3IP1A

Structure of putative alcohol dehydrogenase (tm_042) from thermotoga maritima
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
396
structure length
396
Chain Sequence
SLRAVRLHAKWDPRPEFKLGPKDIEGKLTWLGSKVWRYPEVRVEEVPEPRIEKPTEIIIKVKACGICGSDVHMAQTDEEGYILYPGLTGFPVTLGHEFSGVVVEAGPEAINRRTNKRFEIGEPVCAEEMLWCGHCRPCAEGFPNHCENLNELGFNVDGAFAEYVKVDAKYAWSLRELEGVYEGDRLFLAGSLVEPTSVAYNAVIVRGGGIRPGDNVVILGGGPIGLAAVAILKHAGASKVILSEPSEVRRNLAKELGADHVIDPTKENFVEAVLDYTNGLGAKLFLEATGVPQLVWPQIEEVIWRARGINATVAIVARADAKIPLTGEVFQVRRAQIVGSQGHSGHGTFPRVISLMASGMDMTKIISKTVSMEEIPEYIKRLQTDKSLVKVTMLNE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of putative alcohol dehydrogenase (TM_042) from Thermotoga maritima
rcsb
source organism Thermotoga maritima
molecule tags Oxidoreductase
molecule keywords Alcohol dehydrogenase, zinc-containing
total genus 119
structure length 396
sequence length 396
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00107 ADH_zinc_N Zinc-binding dehydrogenase
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3ip1A02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 3ip1A01
3WWYA 4RF4A 3O03A 4GKVA 1I01A 2FSVA 1FJHA 3E5RA 4WNCA 4YJHA 3GMDA 5IXSA 1XELA 2DLDA 2X22A 1PS9A 3QRWA 5ITWA 3B1FA 1JN0A 4RVFA 3U4DA 6LDHA 5KVVA 2BKAA 1N9GB 4HFNA 1BVUA 1N8KA 1V3UA 4CODB 4F46A 1KVRA 3MOGA 1I3MA 3DAFA 3VAZA 3H8VA 4TKLA 4JXKA 3JSAA 2Q4EA 3HN7A 4IGEA 1A27A 5COBA 3MZ0A 4WCFC 2Y1FA 3HN2A 5TNXA 2G17A 2GDZA 4LN1A 3BMOB 3OM9A 4FSHA 2X0RA 3RUFA 3NT4A 1R37A 3K9QO 4JBGA 3W4JA 3LQFA 1VJ0A 4P4LA 1U4SA 2YZ7A 4J2OA 2B4TO 3HE3A 1F06A 3BTUA 2BGKA 4FQ8A 4JIGA 2O3TA 4GLLA 1LDBA 5JYDA 2QZ9A 3TL2A 4MVJM 2J3JA 3P2YA 2VHWA 1NAHA 3WSWA 1UZMA 2ZJ1A 5DBFA 4XB1A 3O8QB 1F0YA 4BO2A 2RBEA 5T64A 2OO5A 4KUEA 1R12A 2C0CA 3TFQA 3FTPA 4IQ8A 4JLWA 3UXYA 2OOSA 4DWVA 1KETA 1C0PA 4PIVA 1B8VA 1ENPA 3GVXA 4YXFA 5GY7A 4KOAA 2VYVD 4R3NA 2Y0EA 3F4LA 3DBHB 3AY6A 5F1PA 4BNGA 1UAYA 1U1IA 1ZK1A 2YY7A 3M2TA 3MJVA 1DBVO 3PJFA 2OXIA 2Q4BA 3AUAA 3WLFA 1YB4A 3I9JA 2ZTLA 3PWZA 4Q9NA 4BO8A 1K5HA 1U7TA 3JD0A 3UUWA 4GLOA 4U7WA 2WM3A 2D3TA 3LYLA 1ZJZA 2PGLA 1IHYA 2V6FA 1U5CA 3CINA 3HSKA 5B1YA 2X0NA 4M86A 1QYWA 1FXSA 2RCYA 4GMFA 4M8SA 1F8GA 4P4NA 1PZGA 4IQGA 3IS3A 3KV3O 5IDXA 2GZ3A 4CUZA 5TLSA 4IJVA 1ZXBA 1HLPA 4W7IA 3IL2A 4I9UA 3RJ9A 2XF8A 5A9SB 1BGVA 5F3RA 4ESOA 4QX6A 1HRDA 3LLVA 4KTTE 5MDHA 2DQ4A 4OO3A 4FC6A 4PVCA 2X8LA 4RVHA 3SVTA 4BNWA 2C54A 2JHGA 1LA2A 4XQ9A 1ZKMA 3HDJA 3GVCA 4HXYA 1DIBA 3JQ9A 3RUIA 1MXHA 4Z9FA 2CD9A 4O5OA 3I5MA 1YJQA 5FWNA 4KWIA 3BZUA 1GYQA 2ZJ0A 1A4UA 3AK4A 9LDTA 5ILOA 2E37A 3BMOA 1P3DA 4KDEA 2GERA 1NVMB 1UP7A 1T4BA 2PD4A 3ANMA 4EI2A 3LT0A 4A0SA 1LI4A 3C1TA 1JWAB 2B4QA 1I33A 1YXMA 4GX0A 4O0LA 2DBVO 1E1NA 1GADO 4UVDA 4BO7A 2D4AA 1UDAA 2PD3A 1DIGA 3ICCA 4IDAA 3D4NA 1TT5B 3JV7A 3DTYA 2PY6A 3EYWA 3JTMA 4TRNA 3ZV5A 3ZHXA 1P77A 1GUZA 4RCVA 2Q99A 4J0EA 3WYBA 5CP8A 3ZWXA 3AU8A 1EVJA 4GVLA 1YB5A 2BF7A 1GV1A 3WGIA 2JD0A 1NXQA 1VSVA 4IZHA 5CDTA 5L7TA 1T2DA 1S7CA 1GZ3A 2QHXA 5KJFA 1EDOA 4IIUA 3DBHA 5TJHA 2FR1A 2W90A 4M54A 3U3XA 1TXGA 2Y68A 1XGKA 2HRBA 4OXKA 5CDUA 4J3FA 4DBZA 4IDDA 4E12A 4DTIA 1N1EA 4A27A 4R1UA 1SAYA 4RPHA 3P2OA 3ZNQA 1YS4A 3FF4A 5HS6A 3E9NA 3WJ7A 3OHSX 3G79A 1XR3A 2O3QA 5TGDA 1PJ4A 2CVZA 3DONA 4WCDA 1UP6A 4II3A 3RBXA 1DLJA 5AYVA 3RJ5A 5KJEA 1NP3A 4JX8A 4NU6A 1BW9B 1Y7TA 4UAGA 4BNYA 2FPIA 1PGOA 3RI3A 2NSDA 2B5VA 4CUJA 4EJMA 1V8BA 2C2YA 4G5HA 4MVJI 4BMSA 3OJOA 4ALNA 1PS0A 2OBNA 3U4IA 4GL4A 5I9MA 4ZQGA 4BB6A 3OBBA 1U3TA 3HADA 5G0TA 1Q7GA 1S6YA 3GH3A 4O6VA 5CG1A 4XYLA 3OJLA 4ITUA 4J43A 2PZMA 4GX5A 3A28A 5EMHA 1T25A 3TRIA 3TQHA 1SOVA 3ZN2A 4GWKA 4GH5A 4CL3A 4UEOA 1EDZA 4AVYA 1MX3A 3JD1A 1O8CA 3SBOA 1ADGA 2JCYA 4GX1A 1Z74A 3N58A 3GF4A 1YDWA 1U28A 1X13A 2CF5A 3M1LA 4WLVA 3ONEA 3DZHA 4RVGA 4DQUA 1M75A 4XJTA 3GNTA 1AXGA 3BXXA 3I9OA 5K0ZA 1MB4A 4JJIA 3Q1LA 4L0QA 1X7GA 4JP2A 3ZWAA 4ND4A 1QYXA 1WDKA 1YBAA 4MO2A 2ILTA 3BHJA 3IAHA 4KUHA 3NGXA 3VZPA 4XD2A 3GNQA 5A9RA 1XKQA 4PLHA 1UUFA 2UV8A 5K1SA 4DREA 4DQXA 1EVYA 3L77A 3PYXA 2VWQA 4XRRA 4LVCA 5BNIA 1UXKA 3IIEA 3HWRA 2JAHA 3JQ8A 2Q1TA 3GG2A 4JQCA 1IB6A 3NDRA 4RPLA 5K6AA 5DP2A 2BFOA 2I9PA 3U49A 2OFPA 3W6ZA 4IMPA 3DDNA 3Q11A 4RORA 3ZWOA 2BFMA 3GLQA 3VH4A 4UEKA 2AQIA 2IXAA 3NGLA 4MVJF 5JCXA 3NTOA 4N7RA 4AJNA 3QVTA 3WR5A 2E48A 3W1VA 2HK9A 2HUNA 3WBBA 4PCVA 3U62A 1YQDA 3M1AA 3B6ZA 4JCOA 1DLIA 1TVEA 4J90A 4ZICA 2G82A 2PGJA 4A2CA 4CQLA 2FR8A 4E2ZA 8ADHA 1WW8A 5HA5A 5JSFA 2YV3A 1YOVA 2A9FA 2DTXA 3K31A 2NVUB 3ENNA 5JO9A 3AY3A 2Z95A 3G1TA 3OA2A 4GKBA 3JQGB 3M6IA 1HE3A 5L4SA 2CZCA 3LC2O 5IN4A 2Y93A 1ONNA 3JQFA 4NG5A 2O48X 2XXBA 4BQPA 5DCWA 1I10A 2X23A 3RUDA 4E2YA 5TC4A 3EZLA 2IE0A 1MG0A 2AMFA 5C3MA 3HDQA 1SBYA 5I7SA 2XOXA 1ENOA 1Y5MA 1M67A 2VOJA 4IJUA 4YYZA 1K0UA 2IODA 3D5QA 5C37A 4BNMA 3WFJA 1HDZA 3VOSA 9LDBA 1QXSA 1TLTA 3H5AA 1UH5A 1W73A 3DR3A 2EGHA 2GSDA 2BFAA 2EIHA 4H3VA 3X2EA 3JQ6A 1L7DA 4I9NA 3TN7A 2VNAA 2HO5A 4NJOA 4NQZA 4ALMA 2X0IA 1Z75A 1PU2A 2EP7A 1A7AA 1AUPA 3ETEA 1H93A 2CNBA 3L07A 3WTBA 4N5MA 4FFNA 2X5KO 1C1XA 3GAFA 3IDSA 3PZBA 4J4TA 3HNPA 3PTZA 4W4TA 4E5KA 1NTOA 3FWZA 1GQYA 3QWHA 2PKRA 1DAPA 