3IPJA

The crystal structure of one domain of the pts system, iiabc component from clostridium difficile
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
SNANKYNKIANELIKIIGEDNIISITHCATRLRVMVKDREIINDKKVEKVDEVKGVFFTSGQYQIILGTGIVNKVYAEVEKMGLKTLSKKEQDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of one domain of the PTS system, IIabc component from Clostridium difficile
rcsb
source organism Clostridium difficile
molecule tags Transferase
molecule keywords PTS system, IIabc component
total genus 22
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 3ipjA01
3BP3A 1IBAA 3IPJA 1O2FB 3BP8C
chains in the Genus database with same CATH superfamily
4C3IC 1VJEA 4M1XA 2NVQK 4Y52K 4C45A 3T01A 3GTOA 4AH6A 2CFAA 3GTLK 4WJ3M 2P8TA 1O27A 4GTCA 3FOFA 4A3IC 4BKWA 1K83A 3H3VL 3S15K 1SMYA 4A3BK 5IP7K 1Y1VK 3MMLB 1KQ4A 5IP7C 3FKIC 2PA8L 2GAHC 2R92K 2R92C 4G0UA 4RMFA 3BP3A 2R7ZC 2A6HA 2GSNA 2ZUEA 3GTGK 2A69A 2A6EA 1WOSA 1F93A 4KASA 3S2HK 2Y0SD 2Y3PA 3GTPC 2NVYC 1IBAA 4QJVA 2NVXK 4LJZA 1TWGC 1I3QA 3HOVC 3DXJA 4LLGA 1TWGA 2E2IA 5IP9C 2YU9A 1USMA 3GTMC 1F7UA 3RZDC 4PAAA 3GTPA 2V6SA 1TWHK 3S15C 4A3JC 1VRQC 4G7HA 4BY7K 1I6HK 1DCHA 5C4XK 2WB1L 1SFOK 4KM9A 4O2DA 3M3YC 5EGHA 1O24A 1J6XA 4A3LK 1J6WA 4AYBD 1X31C 5IYBK 3QX3A 3CQZK 4BY1K 1VGXA 4OIOA 4KMDA 4P5AA 2PMZD 1I50A 1BS2A 2CFAB 3S17K 1TWAK 1TWCC 1ZBSA 3GTLC 4Q4ZA 4GT9A 5IOSA 3GTMA 4A3CK 4XCHA 2NVXC 3VA7A 4A3IK 4GFQA 4C3HK 1EK8A 2VUMA 5IORA 3GTGA 1TWFK 4PABA 4OIPA 2EBBA 3K7AC 1ISEA 3H0GK 2WB1D 4GTFA 5CJ9A 4P5BA 1HQMA 1B4AA 4MEYA 3FHZA 3GTGC 1Y1VA 4LOWA 4P9SA 2FQOA 1WORA 3T02A 3HOXK 3H0GA 1I6VA 1USOA 4WILA 3OEPA 3S2HC 4A3DC 1B4BA 3GTLA 1DD5A 3S1RC 2E2JK 5IOTA 1I50K 4NOIA 4XLPA 1EI6A 5C4JC 4G0VA 5JFEA 1WSVA 2NVTK 3TFJA 4KMHA 3GTJC 4GTDA 1O29A 3GEHA 4OINA 3Q3QA 3A8KA 1XZQA 3EQLA 3NUHA 4G0WA 2E2HK 3LAPA 3S16K 5IYDC 3AQOA 1TWHC 3S1QK 1Y1VC 4A3BC 4LR2A 5C44K 3FKIK 1G51A 3HOWC 1EFWA 5D4DA 4C2MC 2O5IA 3FOEA 1PJ7A 