD9A 5ECKB 2O87A 1Z9HA 1QMVA 4CHSA 5IOXA 3IDVA 5JCGA 4F9ZA 2A4VA 3HZ4A 2M80A 5GSTA 4MF5A 2I1UA 4JR6A 3ZVJD 1SKWB 4K1FA 3GX0A 4G10A 2N5FA 4IQAA 1ZYEA 8GSSA 1EOHA 3GTUA 4KCAA 2PGTA 4JEDA 1R5AA 3WT1A 3W6GA 4FYUA 2UZ8A 4HU7A 4IELA 1K0NA 1THXA 2AUVA 2OA7A 1W4VA 5KOWA 1XVWA 2O7KA 2YPMA 2KP2A 1QK8A 5IM9A 1DBYA 4LL1B 2L4CA 3A5IA 2LRNA 2GTUA 5G1KA 3GURA 4TN8A 4K5RA 4PQIA 1H75A 5JWQB 5IMZA 22GSA 3CSJA 1YEXA 2WRTA 2F3MA 4MNNA 1PX6A 5HFGA 1S3AA 1T00A 1PN0A 1OC3A 2E2MA 2R5GA 4GLTA 1SJZA 4USSA 4CY8A 2PWJA 2CAIA 10GSA 3UARA 1MTCA 2DJ1A 4HI7A 3GYKA 1FB0A 1U87A 3FZAA 4HJ2A 1AIUA 1LU4A 1SL1B 3CYNA 3LXZA 2H75A 2GT6A 1K0DA 4BWSA 2DJ3A 3O3TA 2B5XA 1O7UA 4EDZA 5BRTA 1EP7A 2IL3A 1IYHA 3MYDA 4I2TA 4TR0A 4X1UA 1ACVA 2B5EA 6GSUA 4MF7A 2R0PA 3Q19A 3IA1A 3M1GA 2C3QA 1SJ6A 3A3TA 4PURA 4WKWA 1SKSB 5B8BA 2B6MA 1ZYPA 6GSWA 3BOAA 4OO5A 4PGTA 2X8HA 1A2LA 3LJRA 1O6JA 5L71A 1R4WA 3HA9A 3KP8A 5DAKA 4G0LA 3UAPA 4WXTA 1C72A 1ERVA 4HQZA 4YQUA 19GSA 2H71A 1YDKA 4TVEA 4TR4A 2P5RA 2I9HA 3GHAA 1XW9A 1B48A 1F37A 3CBUA 4MZBA 4OO4A 3TJKA 2H1BA 1V9WA 2GQKA 4K0NA 5D8IA 3GSTA 4BL7B 1JZRA 2C0DA 1V2AA 2LUSA 2V1MA 4IVFA 5DALA 1SU9A 4WBJA 5ID2A 1KNGA 4F0CA 1TOFA 4IJIA 2I81A 3RAZA 1M0UA 4Q5RA 4ICYA 4I5QA 1PQNA 5IMDA 4MH2A 5D9TA 5D93A 3DIEA 1NW2A 6GSXA 3G7JA 3IOSA 1TXXA 3DWVA 2V32A 1BJXA 1R7HA 1G6YA 3ERGA 1PGTA 2YANA 2OJLA 5IPGA 2LJAA 2K9FA 4ZL8A 2HRFA 4ACSA 2B7JA 1GTIA 2MBSA 2E7PA 3EPTA 4YAVA 2V6KA 4I6XA 1X5CA 2WGRA 4WF5A 12GSA 2WS2A 2B5YA 1PD21 3KCMA 3GIXA 1GLPA 3C8EA 2H76A 4XRDA 3CTFA 4PX1A 2GZPA 2VCTA 4MF6A 4KAEA 2H0IA 5KEJA 1YQ1A 4KE3A 3VWVA 2FGXA 1DE2A 3UBLA 1TRSA 4ZL9A 1AQVA 2LS5A 3KMOA 3FZ4A 3LEFA 2X4AA 6GSVA 2AAWA 4EO3A 1K0MA 2FNOA 4L5OA 1W89A 3EU3A 1K0CA 4FYCA 7GSSA 2LNSA 2RUEA 2VD1A 2CA8A 4MJAA 1GLQA 1ZYQB 5D96A 1TU8A 2HT9A 5KN2A 5ECMB 2X49A 3W8SA 1BG5A 4ISDA 4JU5A 1GH2A 2EIOA 5HR0A 4ZL7A 4CDOA 4BA7A 3L0HA 1F2EA 2H72A 3HY2A 4EL1A 1V40A 2O8VB 1OVNA 4EF0A 3PGTA 2LJRA 4GSNA 3APQA 3ZTLA 4E8HA 2J9HA 3TKPA 2LSTA 2CVDA 4Z2TA 2JACA 3K8NA 4WR4A 1TJDA 2LRTA 3QCPA 5DAKB 4BVYA 2ZCTA 4H86A 2CQ9A 3ERWA 2H66A 2IFQA 3F9UA 2FD3A 3VWUA 2O85A 2HRNA 2YWNA 5DJLA 1FVKA 5B8AA 2A4HA 5IMVA 3I69A 2HYXA 5LCZA 3L9SA 2L4QA 2WB9A 4TKYA 4HZ4A 3IK7A 1U3AA 2CZ3A 2KUCA 1NM3A 1PL1A 5DALB 5ELGA 2CX3A 2X64A 3RHBA 1YZXA 2C0GA 2YNXA 4HOJA 5JCWA 2WCIA 3GRXA 4O5QA 2QA2A 4I2UA 4O92A 3E3EA 1GTBA 1USBA 5INYA 2HSMA 5JWRB 5KN1A 4MPFA 4Z7XA 3P2AA 1NHOA 3FZ9A 4HJMA 3US3A 1JZDA 3F4SA 3QOUA 4X0XA 3KXOA 4PNFA 3GKXA 4ZBDA 4WEYA 3FYGA 3N9JA 2P31A 4DSSA 4OMVA 2GQLA 3A2XA 2J23A 1ST9A 5AIXA 4ILFA 3DEXA 3Q18A 3GKNA 1ZOFA 1T1VA 1I5GA 1BQ7A 4IW9A 3LGCA 5DCHA 1FW1A 2X99A 3ISOA 2DMMA 1AC1A 1Z5YE 3GSSA 3QMXA 5IMAA 2KP1A 4MDCA 1X9MB 3QFBC 1PKWA 2YWMA 5AN1A 4EC0A 3GH9A 4RQRA 4KDYA 1HD2A 3FR9A 3TKSC 2JADA 1CQGA 4AJ7A 2YWOA 1X9SB 3FY7A 2E2GA 1AQWA 2IN3A 3EMPA 4EKZA 3Q6OA 4TXOB 3QD9A 1UVZA 4YKGA 3ZRDA 2K8VA 1I9DA 2AYTA 3JCML 2C0EA 1CQHA 3GFKA 1MD4A 4XS1A 2L6CA 2HFDA 3CMIA 4KGIA 2VCZA 5ECRB 3TKRA 3HYPA 3WGXA 2YZHA 4L0UA 5F8BA 3TB2A 3L9UA 1PX7A 1QGVA 4ZILA 3FHKA 2O89A 4NXIA 4V1Ap 1RQMA 4KDXA 3UL3A 5DJMA 2JSZA 2KOKA 2H1DA 2LV3A 2H73A 5A4WA 1ZZYA 4CY6A 4BVYB 3EYTA 3C71A 1U88A 2IFQB 2H6XA 3M9JA 1SYRA 3F0IA 4BVXA 4EVMA 2QC7A 4KH7A 3F63A 3GMFA 1Z6NA 4IP6A 1G7EA 1TP9A 1ZL9A 1MD3A 2H8LA 1N2AA 4ZB6A 1TW9A 2WFCA 1GP1A 1E6BA 1Z7RA 3HXSA 4KCEA 4XRAA 3KH7A 3GA4A 2VCVA 3TDGA 3FW2A 1ZYNA 2A2PA 2CT6A 2QSIA 3QR6A 5H5RA 1GULA 1OE8A 1XWAA 4PQ1A 3HD5A 1M9BA 1O81A 2E0QA 4RUVA 2K18A 3WD6A 3Q74A 2HXKA 3TUEA 1EZKA 3QDNA 4LMWA 3J7Yb 1A0FA 4RI6A 3O6TA 4TR3A 5CAXA 4G19A 3GUSA 3H93A 5JWOB 5ECIB 1GRXA 2VLTA 1BEDA 2LNTA 2OE0A 5DCGA 3VI7A 5CP1A 2V6OA 1XCCA 2HRKA 2PVQA 3KM6A 4JE1A 1AQXA 2K8SA 2H1GA 4ULXA 1X0RA 4DSSB 1XIYA 2IPAA 4PUAA 2JZSA 3H4KA 1SKRB 5CRDA 3N5OA 4MJCA 2NVLA 4MLYA 5F0GA 3A2VA 1U6TA 4G2EA 2VL9A 4YQMA 5A5KA 2GSSA 1OYJA 4OCEA 4Q5NA 1TK0B 4QL7A 3IK9A 2YP6A 5J5NA 5ECNB 2H74A 1EV9A 2L57A 5F05A 4IP1A 1F3BA 3TGZA 3DD3A 4NV5A 5ECQB 2M72A 3HVVA 4K7NA 1T8EB 3D0ZA 4N30A 4YQVA 2HE3A 1BYEA 16GSA 4OCFA 2KLXA 1YJ6A 1JZOA 3BCIA 1G0TA 1HNBA 2IWTA 6GSTA 3C1RA 1GSDA 3G9BA 1F6MC 2GDRA 3H79A 1EGRA 2XPEA 2HRAA 5IOWA 1QQ2A 4N10A 1DE1A 5CRHA 4ECBA 4FO5A 1T4YA 6GSYA 5GSSA 2DKHA 3IRAA 4F03A 5EVOA 5ELAA 1EEJA 3UBKA 1TI1A 3HDCA 3UEMA 3D4TA 2NBSA 1X5DA 2VD0A 1M2DA 5ECOB 1B9YC 4GCIA 1Y6EA 2ES7A 3IXRA 3I6AA 4F82A 1GL8A 5LD0A 5J9CA 4GQFA 3M0FA 2HNLA 3P8WA 3F4TA 5EY6A 2C8UA 4MPGA 1SK2A 2G0FA 2QGVA 3QPMA 5ECLB 5ECSA 3TCOA 1RK4A 1G7OA 4BVXB 4AGSA 3GX8A 1YKCA 4I97A 4KUNA 2C1YA 2IMFA 2X8CA 1TRUA 4KSOA 2EIQA 2GQMA 1Z3EA 4DEJA 3GH6A 3CSHA 3TOTA 4O5RA 3IHGA 2DBCA 6GSSA 1ZGNA 3RDWA 5E59A 4AJ6A 2F8FA 2VL2A 4IN0A 2GLRA 1URMA 3GV1A 1SK1A 1HNAA 1OC9B 1OAZA 1MDJA 3IE3A 4POBA 3OR5A 1M2BA 4MMMA 5CNWA 3S9FA 1MDKA 1UA5A 4XS4A 2P5QA 2HLSA 3WGEA 3TJFA 4K7IA 1A8LA 3QFAC 1ABAA 3CSIA 11GSA 1K0AA 5IPHA 1SENA 3HJOA 4IKHA 4TOPA 2JZTA 2R0CA 3IC8A 1HNCA 3DRNA 5A4UA 1YF0A 2FCHA 5CRGA 4I8BA 3ZIJA 4DSRA 2PBJA 1ERUA 3ZFLA 2DMLA 1XW6A 4IHUA 3RBTA 1EP8A 3EVIA 4TXOA 5C04A 2YWIA 2VAFA 3ZIVA 2XHFA 4K6XA 2NDOA 3EWLA 4V2NA 3QAWA 3TKSE 3ZVJA 5J4UA 5H5SA 2BJXA 3D22A 5FWGA 2GZYA 2H01A 2VL3A 4O5UA 4GXZA 4N11A 3TJJA 1WIKA 2L5LA 2FHEA 3IBHA 3KTBA 2L6DA 2DJ0A 1J0FA 4G0KA 2MMZA 5G31A 9GSSA 4XCSA 3O76A 1XWBA 1FOHA 1SL2B 2HI7A 1MDIA 3HJPA 1KEBA 4GTUA 1OC8A 2JU5A 1GNWA 2WULA 4FH8A 4MP4A 4Q5QA 2PUKC 2JSYA 3C7MA 2GS3A 4DVCA 4NMUA 1WP0A 1LJRA 4NHZA 3BD2A 5CO3A 2OE1A 4KF9A 1VRSD 3DYRA 1X9WB 1M9AA 2H0GA 2H6ZA 2PPTA 2R3XA 2AHEA 4XS6A 1O8XA 2AJQB 4A5PA 4MA9A 4WBRD 2C0FA 3C73A 1XVQA 1A23A 1GTAA 1S3DA 2R2JA 5AIVA 5LNKe 4J56E 2H1AA 3CRTA 3ZZXA 2ZUPA 2WDUA 1AAZA 3TKSA 4KSMA 2F9SA 4HEA2 4E8EA 2I4AA 14GSA 1XOAA 2FWHA 5GAND 3GNJA 3CXGA 5C00A 1K3YA 3I43A 2RUFA 3CRUA 1HQOA 5FT3A 3FR6A 4D73A 3A5WA 4K9ZA 5HR1A 2R37A 3ZMKA 2FLSA 1ERWA 2VM1A 2JL4A 4MJBA 5D9WA 2V2GA 2HSHA 3M8NA 2AV4A 2R6KA 3TJGA 1XXUA 4V1Ag 2IMDA 3HCZA 1ON4A 1GUHA 4GF0A 5IMCA 4MABA 3U5RE 1GSSA 1F3AA 1JFUA 3MDKA 4GQCA 4TXVA 3VWWA 4ZB8A 1YEPA 2Z9SA 3F3RA 4LL4B 4ZIJA 4XS4B 1V98A 3SWLA 2MMAA 2REMA 1KTEA 1PA3A 4N0VA 1VF4A 3GKMA 5IO0A 3WGDA 3LXTA 2FWFA 1XW5A 1MEKA 2HZFA 5HFKA 3FEUA 3LFLA 5JCUA 2IMEA 3TOUA 1FOVA 1OE7A 2LEGA 5G5EA 2C3TA 2CV4A 1NHYA 2RLIA 2C4JA 4RQXA 1TDIA 4CW9A 5IQYA 2A2RA 5CYYA 1A24A 1WE0A 5HR2A 1N8JA 3BCKA 4KDUA 1K3LA 3HZ8A 5AGYA 3R3EA 3KD0A 3M3MA 5COHA 1ERTA 1TU7A 5B7CA 3LWAA 3IAM2 3KP9A 3ZFBA 3KEBA 3IV4A 4EXJA 2VO4A 4KX4A 1BAYA 4EDYA 2LQQA 4Z2RA 3EU4A 2PERA 2OBKA 2LJKA 4FIWA 4IBPA 4BWQA 1WPIA 2FWEA 3KJYA 3KH9A 4YH2A 2GSRA 3D21A 4NAXA 3D5JA 1R26A 3KMNA 1AXDA 1XOBA 5D73A 5KOXA 5ECPB 3SBCA 1ZMAA 2DJ2A 