4MKXA 1NM5A 4EYEA 4PLPA 1LU9A 2GZ2A 1UXIA 3OQ1A 4FN4A 4ND1A 1VL0A 4CMJA 2CVQA 5JCJD 1GUYA 1QYCA 4XGKA 4N18A 4N5LA 2Y1GA 4G2NA 1YBMA 2X58A 4U0JA 2EKLA 5JMWA 4JGBA 4TVBA 3FSRA 1XDWA 2AHRA 2H5LA 1VL6A 1ISFA 1V3TA 3GRKA 4FOOA 2QRLA 4CLHA 3ITDA 1GYRA 4BNHA 1I8TA 4LRTB 4U5QA 5G4KA 4QO8A 1NQAO 1JKFA 4TRJA 1ZBQA 4YEDA 1XQ6A 5U4QA 2GD1O 3EAGA 4XQEA 4BNNA 1P9LA 1K6IA 3AI3A 3DOCA 4HFJA 2AG8A 4J16A 1GZ4A 2P2SA 2FPGA 2FMUA 1LDYA 4GSLA 2J5KA 1BSVA 4BKQA 1U2GA 1H6BA 3JQGA 1BHSA 1HZJA 4QFCA 3ZU5A 4EBFA 3ETGA 1XU7A 3KSZO 1U8XX 3F46A 3H5RA 1FDUA 1JVSA 2UVDA 1FK8A 3RKUA 5DOVA 5JLAA 5A06A 3WNQA 1I24A 3HHPA 2VUSA 1HE4A 4BNFA 1EE2A 2X5OA 3I52A 3QHAA 4E30A 5BR7A 2CF6A 4D45A 2QQ5A 4UVHA 2WE7A 2AQKA 4ALJA 2GNAA 1GV0A 4BNKA 3GPDG 2J3IA 2NUAA 1C14A 1ZUD1 1NWHA 4BNZA 1MC5A 5DDIP 3TZQA 1WP4A 1Y8RB 4N5NA 1HTBA 4Z9XA 3DAGA 5JFOA 1P1KA 1HYHA 4U6SA 3K6JA 1PGJA 1HKUA 2BHLA 2C59A 1C1DB 3MJEA 4INAA 4J1QA 5F1KA 5EINA 2FP4A 2R2GA 1LRLA 1VL8A 4CLXA 2OORA 2FWMX 4CV0A 1PJ2A 3GY0A 1O9BA 2J5RA 4WLNA 1PL7A 1KC1A 4RVUA 3NRCA 3ZV3A 4ALKA 1DRVA 4EW6A 3W8FA 4MIOA 4XEHA 2FZWA 1E3WB 3DBVO 4NNJA 5BSGA 1Q7BA 2R00C 5JBIA 3QSGA 2DT5A 1DFHA 2QZZA 3DFZA 3WIDA 1JTVA 5LCXA 2PZKA 1T2FA 2SCUA 4E32A 3DOOA 1NBOA 1YRLA 3DZKA 3L6OO 3DMTA 2HCTA 4L9RA 3H2ZA 5IN5A 5DNAA 4CQLB 4CM1A 3PEFA 5F21A 3PP8A 1R0LA 3MTJA 2H1SA 5JAZA 5CPFA 3CMCO 2HSDA 4OKNA 4D79A 1A9YA 2NVUA 4CMIA 3FNFA 4RF2A 4YJFA 1BWSA 2HAEA 4ZU3A 2VOEA 1YBVA 1XQ1A 3KYCB 4AJOA 3NUGA 4UEJA 2FPPA 3GZNB 1QR6A 2JD1A 1O6ZA 3MJTA 5G0UA 5HRUA 4RV9A 1U4OA 1XCBA 2UAGA 3KUXA 5COAA 5I8WA 4WOKA 5CPBA 1TT7A 1Y81A 1NFRA 4XWYA 1DJQA 3TZKA 5DBGA 1ISGA 4WNIA 1P0FA 1LQUA 1H0KA 1LSJA 1J49A 3W4KA 3ZV6A 5HWSA 1R4MB 1DC4A 2GF2A 3OQBA 5B4TA 2EKQA 2HK7A 1LLCA 1FDTA 2GN6A 2EW2A 2I5PO 1O89A 1QP8A 2DFVA 1A71A 1LSUA 5TF4A 3WBFA 4CR7A 2FOIA 3W8EA 1NFFA 4R1NA 4D7AA 1PQPA 1QLHA 1TB4A 2DTDA 2IYOA 1EFLA 2NU9A 3ZW9A 4B7XA 3PDJA 5L3ZA 3FTNA 4RGBA 3VVCA 3V2GA 5T5QA 2LDXA 3D4OA 3UF0A 1C1XB 5T57A 4BKRA 2DM6A 1E5LA 3Q2IA 1VM6A 3RVDA 4J4HA 3VTFA 5H83A 3OIDA 2C2XA 1HE2A 3F1KA 4Y6RA 1X0VA 2OL4A 2PKQO 3LLSA 4JJFA 3HUDA 3ZHZA 4ZVVA 1QG6A 3MWDB 4CM9D 2G0TA 3UCEA 3OA0A 3SJUA 4AJHA 1RPNA 2PA3A 1HDGO 4IXWA 4MVJE 5BNTA 4RVSA 3ZHYA 4GBJA 4IJKA 5HS4A 3OP4A 4IQ0A 1OMOA 4NK5A 1WZIA 4QXMA 4F6LA 4CLOA 1CYDA 4NH4A 3INRA 4DQVA 2GCGA 1PGQA 3BMNB 3IMFA 1EE9A 4DC0A 4P38A 5CEFA 3GGPA 4CQMB 4TSKA 2X7HA 1UXJA 2JL1A 1RM5A 3DXFA 1O5IA 2GZ1A 3O9ZA 1DDOA 3VKVA 2DPHA 3OJEA 2WSBA 1PS8A 2DUUA 3K8ZA 4KQXA 3ZU3A 3DB2A 4CMIB 4YDRA 3ROKA 1OFGA 5IXYA 4IDCA 3PGXA 4LCJA 4PFJA 1I2ZA 1NYTA 1QYVA 7MDHA 1GQQA 1X0XA 1LSSA 5JY1A 3CIFA 3IP1A 1Y8QB 1U3WA 1UDBA 1GDHA 4YPOA 3I4CA 1DPGA 1V9LA 2YDXA 3DZIA 4M55A 4CM6A 1BDMA 4ZQFA 2Y0DA 4ZQEA 4FFLA 1BRMA 2E6UX 5CDSA 1UZLA 2P9CA 3PQEA 1B8PA 4ROSA 1QRRA 2Z5LA 2DBRA 2RHCA 2VWHA 3P5SA 3PIDA 5JE8A 3D3WA 2VQ3A 3OEYA 2PV7A 5AOVA 1ISMA 1ID1A 1SB9A 5L4LA 1I30A 1YQGA 1E6EA 3D1LA 4PLTA 5G0SA 1YVEI 2J8ZA 4RDIA 5EESA 2JD2A 3D5TA 5EPOA 1J6UA 4WEOA 2PTGA 3AUUA 4O59O 4E5NA 3IKVA 3PFFA 4PN3A 3WLEA 5KCZA 2P9EA 3VPXA 1N7GA 4Z0PA 4CV2A 1C3VA 3RUCA 2YFHA 3IP3A 1HDRA 1ML3A 5IZ4A 7ADHA 3ADOA 1E0DA 1JKIA 3QQPA 3I9NA 5ES3A 3ZWVA 3CKYA 3S55A 4CUKA 3S1LA 3DHEA 3LT4A 3KHUA 4OXNA 3KEOA 5JCJA 2EWMA 3B70A 3NJ4A 4YAGA 5IZCA 1PX0A 5KTKA 1HZZA 4Y9DA 4ZRMA 3E5MA 3A9WA 1E7QA 2X0JA 1CDOA 1C0KA 3LZ6A 4OOEA 1R4NA 2GUGA 3PHIA 3HJAA 1U7HA 1HDOA 5EQDA 2DBQA 4XYBA 2W8ZA 2EKPA 2ET6A 1H6DA 1X14A 2OP1A 3HB5X 3JQDA 3WFIA 3O26A 1R0SA 3SC4A 4PG5A 1GU7A 1KIFA 4L4XA 2AE1A 3JQBC 2VHZA 1XEAA 3QWAA 3H3JA 1SCUA 1IZ9A 1Q0HA 1R15A 2O3RA 8LDHA 4B3IA 1LLQA 4D46A 4BUCA 3TOXA 4IGFA 3T7CA 2BGLA 1F12A 3ZDFA 3F47A 3L6EA 1E3SA 2OBYA 2Y05A 4CMEC 3DBRA 4CM9A 1EK5A 4R16A 3E9QA 5EN4A 5CDGA 4L4RA 3DEYX 2B4RO 2CSUA 4C7KA 3NX4A 4XYGA 1PJ3A 3WG9A 5C5IA 3S2FA 5ENVA 4D3SA 2B5WA 2X9NA 2V6GA 3F3SA 4RF3A 1R4MA 3H65A 2PGDA 3ZU4A 3OEWA 1ISIA 1DJNA 4RLSA 3ZNNA 5FI3A 3VDQA 2VN8A 2O2SA 4RPKA 4ZGWA 4R1SA 1KY4A 4MVJH 2B83A 3BYZA 1NVTA 1CEQA 1ORRA 2QIOA 4N54A 4TZTA 2VTEA 2XXJA 1O94A 1N1GA 4FGSA 1KEWA 3AOGA 3SXPA 1NNUA 5L7YA 4FFMA 3RAJA 1B7GO 3B1JA 4FOSA 1P33A 2CY0A 4EUEA 4BNJA 1UJMA 4NBWA 1CQJA 5TSDA 1SNYA 1KYQA 1ULSA 5ER6A 2NU6A 3JYOA 5TT1A 4J7CA 1ZXLA 1HXHA 1I2CA 4OSOA 3UHAA 1SEVA 4NR0A 5TT0A 3AI2A 3CXRA 1LLDA 2ZYAA 1Y1PA 1ZSYA 2FRDA 3KRTA 3NDIA 2NTVA 3DHYA 3PXXA 1JKJA 5MGBA 4KQWA 2ZTUA 5G4LA 5BSEA 1N9GA 4DRYA 1NQOA 2ZB4A 4HNHA 2CFCA 3F1LA 3BMNA 1JVBA 4FFRA 2WYWA 4R1TA 3JYLA 1DHRA 4BO4A 5F5NA 2WD7B 4JROA 4QQRA 2YYYA 5KOIA 2Q3EA 1LLUA 1E7MA 1ZIDA 2GGSA 1WMBA 4W6ZA 4J0FA 5JYEA 2NU8A 1BXGA 1JLLA 5BQFA 5KVSA 3G49A 3PYMA 4HKTA 4NFYA 4RL6A 3PHLA 5IG2A 5JAIA 2DPGA 1SPXA 1Q7CA 4FC7A 4B3JA 4RZIA 3RROA 4NK4A 4ID9A 2TMDA 4MP8A 3GUCA 1GPDG 3H3FA 4WPGA 2BGMA 1Z6ZA 1E3JA 4XKJA 4OSPA 3TZHA 3DC2A 1PL6A 4BO5A 2DBZA 2JFHA 4BNLA 5EERA 4BKOA 4XQGA 5AQ1A 1B3BA 1D7OA 5AXAA 4AJPA 4ILKA 5IFLA 2PH3A 1I2BA 4M49A 3LVFO 4BMNA 3RKRA 5EJ2A 5G0VA 1MGOA 5F1OA 4K6FA 4DBVO 2IZ1A 1B0AA 1L7EA 4PG6A 3T4EA 2O7QA 2RH8A 3PHGA 4FCCA 4E4YA 3L4SO 4RJTA 5ENDA 4EEZA 4NFHA 2WDZA 5G2OA 5I7FA 4DPMA 1GQ2A 3RBZA 3TF5A 4QECA 2EGGA 2CDAA 2NVWA 2XAAA 3VPHA 1PQUA 3NT2A 1DC3A 