1WSRA 2O5JA 2YU9K 1XZPA 1SFOA 3T00A 4BBSK 2JA8K 3AQPA 1RU0A 4LK0A 1ZQ1C 3S1NK 3N0CA 1I3QK 4OIQA 3S1NC 3BP8C 2E2HA 1TWCK 2JA7A 3L4KA 3GTPK 4A93K 5C3EK 1IW7A 1PJ6A 4A3DK 3JSTA 4YFNA 3S14C 2E2IK 4C3HC 4QIWD 3WODA 1F9NA 4C3JC 3RZDK 2R7ZA 2JA7C 2R92A 1V5VA 3H0GC 2E2HC 4BXXK 2R93C 4X6AK 4BXXC 5FLMK 4FZBA 1JVIA 3HOYC 2ZFZA 5TJ3A 3HXAA 3GTQA 5M5YK 1YX2A 4A3KK 4AYBL 1SFOC 3TFHA 5FJ8K 3OREA 4FM9A 2PPBA 4KM8A 2GSOA 3GTOK 1C0AA 2YU9C 1JOEA 3TTGA 1WOOA 4A3EK 4A3EC 2WAQD 4JK1A 1I3QC 1WCMC 2PMZL 2B63K 1K83K 1TWAC 3I4MC 1O25A 4A93C 2B63A 3S14K 1WQHA 1XZPB 5IYDK 3S1QC 1XXCA 1O28A 3GIRA 3TFIA 4G7ZA 3GEEA 4ILDA 4KMAA 4XLNA 1Y1WC 1XXAA 3HOZC 4MQ9A 4C2MK 3PO2C 2PHCB 4BBSC 5IYCC 4YG2A 3GTQK 1YCLA 2VUMK 1J6VA 3H3VD 2XCRB 4A3FC 3HOXC 4LQYA 1BGWA 1ZVUA 1ZYRA 1O2AA 4KB2A 1TWAA 1TWFA 4GTAA 1TWGK 1O26A 2E2IC 1WCMA 3RZOK 5C4JK 2A68A 3GEIA 4KARA 5IP9K 2GAGC 4Y52C 2NVXA 1GE9A 4KATA 1TWFC 4MEXA 4BLAA 2JA7K 1TWCA 5JVOA 2V6UA 1WOPA 2JA6A 2Y0SL 4X6AC 4KN4A 1YNNA 5FLMC 2BE5A 2P5MA 3S2DC 3CQZA 1VLOA 1YNJA 2ZUFA 5L46A 1O2FB 2R93A 2JA6K 3GTKA 4KC6A 4A3LC 3I4NC 4A3GC 3ADAC 2KWAA 3CQZC 5IYBC 4YFXA 3A8JA 3AD9C 3IPJA 4C3IK 4XSXA 2WAQL 4GZYA 3OPFA 4ZH4A 3AH5A 1O2BA 2CW0A 3L4JA 3ERED 3I4MK 4A3CC 4KAWX 5C3EC 3PO3C 4BLBA 4QIWL 4YFKA 5M3MK 3G4AA 1WIHA 3RZOC 3SZZA 1XZQB 3CAGA 4C3JK 3HOWK 1WQFA 2NVYA 3N3YA 3HOUC 1R9TK 4KMUA 4A3MC 3PO2K 4G7OA 3V4GA 2D6FC 3AD7C 3S2DK 3GTQC 4LK1A 1J98A 5C4XC 2VUMC 2XCOA 1HI9A 1XXBA 1JQWA 3LAJA 3M3YK 1DCPA 2XCQA 5TMCA 1R9TA 1IQ0A 3N0BA 2PA8D 5IOQA 2JA5C 1F7VA 5HL8A 4KN7A 5E68A 5EGEA 3I4NK 4A3GK 1Y1WA 4BBRK 3S1RK 2E2JC 5TMFA 4Y7NK 3HKZL 1ZXOA 4BY1C 2NVTC 1K83C 3BUEA 2GSUA 2FQTA 3G4CA 2B63C 3GTMK 1DCOA 1IL2A 4WJ4A 5M5XK 3GDZA 1AB4A 3S16C 1EH1A 1I6HC 4DDQA 5M3FK 4GTEA 4KB4A 4XSZA 1XPPA 4KDDA 3K7AK 3S1MC 3HOUK 3S1MK 4OIRA 2R7ZK 3M4OK 5IYCK 2W7VA 2JH3A 5M5WK 1PJ5A 3S0XA 4A3FK 2NVQC 1WCMK 1TWHA 3S17C 4J3NA 1BDFA 3PO3K 2JA5K 3GTJA 3HOVK 1UV7A 1I50C 3AD8C 3HKZD 4GTLA 3GTJK 1Y1WK 3SZYA 2V6TA 1IE0A 3GSIA 3HOZK 2JA5A 3A8IA 1R9TC 3GTKC 4A3MK 3GTKK 3HOYK 2R93K 4A3JK 1VH2A 1L0WA 4A3KC 3FKIA 4QJVB 4BY7C 5CHPA 2RGRA 5C44C 3LPXA 1WQGA 2JA6C 2NVYK 1EQRA 4Q5SA 1BJTA 3GTOC 1INNA 2RH6A 1IS1A 3M4OC 4Y7NC 4BBRC 2JA8C 4GTBA