3APOA 4POKA 1Z7PA 3DXBA 4X43A 2V41A 1GTUA 5GAPD 2M46A 2NTOA 2YV7A 4JBBA 3UMAA 4HS1A 1B4PA 4G9HA 1SK0A 1FG4A 5F07A 1SYXA 4V2MA 3ZREA 2N5AA 5ABRA 1GSUA 5DDLA 3ED3A 4GRFA 1IYIA 3UOMA 2GGTA 2ZNMA 2GVPA 3DKSA 1OC9A 3UVHA 3IC4A 3MWHA 1JHBA 2DKIA 3HVXA 4ID0A 3G7YA 4D73B 1E2YA 1Q98A 4JRRA 3FMWA 1GSFA 2YOIA 3BBYA 2NPBA 3F3QA 3L9VA 3ZYWA 1TRWA 3VPQA 3ZL5A 1QXHA 1FVJA 1EWXA 1FAAA 4GSTA 2TRCP 3LYKA 3EURA 4G0IA 1XWCA 3EINA 1DUGA 3J7Yk 3D6IA 4NPBA 2N5BA 4PQHA 2OKAA 2IIYA 1O8WA 4KA0A 3KZQA 2PVOC 1T7PB 3VURA 1OKDA 1Y25A 5HFIA 4FQUA 3UIWA 2BTOT 1GUKA 4NWYA 3VWXA 5F06A 2LTKA 3G7IA 3P90A 2R4VA 3LW9A 5G2ZA 2KHPA 2PN8A 5AISA 1XBSA 2RM5A 4AF2A 1SL0B 5FHIA 2TIRA 1YKAA 4F2IA 1WJKA 2L59A 3L78A 5D9XA 1EGOA 4MCUA 3PPUA 3RHCA 2HZEA 2F51A 3EMXA 1EV4A 4ECIA 3GN3A 2L5OA 3PR8A 2C3NA 4J57E 1O85A 5J41A 2R0GA 5DBQA 3PH9A 4ZBBA 1FO5A 2H30A 5HQPA 2AB6A 3C1SA 4GWRA 5CRWA 5HR3A 4XHMA 3ZITA 3R2QA 1A2MA 4L0WA 1YF1A 4HUAA 4LLRA 3ZLPA 2DJKA 1DSBA 1TRVA 4OD7A 3GL5A 3LSZA 1JZWA 2DSAA 3F8UA 2PMTA 1PMTA 1THOA 5D9VA 2QA1A 1K3OA 2QKEA 2LRCA 4OFTA 3QAVA 2F8AA 5E4WA 3RPPA 3UVTA 4ECCA 1ILOA 2DIZA 3DMLA 4EUYA 1WWJA 2FWGA 4K5SA 1KBNA 3IR4A 2GZZA 5EL8A 1PN9A 1AW9A 2VLVA 4TR1B 5BMUA 3UJ1A 3HHVA 3MNGA 1G6WA 3H8QA 2B7KA 3BJ5A 1PL2A 3FK8A 2ON5A 1GSQA 2GSTA 3TJBA 3VI5A 4EIPA 1ML6A 2D2ZA 4K7OA 3MSZA 1K0BA 2WJUA 1A0RP 1UN2A 2VLUA 2IMKA 4FYBA 5B6MA 2MMNA 2CAQA 1VGLA 2VCXA 5G1LA 1GWCA 2IMIA 2DC5A 3GTUB 3HKRA 4HDEA 1PRXA 4J2FA 5IIZA 18GSA 3IPZA 1TTZA 2XC2A 2HSYA 3FRCA 1R5PA 1EEMA 4GSSA 4Z2UA 2H0HA 3A2WA 1WRYA 3LG6A 4YKFA 5ENUA 4ML6A 4ZXGA 1B8XA 5DVBA 1TI3A 1PKZA 4LMVA 1M2AA 1V57A 3ZMLA 1GSYA 1TK5B 5J9BA 1LBKA 1GSEA 4HQSA 3VK9A 2FY6A 1XWKA 3CTGA 4F0BA 2G2QA 4MZWA 4KB3A 1AUCA 4EIQA 4ZBAA 3DGQA 3NIVA 3ME8A 4XTSA 3M9KA 5G30A 3E0UA 4IS0A 3FZ5A 1GUMA 2HZEB 3D4MA 2VM2A 1T3BA 2MZCA 1XWGA 3EC3A 2A2SA 2OE3A 1RW1A 2VL2C 3GL3A 2GSQA 4KW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1T4Z A;  1XPV A;  2XPD A;  4OFM A;  2TRX A;  2YJH A;  4WF4 A;  1SJI A;  4WR5 A;  2VIM A;  1YY7 A;  3F6F A;  3I9V 2;  4V2L A;  2FA8 A;  4WET A;  1Q4J A;  3VPT A;  3TKQ A;  3F6D A;  4ZB9 A;  5A4V A;  17GS A;  4K8M A;  4PXO A;  2FUG 2;  1J08 A;  2XBI A;  1U3I A;  3HJM A;  2P0G A;  3DVW A;  1VF2 A;  3EE2 A;  4K2D A;  1X5E A;  2H70 A;  2EIR A;  1PSQ A;  5H5Q A;  3E9J B;  1VF1 A;  4O32 A;  3VLN A;  1FB6 A;  1FHE A;  3MAK A;  4POM A;  1A2J A;  1ZCP A;  2OBI A;  3KIJ A;  4MJE A;  5IO2 A;  4O7H A;  1NSW A;  3NOF A;  4P3Y B;  2DJJ A;  2CZ2 A;  5ID2 B;  4YAP A;  1TKD B;  2RM6 A;  2K6V A;  2CVK A;  4Q5F A;  4TRX A;  3NZN A;  1SD8 A;  1JLV A;  3H1N A;  2DLX A;  5G5F A;  1F9M A;  4QQ7 A;  4DSQ A;  1WMJ A;  4MH3 A;  5CRE A;  2MBT A;  3TRP A;  1M99 A;  3WYW A;  4POL A;  2CX4 A;  3TRQ A;  1QFN A;  1M7T A;  2MMO A;  3GKK A;  3WT2 A;  4OFN A;  4HZ2 A;  4L5L A;  3V1W A;  2RII A;  3ME7 A;  5DQY A;  1GNE A;  3APS A;  3LOR A;  3KGK A;  2VCQ A;  4TW5 A;  3L4N A;  2LQO A;  3P7X A;  1K0O A;  4EE0 A;  4QL9 A;  1XZO A;  2YZU A;  4MZC A;  4ML1 A;  3QAG A;  1B9X C;  2VCW A;  2PU9 C;  4NHW A;  2I3Y A;  1V58 A;  2OAD A;  2FA4 A;  2YCD A;  2CVB A;  2YV9 A;  4NV2 A;  2H19 A;  2BMX A;  2C80 A;  5IMF A;  1UC7 A;  4K0G A;  4KND A;  4IJ3 A;  2XBQ A;  2DIY A;  3LYP A;  4HU9 A;  1J9B A;  3W8J A;  2B3S A;  4ECJ A;  3FR3 A;  4N0Z A;  2GT5 A;  5DQS A;  5EPF A;  2YN1 A;  2IJY A;  4IGJ A;  1B4Q A;  4AJ8 A;  5J3R A;  2ON7 A;  4PUF C;  2B1L A;  5ECH B;  1QUW A;  4RI7 A;  1VF3 A;  20GS A;  4JZQ A;  3VFI A;  1S3C A;  1XFL A;  5KN3 A;  3FKF A;  5GZZ B;  3F4R A;  13GS A;  4JR4 A;  2WZ9 A;  4XIH A;  4IQ1 A;  2EC4 A;  1BX9 A;  3IAS 2;  2YJ7 A;  2B1K A;  4LA1 A;  1Z6M A;  1H4O A;  4MK3 A;  1WOU A;  4BL7 A;  3IHQ A;  2OAC A;  3HVS A;  4L8E A;  1A8Y A;  2LKU A;  3U6V A;  2JZR A;  5B6N A;  1O73 A;  2H6Y A;  2VOC A;  1JLW A;  4PNG A;  3RPN A;  2VUP A;  1TK8 B;  4TR1 A;  3ERF A;  3DVX A;  4OWY A;  3AY8 A;  1HYU A;  5KN0 A;  1EOG A;  2ALB A;  3PIN A;  2MYG A;  1OKT A;  2X8G A;  4BPY A;  3TRX A;  3LQ7 A;  3KTL A;  1SD9 A;  5ECK B;  2O87 A;  1Z9H A;  1QMV A;  4CHS A;  5IOX A;  3IDV A;  5JCG A;  4F9Z A;  2A4V A;  3HZ4 A;  2M80 A;  5GST A;  4MF5 A;  2I1U A;  4JR6 A;  3ZVJ D;  1SKW B;  4K1F A;  3GX0 A;  4G10 A;  2N5F A;  4IQA A;  1ZYE A;  8GSS A;  1EOH A;  3GTU A;  4KCA A;  2PGT A;  4JED A;  1R5A A;  3WT1 A;  3W6G A;  4FYU A;  4HU7 A;  4IEL A;  1K0N A;  1THX A;  2AUV A;  2OA7 A;  1W4V A;  1XVW A;  2O7K A;  2YPM A;  2KP2 A;  1QK8 A;  5IM9 A;  1DBY A;  4LL1 B;  2L4C A;  2LRN A;  2GTU A;  5G1K A;  3GUR A;  4TN8 A;  4PQI A;  5JWQ B;  1H75 A;  5IMZ A;  22GS A;  3CSJ A;  1YEX A;  2WRT A;  2F3M A;  1PX6 A;  5HFG A;  1S3A A;  1T00 A;  2E2M A;  1OC3 A;  2R5G A;  4GLT A;  1SJZ A;  2PWJ A;  2CAI A;  10GS A;  3UAR A;  1MTC A;  2DJ1 A;  4HI7 A;  3GYK A;  1FB0 A;  1U87 A;  3FZA A;  4HJ2 A;  1AIU A;  1LU4 A;  1SL1 B;  3CYN A;  3LXZ A;  2H75 A;  2GT6 A;  1K0D A;  4BWS A;  2DJ3 A;  3O3T A;  2B5X A;  1O7U A;  4EDZ A;  1EP7 A;  2IL3 A;  1IYH A;  4I2T A;  4TR0 A;  4X1U A;  1ACV A;  2B5E A;  6GSU A;  4MF7 A;  3Q19 A;  3IA1 A;  3M1G A;  2C3Q A;  1SJ6 A;  3A3T A;  4PUR A;  4WKW A;  1SKS B;  5B8B A;  2B6M A;  6GSW A;  3BOA A;  4OO5 A;  4PGT A;  2X8H A;  1A2L A;  3LJR A;  1O6J A;  5L71 A;  1R4W A;  3HA9 A;  3KP8 A;  5DAK A;  3UAP A;  4WXT A;  1C72 A;  1ERV A;  4HQZ A;  4YQU A;  19GS A;  2H71 A;  1YDK A;  4TVE A;  4TR4 A;  2P5R A;  2I9H A;  3GHA A;  1XW9 A;  1B48 A;  1F37 A;  3CBU A;  4MZB A;  4OO4 A;  3TJK A;  2H1B A;  1V9W A;  2GQK A;  4K0N A;  5D8I A;  3GST A;  1JZR A;  2C0D A;  1V2A A;  2LUS A;  2V1M A;  4IVF A;  5DAL A;  1SU9 A;  4WBJ A;  5ID2 A;  1KNG A;  4F0C A;  1TOF A;  4IJI A;  2I81 A;  3RAZ A;  1M0U A;  4Q5R A;  4I5Q A;  1PQN A;  5IMD A;  4MH2 A;  5D9T A;  5D93 A;  3DIE A;  1NW2 A;  6GSX A;  3G7J A;  3IOS A;  1TXX A;  3DWV A;  2V32 A;  1BJX A;  1R7H A;  1G6Y A;  3ERG A;  1PGT A;  2YAN A;  2OJL A;  5IPG A;  2LJA A;  2K9F A;  4ZL8 A;  2HRF A;  4ACS A;  2B7J A;  1GTI A;  2MBS A;  2E7P A;  4YAV A;  2V6K A;  4I6X A;  1X5C A;  2WGR A;  4WF5 A;  12GS A;  2WS2 A;  2B5Y A;  1PD2 1;  3KCM A;  3GIX A;  1GLP A;  3C8E A;  2H76 A;  4XRD A;  3CTF A;  4PX1 A;  2GZP A;  2VCT A;  4MF6 A;  4KAE A;  2H0I A;  5KEJ A;  1YQ1 A;  4KE3 A;  3VWV A;  2FGX A;  1DE2 A;  3UBL A;  1TRS A;  4ZL9 A;  1AQV A;  2LS5 A;  3KMO A;  3FZ4 A;  3LEF A;  6GSV A;  2AAW A;  4EO3 A;  1K0M A;  2FNO A;  4L5O A;  1W89 A;  3EU3 A;  1K0C A;  4FYC A;  7GSS A;  2LNS A;  2RUE A;  2VD1 A;  2CA8 A;  4MJA A;  1GLQ A;  1ZYQ B;  5D96 A;  1TU8 A;  2HT9 A;  5KN2 A;  5ECM B;  3W8S A;  