4A5OA 5JO0A 3VZRA 2ZK7A 2V6BA 3ZH2A 4S1VA 4TRRA 1X7HA 3ZNOA 2I3AA 1NR1A 2FN7A 2C29D 3RU7A 1NWCA 1ONPA 2ZTVA 2FSSA 3RC2A 3TNLA 4CLRB 2VYNA 1GL3A 2GN9A 2R6JA 1ZK0A 1ZZEA 3UN1A 3QIVA 1GUFA 4XGNA 2W98A 1SMKA 4FGWA 4J1SA 5HM8A 3IJRA 4UVIA 2X5JO 5IF3A 5J23A 3FR8A 1R66A 4PG7A 5A9TA 1B15A 4U8GA 3KSDO 4YVFA 1F17A 1E7YA 2PNFA 2I65A 2UYYA 5AXCA 4NPCA 1G6KA 1PJCA 1XG5A 2EW8A 1C0IA 1LDNA 4MOWA 1JAXA 2V6MA 1YE3A 4L75A 4A73A 4CM4A 1KEVA 1SOWA 1BVRA 3D4PA 1AXEA 3P7MA 4D44A 1I3LA 2WD7A 4DL9A 3EMKA 3LF1A 4RDHA 2Y1OA 3QA9A 3KBOA 2YV2A 3B20A 3UCFA 4BGVA 4IJWA 1I5RA 5A1TA 2A35A 1GYPA 1LRJA 1MFPA 3TPCA 5CDYA 3LDHA 2I66A 4UUOA 3VZSA 2WD8A 4GX2A 3BTSA 4HADA 3W4IA 1H2HA 3ETDA 3B1KA 1DRUA 1P1JA 3KM0A 3QWFA 3KXDA 3S2IA 2WWRA 3FCOA 4OXYA 4ZN6A 3RUEA 2BD0A 4ND2A 4MDHA 3L9XA 1E7RA 4ZRNA 3ZGYA 3ZNPA 5JDCA 1AE1A 1G0OA 2V7PA 3K2BA 1V0JA 3JQ9C 3PHHA 3LC7O 3CUKA 1PZHA 2Y1DA 2IZZA 1P1RA 3C8MA 1PR9A 3CE6A 1Y6JA 3PJDA 1Z7BA 3OECA 5FEUA 1I3KA 2B35A 1WZEA 3PPIA 1XIVA 4FJ0A 4RQUA 4BNVA 5L4NA 1M76A 1HYGA 1MA0A 3QVXA 2JAPA 3JCZA 2F1KA 3OQ6A 1B2LA 1YGYA 4P4GA 3GN1A 3WMWA 1CERA 1RJWA 3SLKA 5IDWA 1AHHA 5B4UA 2NACA 4B4WA 4JN6B 2C20A 3WSVA 5EQFA 4CJXA 1BDBA 1BXKA 1VJTA 3TFOA 4J91A 1PJTA 1E1LA 1FDWA 4B3HA 5FYDA 1EMDA 1EK6A 3WX0A 4YT5A 2BRUA 4BNIA 2X9GA 4YT4A 3HG7A 3VKUA 1PJLA 3NKLA 2O2YA 1GY8A 3BA1A 3JQAB 4XR4A 1GCUA 3E82A 1EVZA 3WYCA 4CM8A 1HLDA 4HY3A 2DFDA 1LDGA 3PDUA 4B8ZA 5H82A 1CF2O 3C7AA 1UZNA 1JW9B 2CVOA 3S2GA 4XZ3A 2EERA 4FIZA 5C7IO 3DMTC 4XA8A 3BTOA 1JA9A 1YO6A 1RKXA 2H6EA 3DWFA 1EUDA 1PJBA 4PZEA 2O3SA 4EEXA 2QRJA 1BXGB 3E8XA 2B0JA 4CMCA 4NJMB 4X54A 5JXWA 1E5QA 1E3EA 2ZB8A 2W4QA 3EVNA 1HEUA 3UCXA 4DGSA 2PWZA 3DL2A 3PHJA 4WOJA 2ZKLA 1KVUA 2X9VA 4TZKA 1H6AA 4BMVA 4DYVA 2Z1MA 5A05A 4I9HA 3ROMA 4G65A 5DP1A 3U4HA 5KVCA 2NWQA 2Y67A 3V1YA 2ZATA 4LW8A 1TT5A 2ZQZA 4RVDA 1IYZA 1OI7A 3WGGA 3H6KA 4GWGA 4CQMD 2DUWA 3VTZA 3PGJA 5I7EA 5A02A 1SO8A 1O0SA 1XWFA 5HTOA 4J7XA 4RPJA 3PZRA 1A5ZA 1NR7A 2ZCVA 4AJKA 4F6CA 3DBLB 1IY8A 3ZWMA 1JQBA 4YAKA 2Y66A 1GEGA 4H7PA 3ZWCA 1T4DA 2QW8A 2IDZA 4GSKA 3ST7A 3FI9A 5C7OO 4RQTA 1WDMA 2JCVA 4E33A 5L9AA 3GHYA 4K28A 4WLUA 3ASUA 5C7LO 3H7AA 5ADHA 3CZMA 1ADFA 4GGOA 4NBTA 3H2SA 4IDBA 3TL3A 3WWZA 1A72A 2WMDA 5JDIA 1DC6A 4YCAA 3ZWBA 4NZ9A 2IXBA 2ZYGA 4FB5A 5JY6A 4LISA 3JD2A 2BI8A 1QYDA 3E9MA 1HSOA 5KJCA 1PGPA 4BV9A 1ONOA 3C1OA 4FJ1A 3ZV4A 2QYSA 4XRGA 2VT2A 1SEPA 3K96A 4RLHA 1NPDA 2HMTA 2P5UA 2YW9A 4A03A 3RC7A 3C3XA 1HWYA 3CTMA 3HDYA 3N74A 3O4RA 3U09A 2CDBA 4FD3A 1HYEA 4OM8A 4HX5A 5BSHA 1KVSA 3I83A 3I4FA 3WMXA 4A7PA 3AM4A 2GYYA 1PSDA 3GGOA 3OIFA 4CM4B 3BMCB 4TMFA 1MC4A 1TEHA 1WMAA 4BB5A 3NTRA 2BLLA 5DULA 1YOVB 2HLPA 4TVOA 3AUSA 3Q0EA 1Y9AA 1QSGA 2PD6A 3H9JA 1LX6A 3RCBA 3ULKA 3RBVA 3V5NA 4MVJG 3UAGA 5T67A 2I67A 4EITA 1KEPA 2E4AA 3UFXA 2FHSA 3VDRA 4DLAA 3LT2A 2YHIA 1YONA 3SX2A 4UUPA 3ZCXA 3GG9A 4JBIA 2ZTMA 4LVUA 3OETA 2QX7A 5LC1A 1LDMA 3QW2A 4Y67A 1IL0A 5JNLA 4I5GA 1VKOA 2RHRA 3FNHA 4BO0A 1BXZA 3RFVA 3AFMA 3RQSA 3WGTA 4DYDA 3U0BA 3IOYA 3V1TC 1ZH8A 3WQRA 3VH3A 3AOEA 2GPTA 3G0OA 1ISHA 3CSDA 3O8QA 4D3FA 1ZEJA 3DQPA 4IY1A 4E21A 4R5HA 2NV6A 2JHFA 3U4CA 1FDSA 4AL4A 4WCFB 3ENKA 1H2BA 4Z0TA 1HSZA 1YH3A 2X1HA 3DBLA 2EF1A 4WJZA 2A94A 4OJNA 4YJGB 4BNXA 2P4QA 3JQ8B 1ENZA 1L1FA 1IULA 1JAYA 2BH9A 2Y1CA 2J3HA 4PLVA 4OYRA 3O38A 3QE3A 4FFOA 3T7EA 3A4VA 4J4BA 1H6CA 4IUYA 4LSMA 4BV8A 5CEJA 2NLOA 1PJQA 3DO5A 2HKIA 4S3MA 1J0XO 3UVEA 4KZPA 4RO0A 1AGNA 1GEEA 1FMCA 4E5MA 3ZWPA 3CMMA 1D8AA 1E1MA 4JJGA 4ND5A 4BOYA 3KEQA 5BT9A 2F00A 3JQFC 4XR9A 4YJHB 1NVGA 4J49A 3WYEA 3UOGA 3RC9A 3STHA 3V1UA 4BNTA 4PRLA 3HQ4O 5CEEA 3PFWO 1MLDA 5A3VA 3VC7A 4XDZA 1DB3A 3K92A 3C24A 1LSOA 2GN8A 3K73O 1Q2XA 5BNFA 2PLAA 1G1AA 4IDEA 4Q3DA 4UVGA 1PTJA 3WQQA 4BKPA 3DOJA 3JQ7A 4B4UA 3R6DA 5I9NA 2C5AA 3C7CB 4WLEA 4Z0HO 1YJ8A 4NI5A 3ADPA 3QP9A 3UGKA 5L7WA 1P0CA 4JBHA 4E0BA 4J6FA 2Y0CA 2YUTA 3SEFA 3GK3A 5JC1A 1A7KA 4R41A 3KTDA 3PWKA 5L40A 1NHGA 4I5EA 4DIFA 1X1EA 1HE5A 5GMOA 4CPDA 4L4SA 1P74A 5JAQA 3FPLA 3LF2A 1NPTO 5K6AC 1CJCA 3ANLA 3VHRA 1E6UA 4R01A 4CMEA 1Z7EA 5KVQA 4BHTA 3OMLA 1ZFNA 2NQTA 1PWXA 2YHUA 5KWEA 2D5CA 3GNSA 1P31A 3OFSA 2ZB3A 4B79A 4BIIA 4DPLA 2NTNA 2AQHA 4YT8A 4K26A 2YQ4A 3D64A 4IS3A 1B14A 1I0ZA 1QV7A 4Q3BA 3QVOA 2JKVA 1YB1A 4D0SA 3K5PA 3ZHBA 3W6UA 4GI2A 4TQGA 5KJ6A 4WUVA 1E3IA 3QV1A 3JYPA 3SLGA 2X86A 4YJGA 3TJRA 1EBFA 4W7HA 1GFSA 3KSUA 3EC7A 5ICMA 2AW5A 4OQZA 4GMGA 3BHMA 2NADA 1LRKA 2QG4A 3AM3A 2PK3A 4IMRA 4J7UA 4AJEA 1DSSG 4OQYA 3L4BC 3H5NA 4J1NA 4BS9A 1EZ4A 5CHEA 3MTGA 3FRJA 1YQXA 1W8DA 3AFNA 3GMSA 3AI1A 4CLEA 3SJ7A 1PJSA 4L73A 4OIMA 1EFKA 2I99A 4K1LA 2DU8A 4DIBA 1LQTA 5LDGA 4MJLA 2Q2QA 3E48A 3I6IA 2P9GA 1PQWA 1UXHA 2D0IA 1LDEA 2Z1NA 2HMUA 2O3JA 2ZB7A 3BMCA 3F4BA 3EHEA 5G4KB 3W8DA 3ZWYA 4FJ2A 4YRBA 3DMYA 4EUHA 1IUKA 5GZ1A 4JK3A 3KZVA 1LNQA 4UUNA 1RYDA 3RUHA 1HF3A 5A3JA 2OP0A 4Q3AA 5B37A 1DXYA 4TWRA 4MVJD 5JW6A 3L4BA 3EDMA 3PJEA 3V2UA 3KB6A 2B37A 3UICA 3HB4X 1F14A 1OC4A 5L95A 2YHIB 2OGUA 2JFFA 3FBTA 4BO3A 2O23A 3AY7A 3FR7A 4MP3A 1DEHA 3LSYA 1VC2A 2J6IA 1VE9A 1FDVA 4UVEA 3DHNA 4BNUA 4HP8A 4MIEA 3G3EA 1GTMA 1ZW1A 2CUKA 2A92A 1ZK2A 4XJSA 4FR5A 3NEPX 2VRCD 5ILGA 3TSCA 1IPEA 4Y6SA 4C7JA 3G17A 1OBFO 4Y98A 2O50A 2RAFA 4DIOA 2J5QA 2Q1WA 3H4VA 2EG9A 1DO8A 3E03A 2PFGA 4E2XA 2HMVA 3GEMA 1YKFA 4YTEA 4E2WA 2YQ5A 4P22A 3E6AA 3VVBA 4PLYA 3PI7A 1C1DA 4AICA 4J9VA 3ZU2A 1W6UA 3D3EA 3RUAA 3PQDA 1Z45A 4KUGA 4Z9YA 5A5FA 1A4IA 3T4XA 5ICSA 1YL6A 1QLJA 4GVXA 2AXQA 3FBGA 3LT1A 1PL8A 3RFTA 2RIRA 3NJ8A 4L8VA 2O7SA 4R9RA 1X15A 3EW7A 3JYQA 4R69A 5U1PA 1ZJYA 3UH1A 3ONDA 1UXGA 3OICA 1IHXA 1TI7A 2IEBA 4YAEA 3H9EO 1QMGA 3GEDA 3VPFA 4Z3DA 1BW9A 2DKNA 3UW3A 4HWKA 5BSFA 3QY9A 1H5QA 3TZ6A 5JS6A 1V6AA 3GN2A 4CLOB 3C85A 5JPIA 2GN4A 1Q0QA 3LK7A 4C4OA 2QRKA 3OJ0A 4J2HA 2RH4A 3F9IA 4PVDA 2H9IA 3I23A 4R3WA 5TRTA 3GVIA 3JQ7B 4JP3A 1X1TA 4L74A 3EZYA 3GZNA 4FDAA 2P4HX 3S8MA 5U9CA 1T2CA 4B4VA 1P1HA 2IZ0A 3IKTA 5KKCA 4G81A 4HBGA 1X7DA 2D2IA 3MOIA 5ITVA 4MINA 3IJPA 4IDFA 2POQX 3WOHA 4OH1A 1J5PA 2CMDA 3NT5A 1ZO8A 3GQVA 2E82A 4J1TA 4RF5A 1RM3A 1YL5A 2Q2WA 3TZCA 2AA3A 1K89A 1O95A 3AW9A 2IEDA 3KO8A 3IQDB 2VYVA 1ZMOA 1KBZA 3VZQA 4EGFA 4ZQHA 1TA4A 4WK6A 3BMQA 1ZSNA 2FY8A 3Q9NA 4EJ6A 1KVQA 1WWKA 4AFNA 1WXDA 4RZHA 4CMKA 4PLGA 2NM0A 3PVZA 3WGQA 1M66A 2J3KA 1XYGA 4W99A 4CMGA 1CRWG 2D59A 4DLBA 5I7VA 1C0LA 3A14A 3FPCA 4OAQA 2AEMA 3AOEC 4QSMA 4I5DA 4LGVA 1LTHR 3INGA 4D42A 5CFZA 2EP5A 2P68A 5L53A 1DHTA 2W2LA 4YAJA 3M2PA 2R00A 1MP0A 3FHLA 4CM3A 3CZRA 1U3VA 4II2A 4R5MA 4Y8VA 3UKOA 4RPGA 5AXDA 3JD3A 2UDPA 4B7UA 3DAPA 4MVJA 3WDSA 3WJAA 4AJLA 1KEUA 3V2HA 4CR8A 2HQ1A 1M6WA 3R3JA 4ONEA 1VI2A 2AG5A 4FPXA 1HDYA 3MCVA 4I1IA 4NBVA 4DPKA 1R0KA 5DCYA 4H16A 1R4NB 6ADHA 4OOFA 4PZCA 1IZ0A 4CQMA 1T24A 1OAAA 4I5FA 4BVAA 2YDYA 4Q3EA 1I36A 4YRAA 1IOLA 3L6DA 2C07A 2LDBA 1EUCA 1AN9A 2YV1A 3QVSA 1DFIA 3VH2A 5COQA 3GC6A 3RSHA 3AU9A 1OOEA 1E3LA 4F3YA 4CLDA 4FS3A 4BGEA 1VPDA 2C5EA 3TWOA 4NDNE 1B16A 2PH5A 3DZFA 4PG4A 2FR0A 3K30A 1WVGA 2O4UX 3DBRB 3FWNA 3F5SA 3MJCA 3Q3CA 1CETA 5DF1A 4IIVA 2WTBA 3DTTA 4QTZA 4YAIA 5GZ3A 3MWEB 3ROQA 1LXCA 2V65A 4UULA 3X2FA 3VPSA 3TOZA 3A06A 3DZBA 5JDIC 3GGGA 4KTVE 3F6YA 4XYMA 3PRJA 4WGGA 1P44A 3IUSA 2Q46A 4IM7A 2UUOA 4OL9A 1QV6A 4B8WA 3ANNA 3GT0A 1PIWA 4YWJA 3A1NA 5JC8A 3OJFA 2IRWA 3WIEA 3WGZA 3TDKA 3E18A 4IDGA 4R68A 3BMQB 4Q3NA 2Q45A 1GCOA 4E5PA 4BL5A 5DN9A 1SC6A 5IDQA 5L51A 4ZD6A 3KYDB 1D1TA 3D7LA 4HUJA 4DA9A 1ZNQO 4WASA 5T8KA 3JQCA 4BGIA 1Q1NA 4U6QA 1Y8RA 1NX6A 4IXTA 1U5AA 4A26A 2HDHA 1HETA 2XPCA 2NNLD 1KERA 5A04A 1GD1O 1NQ5A 2WJPA 1RM0A 4FW8A 2EV9A 4D3DA 3I6QA 4XCVA 3GRPA 5KJ1A 2E49A 3S2EA 1ADBA 1IE3A 2FZEA 5CG2A 3ON5A 3BHIA 1RWBA 3FD8A 2D1YA 3DZJA 4LMPA 2GASA 3WGYA 5CAEA 2OHXA 3E1KA 1Q0LA 3ZZNA 4CM5A 3JD4A 2HMWA 1N5DA 3OSUA 4IBOA 2GO1A 3FNEA 4KMSA 4LMRA 3GDGA 2PZJA 2WYVA 1JU9A 1EBUA 5T6BA 4TKMA 5THKA 5TQVA 5B4VA 3RWBA 4GPD1 2Q49A 3PK0A 1I32A 2VRBA 1Y9EA 5A4DA 5JMPA 1D1SA 1V35A 1DIAA 1K3TA 5DT9A 3ROPA 4BO6A 4BKUA 3RASA 1U9JA 1ZEMA 1GPJA 4PLZA 4Z3KA 4WKGA 4FBGA 4MP6A 1UAGA 5TIIA 3NV9A 4YQZA 3GOHA 1ADCA 1MG5A 2VT3A 1WDLA 1EEHA 1R16A 1LC0A 4OKIA 3IUPA 4MKRA 2NTJA 5FF9A 4IZIA 2W2LD 4HFMA 3DZGA 1YL7A 2QYTA 5H81A 3OIGA 4QEDA 2ZIZA 2VZ8A 4OHUA 1D3AA 2GLXA 2Q50A 1UDCA 1UP4A 3SC6A 2VYND 3MJ4A 2C7GA 2Q1UA 2VRCA 4OMUA 3PIIA 1ULUA 2VHXA 4D43A 3ZWWA 4XIJA 3QVWA 3H9GA 2AE2A 4AJIA 3RIHA 4J9UE 4YT2A 2HU2A 4WLOA 1VRWA 3CEAA 5TS3A 3I9KA 3WQSB 2JCXA 3NYWA 2BELA 4AJ2A 5JDCC 2VHVA 4IINA 3I9MA 3GDOA 3EY4A 3ZWNA 4MVJP 3KYDA 4PLFA 3LC1O 2VZ0A 4PZDA 1JDJA 2VUTA 4LCEA 1KVTA 5IDYA 3KVOA 2OMEA 2VTDA 2DC1A 2W2KA 3GHHA 4E13A 3Q2KA 5F5LA 1P1FA 5KIAA 1DFGA 1B8UA 1B26A 2HJRA 3RC1A 3ORFA 4B7CA 3RFXA 1HDCA 4CLRA 1V3VA 3EGOA 3NDJA 4JNKA 5LDHA 2PZLA 1U8FO 3QLJA 3PLNA 4Q3CA 1E3WA 4WEQA 3Q9UA 4XIYA 4E6PA 4EJ0A 4XB2A 3PQFA 3INTA 1OC2A 1DRWA 1HL3A 3BTVA 5THQA 2WYUA 3HZZA 1R6DA 3GAZA 1NQTA 1E1KA 4ZA2A 3PLRA 4R9SA 3G1UA 3PJGA 1Z73A 2TMGA 5B12A 3GR6A 4ND3A 1I3NA 5DZSA 5G0WA 4YACA 4B4OA 4YR9A 4ALIA 2IYPA 4CMHA 4LK3A 2Y99A 2DVMA 4GQAA 2VCYA 4MIYA 2PR2A 1EQ2A 1CQIA 3GDFA 4U0KA 5I8ZA 1D4FA 4YJFB 5FFFA 1MUUA 3KYCA 4PGFA 2OUIA 3JQAD 3R0IA 3I3OA 2Q2VA 4QT0A 5DOZA 4AG3A 3KETA 1KC3A 1DAOA 2VZ9A 4NHEA 2D8AA 3R1IA 1K6XA 3CH6A 1VJ1A 2NVBA 2VWPA 1NASA 2O4CA 4GGPA 2ZYDA 4YRDA 4DUPA 4KP7A 2A4KA 4Y6PA 1T26A 1Y8QA 3GVPA 5TX7A 4D41A 1QKIA 4UREA 5A03A 2HJSA 2EHDA 4WECA 1HDXA 1WLYA 2O3UA 5AXBA 1XSEA 2Y1EA 1E92A 3GFBA 5TJ9A 1N92A 3BAZA 3COSA 2VWGA 3AJRA 5DCUA 4NFSA 2AEFA 1U3UA 1DC5A 1U2DA 4W9NC 1M2WA 1NPYA 4NIMA 4DLLA 1M6HA 4KWHA 3WGHA 3KLPX 4W9NA 3L9WA 2H63A 3GA0A 3I9LA 3WTCA 1OZAA 4DMMA 2WE8A 3ITKA 2X4GA 3Q6IA 1KOLA 3AM5A 4URFA 4YBZA 3MEQA 3RD5A 1XHLA 1MV8A 4PLCA 3LU1A 2EJVA 2AEJA 2Q1SA 1BTOA 5GZ6A 2BMAA 3QJ5A 4AJJA 1PWZA 4M1QA 4A10A 4CMAA 2VNSA 2ZQYA 2W2KB 1H9BA 2YJZA 3N7UA 3MJSA 3RU9A 4BO9A 4CL8A 3EVTA 4BGUA 4EDFA 1WPQA 4MKZA 5KKAA 4R54A 2PKQP 1PZEA 3JYNA 3U9LA 4CM7A 2JJYA 3ABIA 1K2WA 1XLTA 1G0NA 1PR3A 2C82A 4DMLA 1LUAA 4F45A 4BO1A 4NU5A 3L0DA 1H9AA 1VLLA 4NMHA 4PLWA 1E6WA 2NQ8A 4Q39A 4WLFA 1B3RA 3AUTA 2EJWA 3GZ4A 1F8FA 4ZQBA 3WNVA 1Y5RA 4QFDA 3PWSA 1Z82A 2OZPA 2BI7A 2G1UA 4I8XA 1QORA 4M87A 1GAEO 2HRZA 3ASVA 2WEKA 4YB8A 1DOHA 4IS2A 4NJMA 1EUZA 1FF9A 5JAMA 4YQYA 2DTEA 1EQUA 4XGIA 3GFGA 1GZ6A 1IPFA 3D0OA 4YA6A 5IAAA 3KYBA 2BFPA 1P1IA 1E7WA 3IC5A 4CV1A 1LC3A 1AHIA 3EUWA 