chains in the Genus database with same CATH topology
3BP3A 1IBAA 3IPJA 1O2FB 3BP8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BP3 A;  1IBA A;  3IPJ A;  1O2F B;  3BP8 C; 
#chains in the Genus database with same CATH topology
 4C3I C;  1VJE A;  4M1X A;  2NVQ K;  4Y52 K;  4C45 A;  3T01 A;  3GTO A;  4AH6 A;  2CFA A;  3GTL K;  4WJ3 M;  2P8T A;  1O27 A;  4GTC A;  3FOF A;  4A3I C;  4BKW A;  1K83 A;  3H3V L;  3S15 K;  1SMY A;  4A3B K;  5IP7 K;  1Y1V K;  3MML B;  1KQ4 A;  5IP7 C;  3FKI C;  2PA8 L;  2GAH C;  2R92 K;  2R92 C;  4G0U A;  4RMF A;  3BP3 A;  2R7Z C;  2A6H A;  2GSN A;  2ZUE A;  3GTG K;  2A69 A;  2A6E A;  1WOS A;  1F93 A;  4KAS A;  3S2H K;  2Y0S D;  2Y3P A;  3GTP C;  2NVY C;  1IBA A;  4QJV A;  2NVX K;  4LJZ A;  1TWG C;  1I3Q A;  3HOV C;  3DXJ A;  4LLG A;  1TWG A;  2E2I A;  5IP9 C;  2YU9 A;  1USM A;  3GTM C;  1F7U A;  3RZD C;  4PAA A;  3GTP A;  2V6S A;  1TWH K;  3S15 C;  4A3J C;  1VRQ C;  4G7H A;  4BY7 K;  1I6H K;  1DCH A;  5C4X K;  2WB1 L;  1SFO K;  4KM9 A;  4O2D A;  3M3Y C;  5EGH A;  1O24 A;  1J6X A;  4A3L K;  1J6W A;  4AYB D;  1X31 C;  5IYB K;  3QX3 A;  3CQZ K;  4BY1 K;  1VGX A;  4OIO A;  4KMD A;  4P5A A;  2PMZ D;  1I50 A;  1BS2 A;  2CFA B;  3S17 K;  1TWA K;  1TWC C;  1ZBS A;  3GTL C;  4Q4Z A;  4GT9 A;  5IOS A;  3GTM A;  4A3C K;  4XCH A;  2NVX C;  3VA7 A;  4A3I K;  4GFQ A;  4C3H K;  1EK8 A;  2VUM A;  5IOR A;  3GTG A;  1TWF K;  4PAB A;  4OIP A;  2EBB A;  3K7A C;  1ISE A;  3H0G K;  2WB1 D;  4GTF A;  5CJ9 A;  4P5B A;  1HQM A;  1B4A A;  4MEY A;  3FHZ A;  3GTG C;  1Y1V A;  4LOW A;  4P9S A;  2FQO A;  1WOR A;  3T02 A;  3HOX K;  3H0G A;  1I6V A;  1USO A;  4WIL A;  3OEP A;  3S2H C;  4A3D C;  1B4B A;  3GTL