1BG5 A;  4ISD A;  4JU5 A;  1GH2 A;  2EIO A;  5HR0 A;  4ZL7 A;  4CDO A;  4BA7 A;  3L0H A;  1F2E A;  2H72 A;  3HY2 A;  4EL1 A;  1V40 A;  2O8V B;  1OVN A;  4EF0 A;  3PGT A;  2LJR A;  4GSN A;  3APQ A;  3ZTL A;  4E8H A;  2J9H A;  3TKP A;  2LST A;  2CVD A;  2JAC A;  3K8N A;  4WR4 A;  1TJD A;  2LRT A;  3QCP A;  5DAK B;  4BVY A;  2ZCT A;  4H86 A;  2CQ9 A;  3ERW A;  2H66 A;  2IFQ A;  3F9U A;  2FD3 A;  3VWU A;  2O85 A;  2HRN A;  2YWN A;  5DJL A;  1FVK A;  5B8A A;  5IMV A;  3I69 A;  2HYX A;  5LCZ A;  3L9S A;  2L4Q A;  2WB9 A;  4TKY A;  4HZ4 A;  3IK7 A;  1U3A A;  2CZ3 A;  2KUC A;  1NM3 A;  1PL1 A;  5DAL B;  5ELG A;  2CX3 A;  2X64 A;  3RHB A;  1YZX A;  2C0G A;  2YNX A;  4HOJ A;  5JCW A;  2WCI A;  3GRX A;  4I2U A;  4O92 A;  3E3E A;  1GTB A;  1USB A;  5INY A;  5JWR B;  5KN1 A;  4Z7X A;  3P2A A;  4MPF A;  1NHO A;  3FZ9 A;  4HJM A;  3US3 A;  1JZD A;  3F4S A;  3QOU A;  4X0X A;  3KXO A;  4PNF A;  3GKX A;  4ZBD A;  4WEY A;  3FYG A;  3N9J A;  2P31 A;  4DSS A;  4OMV A;  2GQL A;  3A2X A;  2J23 A;  1ST9 A;  5AIX A;  4ILF A;  3DEX A;  3Q18 A;  3GKN A;  1ZOF A;  1T1V A;  1I5G A;  1BQ7 A;  4IW9 A;  3LGC A;  5DCH A;  1FW1 A;  2X99 A;  3ISO A;  2DMM A;  1AC1 A;  1Z5Y E;  3GSS A;  3QMX A;  5IMA A;  2KP1 A;  4MDC A;  1X9M B;  3QFB C;  1PKW A;  2YWM A;  5AN1 A;  4EC0 A;  3GH9 A;  4RQR A;  4KDY A;  1HD2 A;  3FR9 A;  3TKS C;  2JAD A;  1CQG A;  4AJ7 A;  2YWO A;  1X9S B;  3FY7 A;  2E2G A;  1AQW A;  2IN3 A;  3EMP A;  4EKZ A;  3Q6O A;  4TXO B;  3QD9 A;  1UVZ A;  3ZRD A;  2K8V A;  1I9D A;  2AYT A;  3JCM L;  2C0E A;  1CQH A;  3GFK A;  1MD4 A;  4XS1 A;  2L6C A;  2HFD A;  3CMI A;  4KGI A;  2VCZ A;  5ECR B;  3TKR A;  3HYP A;  3WGX A;  2YZH A;  4L0U A;  5F8B A;  3TB2 A;  3L9U A;  1PX7 A;  1QGV A;  4ZIL A;  3FHK A;  2O89 A;  4NXI A;  4V1A p;  1RQM A;  4KDX A;  3UL3 A;  5DJM A;  2JSZ A;  2KOK A;  2H1D A;  2LV3 A;  2H73 A;  5A4W A;  1ZZY A;  3EYT A;  3C71 A;  1U88 A;  2IFQ B;  2H6X A;  3M9J A;  1SYR A;  3F0I A;  4BVX A;  4EVM A;  2QC7 A;  4KH7 A;  3F63 A;  3GMF A;  1Z6N A;  4IP6 A;  1G7E A;  1TP9 A;  1ZL9 A;  1MD3 A;  2H8L A;  1N2A A;  4ZB6 A;  1TW9 A;  2WFC A;  1GP1 A;  1E6B A;  1Z7R A;  3HXS A;  4KCE A;  4XRA A;  3KH7 A;  3GA4 A;  2VCV A;  3TDG A;  3FW2 A;  2CT6 A;  2QSI A;  3QR6 A;  5H5R A;  1GUL A;  1OE8 A;  1XWA A;  4PQ1 A;  3HD5 A;  1M9B A;  1O81 A;  2E0Q A;  4RUV A;  2K18 A;  3WD6 A;  3Q74 A;  2HXK A;  3TUE A;  1EZK A;  3QDN A;  4LMW A;  3J7Y b;  1A0F A;  4RI6 A;  3O6T A;  4TR3 A;  5CAX A;  4G19 A;  3GUS A;  3H93 A;  5JWO B;  5ECI B;  1GRX A;  2VLT A;  1BED A;  2LNT A;  2OE0 A;  5DCG A;  3VI7 A;  5CP1 A;  2V6O A;  1XCC A;  2PVQ A;  3KM6 A;  4JE1 A;  1AQX A;  2K8S A;  2H1G A;  4ULX A;  1X0R A;  4DSS B;  1XIY A;  2IPA A;  4PUA A;  2JZS A;  3H4K A;  1SKR B;  5CRD A;  3N5O A;  4MJC A;  2NVL A;  4MLY A;  5F0G A;  3A2V A;  1U6T A;  4G2E A;  2VL9 A;  4YQM A;  5A5K A;  2GSS A;  1OYJ A;  4OCE A;  4Q5N A;  1TK0 B;  4QL7 A;  3IK9 A;  2YP6 A;  5J5N A;  5ECN B;  2H74 A;  1EV9 A;  2L57 A;  5F05 A;  4IP1 A;  1F3B A;  3TGZ A;  3DD3 A;  4NV5 A;  5ECQ B;  2M72 A;  3HVV A;  4K7N A;  1T8E B;  3D0Z A;  4N30 A;  4YQV A;  2HE3 A;  1BYE A;  16GS A;  4OCF A;  2KLX A;  1YJ6 A;  1JZO A;  3BCI A;  1G0T A;  1HNB A;  2IWT A;  6GST A;  3C1R A;  1GSD A;  3G9B A;  1F6M C;  2GDR A;  3H79 A;  1EGR A;  2XPE A;  5IOW A;  1QQ2 A;  4N10 A;  1DE1 A;  5CRH A;  4ECB A;  4FO5 A;  1T4Y A;  6GSY A;  5GSS A;  3IRA A;  4F03 A;  5EVO A;  5ELA A;  1EEJ A;  3UBK A;  1TI1 A;  3HDC A;  3UEM A;  3D4T A;  2NBS A;  1X5D A;  2VD0 A;  1M2D A;  5ECO B;  1B9Y C;  4GCI A;  1Y6E A;  2ES7 A;  3IXR A;  3I6A A;  4F82 A;  1GL8 A;  5LD0 A;  5J9C A;  4GQF A;  3M0F A;  2HNL A;  3P8W A;  3F4T A;  5EY6 A;  2C8U A;  4MPG A;  1SK2 A;  2G0F A;  2QGV A;  3QPM A;  5ECL B;  5ECS A;  3TCO A;  1RK4 A;  1G7O A;  4AGS A;  3GX8 A;  1YKC A;  4I97 A;  4KUN A;  2C1Y A;  2IMF A;  2X8C A;  1TRU A;  4KSO A;  2EIQ A;  2GQM A;  1Z3E A;  4DEJ A;  3GH6 A;  3CSH A;  3TOT A;  4O5R A;  2DBC A;  6GSS A;  1ZGN A;  3RDW A;  5E59 A;  4AJ6 A;  2F8F A;  2VL2 A;  4IN0 A;  2GLR A;  1URM A;  3GV1 A;  1SK1 A;  1HNA A;  1OC9 B;  1OAZ A;  1MDJ A;  3IE3 A;  4POB A;  3OR5 A;  1M2B A;  4MMM A;  5CNW A;  3S9F A;  1MDK A;  1UA5 A;  4XS4 A;  2P5Q A;  2HLS A;  3WGE A;  3TJF A;  4K7I A;  1A8L A;  3QFA C;  1ABA A;  3CSI A;  11GS A;  1K0A A;  5IPH A;  1SEN A;  3HJO A;  4IKH A;  4TOP A;  2JZT A;  1HNC A;  3DRN A;  5A4U A;  1YF0 A;  2FCH A;  5CRG A;  4I8B A;  3ZIJ A;  4DSR A;  2PBJ A;  1ERU A;  3ZFL A;  2DML A;  1XW6 A;  4IHU A;  3RBT A;  1EP8 A;  3EVI A;  4TXO A;  5C04 A;  2YWI A;  2VAF A;  3ZIV A;  2XHF A;  4K6X A;  2NDO A;  3EWL A;  4V2N A;  3QAW A;  3TKS E;  3ZVJ A;  5J4U A;  5H5S A;  2BJX A;  3D22 A;  5FWG A;  2GZY A;  2H01 A;  2VL3 A;  4GXZ A;  4N11 A;  3TJJ A;  1WIK A;  2L5L A;  2FHE A;  3IBH A;  3KTB A;  2L6D A;  2DJ0 A;  1J0F A;  2MMZ A;  5G31 A;  9GSS A;  4XCS A;  3O76 A;  1XWB A;  1SL2 B;  2HI7 A;  1MDI A;  3HJP A;  1KEB A;  4GTU A;  1OC8 A;  2JU5 A;  1GNW A;  2WUL A;  4FH8 A;  4MP4 A;  4Q5Q A;  2PUK C;  2JSY A;  3C7M A;  2GS3 A;  4DVC A;  4NMU A;  1WP0 A;  1LJR A;  4NHZ A;  3BD2 A;  5CO3 A;  2OE1 A;  1VRS D;  3DYR A;  1X9W B;  1M9A A;  2H0G A;  2H6Z A;  2PPT A;  2R3X A;  2AHE A;  4XS6 A;  1O8X A;  2AJQ B;  4MA9 A;  4WBR D;  2C0F A;  3C73 A;  1XVQ A;  1A23 A;  1GTA A;  1S3D A;  2R2J A;  5AIV A;  5LNK e;  4J56 E;  2H1A A;  3CRT A;  3ZZX A;  2ZUP A;  2WDU A;  1AAZ A;  3TKS A;  4KSM A;  2F9S A;  4HEA 2;  4E8E A;  2I4A A;  14GS A;  1XOA A;  2FWH A;  5GAN D;  3GNJ A;  3CXG A;  5C00 A;  1K3Y A;  3I43 A;  2RUF A;  3CRU A;  1HQO A;  5FT3 A;  3FR6 A;  4D73 A;  3A5W A;  4K9Z A;  5HR1 A;  2R37 A;  3ZMK A;  2FLS A;  1ERW A;  2VM1 A;  2JL4 A;  4MJB A;  5D9W A;  2V2G A;  2HSH A;  3M8N A;  2AV4 A;  2R6K A;  3TJG A;  1XXU A;  4V1A g;  2IMD A;  3HCZ A;  1ON4 A;  1GUH A;  4GF0 A;  5IMC A;  4MAB A;  3U5R E;  1GSS A;  1F3A A;  1JFU A;  3MDK A;  4GQC A;  4TXV A;  3VWW A;  4ZB8 A;  1YEP A;  2Z9S A;  3F3R A;  4LL4 B;  4ZIJ A;  4XS4 B;  1V98 A;  3SWL A;  2MMA A;  2REM A;  1KTE A;  1PA3 A;  4N0V A;  1VF4 A;  3GKM A;  5IO0 A;  3WGD A;  3LXT A;  2FWF A;  1XW5 A;  1MEK A;  2HZF A;  5HFK A;  3FEU A;  3LFL A;  5JCU A;  2IME A;  3TOU A;  1FOV A;  1OE7 A;  2LEG A;  5G5E A;  2C3T A;  2CV4 A;  1NHY A;  2RLI A;  2C4J A;  4RQX A;  1TDI A;  4CW9 A;  5IQY A;  2A2R A;  5CYY A;  1A24 A;  1WE0 A;  5HR2 A;  1N8J A;  3BCK A;  4KDU A;  1K3L A;  3HZ8 A;  5AGY A;  3KD0 A;  3M3M A;  5COH A;  1ERT A;  1TU7 A;  5B7C A;  3LWA A;  3IAM 2;  3KP9 A;  