2JFGA 1ISJA 1UR5A 2G76A 1MFZA 5L45A 1RM4A 2VHYA 4CR6A 3EK2A 3HDHA 3JQEA 3VH1A 4DC1A 1MXFA 3NTQA 4XX0A 5AVOA 5IJZA 1W4ZA 1WNTA 3D3WB 4R4JA 2VUUA 3PYLA 1WAMA 4ALLA 2HK8A 4TROA 3WB9A 3GEGA 1XA0A 3U5TA 3ONFA 2B36A 3ZI0A 5ER9A 4AJ1A 1KY5A 1N2SA 4MPDA 4AJ4A 3C1AA 3ZW8A 4DVJA 4Z6KA 1T2AA 2HMSA 5HBRA 3WS7A 3AWDA 4BQRA 3GUYA 1A9ZA 3OF2A 4EUFA 4HV4A 1KS9A 4E31A 4O63O 2EEZA 4NBUA 1HT0A 1NFQA 4DXHA 3WGOA 2ZCUA 2G5CA 3KOUA 5KNLA 4XQCA 4QUKA 1E77A 1ZVMA 1LBEA 1VSUA 1T2EA 3DFUA 3JQAA 4M89A 2P5YA 4CM8B 4FFPA 4E5YA 2C7VA 4LRSB 5A9SA 2EXXA 3JQBA 1BG6A 5A5EA 4EZBA 1DIRA 1NHWA 2I6TA 3FNGA 5I9LA 1H94A 3WICA 4HNGA 3K2EA 4TRMA 4UUMA 4H15A 4ZJUA 4IPTA 4OGWA 4I08A 4NBRA 2B69A 1ZK3A 4K6CA 4WE3A 4O1MA 3QWBA 5IZCC 4YJDA 1W0CA 4LSWA 2CDCA 4CMBA 2I76A 2D5AA 2I3GA 4E3ZA 1ZSVA 1K6JA 1ZK4A 4D0RA 2X6TA 3NAQA 3I1JA 1PGNA 1PEDA 1EVIA 1NAIA 1SB8A 3CPSA 4XDYA 5FI5A 2DAPA 4CV3A 5DBIA 3OH8A 4P8RA 4ZHSA 2UUPA 4PRKA 3HFGA 2P91A 4GAEA 1JWBB 1YWGO 3GVHA 5EL0A 3BIOA 4KDFA 4K9DA 3KLMX 4QO7A 1E7SA 5T8KC 4R51A 1P45A 2GRAA 3P19A 1RYEA 5EIOA 3HFSA 4WCFA 5K9ZA 1ZMTA 1BMDA 2YFQA 1CWUA 3QWIA 3R3SA 1GR0A 1T1RA 1DIHA 4W82A 2NU7A 3V8BA 1ARZA 1ENYA 3C7DB 4PG8A 3H9QA 3VPGA 3ICPA 1LEHA 1YDEA 2GR9A 2AQ8A 1LJ8A 3WXBA 3F5QA 1SZJG 1ZCJA 4XYEA 1XU9A 1J4AA 1N7HA 1CIVA 3H9UA 1T1SA 1VKNA 3GPIA 4HFRA 4L76A 1PZFA 3FN4A
chains in the Genus database with same CATH superfamily
3WWYA 2QBYB 2W0SA 5AK0A 1I01A 4BXOA 4ZOLF 2NT4A 2O59A 4UM5A 1RXEA 1TK9A 2BTQB 4MDEA 1NZDA 4QU8A 5FUMA 4JI4B 3A58B 4KXWA 4LJYA 4RHFA 4WNCA 4YJHA 3O1JC 1W0JA 4XEUA 3ZY2A 4YUYA 1XELA 2IF2A 3W2TA 1MZPA 4G36A 1PS9A 2XTNA 3T3MB 4AJ9A 3QRWA 1R4ZA 4Z1OA 1XNQB 2HA2A 1ZOPA 2R25B 1JN0A 3U4DA 4LYDA 3R9IA 3C39A 4RMJA 5FPPA 4Q4HA 2FMKA 3HU1A 2QN8A 3W1WA 1KVRA 2AN4A 3MOGA 4JA0A 4RK4A 1ECGA 1IBMB 1UFQA 3VAZA 3H8VA 4JXKA 4C05A 2R6HA 1HURA 3HYRA 4CIDA 2Q4EA 1BROA 3CLHA 1RJFA 3E3OA 3KPYA 5K45A 1OFUA 3D3JA 3JZMA 5LB2A 1A27A 4FOLA 4BV2A 2VJAA 1R8JA 3EG9B 3HN2A 2C4UA 5TNXA 4DW8A 1T9GS 2YMMA 5IARA 4PX5A 3THXB 3SJZA 4PZAA 1CNMA 3OTHA 3SSOA 2AWNA 5JALA 1E8NA 1TMYA 4CW7A 2X0RA 4EHDA 2FV8A 1PR1A 1Z83A 4JBGA 4RAQA 4U2CA 5TARA 3P52A 3EX7C 1QHFA 3PJRA 4P4LA 2C5BA 4AWAA 1SA0A 5CXXA 3LDFA 3A37A 4PV7A 2RDMA 4H7FA 1OLSB 2B4TO 2BVNA 3HE3A 1YRQA 1ZLXA 3H6GA 4KYUA 1F06A 3S1SA 2G77B 2GCNA 3BXOA 4FQ8A 4JIGA 1NKVA 2XY4A 1OHHD 3L8CA 4PPNA 1WUYA 3T7TA 5JYDA 3I6YA 2IPNA 5CVDA 5DHRA 2UZ4A 2G67A 1CE8B 1U8CB 2VHWA 5KCMA 3MMNA 1MDBA 5J4VA 1HPLA 3HHEA 4YRQA 4KRXA 2J3EA 1M5TA 1SHJA 3IV6A 5DHAA 3Q5DA 2RBEA 3LLUA 4AX8A 1X1AA 3TZEA 2AFVA 2ZE6A 1R12A 3EMVA 2GVNA 1UJ6A 5I7AA 4JLWA 1CY0A 3FCAA 4HDOB 1SU4A 4REQA 4ARZA 4DWVA 4GUDA 1KF0A 4A91A 4H4EA 5JMTA 2FH5B 4ZI5A 2C78A 4ZCMA 1OIWA 2VYVD 2DHRA 1O95D 3ADKA 2VTKA 3KFVA 4KYTA 2BJWA 3DBHB 5CM2Z 2EJCA 1S0UA 1KFEB 1OKKD 1UAYA 2RHOA 3B9PA 2IU0A 3TB6A 4G3XA 3WZ2A 4GM0A 2IXTA 1MC1A 4IZ6A 2PYIA 4ZAYA 5B2ZA 1JT9A 3AUAA 1YB4A 2F1RA 1MVLA 1AQNA 2LW7A 2OEPA 3PWZA 4BO8A 2YYSA 4GYWA 4UUQA 1U7TA 1WJGA 1XFAA 1XTIA 2GM9A 1BQ4A 2ZITA 4D4LA 3MTEA 3HPQA 2E9SA 1PRYA 2HT6A 4ZO8A 1SQSA 2ZJ2A 1MENA 3LYLA 4WVLA 2P79A 2V6FA 1QMPA 1U5CA 3CINA 3HSKA 5B1YA 4FLFA 3GV0A 4M8SA 4GMFA 3SDBA 3T5TA 5F7XA 4IAOA 4P5DA 5TMPA 2D8MA 1YNSA 2BZGA 3AKYA 4YMLA 5KU1A 2IP1A 3TQSA 4IJVA 1HLPA 1VBNA 1M2FA 4GOXA 1AGPA 4I9UA 1V16A 3G59A 1V6SA 3NIDB 3GLTA 1JXOA 3MA0A 4QTXA 4ESOA 2A4MA 2FSUA 2VHTA 4RJKA 1AHPA 1QYRA 4LHWA 1Y9JA 1QHHB 3UA3A 3SVTA 1S89A 1HFJA 4BNWA 3P9QA 3ONWA 3F9CA 4BASA 4G5RA 3WAKA 4HXYA 3PEVA 3RUIA 4V0QA 4QGBA 4Z9FA 2Z98A 4YJ2A 3ZVLA 3T5GA 4MKIA 2FEAA 5AJVB 5IH3A 1MHTA 2MSWA 3BZUA 1ILWA 2I7TA 3DMPA 1GYQA 2ZJ0A 3M6VA 3FF1A 4IVPA 3QBJA 4LJ7A 2B9EA 1E61A 1JEJA 3QE0A 1JXMA 3O4FA 5CYOA 1JHUA 4C6RA 3QVMA 3K09C 5IT4A 4XSGA 1CR4A 2GBIA 4EJSC 1QFSA 3FAZA 4Z7QB 1I1QB 4NPAA 4P7JA 1L7MA 2KYRA 3UUEA 3V8PA 3OT1A 4UW9A 5H4GA 1IBKB 3KL2A 3WMFA 2RAUA 3GBSA 3EA5A 3TI7A 4A0SA 2EFDB 3P0IA 1JWAB 3VR4H 4B87A 2OV1A 2KE5A 1P17A 3AWIA 5FR1A 1ZJ4A 1KTIA 4O0LA 1YE8A 4GICA 2VIIA 3BE8A 4I4TF 1MNQA 3RH0A 2P77A 2D4AA 1A5TA 1JV2B 4I3HA 2ZQ5A 3A1WA 1OYOA 1TT5B 2Q5JA 2QMUA 3DTYA 2CMGA 2I2WA 2K5UA 4N1AA 2NSJA 4FYWA 3IUMA 1P77A 2XTJA 1GUZA 2VDJA 2VXBA 3GJ7A 4HXGA 4JC0A 3ETLA 3S68A 3UWOA 3H9BA 5AVKA 3WLOA 4DIKA 3A2KA 2JLWA 3PL1A 3OM0A 4WBSA 2J4FA 2FA9A 4G25A 1OPRA 1R9JA 1YB5A 3I2HA 4JJKA 4PBSA 1XJQA 5CLJA 2OHVA 2QTMA 2HSJA 4FNMA 1NXQA 1XKLA 2GT1A 2YY5A 3OPQA 3RTBA 1PUXA 5EHIA 5C5EA 1QLWA 3N59A 5FPKA 4N76A 4Q05A 1EDOA 1KU6A 1JR3E 2ZE7A 1CCWA 2W90A 1A88A 1SCKA 1VPEA 4BCBA 3NEYA 2BGTA 3K1TA 1XZEA 2V55B 5CDUA 3DEZA 4DBZA 4IDDA 4E12A 4PM4A 4A27A 5KX5B 5HS6A 3WJ7A 5AUNB 1D9ZA 1VIDA 2X14A 2QF7A 3MRVA 4UXIA 2HWWA 5ERGB 4B3GA 2RHTA 2A0KA 4M1ZA 3X3HA 4BLTA 1XR3A 2O3QA 3REQB 2DJ5A 3VZCA 1D1QA 2Q3LA 2RHDA 4II3A 4RD3A 3MBIA 3ENVA 3L18A 4LBZA 2IXDA 3KAQA 1F7UA 1P18A 3FPEA 4IH1A 2WWHA 1BW9B 3MS2A 3UJ7A 2RAVA 4BNYA 2HQSA 3HTXA 4HNAA 4TTSA 2I33A 4KAJA 4MCAA 2WQ7A 1Q0ZA 3C6MA 1EFHA 1ETHA 2RC5A 3IMKA 3HKEA 4M83A 1OKKA 2C7BA 3OJOA 3BXZA 2LVBA 1DQZA 2P62A 2BDUA 1X1DA 4GL4A 5HUHA 2ZT7A 1F2TB 4UUBA 4BB6A 2X4DA 3KYIB 3ZD6A 3GP8A 4YCLA 2ZR0A 1C1YA 3MINB 4L8FA 4DWWA 4BMXA 3IAS6 5CR9A 1CD5A 3R5JA 