A;  1DD5 A;  3S1R C;  2E2J K;  5IOT A;  1I50 K;  4NOI A;  4XLP A;  1EI6 A;  5C4J C;  4G0V A;  5JFE A;  1WSV A;  2NVT K;  3TFJ A;  4KMH A;  3GTJ C;  4GTD A;  1O29 A;  3GEH A;  4OIN A;  3Q3Q A;  3A8K A;  1XZQ A;  3EQL A;  3NUH A;  4G0W A;  2E2H K;  3LAP A;  3S16 K;  5IYD C;  3AQO A;  1TWH C;  3S1Q K;  1Y1V C;  4A3B C;  4LR2 A;  5C44 K;  3FKI K;  1G51 A;  3HOW C;  1EFW A;  5D4D A;  4C2M C;  2O5I A;  3FOE A;  1PJ7 A;  1WSR A;  2O5J A;  2YU9 K;  1XZP A;  1SFO A;  3T00 A;  4BBS K;  2JA8 K;  3AQP A;  1RU0 A;  4LK0 A;  1ZQ1 C;  3S1N K;  3N0C A;  1I3Q K;  4OIQ A;  3S1N C;  3BP8 C;  2E2H A;  1TWC K;  2JA7 A;  3L4K A;  3GTP K;  4A93 K;  5C3E K;  1IW7 A;  1PJ6 A;  4A3D K;  3JST A;  4YFN A;  3S14 C;  2E2I K;  4C3H C;  4QIW D;  3WOD A;  1F9N A;  4C3J C;  3RZD K;  2R7Z A;  2JA7 C;  2R92 A;  1V5V A;  3H0G C;  2E2H C;  4BXX K;  2R93 C;  4X6A K;  4BXX C;  5FLM K;  4FZB A;  1JVI A;  3HOY C;  2ZFZ A;  5TJ3 A;  3HXA A;  3GTQ A;  5M5Y K;  1YX2 A;  4A3K K;  4AYB L;  1SFO C;  3TFH A;  5FJ8 K;  3ORE A;  4FM9 A;  2PPB A;  4KM8 A;  2GSO A;  3GTO K;  1C0A A;  2YU9 C;  1JOE A;  3TTG A;  1WOO A;  4A3E K;  4A3E C;  2WAQ D;  4JK1 A;  1I3Q C;  1WCM C;  2PMZ L;  2B63 K;  1K83 K;  1TWA C;  3I4M C;  1O25 A;  4A93 C;  2B63 A;  3S14 K;  1WQH A;  1XZP B;  5IYD K;  3S1Q C;  1XXC A;  1O28 A;  3GIR A;  3TFI A;  4G7Z A;  3GEE A;  4ILD A;  4KMA A;  4XLN A;  1Y1W C;  1XXA A;  3HOZ C;  4MQ9 A;  4C2M K;  3PO2 C;  2PHC B;  4BBS C;  5IYC C;  4YG2 A;  3GTQ K;  1YCL A;  2VUM K;  1J6V A;  3H3V D;  2XCR B;  4A3F C;  3HOX C;  4LQY A;  1BGW A;  1ZVU A;  1ZYR A;  1O2A A;  4KB2 A;  1TWA A;  1TWF A;  4GTA A;  1TWG K;  1O26 A;  2E2I C;  1WCM A;  3RZO K;  5C4J K;  2A68 A;  3GEI A;  4KAR A;  5IP9 K;  2GAG C;  4Y52 C;  2NVX A;  1GE9 A;  4KAT A;  1TWF C;  4MEX A;  4BLA A;  2JA7 K;  1TWC A;  5JVO A;  2V6U A;  1WOP A;  2JA6 A;  2Y0S L;  4X6A C;  4KN4 A;  1YNN A;  5FLM C;  2BE5 A;  2P5M A;  3S2D C;  3CQZ A;  1VLO A;  1YNJ A;  2ZUF A;  5L46 A;  1O2F B;  2R93 A;  2JA6 K;  3GTK A;  4KC6 A;  4A3L C;  3I4N C;  4A3G C;  3ADA C;  2KWA A;  3CQZ C;  5IYB C;  4YFX A;  3A8J A;  3AD9 C;  3IPJ A;  4C3I K;  4XSX A;  2WAQ L;  4GZY A;  3OPF A;  4ZH4 A;  3AH5 A;  1O2B A;  2CW0 A;  3L4J A;  3ERE D;  3I4M K;  4A3C C;  4KAW X;  5C3E C;  3PO3 C;  4BLB A;  4QIW L;  4YFK A;  5M3M K;  3G4A A;  1WIH A;  3RZO C;  3SZZ A;  1XZQ B;  3CAG A;  4C3J K;  3HOW K;  1WQF A;  2NVY A;  3N3Y A;  3HOU C;  1R9T K;  4KMU A;  4A3M C;  3PO2 K;  4G7O A;  3V4G A;  2D6F C;  3AD7 C;  3S2D K;  3GTQ C;  4LK1 A;  1J98 A;  5C4X C;  2VUM C;  2XCO A;  1HI9 A;  1XXB A;  1JQW A;  3LAJ A;  3M3Y K;  1DCP A;  2XCQ A;  5TMC A;  1R9T A;  1IQ0 A;  3N0B A;  2PA8 D;  5IOQ A;  2JA5 C;  1F7V A;  5HL8 A;  4KN7 A;  5E68 A;  5EGE A;  3I4N K;  4A3G K;  1Y1W A;  4BBR K;  3S1R K;  2E2J C;  5TMF A;  4Y7N K;  3HKZ L;  1ZXO A;  4BY1 C;  2NVT C;  1K83 C;  3BUE A;  2GSU A;  2FQT A;  3G4C A;  2B63 C;  3GTM K;  1DCO A;  1IL2 A;  4WJ4 A;  5M5X K;  3GDZ A;  1AB4 A;  3S16 C;  1EH1 A;  1I6H C;  4DDQ A;  5M3F K;  4GTE A;  4KB4 A;  4XSZ A;  1XPP A;  4KDD A;  3K7A K;  3S1M C;  3HOU K;  3S1M K;  4OIR A;  2R7Z K;  3M4O K;  5IYC K;  2W7V A;  2JH3 A;  5M5W K;  1PJ5 A;  3S0X A;  4A3F K;  2NVQ C;  1WCM K;  1TWH A;  3S17 C;  4J3N A;  1BDF A;  3PO3 K;  2JA5 K;  3GTJ A;  3HOV K;  1UV7 A;  1I50 C;  3AD8 C;  3HKZ D;  4GTL A;  3GTJ K;  1Y1W K;  3SZY A;  2V6T A;  1IE0 A;  3GSI A;  3HOZ K;  2JA5 A;  3A8I A;  1R9T C;  3GTK C;  4A3M K;  3GTK K;  3HOY K;  2R93 K;  4A3J K;  1VH2 A;  1L0W A;  4A3K C;  3FKI A;  4QJV B;  4BY7 C;  5CHP A;  2RGR A;  5C44 C;  3LPX A;  1WQG A;  2JA6 C;  2NVY K;  1EQR A;  4Q5S A;  1BJT A;  3GTO C;  1INN A;  2RH6 A;  1IS1 A;  3M4O C;  4Y7N C;  4BBR C;  2JA8 C;  4GTB A; 
#chains in the Genus database with same CATH homology
 3BP3 A;  1IBA A;  3IPJ A;  1O2F B;  3BP8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...