3IPJA

The crystal structure of one domain of the pts system, iiabc component from clostridium difficile
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
SNANKYNKIANELIKIIGEDNIISITHCATRLRVMVKDREIINDKKVEKVDEVKGVFFTSGQYQIILGTGIVNKVYAEVEKMGLKTLSKKEQDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTS system, IIabc component
publication title The crystal structure of one domain of the PTS system, IIabc component from Clostridium difficile
rcsb
source organism Clostridium difficile
molecule tags Transferase
total genus 22
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 3ipjA01
1O2FB 3IPJA 1IBAA 3BP3A 3BP8C
chains in the Genus database with same CATH superfamily
1Y1WK 2NVXC 4GTLA 4A3DK 2XCOA 2E2HC 4GTBA 4LOWA 4C3JC 2W7VA 3I4NC 4FZBA 1YX2A 3GIRA 2E2IK 1XZPB 3HOVK 3PO3C 3TTGA 5IYCK 3S1QK 5FLMC 4C2MK 4KATA 2NVQC 2FQOA 3IPJA 2JA7C 5C4JK 3AQPA 5IP7K 3HOYC 3S16C 3BP8C 4BY1K 4LK1A 1O25A 3CQZC 3AH5A 3S17K 3H0GK 1YNNA 4Y52K 4YFXA 4G0VA 4BY7K 3I4MK 1XXCA 3V4GA 1PJ5A 4A3DC 4Q5SA 3L4KA 3EQLA 2PA8D 1TWGA 5M3MK 1RU0A 4GFQA 3PO2K 2R7ZA 1O2BA 3LAJA 4MEYA 4P9SA 5C4JC 1IL2A 5E68A 3GTLA 2JA5K 1I6HK 2B63K 5IP7C 2FQTA 4BY1C 1ZYRA 5JVOA 5IOQA 4OIQA 2EBBA 4WILA 3AQOA 4A3LK 3N0BA 2A6EA 4BY7C 2YU9A 1R9TC 5IYBK 3A8JA 1AB4A 1O2AA 4OIOA 1UV7A 4MEXA 3FHZA 2E2JK 1TWAC 5C3EK 4KC6A 3GTKA 1TWGC 4PAAA 2JA6K 5C44C 5L46A 3GTGC 1DCOA 2ZUFA 1ZBSA 3GTLC 5IP9K 3AD7C 3S2HK 5M5YK 3M4OK 1WQFA 3GTMC 4A3LC 4YFKA 2R92A 1WORA 4DDQA 3VA7A 3A8IA 5IYBC 4BBSK 1B4BA 1K83K 2E2JC 3H3VL 3S14C 3T02A 2R93C 4C3HK 4BKWA 3MMLB 4QIWL 5IP9C 4Y7NK 4LQYA 2Y3PA 3M4OC 4C3IC 4KM9A 4YG2A 1Y1VA 2R92C 4KMHA 1G51A 4KARA 2NVYK 3HOUC 5IOSA 2GAGC 2E2HA 1HI9A 3GSIA 4BBRC 1EH1A 1SFOK 1PJ7A 4A3JK 1WOSA 2NVTK 3GTQK 1J6VA 3GEEA 3GTJK 2GSNA 5IYDK 3GEIA 2JA7A 1I50A 3FKIK 4KMUA 3T01A 3CQZA 4A3KK 1Y1VC 4BLBA 4A3BC 5TMCA 5M3FK 2PMZD 3LPXA 2CFAB 3GEHA 3TFHA 1YNJA 4LJZA 4A3JC 4A3EK 2NVTC 3TFJA 4FM9A 1USMA 5TMFA 1IQ0A 2WB1L 