5J5VA 3SJBA 1PQYA 5HFAA 1UQTA 3O74A 2G7MC 4J43A 2PZMA 3JRXA 2C31A 1MRNA 5B3JC 2RI0A 1K88A 2BR4A 2COEA 4DKJA 2CDRA 1EWYA 4GWKA 1V4BA 1T4CA 3FDZA 4ZANA 2REBA 3GJ6A 3L7DA 1J33A 4AVYA 2GBLC 5DI9A 1KNXA 1O8CA 4KVFA 1N2CB 4JT4A 2JCYA 3NNSA 1YZUA 1C29B 1CE8A 2XYHA 3K53A 4O4JA 4TLEA 4NYMQ 3TIVA 2IS6A 1LPBB 1XRJA 4GI1A 4RVGA 1PKXA 3GD5A 4KB5A 2W6JD 1ZUHA 4A8PA 1XAGA 5DYTA 4B71A 1T8UA 4Q1FA 4DOMA 3GNTA 1RNLA 2G1JA 3I9OA 4ZV9A 2W6MA 2HNBA 4L0QA 1K4KA 2C4WA 1QYXA 2BFWA 3WNBA 5A2GA 2CNKA 3OQMA 3INNA 4KUHA 2VSOA 1NUPA 4OV6B 3VZPA 2UXDB 1NTRA 3I5YA 1W5SA 4BMPB 4FMCF 4MKHA 1Z2CA 1QIIA 1LBSA 3EPRA 1XV5A 4UMVA 3BQMB 3QV2A 4KR7A 1FB5A 2V45A 5LP6F 2ZUFA 3QKRB 2C4TA 1K98A 4NBSA 1YJXA 2XI4A 1D6JA 1PKEA 1UXKA 1HQCA 2JAHA 1JEOA 2NO6A 3Q3VA 4MGEA 4R8LA 5G3ZA 5TV2A 4RPLA 5K6AA 3AVUA 3ZZMA 2O5EA 2BFOA 3NBQA 1E2JA 2OFPA 1ONSA 1NDQA 5EVJA 3DDNA 4M46A 5D3KA 3TAXA 4RORA 1QF6A 2XX3A 3S29A 3VH4A 3ED5A 3KT8A 4NENA 3INYA 1T3ZA 1GT6A 1JEDA 3H8JA 2H4WA 2DR2A 2JLXA 2ZJAA 2IXAA 3WGLA 1FQWA 5EE1A 4MVJF 4N0MA 1H1LB 4LE2A 2DY1A 1FP1D 3DZDA 1FMTA 1MVOA 3QVTA 1A77A 2HUNA 3FTQA 3WBBA 4ZAFA 1G38A 3DL7A 3B6ZA 3GRVA 2VAWA 4JCOA 1A9XA 1DZIA 4DLUA 1CUGA 1VI5A 4J90A 1GKKA 2C9OA 4TLDA 5FIUA 3CNOA 1TVCA 4PZ0A 1JDSA 3REGA 3UC5A 4E2ZA 2VLIA 4F04A 5BUCA 4LOLA 2BMVA 4JXJA 1UCFA 3KZ1E 3MXOA 4WKBA 1T9AA 1CUCA 4XVRA 3FPGA 2A9KA 2H4YA 1YOVA 2DTXA 5ELMA 2GBCA 1QJCA 2NVUB 3E8SA 5ULLA 2FWNA 2XGSA 5HQTA 4E14A 4B6JA 1JDVA 3HP4A 3ORSA 3VYWA 4V0LA 2FU5C 3F7NA 1NATA 1U94A 1RR6A 2FQWA 2RAPA 4PFSA 2C0PA 5ETJA 3UFXB 1RYMA 1HE3A 5L4SA 1QTNA 5B7QA 3JQFA 4NG5A 3DPSA 1Z35A 5KWIA 2XIJA 1FVXA 2NPIA 4JDUA 3KOYA 4QIHA 1QVRA 5D7NA 4PGMA 2IE0A 3FY4A 2XMCA 2COKA 5C3MA 4MPTA 5D86A 2XOXA 1XX6A 1M9NA 2CK3D 3V32A 1T34A 2H5EA 1M67A 1R5JA 4K6KA 1A4RA 2NYUA 3ES9A 5ES4B 4YYZA 3WBKA 2OC9A 3D5QA 4U39A 1RAFA 9LDBA 5CTAA 3CNLA 4RD4A 5DBEX 2Z9DA 3PWTA 1SOAA 3DOFA 4DARA 2VJLA 4KLNA 5CBPB 5J4YA 3HJUA 1NJ5A 3WGKA 4AF6A 3VR5A 4BAUA 5LQSA 1ELOA 1M2GA 1VE5A 1CFJA 1SKYB 3WKCA 3ZLJA 3UAVA 2TECE 3CC8A 3OO1A 4I9NA 2HO5A 4GW3A 4NQZA 4KC0A 4XARA 3RYCB 1Z75A 1WEHA 2BR3A 2EP7A 4YNBA 4EUKA 3ERCA 1H93A 5C3UA 3L07A 4PAQA 3SS9X 4N5MA 1NQXA 3S81A 3UMMA 5FTLA 3RSQA 4NG4A 3GAFA 4JQZA 3PZBA 1GGKA 1L3IA 3QY0A 2GJKA 3PTZA 1QFZA 4BN0A 3HABA 2XD9A 1CUAA 3AHCA 3ELYA 1GQYA 3VSEA 3QWHA 3PGA1 5CU7A 3JWEA 3DL0A 1OR8A 5JQGA 5KBYA 1NT2A 1T8YA 3OURA 4FINA 4MPPA 2A9OA 3THSA 1HGXA 2GZ2A 5K99A 3I04M 4ND1A 1VL0A 2IGTA 2CVQA 1GUYA 2I54A 1JEEA 1QO7A 4TWZA 3G9UA 4G2NA 5AK5A 1EWVA 1YBMA 4U0JA 3GDWA 4A23A 3ASZA 4QA9A 5JMWA 2GAFA 4MJ7A 3FSRA 3B5JA 5ALGA 3F49S 3V3KA 2H5LA 3GEBA 3FFAA 4K81B 4M21A 3ZKWB 5AVSA 3SFTA 3MGCA 1SBNE 3H6HA 1V3TA 2VJPA 1VMKA 2Y4NA 3I39X 2VPZA 3DXZA 4FOOA 4O0MA 3LCVB 1JBQA 1U63A 4HSEA 4P82A 4X84A 1FRVA 3KEGA 2PO7A 3KCQA 2FWAA 2HL6A 3MINA 2EVWX 3UB2A 2GCOA 1Q50A 4TRJA 2IUFA 4UE2A 2W58A 3H0CA 1GCIA 1K0FA 4Q9JA 2GD1O 4EHIA 3EEBA 3QOFA 4J3NA 4DR7B 4OFXA 1DAGA 3TS1A 1NLYA 3DULA 2ACKA 1ZAYA 1BSVA 2J5XA 2OXTA 1BHSA 3LHFA 4H77A 3ETGA 1XU7A 3L8ZA 1HYQA 1XEWY 3NKVA 4KMRA 2BJVA 3RGWS 1YZHA 3L8HA 2CLDX 1S4MA 5EXDA 2UVDA 3RKUA 4DABA 1YJBA 4G4GA 4NOMA 5LP6C 3WNQA 4WIAA 4Q9KA 5A06A 1I24A 5ARCA 2VUSA 2Z5FA 4KR3A 1VA5A 3MGAA 2X5OA 3H1GA 1SVNA 1UDRA 1AGYA 1YI1A 3QHAA 5ERYA 4FT4A 4E30A 5C7YA 2CF6A 1YFLA 2EGUA 4H08A 1Z36A 1VJ5A 1X77A 2W5UA 1J06A 4ZVNA 3SE0A 3ISVA 3QNUA 2J3IA 4UQPA 1ZUD1 2F9MA 2ZYIA 2FPLA 1E8DA 1NWHA 4BNZA 3ITEA 5DDIP 3TZQA 3EWSA 3HK2A 4N5NA 1HTBA 2C42A 5SYMA 3VR0A 5BOVA 5KTRA 4RZQA 4CHTA 1SUWA 3P8ZA 4INPA 1TKBA 2R7AA 3LKBA 4W6QA 1FJXA 1PGJA 5JJLA 1EX1A 1HKUA 4QGHA 1C1DB 1S7GA 1TEZA 1F4PA 5KC9A 1NLZA 2R2GA 1LRLA 1ZN7A 2OORA 2GXSA 1SCQA 1OUMA 2D0PB 2OBBA 3P0JA 1X80B 3R2JA 3WLNA 5C8YB 3EVZA 1NSFA 2IQIA 4LCBA 3RRBA 1Z5NA 1E6KA 2GDJA 3O92A 3RNOA 4W1SA 4A8HA 2KM1A 3FFWA 1YDGA 3G5LA 5CAEB 3K8QA 4EW6A 5IPFA 4QYXA 1K4MA 3LA6A 5CM8B 3H7IA 5CNKA 2FZWA 3CJRA 2DKOA 4POOA 1VMDA 2BBSA 2BUCA 3IUEA 1C9DB 4P7GA 1Z38A 2CEAA 3BWEA 3KQLA 2QOEA 2DT5A 1S1MA 3QEBZ 3IALA 2VHUA 3WIDA 3EAFA 5BMVF 3L46A 2Z43A 3D59A 1T2FA 2IYZA 3OPYB 5K0CA 3X1YA 2ZUEA 1ZVVA 4E32A 2I4IA 2OYCA 4C4AA 3TO5A 4CQNA 1NBOA 3TQIA 3RLFA 3DMTA 3H2ZA 2C1EA 2XE8A 1CQWA 4KIJA 1VB5A 2DR3A 2D5LA 3B82A 4CU5A 5DM2A 4YLYA 3CURA 4RVCA 4GG1A 2G08A 1CQIB 2NVUA 4N7BA 3FNFA 4RF2A 4EHFA 4O4HB 3W34A 1T4MA 1KA9H 4JYPA 5J63A 3QHPA 4AJOA 5MF6A 3C97A 2PAFA 3HYSA 3S28A 1SIBE 4UEJA 1SPBS 3L04A 4WINA 2QZJA 2CLCX 3IX7A 3A11A 3EQZA 1XQVA 1O95C 2UAGA 3KUXA 2QN6A 1QGAA 2VHJA 5D7BA 4PU0A 4M1YA 3PC2A 4H60A 5CPBA 4XWYA 3WNZA 3TZKA 2EX4A 1JHQA 3F2VA 1MRZA 2WU3A 1JIKA 4V0RA 1E6MA 1YS1X 1OTYA 3NO4A 1P0FA 1GNVA 4L8GA 4DDVA 2WVJA 3A3YA 1LSJA 3FPAA 3Q7RA 3ZV6A 5HWSA 4Y3UA 5IJ9A 4MK4A 4QUGA 4YRLA 3OQBA 1AXRA 4J0CA 4Y9SA 1DBQA 4HNUA 1LLCA 2GN6A 1VSQA 1ISRA 1W44A 2YJ5A 5I51A 1QP8A 3BPSA 4XIGS 4LJ6A 2JJ2D 2O2EA 1NONA 1W29A 4PSUA 3ZY4A 4OP2A 4DWJA 1JIQA 2W4IA 3C3BA 4RLFA 3G0DA 5I5GA 3A6KA 1PQPA 2C3PA 1QLHA 2HPZA 2BZ0A 1EFLA 2NUAB 5KYXA 1WOMA 3JWGA 1NMZA 3K6KA 2FCAA 2QAJA 3I2IA 4RGBA 3V2GA 5AKIA 3B2QA 2DM6A 3SX4A 1NVVQ 1SIUA 3M4XA 3R3YA 5HKKD 5AO9A 2WFZA 3RPEA 3U7JA 3WWOA 4Y6RA 5F73A 5BQPA 1PNTA 4MVCA 2ZAIA 