3IPJA

The crystal structure of one domain of the pts system, iiabc component from clostridium difficile
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
95
structure length
95
Chain Sequence
b'SNANKYNKIANELIKIIGEDNIISITHCATRLRVMVKDREIINDKKVEKVDEVKGVFFTSGQYQIILGTGIVNKVYAEVEKMGLKTLSKKEQDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTS system, IIabc component
publication title The crystal structure of one domain of the PTS system, IIabc component from Clostridium difficile
rcsb
source organism Clostridium difficile
molecule tags Transferase
total genus 22
structure length 95
sequence length 95
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00367 PTS_EIIB phosphotransferase system, EIIB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.60 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Glucose permease domain IIB 3ipjA01
3IPJA 3BP8C 1O2FB 1IBAA 3BP3A
chains in the Genus database with same CATH superfamily
3PO3C 2JA5A 3S1QK 4J3NA 4Y7NK 2YU9C 4GTLA 5TMCA 3H0GA 5IYDK 1VRQC 4BY7K 1WOOA 2FQOA 4BKWA 3AD8C 1INNA 2V6SA 4A3DK 1K83K 3K7AC 1F7VA 1GE9A 1WOSA 1ZYRA 4C3IC 3AD9C 1SFOA 1TWAA 4PAAA 3HOZC 1JOEA 1PJ7A 1TWFC 3S1NC 3OEPA 2JA6C 2O5JA 3CQZC 1Y1WC 4XSXA 2CFAA 3HOXK 4A3KK 2NVQK 4KMHA 3RZOC 3LAPA 4MEXA 3M3YC 1K83A 2PPBA 3GTOK 3S2DK 1IS1A 1O2BA 2CFAB 1EI6A 2E2HK 2VUMC 3HXAA 5C4JC 2EBBA 3S1RK 2P8TA 1F7UA 1I6HC 3FOFA 2RGRA 3I4NC 3S14K 5IP7K 2V6TA 5IYCK 2PHCB 3LAJA 3GTOA 2A6HA 1IL2A 4Q5SA 1PJ5A 5IYBK 2E2HA 2JA7K 4AYBL 3ERED 3GEIA 4A3CK 3S16K 1BS2A 1VH2A 3S15K 2A68A 4BXXC 3G4CA 4Y52K 3IPJA 4QIWD 3L4KA 5IP9K 1J6XA 1EQRA 3G4AA 3GTJK 1RU0A 3M4OC 2JA7A 1WQGA 3FOEA 4YFKA 2E2IK 3HOUC 2XCOA 1HI9A 1Y1VC 2NVYK 4C45A 4Q4ZA 3GTMC 4A3MC 4KARA 2D6FC 3VA7A 4BY1C 3SZYA 3HKZD 4A93C 3GTJA 2R92K 4A3IK 1TWGC 4OIQA 4OIPA 3S1MC 3AQPA 4KDDA 1J98A 4YFXA 2E2IA 2B63C 1TWHK 2Y0SL 2NVYA 5IORA 4GTDA 2Y3PA 4A3FC 4GZYA 1EK8A 3HOYC 3PO2K 3H3VL 3GTPA 5C3EK 3HOWC 2R92A 2WAQD 3A8KA 3GTKC 4BBSC 3AH5A 3JSTA 4A3JC 1TWHA 4MQ9A 1L0WA 2WB1L 2GSNA 4AH6A 1B4BA 4KB2A 1TWCK 4BBRC 3TFIA 4GTCA 4C2MK 1TWAC 4KMAA 1J6VA 3AQOA 4G7HA 1XZPA 5IOQA 2R7ZK 1EH1A 4P5AA 3GTGA 4X6AC 4G0UA 1K83C 3ADAC 1BJTA 1XZPB 2R93K 1TWCA 4XLNA 1ISEA 1DCHA 4XLPA 5C44C 2BE5A 2YU9K 5E68A 2R7ZA 1XXAA 3FHZA 4OIRA 1WCMC 5D4DA 3DXJA 3K7AK 4YFNA 3S2DC 3I4MC 1VLOA 2PA8D 4C3IK 5IOTA 3QX3A 4A3GC 4LOWA 3HOZK 1I50C 2YU9A 3S14C 1TWFK 3T01A 4MEYA 2JA6K 3S1NK 5IYCC 1Y1WK 2ZUEA 3RZOK 3M3YK 3S0XA 2NVXC 1SMYA 2PMZL 4A3EC 1UV7A 4RMFA 4C3HK 2W7VA 5IYBC 4A3BC 2VUMK 4LK1A 2JA7C 2V6UA 5C4JK 4BLBA 1XXCA 3MMLB 5TMFA 4LK0A 1TWFA 1WIHA 2A6EA 5HL8A 3OREA 2JA6A 1Y1WA 1DCOA 3TFHA 2XCQA 4GTAA 