3FKIC 3JSTA 1I50C 1BS2A 1DD5A 4KB2A 4A3CC 4A3KC 3H0GA 3HOXK 1TWFC 1YCLA 2O5JA 1Y1WC 1R9TA 4NOIA 5C4XK 1TWAA 1IW7A 5JFEA 4G7OA 2GSOA 4AYBD 2E2IC 4MQ9A 5D4DA 3HOVC 2P5MA 5IYCC 3S1QC 3LAPA 1J6XA 4C2MC 4KAWX 4GTFA 2JA5A 3GTGA 1INNA 3G4AA 2Y0SL 1WSRA 2RGRA 3OREA 1TWHK 3GTMA 4P5BA 3S1NK 3S17C 3WODA 3H0GC 4Y52C 2JH3A 3I4MC 4JK1A 3Q3QA 3HKZL 1ZVUA 3RZDK 3HXAA 2ZUEA 3PO2C 2R93A 4WJ4A 4KASA 4X6AK 3GTPK 1I6HC 4OIRA 2JA5C 2B63C 1VH2A 4XSXA 1TWHC 3S1NC 4KMAA 2KWAA 4C45A 3OPFA 4ILDA 2V6UA 1BGWA 2V6TA 4YFNA 1TWCK 1J98A 4KN4A 1K83A 4GZYA 1EFWA 3RZDC 4A3MK 3N0CA 1JQWA 1O2FB 5C3EC 4G0WA 3AD8C 1F7UA 4QJVA 1F9NA 2D6FC 2PPBA 3GDZA 2JA6C 3AD9C 3L4JA 1WOPA 4X6AC 1JVIA 1GE9A 3GTPC 3GTOK 5IORA 3BP3A 3HOWK 1X31C 1V5VA 1WIHA 2WAQL 3S2HC 3N3YA 4GTAA 1WCMK 4BXXK 4A3GK 1HQMA 1VLOA 2NVYA 4BBSC 4KDDA 1K83C 4WJ3M 1O28A 1SFOA 2PHCB 1XPPA 3GTQA 1F93A 3GTJA 4C3HC 2BE5A 3S1RK 1EI6A 3FKIA 1C0AA 1I3QK 4A3IK 4Y7NC 3HOZK 1JOEA 4BLAA 1O27A 4BXXC 4A3GC 2VUMK 1XXBA 1TWFA 5FJ8K 1Y1WA 2NVYC 2NVXK 3S0XA 4KN7A 2E2HK 3H3VD 4C3JK 5IOTA 3I4NK 3ADAC 1XXAA 2E2IA 3PO3K 2PA8L 1SFOC 2GSUA 1EQRA 5FLMK 4QIWD 1PJ6A 3GTQC 3GTJC 1I3QC 5IYDC 2CW0A 1KQ4A 3HOZC 3FOEA 2A6HA 3CQZK 1WOOA 4XLNA 2VUMC 4PABA 1WQGA 5EGHA 1F7VA 4LLGA 1O24A 1O29A 4A3EC 1ZXOA 1IBAA 4XLPA 2XCQA 2B63A 3S2DK 2O5IA 1TWHA 2V6SA 3A8KA 2XCRB 3HOXC 3T00A 1R9TK 5C4XC 3G4CA 1TWAK 1ZQ1C 1TWGK 5C44K 4LK0A 2JA6A 2WB1D 3OEPA 2RH6A 1WSVA 2R7ZK 3GTPA 3GTGK 4LR2A 1BJTA 1VJEA 3GTLK 3S2DC 3S15K 1VRQC 3SZYA 3GTMK 1J6WA 1WQHA 5CHPA 3ERED 5EGEA 1TWCA 2YU9K 2JA8K 4RMFA 4AH6A 4GTDA 3RZOK 3S14K 4A3FK 3GTKK 3BUEA 2ZFZA 4O2DA 2R7ZC 2Y0SD 4A93K 2R93K 4GTEA 3GTOA 1EK8A 3S1MK 3S15C 3NUHA 5M5XK 4GT9A 1WCMA 4C3IK 1B4AA 2P8TA 4KM8A 2R92K 2YU9C 3HOUK 3HKZD 2JA8C 4XSZA 1TWCC 3SZZA 1IE0A 1DCPA 4QJVB 1XZQA 4A3MC 3RZOC 2PMZL 1O26A 3M3YK 4BBRK 4A3FC 4G0UA 3GTKC 4A93C 5HL8A 1I3QA 3S1MC 3GTOC 1DCHA 4M1XA 3HOWC 3FOFA 1L0WA 4G7ZA 4XCHA 5CJ9A 1WCMC 1USOA 3K7AK 5M5WK 2VUMA 4OIPA 1XZQB 1Y1VK 5TJ3A 4A3BK 2NVXA 4ZH4A 4KMDA 3QX3A 1SMYA 3M3YC 1BDFA 1I6VA 2CFAA 4GTCA 2A68A 4G7HA 4J3NA 3DXJA 1VGXA 4AYBL 2NVQK 3S1RC 1XZPA 2WAQD 1ISEA 1I50K 4P5AA 4A3IC 2JA7K 4KB4A 1IS1A 3HOYK 4OINA 3S16K 2GAHC 3CAGA 3K7AC 4A3CK 4Q4ZA 3TFIA 2A69A 1TWFK