1AZLA 3PUWA 3HUDA 5JZMA 2C04A 1H4QA 1QG6A 3L1HA 2JLVA 4ED9A 1GTRA 1E2PA 4CF6A 3OFKA 3QUBA 3ONNA 5CVCA 1QQAA 3OA0A 4AJHA 4BEWA 1RPNA 2PA3A 3KXLA 2NO0A 4UFOA 4P1ZA 4MVJE 3EZGA 1DAEA 3HL4A 4RVSA 1QK4A 3K94A 2CE7A 5EHZA 4HO1X 3ZHYA 1G2IA 3UHPA 2HIAA 5TMDA 4O2AF 4QXMA 1WZIA 1H2XA 1L5SA 1ORHA 1U2PA 4IHJA 4NH4A 1AKYA 1V3QE 2C9YA 2C3OA 2RI6A 2X9LA 3ZKWA 4DQVA 1NVBA 3NHAA 2FQXA 3ZCRA 4RABA 3BMNB 1EE9A 1TD1A 1ZH6A 4IGAA 4JI5B 1KPGA 2F64A 4XQ0A 1J0EA 1DWPA 3UGJA 4DJAA 3GGPA 4L0DA 1NMEA 4MV5A 4CQMB 2G28A 4NU8X 10MHA 2X7HA 1LWOA 3VSCA 1IZZA 1QAMA 1RM5A 1W2HA 2REQA 2GCOB 4LDQA 3VKVA 4CT5A 1ZONA 3R3HA 2P6RA 2Y9MB 4ND7A 4ADSG 1TC2A 3K8ZA 3QVUA 4KQXA 2QR5A 4C29A 4TUYF 4RK7A 2FEPA 2DZDA 1G20B 1SXJD 1BMQA 1D2NA 1TQDA 1W46A 2WJ6A 3H3XA 3HNOA 3PGXA 4ZKEA 3RGGA 3ZCVA 4UBNA 1IK6A 1QYVA 4FGZA 5KNCD 1ZH2A 1X0XA 4NPHA 4XGRA 2UVQA 2ISSD 1DPGA 1LVUA 5WRFA 2ZSKA 2GLUA 3JVVA 3DZIA 4M55A 4Z5XA 1ZUIA 4FE7A 3O91A 4ZQFA 5H02A 3ZI7A 4G56A 1FW8A 4ZRDA 5IYZA 3A6PC 4EELA 2OFFA 3SFZA 2BM9A 3PQEA 2BFEB 2WTNA 3TVYA 1BJTA 1VIVA 1G6Q1 3WRXA 821PA 3TSWA 4MCJA 4R83A 1GT91 1C3JA 1BYUA 2PV7A 3CG4A 3F6CA 2IWHA 3TKLA 1SB9A 4D3ZA 3FHJA 1XTTA 1YQGA 1E6EA 3U81A 3ZW7A 2A9RA 4CTNA 3HEBA 3VR6H 4RDIA 5EESA 4TTJA 4GPZA 2QW1A 4FFSA 2ACWA 2JD2A 4MAMA 2IFTA 2X0FA 1O0CA 3EZ2A 4G1EB 1J6UA 3P9YA 3WK8A 2IJGX 4G97A 2PUBA 1VXRA 1JQDA 4C4SA 1YHZA 4E5NA 4O59O 2HU7A 5AFSA 2EW1A 2IPOA 3PFFA 4M9XA 4KAFA 5KCZA 1VLZA 2EARA 1YB6A 3OKCA 3VPXA 3X1DA 1KK1A 4I4TB 4QD3A 3RUCA 5C8YA 4EGCB 4HVLA 4P53A 3QBTA 5G40A 6PFKA 1ZQ9A 2C5FA 1X1RA 5IZ4A 1Q17A 2Z2ZA 2WKSA 1JMYA 3EVDA 3VAYA 3ADOA 2GQ0A 1L5NA 4PZ9A 4TLLB 1TQ6A 3ZWVA 3CB2A 4MYRA 2X8WA 1FX1A 3S55A 4FYIA 3ZHQA 1E9BA 3BSSA 3RYIA 3LT4A 3O8RA 1X9GA 4OXNA 2QY6A 5JCJA 3QEMA 1GZSA 1D4ZA 1ODSA 4UMEA 4YAGA 4G23A 3FIUA 5IZCA 1U3GA 1HZZA 1PEKE 4PZPA 4Y9DA 5AKZA 3U1VA 3NHLA 1SD1A 3DV2A 3P9KA 4NXNB 3A9WA 4G24A 1G5HA 4LMBA 1C0KA 3Q2OA 1VMAA 5F64A 4D74A 1HTWA 1U7HA 5A4IS 3OOSA 2FOXA 3BKWA 5JIBA 4N12A 2EKPA 3BAFA 1Y80A 2AFRA 2R6DA 3AONB 5FUYA 3UHOA 4BLQA 3O26A 3PICA 3BZBA 1N9ZA 1GU7A 5HVNA 5BYAA 3UOWA 2IOHA 1KS2A 2ZW9A 1XEAA 3JQBC 3QWAA 4QC2A 5JVDB 5AW9A 1PN3A 3AETB 4MI6A 1ZOOA 1SCUA 1IZ9A 5JZSA 1KSFX 1LBTA 1SG0A 3VR5H 1E62A 1K1EA 4B3IA 3RJTA 3V4RA 4BUCA 1C9MA 3TOXA 2XODA 1C4WA 3F47A 3L6EA 3L7BA 4R1MA 2Y05A 3U7GA 1QGUA 4OUKX 5A0TA 4J7AA 5JD6A 1IHOA 3OF5A 1IRIA 1D2MA 1JYFA 7AT1A 3FOCA 4S2EA 1N2JA 2N0SA 4ARIA 1BDJA 1E5DA 5CDGA 2QTNA 1H0SA 2I6FA 5BSKA 7YASA 2IOQA 3L84A 1WKVA 2H7YA 2Q4TA 4JSRA 1KU0A 3NX4A 1PJ3A 1W36C 2A0UA 4G0OA 5BWLA 1VOTA 5C5IA 2YZKA 3FMGA 1N2XA 1T10A 3SF8A 1O08A 1GPWB 2VP3A 4R9VA 4RF3A 1R1DA 3AEUB 5FPTA 2O2SA 3IA7A 3EUEA 1QIMA 4G8DA 4ZGWA 2RGBA 4MVJH 3GRCA 2X2PA 3G89A 3NNDA 1JMKC 2GK4A 2B83A 1PZMA 3QU5A 1D2GA 2CVFA 1NVTA 2R6ZA 1CJSA 1YR6A 1ORRA 3KZOA 1RZRA 3VPCA 4C2UA 2I1VB 5KYXB 4C7MA 3I8XA 2C9CA 1GRVA 2ZTHA 1Z08A 3QMVA 1JL3A 2FW1A 2VTEA 4LDPA 3JAWA 4FGSA 5JCOA 4B3XA 1MB9A 2I62A 3SXPA 1Z37A 2A30A 1TK2A 2O1SA 4FFMA 4OH7A 1L5RA 1B7GO 3RAJA 3JQQA 5BYKA 5L3SA 2RJNA 3KOXA 1TYZA 4ZGGA 2C2WA 2UZIR 3FGNA 4KQKA 4Y2RA 2OV6A 4NBWA 2IS4A 5F9HA 1QC5B 2XBUA 5ER6A 4GC9A 1T5DX 5TT1A 4I0WB 5B2EA 3W5SA 4L5IA 1OZ0A 1DMSA 4MQFB 3LUBA 1JEAA 4L5CA 1NZJA 1FFGA 1FPQA 4GR5A 4N8DA 2GYUA 3AESA 3AI2A 4TTRA 5JSHA 2ZYAA 1W52X 1ZSYA 2FRDA 2AG1A 4JLOA 4OHWA 5D6OA 5E0OA 3EF3A 1DJOA 5MGBA 3SXUB 2ZTUA 1W5TA 1J90A 3TJMA 5BSEA 4I1PA 1UWKA 2AV6A 3ADCA 3B7PA 4B75A 3R44A 1N9GA 1VPLA 4DRYA 1KWKA 1SXJA 4GSYA 4DE5A 1JIXA 2QVLA 2ST1A 1TFUA 4HXEB 5HG0A 3F1LA 3BMNA 4D25A 5FL7A 3NBFA 1Y34E 4A0RA 3OZSA 3ANXA 2WD7B 1RHJA 4DNQA 4D8XA 5FTKA 3GZJA 1E7MA 3G7SA 4UBJA 4Y9RA 2A57A 2QX8A 2GGSA 3NATA 3TB4A 1EUDB 3N6VA 4NEQA 4UCWA 3K20A 3ABSB 5ALYA 4C4RA 1J99A 2XVAA 4TLMB 1MMFB 3AG5A 2IEZA 4RNDB 2VQ6A 1HZZC 2P2NA 1G20A 2G9UA 1ZYUA 2YS7A 1P7YA 3PYMA 4H1HA 4NFYA 2NG1A 5MHTA 3UT6A 2V3WA 2ZVQX 4F1WA 2ZRKA 3NJRA 4JIMA 3ZDYB 3IVRA 2R6CA 3GJQA 4BQEA 2TMDA 4EFMA 1TNDA 3GUCA 4N9WA 3H3FA 1TVMA 2BGMA 2PXXA 1W4RA 1ZIOA 1Z6ZA 4H0CA 3D54D 2G0NA 4IKPA 4E70A 2OAEA 1KHTA 4QREA 4BC1A 2B9VA 1PL6A 4BO5A 1XROA 4ZI2A 2XKKA 1Q7EA 5JYEA 3WADA 4HLQB 3GLUA 1MQ9A 1YRYE 5B36A 1KFCB 1M1YE 2XT9A 2XWSA 3AEKB 2OSVA 4HH4A 4M49A 4TLAA 3LVFO 5DXJA 2SECE 3WC4A 3IE1A 5EJ2A 1QRDA 2E5WA 2IYQA 2V58A 3A4MA 2Y9PB 2HJVA 2NO5A 3EGVA 3HBLA 4Y2JA 5F77A 3UK7A 1YR8A 2IIVA 3GLIA 1JG7A 4ZTUB 3UB3A 3VGJA 4PBRA 4ENQA 1C2YA 4WBNA 2NVOA 4QBKA 4XWOA 2Y0PA 4X5OA 3N8DA 3L4SO 4LIPD 1DCFA 3Q3IA 1WPRA 4X91A 3LCUA 4QLBA 1XTKA 3AYXB 4JT8A 1GQ2A 2HF7A 3EGXA 4C0AC 4QECA 4MUAA 1R9GA 3L0OA 4ZI7B 3FCSB 1B43A 3VPHA 1RT9A 4RC9A 2D1QA 4A5OA 1CV2A 1DC3A 1N5JA 2YXEA 2ZK7A 2F8SA 1WUHS 5IEBA 3SVLA 2I3AA 3EEFA 1NR1A 1S02A 1DEOA 1OAOA 1JF8A 3RU7A 3G8AA 1NWCA 5TF0A 2ZAMA 1ONPA 1N25A 3TNLA 4ZAWA 3EXEB 2FMIA 3IAAA 3IQGX 4OQXA 3JVIA 3N5CA 4Y2GA 5DSZA 2XYRA 1VJGA 3OWXA 2FPKA 2HBQA 4DLYA 3SLRA 3DFIA 1MAWA 3JQRA 4UVIA 2EAUA 4F6RA 5BR1A 2QTZA 4IXMA 5A9TA 5C51B 4U8GA 3KSDO 1KO4A 2IYAA 4B31A 4YRGA 2PNFA 3N9IA 2UYYA 3DBIA 3DUWA 3PXAA 5AXCA 3IHKA 1I1HA 4INJA 4NPCA 1G6KA 2EW8A 1C0IA 2ZBPA 1OAKA 2PUVA 1GPLA 4FHEA 4MOWA 1YE3A 4QBFA 1YZKA 4DR5B 5E8RA 3AILA 3VHXB 4K9MA 