3ZFB A;  3KEB A;  3IV4 A;  4EXJ A;  2VO4 A;  4KX4 A;  1BAY A;  4EDY A;  2LQQ A;  3EU4 A;  2PER A;  2OBK A;  2LJK A;  4FIW A;  4IBP A;  4BWQ A;  1WPI A;  2FWE A;  3KJY A;  3KH9 A;  4YH2 A;  2GSR A;  3D21 A;  4NAX A;  3D5J A;  1R26 A;  3KMN A;  1AXD A;  1XOB A;  5D73 A;  5ECP B;  3SBC A;  1ZMA A;  2DJ2 A;  3APO A;  4POK A;  1Z7P A;  3DXB A;  4X43 A;  2V41 A;  1GTU A;  5GAP D;  2M46 A;  2NTO A;  2YV7 A;  4JBB A;  3UMA A;  4HS1 A;  1B4P A;  4G9H A;  1SK0 A;  1FG4 A;  5F07 A;  1SYX A;  4V2M A;  3ZRE A;  2N5A A;  5ABR A;  1GSU A;  5DDL A;  3ED3 A;  4GRF A;  1IYI A;  3UOM A;  2GGT A;  2ZNM A;  2GVP A;  3DKS A;  1OC9 A;  3UVH A;  3IC4 A;  3MWH A;  1JHB A;  3HVX A;  4ID0 A;  3G7Y A;  4D73 B;  1E2Y A;  1Q98 A;  4JRR A;  1GSF A;  2YOI A;  3BBY A;  2NPB A;  3F3Q A;  3L9V A;  3ZYW A;  1TRW A;  3VPQ A;  3ZL5 A;  1QXH A;  1FVJ A;  1EWX A;  1FAA A;  4GST A;  2TRC P;  3LYK A;  3EUR A;  1XWC A;  3EIN A;  1DUG A;  3J7Y k;  3D6I A;  4NPB A;  2N5B A;  4PQH A;  2OKA A;  2IIY A;  1O8W A;  4KA0 A;  3KZQ A;  2PVO C;  1T7P B;  3VUR A;  1OKD A;  1Y25 A;  5HFI A;  3UIW A;  2BTO T;  1GUK A;  4NWY A;  3VWX A;  5F06 A;  2LTK A;  3G7I A;  3P90 A;  2R4V A;  5G2Z A;  2KHP A;  2PN8 A;  5AIS A;  1XBS A;  2RM5 A;  4AF2 A;  1SL0 B;  5FHI A;  2TIR A;  1YKA A;  4F2I A;  1WJK A;  2L59 A;  3L78 A;  5D9X A;  1EGO A;  4MCU A;  3RHC A;  2HZE A;  2F51 A;  3EMX A;  1EV4 A;  4ECI A;  3GN3 A;  2L5O A;  3PR8 A;  2C3N A;  4J57 E;  1O85 A;  5J41 A;  5DBQ A;  3PH9 A;  4ZBB A;  1FO5 A;  2H30 A;  5HQP A;  2AB6 A;  3C1S A;  4GWR A;  5CRW A;  5HR3 A;  4XHM A;  3ZIT A;  3R2Q A;  1A2M A;  4L0W A;  1YF1 A;  4HUA A;  4LLR A;  3ZLP A;  2DJK A;  1DSB A;  1TRV A;  4OD7 A;  3GL5 A;  3LSZ A;  1JZW A;  2DSA A;  3F8U A;  2PMT A;  1PMT A;  1THO A;  5D9V A;  1K3O A;  2QKE A;  2LRC A;  4OFT A;  3QAV A;  2F8A A;  5E4W A;  3RPP A;  3UVT A;  4ECC A;  1ILO A;  2DIZ A;  3DML A;  4EUY A;  1WWJ A;  2FWG A;  1KBN A;  3IR4 A;  2GZZ A;  5EL8 A;  1PN9 A;  1AW9 A;  2VLV A;  4TR1 B;  3UJ1 A;  3HHV A;  3MNG A;  1G6W A;  3H8Q A;  2B7K A;  3BJ5 A;  1PL2 A;  3FK8 A;  2ON5 A;  1GSQ A;  2GST A;  3TJB A;  3VI5 A;  1ML6 A;  2D2Z A;  4K7O A;  3MSZ A;  1K0B A;  2WJU A;  1A0R P;  1UN2 A;  2VLU A;  2IMK A;  4FYB A;  5B6M A;  2MMN A;  2CAQ A;  1VGL A;  2VCX A;  5G1L A;  1GWC A;  2IMI A;  2DC5 A;  3GTU B;  3HKR A;  4HDE A;  1PRX A;  4J2F A;  5IIZ A;  18GS A;  3IPZ A;  1TTZ A;  2XC2 A;  2HSY A;  3FRC A;  1R5P A;  1EEM A;  4GSS A;  2H0H A;  3A2W A;  1WRY A;  3LG6 A;  5ENU A;  4ML6 A;  4ZXG A;  1B8X A;  5DVB A;  1TI3 A;  1PKZ A;  4LMV A;  1M2A A;  1V57 A;  3ZML A;  1GSY A;  1TK5 B;  5J9B A;  1LBK A;  1GSE A;  4HQS A;  3VK9 A;  2FY6 A;  1XWK A;  3CTG A;  4F0B A;  2G2Q A;  4MZW A;  4KB3 A;  1AUC A;  4ZBA A;  3DGQ A;  3NIV A;  3ME8 A;  4XTS A;  3M9K A;  5G30 A;  3E0U A;  4IS0 A;  3FZ5 A;  1GUM A;  2HZE B;  3D4M A;  2VM2 A;  1T3B A;  2MZC A;  1XWG A;  3EC3 A;  2A2S A;  2OE3 A;  1RW1 A;  2VL2 C;  3GL3 A;  2GSQ A;  4KW6 A; 
#chains in the Genus database with same CATH topology
 1T4Z A;  1XPV A;  2XPD A;  4OFM A;  2TRX A;  2YJH A;  4WF4 A;  1SJI A;  4WR5 A;  2VIM A;  1YY7 A;  3F6F A;  3I9V 2;  4V2L A;  2FA8 A;  4WET A;  1Q4J A;  3VPT A;  3TKQ A;  3F6D A;  4ZB9 A;  5A4V A;  17GS A;  4K8M A;  4PXO A;  2FUG 2;  1J08 A;  2XBI A;  1U3I A;  3HJM A;  2P0G A;  3MIX A;  3DVW A;  1VF2 A;  3EE2 A;  4K2D A;  1X5E A;  2H70 A;  2EIR A;  1PSQ A;  5H5Q A;  3E9J B;  1VF1 A;  4O32 A;  3VLN A;  1FB6 A;  1FHE A;  3MAK A;  4POM A;  1A2J A;  1ZCP A;  2OBI A;  3KIJ A;  4MJE A;  5IO2 A;  4O7H A;  1NSW A;  3NOF A;  4P3Y B;  2DJJ A;  2CZ2 A;  5ID2 B;  4YAP A;  1TKD B;  2RM6 A;  2K6V A;  2CVK A;  4Q5F A;  4TRX A;  3NZN A;  1SD8 A;  1PFO A;  1JLV A;  3H1N A;  2DLX A;  5G5F A;  1F9M A;  4QQ7 A;  4DSQ A;  1WMJ A;  4MH3 A;  5CRE A;  2MBT A;  3TRP A;  1M99 A;  3WYW A;  4POL A;  2CX4 A;  3TRQ A;  1QFN A;  1M7T A;  2MMO A;  3GKK A;  3WT2 A;  4OFN A;  4HZ2 A;  4L5L A;  3V1W A;  2RII A;  3ME7 A;  5DQY A;  1GNE A;  3APS A;  3LOR A;  3KGK A;  2VCQ A;  4PTS A;  4TW5 A;  3L4N A;  4K2X A;  2LQO A;  3P7X A;  1K0O A;  4EE0 A;  4QL9 A;  1XZO A;  2YZU A;  4MZC A;  4ML1 A;  3QAG A;  1B9X C;  2VCW A;  2PU9 C;  4NHW A;  2I3Y A;  1V58 A;  2OAD A;  2FA4 A;  2YCD A;  2CVB A;  2YV9 A;  4NV2 A;  2H19 A;  2BMX A;  2C80 A;  5IMF A;  1UC7 A;  4K0G A;  4KND A;  4IJ3 A;  2XBQ A;  2DIY A;  3LYP A;  4HU9 A;  1J9B A;  3W8J A;  2B3S A;  4ECJ A;  3FR3 A;  4N0Z A;  2GT5 A;  5DQS A;  5EPF A;  4X4J A;  2YN1 A;  2IJY A;  4IGJ A;  1B4Q A;  4AJ8 A;  5J3R A;  2ON7 A;  4PUF C;  2B1L A;  5ECH B;  1QUW A;  4RI7 A;  1VF3 A;  20GS A;  4JZQ A;  3VFI A;  1S3C A;  1XFL A;  5KN3 A;  3FKF A;  5GZZ B;  3F4R A;  13GS A;  4JR4 A;  2WZ9 A;  4XIH A;  4IQ1 A;  2EC4 A;  1BX9 A;  3IAS 2;  2YJ7 A;  2B1K A;  4LA1 A;  1Z6M A;  1H4O A;  4MK3 A;  1WOU A;  4BL7 A;  3IHQ A;  2OAC A;  3HVS A;  4L8E A;  1A8Y A;  2LKU A;  3U6V A;  2JZR A;  5B6N A;  1O73 A;  2H6Y A;  2VOC A;  1JLW A;  4PNG A;  3RPN A;  2VUP A;  1TK8 B;  4TR1 A;  3ERF A;  3DVX A;  4OWY A;  3AY8 A;  1HYU A;  5KN0 A;  1EOG A;  2ALB A;  3PIN A;  2MYG A;  1OKT A;  2X8G A;  4BPY A;  3TRX A;  3LQ7 A;  3KTL A;  1SD9 A;  5ECK B;  2O87 A;  1Z9H A;  1QMV A;  4CHS A;  5IOX A;  3IDV A;  5JCG A;  4F9Z A;  2A4V A;  3HZ4 A;  2M80 A;  5GST A;  4MF5 A;  2I1U A;  4JR6 A;  3ZVJ D;  1SKW B;  4K1F A;  3GX0 A;  4G10 A;  2N5F A;  4IQA A;  1ZYE A;  8GSS A;  1EOH A;  3GTU A;  4KCA A;  2PGT A;  4JED A;  1R5A A;  3WT1 A;  3W6G A;  4FYU A;  2UZ8 A;  4HU7 A;  4IEL A;  1K0N A;  1THX A;  2AUV A;  2OA7 A;  1W4V A;  5KOW A;  1XVW A;  2O7K A;  2YPM A;  2KP2 A;  1QK8 A;  5IM9 A;  1DBY A;  4LL1 B;  2L4C A;  3A5I A;  2LRN A;  2GTU A;  5G1K A;  3GUR A;  4TN8 A;  4K5R A;  4PQI A;  1H75 A;  5JWQ B;  5IMZ A;  22GS A;  3CSJ A;  1YEX A;  2WRT A;  2F3M A;  4MNN A;  1PX6 A;  5HFG A;  1S3A A;  1T00 A;  1PN0 A;  1OC3 A;  2E2M A;  2R5G A;  4GLT A;  1SJZ A;  4USS A;  4CY8 A;  2PWJ A;  2CAI A;  10GS A;  3UAR A;  1MTC A;  2DJ1 A;  4HI7 A;  3GYK A;  1FB0 A;  1U87 A;  3FZA A;  4HJ2 A;  1AIU A;  1LU4 A;  1SL1 B;  3CYN A;  3LXZ A;  2H75 A;  2GT6 A;  1K0D A;  4BWS A;  2DJ3 A;  3O3T A;  2B5X A;  1O7U A;  4EDZ A;  5BRT A;  1EP7 A;  2IL3 A;  1IYH A;  3MYD A;  4I2T A;  4TR0 A;  4X1U A;  1ACV A;  2B5E A;  6GSU A;  4MF7 A;  2R0P A;  3Q19 A;  3IA1 A;  3M1G A;  2C3Q A;  1SJ6 A;  3A3T A;  4PUR A;  4WKW A;  1SKS B;  5B8B A;  2B6M A;  1ZYP A;  6GSW A;  3BOA A;  4OO5 A;  4PGT A;  2X8H A;  1A2L A;  3LJR A;  1O6J A;  5L71 A;  1R4W A;  3HA9 A;  3KP8 A;  5DAK