chains in the Genus database with same CATH topology
1O2FB 3IPJA 1IBAA 3BP3A 3BP8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O2F B;  3IPJ A;  1IBA A;  3BP3 A;  3BP8 C; 
#chains in the Genus database with same CATH topology
 1Y1W K;  2NVX C;  4GTL A;  4A3D K;  2XCO A;  2E2H C;  4GTB A;  4LOW A;  4C3J C;  2W7V A;  3I4N C;  4FZB A;  1YX2 A;  3GIR A;  2E2I K;  1XZP B;  3HOV K;  3PO3 C;  3TTG A;  5IYC K;  3S1Q K;  5FLM C;  4C2M K;  4KAT A;  2NVQ C;  2FQO A;  3IPJ A;  2JA7 C;  5C4J K;  3AQP A;  5IP7 K;  3HOY C;  3S16 C;  3BP8 C;  4BY1 K;  4LK1 A;  1O25 A;  3CQZ C;  3AH5 A;  3S17 K;  3H0G K;  1YNN A;  4Y52 K;  4YFX A;  4G0V A;  4BY7 K;  3I4M K;  1XXC A;  3V4G A;  1PJ5 A;  4A3D C;  4Q5S A;  3L4K A;  3EQL A;  2PA8 D;  1TWG A;  5M3M K;  1RU0 A;  4GFQ A;  3PO2 K;  2R7Z A;  1O2B A;  3LAJ A;  4MEY A;  4P9S A;  5C4J C;  1IL2 A;  5E68 A;  3GTL A;  2JA5 K;  1I6H K;  2B63 K;  5IP7 C;  2FQT A;  4BY1 C;  1ZYR A;  5JVO A;  5IOQ A;  4OIQ A;  2EBB A;  4WIL A;  3AQO A;  4A3L K;  3N0B A;  2A6E A;  4BY7 C;  2YU9 A;  1R9T C;  5IYB K;  3A8J A;  1AB4 A;  1O2A A;  4OIO A;  1UV7 A;  4MEX A;  3FHZ A;  2E2J K;  1TWA C;  5C3E K;  4KC6 A;  3GTK A;  1TWG C;  4PAA A;  2JA6 K;  5C44 C;  5L46 A;  3GTG C;  1DCO A;  2ZUF A;  1ZBS A;  3GTL C;  5IP9 K;  3AD7 C;  3S2H K;  5M5Y K;  3M4O K;  1WQF A;  3GTM C;  4A3L C;  4YFK A;  2R92 A;  1WOR A;  4DDQ A;  3VA7 A;  3A8I A;  5IYB C;  4BBS K;  1B4B A;  1K83 K;  2E2J C;  3H3V L;  3S14 C;  3T02 A;  2R93 C;  4C3H K;  4BKW A;  3MML B;  4QIW L;  5IP9 C;  4Y7N K;  4LQY A;  2Y3P A;  3M4O C;  4C3I C;  4KM9 A;  4YG2 A;  1Y1V A;  2R92 C;  4KMH A;  1G51 A;  4KAR A;  2NVY K;  3HOU C;  5IOS A;  2GAG