1OXMA 1ZGBA 2FVYA 3AFGA 4RYLA 1IEQA 4JDPA 4B7AA 3EMKA 4OXQA 4DL9A 3L1KA 3FYDA 2VBGA 4G4SO 3DGEC 3QF7A 2YV2A 8ABPA 2C4HA 1WCIB 2UVPA 3BVPA 3WB2A 5FWDA 3KKLA 1I5RA 5A4JA 1X8XA 3RHZA 4QG7A 1EE1A 1XVAA 3GXOA 3EA0A 3SBXA 1JG1A 3LTEA 4UUOA 3NPAA 4L95C 4AXBA 4GX2A 1FDRA 4OGFA 1UKZA 3D6JA 4DA7A 1TIPA 1ADJA 2CXNA 1MO5A 2FQYA 1DTEA 3B1KA 4RACA 1P1JA 3ECCA 3JX9A 4CWAA 5CITA 1OLUA 3EFHA 3JZIA 5JS8A 1EJ2A 2MIIA 2QLJA 3OX2A 3FCOA 1L7OA 4M0CA 2G9VA 4QNMA 4ZN6A 3GLKA 4YDQA 3KCNA 2NUTB 2J7PA 2BMFA 4HDKA 5FBQB 4ZRNA 3ZGYA 2VSQA 1JT2A 4G1UC 1QPBA 1SWVA 3PF9A 3Q5EA 1AE1A 1V8DA 4D6XA 1L4MA 2RB4A 3JQ9C 2QNBA 3LC7O 2ZYRA 2VDOB 3QVGB 1A2OA 4XPZA 1J2TA 5JECA 2IZZA 3QBVA 1GPNA 2OFOA 3PJDA 1Y6JA 3NM6B 4IUBS 3T9DA 5FEUA 3FB4A 1I3KA 2B35A 2DLNA 3Q4GA 2PSJA 1YAHA 1XIVA 3JQPA 4P36A 3H1FA 4ZOQI 5IWAB 1O3YA 4KR2A 1MA0A 2JAPA 2AX3A 2F1KA 2D4HA 2R85A 4EFDA 5IDWA 1FVFA 3EGCA 4YV2A 3R76A 2G4VA 2NACA 2VJOA 3P4XA 1SKQA 2P27A 3NTVA 4JN6B 1V5WA 3WV5A 3OOYA 2C83A 1EG7A 2XUGA 1ZCAA 1BXKA 3T4PA 4CDMA 1QTRA 3NH9A 4P92A 4CJXA 3OCZA 3TFOA 2BGWA 3X44A 4B40A 2X3YA 1R27A 3WAGA 1QU3A 3WX0A 5KOHB 5JAPA 5FPQA 1I94B 2PJZA 2F7SA 1Y6GA 4HYEA 1UBCA 2WFLB 3CCCA 2XW6A 2ZSHA 4FONA 3VKUA 4YHHB 1FFXA 3V4SA 2HJHA 4LXGA 1GY8A 3BA1A 3JQAB 3T5PA 4RKWA 3D8HA 3S99A 3SXUA 4BLSA 3E82A 4FUQA 2LTAA 2ZIWB 2BE9A 1HOXA 3AHJA 1QO9A 2J0UA 1DAHA 1HLDA 3O9VA 2DFDA 4LYGA 4RIFA 5JCZA 1H8EA 1RBQA 1SCBA 2QG9A 1B6TA 2DHEA 5DHFA 5AKJA 4W5HA 2CL5A 1E9SA 1KI3A 4IDOA 5G3YA 5HF5A 1UZNA 2CVOA 1J7JA 1EGAA 5C7IO 3DMTC 4XA8A 3BRSA 3WXMA 2GF0A 1YO6A 3IEUA 4FEAA 1RAAA 4YRKA 2BJHA 3SHFA 2H6EA 3DWFA 1EUDA 2OO5C 4EFLA 3LH5A 2HIHA 1YC2A 5LFAA 2O3SA 2YC2C 1HT3A 4WK2B 3SOPA 3WWEA 2YL2A 3E8XA 4CMCA 3QE9Y 4NJMB 4FQ5A 3O2QB 3AF5A 1J5XA 1E5QA 1E2NA 1Y3AA 4GOOD 1UT8A 2H2AA 2XA1A 4DGSA 3RVLA 3G23A 5CT9A 1YASA 4WOJA 2WY2D 2WF5A 5IW8A 2EBHX 2MSCB 2ZKLA 4F2HA 1GPBA 4I9HA 3KT3A 1CJVC 4G65A 1XVTA 4KPUA 4XM0A 1H2WA 3SZUA 2ZXUA 1N2ZA 2PX8A 3UJ6A 2ZQZA 4I81A 3PUKA 4RVDA 4R8RA 2Q6LA 1N5KA 4GWGA 1J00A 2DUWA 5FOWA 4L4YA 5I7EA 5A02A 4RTSA 2OM6A 2VHEA 1DELA 3AEKA 3OO0A 4PFQA 4MHOA 4XX0B 5IJXA 3WRWA 5HTOA 3PZRA 2C7QA 1X7ZA 5DBOA 4ZPJA 1CDZA 2D1TA 2ZCVA 2ZUWA 4ZO4A 5EHGA 3KT6A 4F6CA 1IY8A 2JH8A 1JQBA 1E20A 1PW5A 4WN3A 2Y66A 3QYPA 1XTVA 1EB8A 2JGAA 4H7PA 3SNHA 1JJVA 2IDZA 1JU4A 3FI9A 3OZ7A 3ST7A 4HGPA 3V7WA 4KV9A 5L9AA 3VXKA 2X76A 3FZQA 4DCUA 1ADFA 2XWQA 5E6UB 3W6NA 2R6AA 3WWDA 3TR5A 3WWZA 2BEJA 2A14A 1JJFA 1DC6A 4ZI7A 3HGQA 2XMPA 2C88A 2NN3C 2H1WA 3QXJA 4C6HA 3VSBA 4DB2A 3JD2A 2WJVA 5KTPA 3K2QA 1MAUA 1DV1A 1QYDA 5G41A 1HSOA 4JJAA 3MFQA 4BV9A 1L5FA 5F1YA 1YHNA 2B1RA 3O8LA 3W5DA 1UBHS 2ZBGA 4FJ1A 3T9EA 1BC5A 2QYSA 5KDLA 4F5WA 1SEPA 1JDPA 3E5NA 4ON9A 1PDWA 3AF1A 3K96A 4QFBA 2BUBA 4R2XA 4RLHA 7REQB 2P5UA 1XP8A 2YW9A 3PUZA 4A03A 3ICWA 3N74A 4FGJA 4CKEB 1V95A 3IH5A 4GLJA 2B3DA 1RFLA 2H52A 2A5YB 2XKJE 2YWFA 1E79A 4FU0A 5LXTB 4PC6A 2D1FA 2OG1A 3CNQS 3U9TA 3I4FA 2IWRA 3SDZA 3UV6A 3AKCA 3WMXA 2AMYA 5B58T 2ERXA 3M6UA 4FHZA 1ZMBA 3KAPA 3L05A 2MT9A 4JLAA 5ADWA 5AKHA 1OTHA 1TEHA 1WMAA 4IMIB 4C3ZA 1R7RA 3LUFA 2HLPA 4MR8A 4Z7NB 4TVOA 2ID4A 1C2TA 3Q0EA 1NY5A 2PD6A 2HBYA 2HF9A 3UAGA 1H4VB 1LX7A 1ST2A 2O06A 4BVGA 1V37A 3N0TA 2CDNA 2I67A 4DM3A 1MKYA 3EEIA 2FHSA 3P96A 2IKQA 2JBAA 4HMQA 1NRXA 3K0FA 2E4XA 3OBIA 4OHMA 3UXHA 1T36B 4L3WA 4AXXA 4UUPA 4L3VA 2PMBA 1REQA 4PW0A 1OLOA 4LJ5A 4RY0A 2VF7A 4H7DA 4F97A 5E3JA 4Z2YA 1SXHA 3BILA 2E6KA 1NOKA 2ZXFA 4B7ZA 3QW2A 4ILEA 5KYWB 5JNLA 2OKGA 1ZD8A 3P45A 2R5NA 4BO0A 4NCHA 1TIBA 3MS4A 1PR0A 1V1RB 2Z09A 3K1AB 1AQJA 3WGTA 5JU6A 2EL7A 1UBUS 2JF0A 3IIMA 3ILVA 4HYTA 4RH1A 3V1TC 2VUHB 1P5RA 2P3LA 5I6DA 2GKSA 3CLVA 4WV3A 3F6BX 4J94A 1TJ3A 2NV6A 2JHFA 3U4CA 2F8TA 3ZDZB 1FDSA 1HKHA 5ERXA 4IIXA 5E4TA 3GRFA 1H2BA 2PN1A 4M6WA 1I7NA 2QJRA 5C81A 2EF1A 2YZMA 1JKXA 5AHWA 2GZMA 3M0EA 4YCDA 3SK0A 3RS3A 3TLCA 2RGRA 2LV8A 2BH9A 3H5VA 4AMUA 3FJ1A 4M60A 5FV7A 4PLVA 3SICE 5IU6A 4OYRA 3O38A 1OSNA 4BV8A 3T7EA 1HI9A 2ZVJA 3BMXA 1IMOA 2NLOA 3HVUA 3SZLA 4MB6A 5AK4A 4YP6A 3OUZA 2DUMA 2R1ZA 4JOSA 4G0QA 4KZPA 5F5XA 4BB9A 3LWBA 5FL3A 4P35A 3K8YA 1C41A 5BSUA 4BOYA 3KEQA 5BT9A 3LUCA 1JHRA 1Z0ZA 5DLPA 1DBPA 1VHJA 3JQFC 5ICGA 2WFLA 3MHPA 3P9NA 2BEKA 1R10A 1SG9A 2P30A 3B3QA 4LRQA 4BNTA 4C87A 4FM9A 3U3ZA 3HQ4O 3VPBA 4CIYA 1XEFA 3VUEA 3VC7A 4IXNA 1EGQA 1HQDA 3I64A 4B83A 5IASA 3G82C 3FFBA 5BWNA 2LWIA 2WIKA 2ZRNA 1GU1A 1E9EA 1LSOA 1O94C 4XUDA 5FNZA 5TXGA 4HGOA 4EATA 2GN8A 6AT1A 1NJ1A 1UIRA 3OZBA 1A04A 5EWJA 4ZQCB 3DFFA 3EASA 1AD2A 4UVGA 5I4IA 5J47A 3ORRA 2H9YA 3DLBA 4DS3A 3DOJA 2QRVA 3L8GA 3R6DA 1OXXK 2E1RA 3C7CB 3EDCA 5EE0A 3PIRA 1AUQA 3QP9A 1G3IA 5L7WA 2IW1A 2JFOA 2VRWA 2DHDA 1ND6A 3C4QA 3DEFA 3FSEA 3NTUA 2YUTA 4JWTA 4M76B 3SEFA 5HIIA 4XLLA 1RAIA 5JC1A 2FPGB 1A7KA 4UBIA 3RVKA 3VHQA 2G71A 3AR4A 3HXKA 3MYYA 3H4TA 3VR6D 3FWKA 1X9HA 5L3QB 1NHGA 1RRKA 4QUDA 4DIFA 5FB3A 1T6XA 1P74A 5JAQA 2ZUTA 4CE6A 5LP1A 4CLDA 5EJ8A 2B2NA 3LF2A 4JYZA 4QXOA 4MV6A 3DMRA 1Z2OX 3ANLA 1M6YA 2H7XA 4J2TA 5A5DA 5K6AC 1U1CA 5AW0A 2WF8A 1CUXA 4H3SA 3UJ9A 2PT7A 1Y82A 3CX7A 1Z0DA 1TEVA 1P4SA 1ZM9A 5KVQA 7ABPA 3UV3A 1ESNA 2VPIA 2YHUA 2D5CA 4OQFA 3OFSA 1N6HA 2XOEA 2JJ1D