A;  4G0L A;  3UAP A;  4WXT A;  1C72 A;  1ERV A;  4HQZ A;  4YQU A;  19GS A;  4BIK A;  2H71 A;  1YDK A;  4TVE A;  4TR4 A;  2P5R A;  2I9H A;  3GHA A;  1XW9 A;  1B48 A;  1F37 A;  3CBU A;  4MZB A;  4OO4 A;  3TJK A;  2H1B A;  1V9W A;  2GQK A;  4K0N A;  5D8I A;  3GST A;  4BL7 B;  1JZR A;  2C0D A;  1V2A A;  2LUS A;  2V1M A;  4IVF A;  5DAL A;  1SU9 A;  4WBJ A;  5ID2 A;  1KNG A;  1XG8 A;  4F0C A;  1TOF A;  4IJI A;  2I81 A;  3RAZ A;  1M0U A;  4Q5R A;  4ICY A;  4I5Q A;  1PQN A;  5IMD A;  4MH2 A;  5D9T A;  5D93 A;  3DIE A;  1NW2 A;  6GSX A;  3G7J A;  3IOS A;  1TXX A;  3DWV A;  2V32 A;  1BJX A;  1R7H A;  1G6Y A;  3ERG A;  1PGT A;  2YAN A;  2OJL A;  5IPG A;  2LJA A;  2K9F A;  4ZL8 A;  2HRF A;  4ACS A;  2B7J A;  1GTI A;  2MBS A;  2E7P A;  3EPT A;  4YAV A;  2V6K A;  4I6X A;  1X5C A;  2WGR A;  4WF5 A;  12GS A;  2WS2 A;  2B5Y A;  1PD2 1;  3KCM A;  3GIX A;  1GLP A;  3C8E A;  2H76 A;  4XRD A;  3CTF A;  4PX1 A;  2GZP A;  2VCT A;  4MF6 A;  4KAE A;  2H0I A;  5KEJ A;  1YQ1 A;  4KE3 A;  3VWV A;  2FGX A;  1DE2 A;  3UBL A;  1TRS A;  4ZL9 A;  1AQV A;  2LS5 A;  3KMO A;  3FZ4 A;  3LEF A;  2X4A A;  6GSV A;  2AAW A;  4EO3 A;  1K0M A;  2FNO A;  4L5O A;  1W89 A;  3EU3 A;  1K0C A;  4FYC A;  7GSS A;  2LNS A;  2RUE A;  2VD1 A;  2CA8 A;  4MJA A;  1GLQ A;  1ZYQ B;  5D96 A;  1TU8 A;  2HT9 A;  5KN2 A;  5ECM B;  2X49 A;  3W8S A;  1BG5 A;  4ISD A;  4JU5 A;  1GH2 A;  2EIO A;  5HR0 A;  4ZL7 A;  4CDO A;  4BA7 A;  3L0H A;  1F2E A;  2H72 A;  3HY2 A;  4EL1 A;  1V40 A;  2O8V B;  1OVN A;  4EF0 A;  3PGT A;  2LJR A;  4GSN A;  3APQ A;  3ZTL A;  4E8H A;  2J9H A;  3TKP A;  2LST A;  2CVD A;  4Z2T A;  2JAC A;  3K8N A;  4WR4 A;  1TJD A;  2LRT A;  3QCP A;  5DAK B;  4BVY A;  1M3I A;  2ZCT A;  4H86 A;  2CQ9 A;  3ERW A;  2H66 A;  2IFQ A;  3F9U A;  2FD3 A;  3VWU A;  2O85 A;  2HRN A;  2YWN A;  5DJL A;  1FVK A;  5B8A A;  2A4H A;  5IMV A;  3I69 A;  2HYX A;  5LCZ A;  3L9S A;  2L4Q A;  2WB9 A;  4TKY A;  4HZ4 A;  3IK7 A;  1U3A A;  2CZ3 A;  2KUC A;  1NM3 A;  1PL1 A;  5DAL B;  5ELG A;  2CX3 A;  2X64 A;  3RHB A;  1YZX A;  2C0G A;  2YNX A;  4HOJ A;  5JCW A;  2WCI A;  3GRX A;  4O5Q A;  2QA2 A;  4I2U A;  4O92 A;  3E3E A;  1GTB A;  1USB A;  5INY A;  2HSM A;  5JWR B;  5KN1 A;  4MPF A;  4Z7X A;  3P2A A;  1NHO A;  3FZ9 A;  4HJM A;  3US3 A;  1JZD A;  3F4S A;  3QOU A;  4X0X A;  3KXO A;  4PNF A;  3GKX A;  4ZBD A;  4WEY A;  3FYG A;  3N9J A;  2P31 A;  4DSS A;  4OMV A;  2GQL A;  3A2X A;  2J23 A;  1ST9 A;  5AIX A;  4ILF A;  3DEX A;  3Q18 A;  3GKN A;  1ZOF A;  1T1V A;  1I5G A;  1BQ7 A;  4IW9 A;  3LGC A;  5DCH A;  1FW1 A;  2X99 A;  3ISO A;  2DMM A;  1AC1 A;  1Z5Y E;  3GSS A;  3QMX A;  5IMA A;  2KP1 A;  4MDC A;  1X9M B;  3QFB C;  1PKW A;  2YWM A;  5AN1 A;  4EC0 A;  3GH9 A;  4RQR A;  4KDY A;  1HD2 A;  3FR9 A;  3TKS C;  2JAD A;  1CQG A;  4AJ7 A;  2YWO A;  1X9S B;  3FY7 A;  2E2G A;  1AQW A;  2IN3 A;  3EMP A;  4EKZ A;  3Q6O A;  4TXO B;  3QD9 A;  1UVZ A;  4YKG A;  3HVN A;  3ZRD A;  2K8V A;  1I9D A;  2AYT A;  3JCM L;  2C0E A;  1CQH A;  3GFK A;  1MD4 A;  4XS1 A;  1S3R A;  2L6C A;  2HFD A;  3CMI A;  4KGI A;  2VCZ A;  5ECR B;  3TKR A;  3HYP A;  3WGX A;  2YZH A;  4L0U A;  5F8B A;  3TB2 A;  3L9U A;  1PX7 A;  1QGV A;  4ZIL A;  3FHK A;  2O89 A;  4NXI A;  4V1A p;  1RQM A;  4KDX A;  3UL3 A;  5DJM A;  2JSZ A;  2KOK A;  2H1D A;  2LV3 A;  2H73 A;  5A4W A;  1ZZY A;  4CY6 A;  4BVY B;  3EYT A;  3C71 A;  1U88 A;  2IFQ B;  2H6X A;  3M9J A;  1SYR A;  3F0I A;  4BVX A;  4EVM A;  2QC7 A;  4KH7 A;  3F63 A;  3GMF A;  1Z6N A;  4IP6 A;  1G7E A;  1TP9 A;  1ZL9 A;  1MD3 A;  2H8L A;  1N2A A;  4ZB6 A;  1TW9 A;  2WFC A;  1GP1 A;  1E6B A;  1Z7R A;  3HXS A;  4KCE A;  4XRA A;  3KH7 A;  3GA4 A;  2VCV A;  3TDG A;  3FW2 A;  1ZYN A;  2A2P A;  2CT6 A;  2QSI A;  3QR6 A;  5H5R A;  1GUL A;  1OE8 A;  1XWA A;  4PQ1 A;  1M3J A;  3HD5 A;  1M9B A;  1O81 A;  2E0Q A;  4RUV A;  2K18 A;  3WD6 A;  3Q74 A;  2HXK A;  3TUE A;  1EZK A;  3QDN A;  4LMW A;  3J7Y b;  1A0F A;  4RI6 A;  3O6T A;  4TR3 A;  5CAX A;  4G19 A;  3GUS A;  3H93 A;  5JWO B;  5ECI B;  1GRX A;  2VLT A;  1BED A;  2LNT A;  2OE0 A;  5DCG A;  3VI7 A;  5CP1 A;  2V6O A;  1XCC A;  2HRK A;  2PVQ A;  3KM6 A;  4JE1 A;  1AQX A;  2K8S A;  2H1G A;  4ULX A;  1X0R A;  4DSS B;  1XIY A;  2IPA A;  4PUA A;  2JZS A;  3H4K A;  1SKR B;  5CRD A;  3N5O A;  4MJC A;  2NVL A;  4MLY A;  5F0G A;  3A2V A;  1U6T A;  4G2E A;  2VL9 A;  4YQM A;  5A5K A;  2GSS A;  1OYJ A;  4OCE A;  4Q5N A;  1TK0 B;  4QL7 A;  3IK9 A;  2YP6 A;  5J5N A;  5ECN B;  2H74 A;  1EV9 A;  2L57 A;  5F05 A;  4IP1 A;  1F3B A;  3TGZ A;  3DD3 A;  4NV5 A;  5ECQ B;  2M72 A;  3HVV A;  4K7N A;  1T8E B;  3D0Z A;  4N30 A;  4YQV A;  2HE3 A;  1BYE A;  16GS A;  4OCF A;  2KLX A;  1YJ6 A;  1JZO A;  3BCI A;  1G0T A;  1HNB A;  2IWT A;  6GST A;  3C1R A;  1GSD A;  3G9B A;  1F6M C;  2GDR A;  3H79 A;  1EGR A;  2XPE A;  2HRA A;  5IOW A;  1QQ2 A;  4N10 A;  1DE1 A;  5CRH A;  4ECB A;  4FO5 A;  1T4Y A;  6GSY A;  5GSS A;  2DKH A;  3IRA A;  4F03 A;  5EVO A;  5ELA A;  1EEJ A;  3UBK A;  1TI1 A;  3HDC A;  3UEM A;  3D4T A;  2NBS A;  1X5D A;  2VD0 A;  1M2D A;  5ECO B;  1B9Y C;  4GCI A;  1Y6E A;  2ES7 A;  3IXR A;  3I6A A;  4F82 A;  1GL8 A;  5LD0 A;  5J9C A;  4GQF A;  3M0F A;  2HNL A;  3P8W A;  3F4T A;  5EY6 A;  2C8U A;  4MPG A;  1SK2 A;  2G0F A;  2QGV A;  3QPM A;  5ECL B;  5ECS A;  3TCO A;  1RK4 A;  1G7O A;  4BVX B;  4AGS A;  3GX8 A;  1YKC A;  4I97 A;  4KUN A;  2C1Y A;  2IMF A;  2X8C A;  1TRU A;  4KSO A;  2EIQ A;  2GQM A;  1Z3E A;  4DEJ A;  3GH6 A;  3CSH A;  3TOT A;  4O5R A;  3IHG A;  2DBC A;  6GSS A;  1ZGN A;  3RDW A;  5E59 A;  4AJ6 A;  2F8F A;  2VL2 A;  4IN0 A;  2GLR A;  1URM A;  3GV1 A;  1SK1 A;  1HNA A;  1OC9 B;  1OAZ A;  1MDJ A;  3IE3 A;  4POB A;  3OR5 A;  1M2B A;  4MMM A;  5CNW A;  3S9F A;  1MDK A;  1UA5 A;  4XS4 A;  2P5Q A;  2HLS A;  3WGE A;  3TJF A;  4K7I A;  1A8L A;  3QFA C;  1ABA A;  3CSI A;  11GS A;  1K0A A;  5IPH A;  1SEN A;  3HJO A;  4IKH A;  4TOP A;  2JZT A;  2R0C A;  3IC8 A;  1HNC A;  3DRN A;  5A4U A;  1YF0 A;  2FCH A;  5CRG A;  4I8B A;  3ZIJ A;  4DSR A;  2PBJ A;  1ERU A;  3ZFL A;  2DML A;  1XW6 A;  4IHU A;  3RBT A;  1EP8 A;  3EVI A;  4TXO A;  5C04 A;  2YWI A;  2VAF A;  3ZIV A;  2XHF A;  4K6X A;  2NDO A;  3EWL A;  4V2N A;  3QAW A;  3TKS E;  3ZVJ A;  5J4U A;  5H5S A;  2BJX A;  3D22 A;  5FWG A;  2GZY A;  2H01 A;  2VL3 A;  4O5U A;  4GXZ A;  4N11 A;  3TJJ A;  1WIK A;  2L5L A;  2FHE A;  3IBH A;  3KTB A;  2L6D A;  2DJ0 A;  1J0F A;  4G0K A;  2MMZ A;  5G31 A;  9GSS A;  4XCS A;  3O76 A;  1XWB A;  1FOH A;  1SL2 B;  2HI7 A;  1MDI