C;  2E2H A;  1HI9 A;  3GSI A;  4BBR C;  1EH1 A;  1SFO K;  1PJ7 A;  4A3J K;  1WOS A;  2NVT K;  3GTQ K;  1J6V A;  3GEE A;  3GTJ K;  2GSN A;  5IYD K;  3GEI A;  2JA7 A;  1I50 A;  3FKI K;  4KMU A;  3T01 A;  3CQZ A;  4A3K K;  1Y1V C;  4BLB A;  4A3B C;  5TMC A;  5M3F K;  2PMZ D;  3LPX A;  2CFA B;  3GEH A;  3TFH A;  1YNJ A;  4LJZ A;  4A3J C;  4A3E K;  2NVT C;  3TFJ A;  4FM9 A;  1USM A;  5TMF A;  1IQ0 A;  2WB1 L;  3FKI C;  3JST A;  1I50 C;  1BS2 A;  1DD5 A;  4KB2 A;  4A3C C;  4A3K C;  3H0G A;  3HOX K;  1TWF C;  1YCL A;  2O5J A;  1Y1W C;  1R9T A;  4NOI A;  5C4X K;  1TWA A;  1IW7 A;  5JFE A;  4G7O A;  2GSO A;  4AYB D;  2E2I C;  4MQ9 A;  5D4D A;  3HOV C;  2P5M A;  5IYC C;  3S1Q C;  3LAP A;  1J6X A;  4C2M C;  4KAW X;  4GTF A;  2JA5 A;  3GTG A;  1INN A;  3G4A A;  2Y0S L;  1WSR A;  2RGR A;  3ORE A;  1TWH K;  3GTM A;  4P5B A;  3S1N K;  3S17 C;  3WOD A;  3H0G C;  4Y52 C;  2JH3 A;  3I4M C;  4JK1 A;  3Q3Q A;  3HKZ L;  1ZVU A;  3RZD K;  3HXA A;  2ZUE A;  3PO2 C;  2R93 A;  4WJ4 A;  4KAS A;  4X6A K;  3GTP K;  1I6H C;  4OIR A;  2JA5 C;  2B63 C;  1VH2 A;  4XSX A;  1TWH C;  3S1N C;  4KMA A;  2KWA A;  4C45 A;  3OPF A;  4ILD A;  2V6U A;  1BGW A;  2V6T A;  4YFN A;  1TWC K;  1J98 A;  4KN4 A;  1K83 A;  4GZY A;  1EFW A;  3RZD C;  4A3M K;  3N0C A;  1JQW A;  1O2F B;  5C3E C;  4G0W A;  3AD8 C;  1F7U A;  4QJV A;  1F9N A;  2D6F C;  2PPB A;  3GDZ A;  2JA6 C;  3AD9 C;  3L4J A;  1WOP A;  4X6A C;  1JVI A;  1GE9 A;  3GTP C;  3GTO K;  5IOR A;  3BP3 A;  3HOW K;  1X31 C;  1V5V A;  1WIH A;  2WAQ L;  3S2H C;  3N3Y A;  4GTA A;  1WCM K;  4BXX K;  4A3G K;  1HQM A;  1VLO A;  2NVY A;  4BBS C;  4KDD A;  1K83 C;  4WJ3 M;  1O28 A;  1SFO A;  2PHC B;  1XPP A;  3GTQ A;  1F93 A;  3GTJ A;  4C3H C;  2BE5 A;  3S1R K;  1EI6 A;  3FKI A;  1C0A A;  1I3Q K;  4A3I K;  4Y7N C;  3HOZ K;  1JOE A;  4BLA A;  1O27 A;  4BXX C;  4A3G C;  2VUM K;  1XXB A;  1TWF A;  5FJ8 K;  1Y1W A;  2NVY C;  2NVX K;  3S0X A;  4KN7 A;  