A;  3HJP A;  1KEB A;  4GTU A;  1OC8 A;  2JU5 A;  1GNW A;  2WUL A;  4FH8 A;  4MP4 A;  4Q5Q A;  2PUK C;  2JSY A;  3C7M A;  2GS3 A;  4DVC A;  4NMU A;  1WP0 A;  1LJR A;  4NHZ A;  3BD2 A;  5CO3 A;  2OE1 A;  4KF9 A;  1VRS D;  3DYR A;  1X9W B;  1M9A A;  2H0G A;  2H6Z A;  2PPT A;  2R3X A;  2AHE A;  4XS6 A;  1O8X A;  2AJQ B;  4A5P A;  4MA9 A;  4HSC X;  4WBR D;  2C0F A;  3C73 A;  1XVQ A;  1A23 A;  1GTA A;  1S3D A;  2R2J A;  5AIV A;  5LNK e;  4J56 E;  2H1A A;  3CRT A;  3ZZX A;  2ZUP A;  2WDU A;  1AAZ A;  3TKS A;  4KSM A;  2F9S A;  4HEA 2;  4E8E A;  2I4A A;  14GS A;  1XOA A;  2FWH A;  5GAN D;  3GNJ A;  3CXG A;  5C00 A;  1K3Y A;  3I43 A;  2RUF A;  3CRU A;  1HQO A;  5FT3 A;  3FR6 A;  4D73 A;  3A5W A;  4K9Z A;  5HR1 A;  2R37 A;  3ZMK A;  2FLS A;  1ERW A;  2VM1 A;  2JL4 A;  4MJB A;  5D9W A;  2V2G A;  2HSH A;  3M8N A;  2AV4 A;  2R6K A;  3TJG A;  1XXU A;  4V1A g;  2IMD A;  3HCZ A;  1ON4 A;  1GUH A;  4GF0 A;  5IMC A;  4MAB A;  3U5R E;  1GSS A;  1F3A A;  1JFU A;  3MDK A;  4GQC A;  4TXV A;  3VWW A;  4ZB8 A;  1YEP A;  2Z9S A;  3F3R A;  4LL4 B;  4ZIJ A;  4XS4 B;  1V98 A;  3SWL A;  2MMA A;  2REM A;  1KTE A;  1PA3 A;  4N0V A;  1VF4 A;  3GKM A;  5IO0 A;  3WGD A;  3LXT A;  2FWF A;  1XW5 A;  1MEK A;  2HZF A;  5HFK A;  3FEU A;  3LFL A;  5JCU A;  2IME A;  3TOU A;  1FOV A;  1OE7 A;  2LEG A;  5G5E A;  2C3T A;  2CV4 A;  1NHY A;  2RLI A;  2C4J A;  4RQX A;  1TDI A;  4CW9 A;  5IQY A;  2A2R A;  5CYY A;  1A24 A;  1WE0 A;  5HR2 A;  1N8J A;  3BCK A;  4KDU A;  1K3L A;  3HZ8 A;  5AGY A;  3R3E A;  3KD0 A;  3M3M A;  5COH A;  1ERT A;  1TU7 A;  5B7C A;  3LWA A;  3IAM 2;  3KP9 A;  3ZFB A;  3KEB A;  3IV4 A;  4EXJ A;  2VO4 A;  4KX4 A;  1BAY A;  4EDY A;  2LQQ A;  4Z2R A;  3EU4 A;  2PER A;  2OBK A;  2LJK A;  4FIW A;  4IBP A;  4BWQ A;  1WPI A;  2FWE A;  3KJY A;  3KH9 A;  4YH2 A;  2GSR A;  3D21 A;  4NAX A;  3D5J A;  1R26 A;  3KMN A;  1AXD A;  1XOB A;  5D73 A;  5KOX A;  5ECP B;  3SBC A;  1ZMA A;  2DJ2 A;  3APO A;  4POK A;  1Z7P A;  3DXB A;  4X43 A;  2V41 A;  1GTU A;  5GAP D;  2M46 A;  2NTO A;  2YV7 A;  4JBB A;  3UMA A;  4HS1 A;  1B4P A;  4G9H A;  1SK0 A;  1FG4 A;  5F07 A;  1SYX A;  4V2M A;  3ZRE A;  2N5A A;  5ABR A;  1GSU A;  5DDL A;  3ED3 A;  4GRF A;  1IYI A;  3UOM A;  2GGT A;  2ZNM A;  2GVP A;  3DKS A;  1OC9 A;  3UVH A;  3IC4 A;  3MWH A;  1JHB A;  2DKI A;  3HVX A;  4ID0 A;  3G7Y A;  4D73 B;  1E2Y A;  1Q98 A;  4JRR A;  3FMW A;  1GSF A;  2YOI A;  3BBY A;  2NPB A;  3F3Q A;  3L9V A;  3ZYW A;  1TRW A;  3VPQ A;  3ZL5 A;  1QXH A;  1FVJ A;  1EWX A;  1FAA A;  4GST A;  2TRC P;  3LYK A;  3EUR A;  4G0I A;  1XWC A;  3EIN A;  1DUG A;  3J7Y k;  3D6I A;  4NPB A;  2N5B A;  4PQH A;  2OKA A;  2IIY A;  1O8W A;  4KA0 A;  3KZQ A;  2PVO C;  1T7P B;  3VUR A;  1OKD A;  1Y25 A;  5HFI A;  4FQU A;  3UIW A;  2BTO T;  1GUK A;  4NWY A;  3VWX A;  5F06 A;  2LTK A;  3G7I A;  3P90 A;  2R4V A;  3LW9 A;  5G2Z A;  2KHP A;  2PN8 A;  5AIS A;  1XBS A;  2RM5 A;  4AF2 A;  1SL0 B;  5FHI A;  2TIR A;  1YKA A;  4F2I A;  1WJK A;  2L59 A;  3L78 A;  5D9X A;  1EGO A;  4MCU A;  3PPU A;  3RHC A;  2HZE A;  2F51 A;  3EMX A;  1EV4 A;  4ECI A;  3GN3 A;  2L5O A;  3PR8 A;  2C3N A;  4J57 E;  1O85 A;  5J41 A;  2R0G A;  5DBQ A;  3PH9 A;  4ZBB A;  1FO5 A;  2H30 A;  5HQP A;  2AB6 A;  3C1S A;  4GWR A;  5CRW A;  5HR3 A;  4XHM A;  3ZIT A;  3R2Q A;  1A2M A;  4L0W A;  1YF1 A;  4HUA A;  4LLR A;  3ZLP A;  2DJK A;  1DSB A;  1TRV A;  4OD7 A;  3GL5 A;  3LSZ A;  1JZW A;  2DSA A;  3F8U A;  2PMT A;  1PMT A;  1THO A;  5D9V A;  2QA1 A;  1K3O A;  2QKE A;  2LRC A;  4OFT A;  3QAV A;  2F8A A;  5E4W A;  3RPP A;  3UVT A;  4ECC A;  1ILO A;  2DIZ A;  3DML A;  4EUY A;  1WWJ A;  2FWG A;  4K5S A;  1KBN A;  3IR4 A;  2GZZ A;  5EL8 A;  1PN9 A;  1AW9 A;  2VLV A;  4TR1 B;  5BMU A;  3UJ1 A;  3HHV A;  3MNG A;  1G6W A;  3H8Q A;  2B7K A;  3BJ5 A;  1PL2 A;  3FK8 A;  2ON5 A;  1GSQ A;  2GST A;  3TJB A;  3VI5 A;  4EIP A;  1ML6 A;  2D2Z A;  4K7O A;  3MSZ A;  1K0B A;  2WJU A;  1A0R P;  1UN2 A;  2VLU A;  2IMK A;  4FYB A;  5B6M A;  2MMN A;  2CAQ A;  1VGL A;  2VCX A;  5G1L A;  1GWC A;  2IMI A;  2DC5 A;  3GTU B;  3HKR A;  4HDE A;  1PRX A;  4J2F A;  5IIZ A;  18GS A;  3IPZ A;  1TTZ A;  2XC2 A;  2HSY A;  3FRC A;  1R5P A;  1EEM A;  4GSS A;  4Z2U A;  2H0H A;  3A2W A;  1WRY A;  3LG6 A;  4YKF A;  5ENU A;  4ML6 A;  4ZXG A;  1B8X A;  5DVB A;  1TI3 A;  1PKZ A;  4LMV A;  1M2A A;  1V57 A;  3ZML A;  1GSY A;  1TK5 B;  5J9B A;  1LBK A;  1GSE A;  4HQS A;  3VK9 A;  2FY6 A;  3CQF A;  1XWK A;  3CTG A;  4F0B A;  2G2Q A;  4MZW A;  4KB3 A;  1AUC A;  4EIQ A;  4ZBA A;  3DGQ A;  3NIV A;  3ME8 A;  4XTS A;  3M9K A;  5G30 A;  3E0U A;  4IS0 A;  3FZ5 A;  1GUM A;  2HZE B;  3D4M A;  2VM2 A;  1T3B A;  2MZC A;  1XWG A;  3EC3 A;  2A2S A;  2OE3 A;  1RW1 A;  2VL2 C;  3GL3 A;  2GSQ A;  4KW6 A; 
#chains in the Genus database with same CATH homology
 1T4Z A;  1XPV A;  2XPD A;  4OFM A;  2TRX A;  2YJH A;  4WF4 A;  1SJI A;  4WR5 A;  2VIM A;  1YY7 A;  3F6F A;  3I9V 2;  4V2L A;  2FA8 A;  4WET A;  1Q4J A;  3VPT A;  3TKQ A;  3F6D A;  4ZB9 A;  5A4V A;  17GS A;  4K8M A;  4PXO A;  2FUG 2;  1J08 A;  2XBI A;  1U3I A;  3HJM A;  2P0G A;  3MIX A;  3DVW A;  1VF2 A;  3EE2 A;  4K2D A;  1X5E A;  2H70 A;  2EIR A;  1PSQ A;  5H5Q A;  3E9J B;  1VF1 A;  4O32 A;  3VLN A;  1FB6 A;  1FHE A;  3MAK A;  4POM A;  1A2J A;  1ZCP A;  2OBI A;  3KIJ A;  4MJE A;  5IO2 A;  4O7H A;  1NSW A;  3NOF A;  4P3Y B;  2DJJ A;  2CZ2 A;  5ID2 B;  4YAP A;  1TKD B;  2RM6 A;  2K6V A;  2CVK A;  4Q5F A;  4TRX A;  3NZN A;  1SD8 A;  1JLV A;  3H1N A;  2DLX A;  5G5F A;  1F9M A;  4QQ7 A;  4DSQ A;  1WMJ A;  4MH3 A;  5CRE A;  2MBT A;  3TRP A;  1M99 A;  3WYW A;  4POL A;  2CX4 A;  3TRQ A;  1QFN A;  1M7T A;  2MMO A;  3GKK A;  3WT2 A;  4OFN A;  4HZ2 A;  4L5L A;  3V1W A;  2RII A;  3ME7 A;  5DQY A;  1GNE A;  3APS A;  3LOR A;  3KGK A;  2VCQ A;  4PTS A;  4TW5 A;  3L4N A;  4K2X A;  2LQO A;  3P7X A;  1K0O A;  4EE0 A;  4QL9 A;  1XZO A;  2YZU A;  4MZC A;  4ML1 A;  3QAG A;  1B9X C;  2VCW A;  2PU9 C;  4NHW A;  2I3Y A;  1V58 A;  2OAD A;  2FA4 A;  2YCD A;  2CVB A;  2YV9 A;  4NV2 A;  2H19 A;  2BMX A;  2C80 A;  5IMF A;  1UC7 A;  4K0G A;  4KND A;  4IJ3 A;  2XBQ A;  2DIY A;  3LYP A;  4HU9 A;  1J9B A;  3W8J A;  2B3S A;  4ECJ A;  3FR3 A;  4N0Z A;  2GT5 A;  5DQS A;  5EPF A;  4X4J A;  2YN1 A;  2IJY A;  4IGJ A;  1B4Q A;  4AJ8 A;  5J3R A;  2ON7 A;  4PUF C;  2B1L A;  5ECH B;  1QUW A;  4RI7 A;  1VF3 A;  20GS A;  4JZQ A;  3VFI A;  1S3C A;  1XFL A;  5KN3 A;  3FKF A;  5GZZ B;  3F4R A;  13GS A;  4JR4 A;  2WZ9 A;  4XIH A;  4IQ1 A;  2EC4 A;  