2E2H K;  3H3V D;  4C3J K;  5IOT A;  3I4N K;  3ADA C;  1XXA A;  2E2I A;  3PO3 K;  2PA8 L;  1SFO C;  2GSU A;  1EQR A;  5FLM K;  4QIW D;  1PJ6 A;  3GTQ C;  3GTJ C;  1I3Q C;  5IYD C;  2CW0 A;  1KQ4 A;  3HOZ C;  3FOE A;  2A6H A;  3CQZ K;  1WOO A;  4XLN A;  2VUM C;  4PAB A;  1WQG A;  5EGH A;  1F7V A;  4LLG A;  1O24 A;  1O29 A;  4A3E C;  1ZXO A;  1IBA A;  4XLP A;  2XCQ A;  2B63 A;  3S2D K;  2O5I A;  1TWH A;  2V6S A;  3A8K A;  2XCR B;  3HOX C;  3T00 A;  1R9T K;  5C4X C;  3G4C A;  1TWA K;  1ZQ1 C;  1TWG K;  5C44 K;  4LK0 A;  2JA6 A;  2WB1 D;  3OEP A;  2RH6 A;  1WSV A;  2R7Z K;  3GTP A;  3GTG K;  4LR2 A;  1BJT A;  1VJE A;  3GTL K;  3S2D C;  3S15 K;  1VRQ C;  3SZY A;  3GTM K;  1J6W A;  1WQH A;  5CHP A;  3ERE D;  5EGE A;  1TWC A;  2YU9 K;  2JA8 K;  4RMF A;  4AH6 A;  4GTD A;  3RZO K;  3S14 K;  4A3F K;  3GTK K;  3BUE A;  2ZFZ A;  4O2D A;  2R7Z C;  2Y0S D;  4A93 K;  2R93 K;  4GTE A;  3GTO A;  1EK8 A;  3S1M K;  3S15 C;  3NUH A;  5M5X K;  4GT9 A;  1WCM A;  4C3I K;  1B4A A;  2P8T A;  4KM8 A;  2R92 K;  2YU9 C;  3HOU K;  3HKZ D;  2JA8 C;  4XSZ A;  1TWC C;  3SZZ A;  1IE0 A;  1DCP A;  4QJV B;  1XZQ A;  4A3M C;  3RZO C;  2PMZ L;  1O26 A;  3M3Y K;  4BBR K;  4A3F C;  4G0U A;  3GTK C;  4A93 C;  5HL8 A;  1I3Q A;  3S1M C;  3GTO C;  1DCH A;  4M1X A;  3HOW C;  3FOF A;  1L0W A;  4G7Z A;  4XCH A;  5CJ9 A;  1WCM C;  1USO A;  3K7A K;  5M5W K;  2VUM A;  4OIP A;  1XZQ B;  1Y1V K;  5TJ3 A;  4A3B K;  2NVX A;  4ZH4 A;  4KMD A;  3QX3 A;  1SMY A;  3M3Y C;  1BDF A;  1I6V A;  2CFA A;  4GTC A;  2A68 A;  4G7H A;  4J3N A;  3DXJ A;  1VGX A;  4AYB L;  2NVQ K;  3S1R C;  1XZP A;  2WAQ D;  1ISE A;  1I50 K;  4P5A A;  4A3I C;  2JA7 K;  4KB4 A;  1IS1 A;  3HOY K;  4OIN A;  3S16 K;  2GAH C;  3CAG A;  3K7A C;  4A3C K;  4Q4Z A;  3TFI A;  2A69 A;  1TWF K; 
#chains in the Genus database with same CATH homology
 1O2F B;  3IPJ A;  1IBA A;  3BP3 A;  3BP8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...