1BX9 A;  3IAS 2;  2YJ7 A;  2B1K A;  4LA1 A;  1Z6M A;  1H4O A;  4MK3 A;  1WOU A;  4BL7 A;  3IHQ A;  2OAC A;  3HVS A;  4L8E A;  1A8Y A;  2LKU A;  3U6V A;  2JZR A;  5B6N A;  1O73 A;  2H6Y A;  2VOC A;  1JLW A;  4PNG A;  3RPN A;  2VUP A;  1TK8 B;  4TR1 A;  3ERF A;  3DVX A;  4OWY A;  3AY8 A;  1HYU A;  5KN0 A;  1EOG A;  2ALB A;  3PIN A;  2MYG A;  1OKT A;  2X8G A;  4BPY A;  3TRX A;  3LQ7 A;  3KTL A;  1SD9 A;  5ECK B;  2O87 A;  1Z9H A;  1QMV A;  4CHS A;  5IOX A;  3IDV A;  5JCG A;  4F9Z A;  2A4V A;  3HZ4 A;  2M80 A;  5GST A;  4MF5 A;  2I1U A;  4JR6 A;  3ZVJ D;  1SKW B;  4K1F A;  3GX0 A;  4G10 A;  2N5F A;  4IQA A;  1ZYE A;  8GSS A;  1EOH A;  3GTU A;  4KCA A;  2PGT A;  4JED A;  1R5A A;  3WT1 A;  3W6G A;  4FYU A;  2UZ8 A;  4HU7 A;  4IEL A;  1K0N A;  1THX A;  2AUV A;  2OA7 A;  1W4V A;  5KOW A;  1XVW A;  2O7K A;  2YPM A;  2KP2 A;  1QK8 A;  5IM9 A;  1DBY A;  4LL1 B;  2L4C A;  3A5I A;  2LRN A;  2GTU A;  5G1K A;  3GUR A;  4TN8 A;  4K5R A;  4PQI A;  1H75 A;  5JWQ B;  5IMZ A;  22GS A;  3CSJ A;  1YEX A;  2WRT A;  2F3M A;  4MNN A;  1PX6 A;  5HFG A;  1S3A A;  1T00 A;  1PN0 A;  1OC3 A;  2E2M A;  2R5G A;  4GLT A;  1SJZ A;  4USS A;  4CY8 A;  2PWJ A;  2CAI A;  10GS A;  3UAR A;  1MTC A;  2DJ1 A;  4HI7 A;  3GYK A;  1FB0 A;  1U87 A;  3FZA A;  4HJ2 A;  1AIU A;  1LU4 A;  1SL1 B;  3CYN A;  3LXZ A;  2H75 A;  2GT6 A;  1K0D A;  4BWS A;  2DJ3 A;  3O3T A;  2B5X A;  1O7U A;  4EDZ A;  5BRT A;  1EP7 A;  2IL3 A;  1IYH A;  3MYD A;  4I2T A;  4TR0 A;  4X1U A;  1ACV A;  2B5E A;  6GSU A;  4MF7 A;  2R0P A;  3Q19 A;  3IA1 A;  3M1G A;  2C3Q A;  1SJ6 A;  3A3T A;  4PUR A;  4WKW A;  1SKS B;  5B8B A;  2B6M A;  1ZYP A;  6GSW A;  3BOA A;  4OO5 A;  4PGT A;  2X8H A;  1A2L A;  3LJR A;  1O6J A;  5L71 A;  1R4W A;  3HA9 A;  3KP8 A;  5DAK A;  4G0L A;  3UAP A;  4WXT A;  1C72 A;  1ERV A;  4HQZ A;  4YQU A;  19GS A;  2H71 A;  1YDK A;  4TVE A;  4TR4 A;  2P5R A;  2I9H A;  3GHA A;  1XW9 A;  1B48 A;  1F37 A;  3CBU A;  4MZB A;  4OO4 A;  3TJK A;  2H1B A;  1V9W A;  2GQK A;  4K0N A;  5D8I A;  3GST A;  4BL7 B;  1JZR A;  2C0D A;  1V2A A;  2LUS A;  2V1M A;  4IVF A;  5DAL A;  1SU9 A;  4WBJ A;  5ID2 A;  1KNG A;  4F0C A;  1TOF A;  4IJI A;  2I81 A;  3RAZ A;  1M0U A;  4Q5R A;  4ICY A;  4I5Q A;  1PQN A;  5IMD A;  4MH2 A;  5D9T A;  5D93 A;  3DIE A;  1NW2 A;  6GSX A;  3G7J A;  3IOS A;  1TXX A;  3DWV A;  2V32 A;  1BJX A;  1R7H A;  1G6Y A;  3ERG A;  1PGT A;  2YAN A;  2OJL A;  5IPG A;  2LJA A;  2K9F A;  4ZL8 A;  2HRF A;  4ACS A;  2B7J A;  1GTI A;  2MBS A;  2E7P A;  3EPT A;  4YAV A;  2V6K A;  4I6X A;  1X5C A;  2WGR A;  4WF5 A;  12GS A;  2WS2 A;  2B5Y A;  1PD2 1;  3KCM A;  3GIX A;  1GLP A;  3C8E A;  2H76 A;  4XRD A;  3CTF A;  4PX1 A;  2GZP A;  2VCT A;  4MF6 A;  4KAE A;  2H0I A;  5KEJ A;  1YQ1 A;  4KE3 A;  3VWV A;  2FGX A;  1DE2 A;  3UBL A;  1TRS A;  4ZL9 A;  1AQV A;  2LS5 A;  3KMO A;  3FZ4 A;  3LEF A;  2X4A A;  6GSV A;  2AAW A;  4EO3 A;  1K0M A;  2FNO A;  4L5O A;  1W89 A;  3EU3 A;  1K0C A;  4FYC A;  7GSS A;  2LNS A;  2RUE A;  2VD1 A;  2CA8 A;  4MJA A;  1GLQ A;  1ZYQ B;  5D96 A;  1TU8 A;  2HT9 A;  5KN2 A;  5ECM B;  2X49 A;  3W8S A;  1BG5 A;  4ISD A;  4JU5 A;  1GH2 A;  2EIO A;  5HR0 A;  4ZL7 A;  4CDO A;  4BA7 A;  3L0H A;  1F2E A;  2H72 A;  3HY2 A;  4EL1 A;  1V40 A;  2O8V B;  1OVN A;  4EF0 A;  3PGT A;  2LJR A;  4GSN A;  3APQ A;  3ZTL A;  4E8H A;  2J9H A;  3TKP A;  2LST A;  2CVD A;  4Z2T A;  2JAC A;  3K8N A;  4WR4 A;  1TJD A;  2LRT A;  3QCP A;  5DAK B;  4BVY A;  2ZCT A;  4H86 A;  2CQ9 A;  3ERW A;  2H66 A;  2IFQ A;  3F9U A;  2FD3 A;  3VWU A;  2O85 A;  2HRN A;  2YWN A;  5DJL A;  1FVK A;  5B8A A;  2A4H A;  5IMV A;  3I69 A;  2HYX A;  5LCZ A;  3L9S A;  2L4Q A;  2WB9 A;  4TKY A;  4HZ4 A;  3IK7 A;  1U3A A;  2CZ3 A;  2KUC A;  1NM3 A;  1PL1 A;  5DAL B;  5ELG A;  2CX3 A;  2X64 A;  3RHB A;  1YZX A;  2C0G A;  2YNX A;  4HOJ A;  5JCW A;  2WCI A;  3GRX A;  4O5Q A;  2QA2 A;  4I2U A;  4O92 A;  3E3E A;  1GTB A;  1USB A;  5INY A;  2HSM A;  5JWR B;  5KN1 A;  4MPF A;  4Z7X A;  3P2A A;  1NHO A;  3FZ9 A;  4HJM A;  3US3 A;  1JZD A;  3F4S A;  3QOU A;  4X0X A;  3KXO A;  4PNF A;  3GKX A;  4ZBD A;  4WEY A;  3FYG A;  3N9J A;  2P31 A;  4DSS A;  4OMV A;  2GQL A;  3A2X A;  2J23 A;  1ST9 A;  5AIX A;  4ILF A;  3DEX A;  3Q18 A;  3GKN A;  1ZOF A;  1T1V A;  1I5G A;  1BQ7 A;  4IW9 A;  3LGC A;  5DCH A;  1FW1 A;  2X99 A;  3ISO A;  2DMM A;  1AC1 A;  1Z5Y E;  3GSS A;  3QMX A;  5IMA A;  2KP1 A;  4MDC A;  1X9M B;  3QFB C;  1PKW A;  2YWM A;  5AN1 A;  4EC0 A;  3GH9 A;  4RQR A;  4KDY A;  1HD2 A;  3FR9 A;  3TKS C;  2JAD A;  1CQG A;  4AJ7 A;  2YWO A;  1X9S B;  3FY7 A;  2E2G A;  1AQW A;  2IN3 A;  3EMP A;  4EKZ A;  3Q6O A;  4TXO B;  3QD9 A;  1UVZ A;  4YKG A;  3ZRD A;  2K8V A;  1I9D A;  2AYT A;  3JCM L;  2C0E A;  1CQH A;  3GFK A;  1MD4 A;  4XS1 A;  2L6C A;  2HFD A;  3CMI A;  4KGI A;  2VCZ A;  5ECR B;  3TKR A;  3HYP A;  3WGX A;  2YZH A;  4L0U A;  5F8B A;  3TB2 A;  3L9U A;  1PX7 A;  1QGV A;  4ZIL A;  3FHK A;  2O89 A;  4NXI A;  4V1A p;  1RQM A;  4KDX A;  3UL3 A;  5DJM A;  2JSZ A;  2KOK A;  2H1D A;  2LV3 A;  2H73 A;  5A4W A;  1ZZY A;  4CY6 A;  4BVY B;  3EYT A;  3C71 A;  1U88 A;  2IFQ B;  2H6X A;  3M9J A;  1SYR A;  3F0I A;  4BVX A;  4EVM A;  2QC7 A;  4KH7 A;  3F63 A;  3GMF A;  1Z6N A;  4IP6 A;  1G7E A;  1TP9 A;  1ZL9 A;  1MD3 A;  2H8L A;  1N2A A;  4ZB6 A;  1TW9 A;  2WFC A;  1GP1 A;  1E6B A;  1Z7R A;  3HXS A;  4KCE A;  4XRA A;  3KH7 A;  3GA4 A;  2VCV A;  3TDG A;  3FW2 A;  1ZYN A;  2A2P A;  2CT6 A;  2QSI A;  3QR6 A;  5H5R A;  1GUL A;  1OE8 A;  1XWA A;  4PQ1 A;  3HD5 A;  1M9B A;  1O81 A;  2E0Q A;  4RUV A;  2K18 A;  3WD6 A;  3Q74 A;  2HXK A;  3TUE A;  1EZK A;  3QDN A;  4LMW A;  3J7Y b;  1A0F A;  4RI6 A;  3O6T A;  4TR3 A;  5CAX A;  4G19 A;  3GUS A;  3H93 A;  5JWO B;  5ECI B;  1GRX A;  2VLT A;  1BED A;  2LNT A;  2OE0 A;  5DCG A;  3VI7 A;  5CP1 A;  2V6O A;  1XCC A;  2HRK A;  2PVQ A;  3KM6 A;  4JE1 A;  1AQX A;  2K8S A;  2H1G A;  4ULX A;  1X0R A;  4DSS B;  1XIY A;  2IPA A;  4PUA A;  2JZS A;  3H4K A;  1SKR B;  5CRD A;  3N5O A;  4MJC A;  2NVL A;  4MLY A;  5F0G A;  3A2V A;  1U6T A;  4G2E A;  2VL9 A;  4YQM A;  5A5K A;  2GSS A;  1OYJ A;  4OCE A;  4Q5N A;  1TK0 B;  4QL7 A;  3IK9 A;  2YP6 A;  5J5N A;  5ECN B;  2H74 A;  1EV9 A;  2L57 A;  5F05 A;  4IP1 A;  1F3B A;  3TGZ A;  3DD3 A;  4NV5 A;  5ECQ B;  2M72 A;  3HVV A;  4K7N A;  1T8E B;  3D0Z A;  4N30 A;  4YQV A;  2HE3 A;  1BYE A;  16GS A;  4OCF A;  2KLX A;  1YJ6 A;  1JZO A;  3BCI A;  1G0T A;  1HNB A;  2IWT A;  6GST A;  3C1R A;  1GSD A;  3G9B A;  1F6M C;  2GDR A;  3H79 A;  1EGR A;  2XPE A;  2HRA A;  5IOW A;  1QQ2 A;  4N10 A;  1DE1 A;  5CRH A;  4ECB A;  4FO5 A;  1T4Y A;  6GSY A;  5GSS A;  2DKH A;  3IRA A;  4F03 A;  5EVO A;  5ELA A;  1EEJ A;  3UBK A;  1TI1 A;  3HDC A;  3UEM A;  3D4T A;  2NBS A;  1X5D A;  2VD0 A;  1M2D A;  5ECO B;  1B9Y C;  4GCI A;  1Y6E A;  2ES7 A;  3IXR A;  3I6A A;  4F82 A;  1GL8 A;  5LD0 A;  5J9C A;  4GQF A;  3M0F A;  2HNL A;  3P8W A;  3F4T A;  5EY6 A;  2C8U A;  4MPG A;  1SK2 A;  2G0F A;  2QGV A;  3QPM A;  5ECL B;  5ECS A;  3TCO A;  1RK4 A;  1G7O A;  4BVX B;  4AGS A;  3GX8 A;  1YKC A;  4I97 A;  4KUN A;  2C1Y A;  2IMF A;  2X8C A;  1TRU A;  4KSO A;  2EIQ A;  2GQM A;  1Z3E A;  4DEJ A;  3GH6 A;  3CSH A;  3TOT A;  4O5R A;  3IHG A;  2DBC A;  6GSS A;  1ZGN A;  3RDW A;  5E59 A;  4AJ6 A;  2F8F A;  2VL2 A;  4IN0 A;  2GLR A;  1URM A;  3GV1 A;  1SK1 A;  1HNA A;  1OC9 B;  1OAZ A;  1MDJ A;  3IE3 A;  4POB A;  3OR5 A;  1M2B A;  4MMM A;  5CNW A;  3S9F A;  1MDK A;  1UA5 A;  4XS4 A;  2P5Q A;  2HLS A;  3WGE A;  3TJF A;  4K7I A;  1A8L A;  3QFA C;  1ABA A;  3CSI A;  11GS A;  1K0A A;  5IPH A;  1SEN A;  3HJO A;  4IKH A;  4TOP A;  2JZT A;  2R0C A;  3IC8 A;  1HNC A;  3DRN A;  5A4U A;  1YF0 A;  2FCH A;  5CRG A;  4I8B A;  3ZIJ A;  4DSR A;  2PBJ A;  1ERU A;  3ZFL A;  2DML A;  1XW6 A;  4IHU A;  3RBT A;  1EP8 A;  3EVI A;  4TXO A;  5C04 A;  2YWI A;  2VAF A;  3ZIV A;  2XHF A;  4K6X A;  2NDO A;  3EWL A;  4V2N A;  3QAW A;  3TKS E;  3ZVJ A;  5J4U A;  5H5S A;  2BJX A;  3D22 A;  5FWG A;  2GZY A;  2H01 A;  2VL3 A;  4O5U A;  4GXZ A;  4N11 A;  3TJJ A;  1WIK A;  2L5L A;  2FHE A;  3IBH A;  3KTB A;  2L6D A;  2DJ0 A;  1J0F A;  4G0K A;  2MMZ A;  5G31 A;  9GSS A;  4XCS A;  3O76 A;  1XWB A;  1FOH A;  1SL2 B;  2HI7 A;  1MDI A;  3HJP A;  1KEB A;  4GTU A;  1OC8 A;  2JU5 A;  1GNW A;  2WUL A;  4FH8 A;  4MP4 A;  4Q5Q A;  2PUK C;  2JSY A;  3C7M A;  2GS3 A;  4DVC A;  4NMU A;  1WP0 A;  1LJR A;  4NHZ A;  3BD2 A;  5CO3 A;  2OE1 A;  4KF9 A;  1VRS D;  3DYR A;  1X9W B;  1M9A A;  2H0G A;  2H6Z A;  2PPT A;  2R3X A;  2AHE A;  4XS6 A;  1O8X A;  2AJQ B;  4A5P A;  4MA9 A;  4WBR D;  2C0F A;  3C73 A;  1XVQ A;  1A23 A;  1GTA A;  1S3D A;  2R2J A;  5AIV A;  5LNK e;  4J56 E;  2H1A A;  3CRT A;  3ZZX A;  2ZUP A;  2WDU A;  1AAZ A;  3TKS A;  4KSM A;  2F9S A;  4HEA 2;  4E8E A;  2I4A A;  14GS A;  1XOA A;  2FWH A;  5GAN D;  3GNJ A;  3CXG A;  5C00 A;  1K3Y A;  3I43 A;  2RUF A;  3CRU A;  1HQO A;  5FT3 A;  3FR6 A;  4D73 A;  3A5W A;  4K9Z A;  5HR1 A;  2R37 A;  3ZMK A;  2FLS A;  1ERW A;  2VM1 A;  2JL4 A;  4MJB A;  5D9W A;  2V2G A;  2HSH A;  3M8N A;  2AV4 A;  2R6K A;  3TJG A;  1XXU A;  4V1A g;  2IMD A;  3HCZ A;  1ON4 A;  1GUH A;  4GF0 A;  5IMC A;  4MAB A;  3U5R E;  1GSS A;  1F3A A;  1JFU A;  3MDK A;  4GQC A;  4TXV A;  3VWW A;  4ZB8 A;  1YEP A;  2Z9S A;  3F3R A;  4LL4 B;  4ZIJ A;  4XS4 B;  1V98 A;  3SWL A;  2MMA A;  2REM A;  1KTE A;  1PA3 A;  4N0V A;  1VF4 A;  3GKM A;  5IO0 A;  3WGD A;  3LXT A;  2FWF A;  1XW5 A;  1MEK A;  2HZF A;  5HFK A;  3FEU A;  3LFL A;  5JCU A;  2IME A;  3TOU A;  1FOV A;  1OE7 A;  2LEG A;  5G5E A;  2C3T A;  2CV4 A;  1NHY A;  2RLI A;  2C4J A;  4RQX A;  1TDI A;  4CW9 A;  5IQY A;  2A2R A;  5CYY A;  1A24 A;  1WE0 A;  5HR2 A;  1N8J A;  3BCK A;  4KDU A;  1K3L A;  3HZ8 A;  5AGY A;  3R3E A;  3KD0 A;  3M3M A;  5COH A;  1ERT A;  1TU7 A;  5B7C A;  3LWA A;  3IAM 2;  3KP9 A;  3ZFB A;  3KEB A;  3IV4 A;  4EXJ A;  2VO4 A;  4KX4 A;  1BAY A;  4EDY A;  2LQQ A;  4Z2R A;  3EU4 A;  2PER A;  2OBK A;  2LJK A;  4FIW A;  4IBP A;  4BWQ A;  1WPI A;  2FWE A;  3KJY A;  3KH9 A;  4YH2 A;  2GSR A;  3D21 A;  4NAX A;  3D5J A;  1R26 A;  3KMN A;  1AXD A;  1XOB A;  5D73 A;  5KOX A;  5ECP B;  3SBC A;  1ZMA A;  2DJ2 A;  3APO A;  4POK A;  1Z7P A;  3DXB A;  4X43 A;  2V41 A;  1GTU A;  5GAP D;  2M46 A;  2NTO A;  2YV7 A;  4JBB A;  3UMA A;  4HS1 A;  1B4P A;  4G9H A;  1SK0 A;  1FG4 A;  5F07 A;  1SYX A;  4V2M A;  3ZRE A;  2N5A A;  5ABR A;  1GSU A;  5DDL A;  3ED3 A;  4GRF A;  1IYI A;  3UOM A;  2GGT A;  2ZNM A;  2GVP A;  3DKS A;  1OC9 A;  3UVH A;  3IC4 A;  3MWH A;  1JHB A;  2DKI A;  3HVX A;  4ID0 A;  3G7Y A;  4D73 B;  1E2Y A;  1Q98 A;  4JRR A;  3FMW A;  1GSF A;  2YOI A;  3BBY A;  2NPB A;  3F3Q A;  3L9V A;  3ZYW A;  1TRW A;  3VPQ A;  3ZL5 A;  1QXH A;  1FVJ A;  1EWX A;  1FAA A;  4GST A;  2TRC P;  3LYK A;  3EUR A;  4G0I A;  1XWC A;  3EIN A;  1DUG A;  3J7Y k;  3D6I A;  4NPB A;  2N5B A;  4PQH A;  2OKA A;  2IIY A;  1O8W A;  4KA0 A;  3KZQ A;  2PVO C;  1T7P B;  3VUR A;  1OKD A;  1Y25 A;  5HFI A;  4FQU A;  3UIW A;  2BTO T;  1GUK A;  4NWY A;  3VWX A;  5F06 A;  2LTK A;  3G7I A;  3P90 A;  2R4V A;  3LW9 A;  5G2Z A;  2KHP A;  2PN8 A;  5AIS A;  1XBS A;  2RM5 A;  4AF2 A;  1SL0 B;  5FHI A;  2TIR A;  1YKA A;  4F2I A;  1WJK A;  2L59 A;  3L78 A;  5D9X A;  1EGO A;  4MCU A;  3PPU A;  3RHC A;  2HZE A;  2F51 A;  3EMX A;  1EV4 A;  4ECI A;  3GN3 A;  2L5O A;  3PR8 A;  2C3N A;  4J57 E;  1O85 A;  5J41 A;  2R0G A;  5DBQ A;  3PH9 A;  4ZBB A;  1FO5 A;  2H30 A;  5HQP A;  2AB6 A;  3C1S A;  4GWR A;  5CRW A;  5HR3 A;  4XHM A;  3ZIT A;  3R2Q A;  1A2M A;  4L0W A;  1YF1 A;  4HUA A;  4LLR A;  3ZLP A;  2DJK A;  1DSB A;  1TRV A;  4OD7 A;  3GL5 A;  3LSZ A;  1JZW A;  2DSA A;  3F8U A;  2PMT A;  1PMT A;  1THO A;  5D9V A;  2QA1 A;  1K3O A;  2QKE A;  2LRC A;  4OFT A;  3QAV A;  2F8A A;  5E4W A;  3RPP A;  3UVT A;  4ECC A;  1ILO A;  2DIZ A;  3DML A;  4EUY A;  1WWJ A;  2FWG A;  4K5S A;  1KBN A;  3IR4 A;  2GZZ A;  5EL8 A;  1PN9 A;  1AW9 A;  2VLV A;  4TR1 B;  5BMU A;  3UJ1 A;  3HHV A;  3MNG A;  1G6W A;  3H8Q A;  2B7K A;  3BJ5 A;  1PL2 A;  3FK8 A;  2ON5 A;  1GSQ A;  2GST A;  3TJB A;  3VI5 A;  4EIP A;  1ML6 A;  2D2Z A;  4K7O A;  3MSZ A;  1K0B A;  2WJU A;  1A0R P;  1UN2 A;  2VLU A;  2IMK A;  4FYB A;  5B6M A;  2MMN A;  2CAQ A;  1VGL A;  2VCX A;  5G1L A;  1GWC A;  2IMI A;  2DC5 A;  3GTU B;  3HKR A;  4HDE A;  1PRX A;  4J2F A;  5IIZ A;  18GS A;  3IPZ A;  1TTZ A;  2XC2 A;  2HSY A;  3FRC A;  1R5P A;  1EEM A;  4GSS A;  4Z2U A;  2H0H A;  3A2W A;  1WRY A;  3LG6 A;  4YKF A;  5ENU A;  4ML6 A;  4ZXG A;  1B8X A;  5DVB A;  1TI3 A;  1PKZ A;  4LMV A;  1M2A A;  1V57 A;  3ZML A;  1GSY A;  1TK5 B;  5J9B A;  1LBK A;  1GSE A;  4HQS A;  3VK9 A;  2FY6 A;  1XWK A;  3CTG A;  4F0B A;  2G2Q A;  4MZW A;  4KB3 A;  1AUC A;  4EIQ A;  4ZBA A;  3DGQ A;  3NIV A;  3ME8 A;  4XTS A;  3M9K A;  5G30 A;  3E0U A;  4IS0 A;  3FZ5 A;  1GUM A;  2HZE B;  3D4M A;  2VM2 A;  1T3B A;  2MZC A;  1XWG A;  3EC3 A;  2A2S A;  2OE3 A;  1RW1 A;  2VL2 C;  3GL3 A;  2GSQ A;  4KW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...