4M1XA 1ZQ1C 1I3QC 4LQYA 3GEEA 4WJ4A 4KMDA 3GTQC 3AD7C 1B4AA 2VUMA 5C4XC 5JVOA 3T02A 3EQLA 3NUHA 4JK1A 3GTLC 5FJ8K 1VGXA 4O2DA 4KN4A 2E2IC 5EGHA 1YNNA 3S17K 2NVTC 1EFWA 4A3LC 5JFEA 1R9TC 1I6VA 2E2JK 2FQTA 3GTPC 4LJZA 4NOIA 3M4OK 1YCLA 2PA8L 4KC6A 4KAWX 3HOUK 5FLMC 5M3FK 4C3JC 4KB4A 1USMA 5CHPA 4OIOA 3FKIK 1DD5A 2JA5C 1IW7A 5C3EC 1USOA 3H0GC 1BGWA 4FM9A 1TWGK 1O2FB 3Q3QA 3S1MK 4LLGA 3GTGC 2KWAA 3T00A 3S2HC 3RZDC 4GFQA 2B63K 4GTEA 3N0BA 3FKIA 4QIWL 1SFOC 1O26A 3S1QC 3TFJA 4Y7NC 3HOYK 5IYDC 3HOWK 4BY7C 2R7ZC 3GTKK 1TWGA 3LPXA 4BBSK 2JH3A 5M3MK 4A3DC 4A3JK 3GSIA 3HOVK 3TTGA 4AYBD 4WJ3M 5IOSA 4YG2A 5CJ9A 4BBRK 2JA8K 3PO3K 3BP3A 1PJ6A 5TJ3A 3HKZL 1ZVUA 4KMUA 3BP8C 3GTKA 3HOXC 4A3KC 2NVQC 1XZQA 4PABA 4X6AK 1V5VA 4G0VA 4GTFA 1ZXOA 3GTOC 1WOPA 2R93A 4G7OA 1IBAA 4XCHA 1XZQB 4G0WA 2E2HC 1IQ0A 3S1RC 2GAGC 4DDQA 1WQFA 4LR2A 1J6WA 5C44K 3CAGA 4GT9A 1X31C 5IP7C 3CQZK 5M5XK 2WAQL 1WCMK 4WILA 3N3YA 4KATA 5M5YK 3I4MK 4KN7A 4C3HC 1WSRA 1AB4A 4A3GK 4A3CC 3S16C 1I6HK 2Y0SD 1I50K 3I4NK 1XXBA 1ZBSA 3S15C 4Y52C 3CQZA 5IP9C 1WORA 5EGEA 1BDFA 3H3VD 3GEHA 1WCMA 2P5MA 1KQ4A 4ILDA 4ZH4A 1O28A 3V4GA 2RH6A 4KM9A 2NVXK 5M5WK 3GTJC 2XCRB 4A3EK 4P5BA 4A3BK 4FZBA 4KM8A 3WODA 2WB1D 1I50A 3BUEA 4XSZA 3L4JA 3S17C 4BXXK 2NVYC 4BLAA 2A69A 4KASA 4OINA 3A8IA 2GAHC 2E2JC 1WQHA 1O24A 2NVXA 1I3QK 4QJVA 3GTQK 1O2AA 2O5IA 1C0AA 2R92C 1JQWA 4A3IC 1WSVA 5C4XK 3A8JA 1G51A 3OPFA 3GTLK 4QJVB 1DCPA 1O27A 1TWHC 2NVTK 1Y1VK 1F93A 3GTMK 4A3LK 3GIRA 4A3MK 2ZFZA 3FKIC 1R9TK 4BY1K 1I3QA 4A93K 4GTBA 3PO2C 5L46A 3GTQA 3GTPK 1JVIA 2GSOA 3GTLA 3GDZA 5FLMK 1Y1VA 4C3JK 3GTMA 1HQMA 1R9TA 1TWCC 1YNJA 4A3FK 1VJEA 4P9SA 4C2MC 1O29A 2JA5K 1XPPA 4G7ZA 3H0GK 2GSUA 1YX2A 3SZZA 3GTGK 2PMZD 3HOVC 3S2HK 1F9NA 2B63A 3RZDK 1O25A 2ZUFA 2R93C 1IE0A 3N0CA 2JA8C 1SFOK 2CW0A 1TWAK
chains in the Genus database with same CATH topology
3IPJA 3BP8C 1O2FB 1IBAA 3BP3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPJ A;  3BP8 C;  1O2F B;  1IBA A;  3BP3 A; 
#chains in the Genus database with same CATH topology
 3PO3 C;  2JA5 A;  3S1Q K;  4J3N A;  4Y7N K;  2YU9 C;  4GTL A;  5TMC A;  3H0G A;  5IYD K;  1VRQ C;  4BY7 K;  1WOO A;  2FQO A;  4BKW A;  3AD8 C;  1INN A;  2V6S A;  4A3D K;  1K83 K;  3K7A C;  1F7V A;  1GE9 A;  1WOS A;  1ZYR A;  4C3I C;  3AD9 C;  1SFO A;  1TWA A;  4PAA A;  3HOZ C;  1JOE A;  1PJ7 A;  1TWF C;  3S1N C;  3OEP A;  2JA6 C;  2O5J A;  3CQZ C;  1Y1W C;  4XSX A;  2CFA A;  3HOX K;  4A3K K;  2NVQ K;  4KMH A;  3RZO C;  3LAP A;  4MEX A;  3M3Y C;  1K83 A;  2PPB A;  3GTO K;  3S2D K;  1IS1 A;  1O2B A;  2CFA B;  1EI6 A;  2E2H K;  2VUM C;  3HXA A;  5C4J C;  2EBB A;  3S1R K;  2P8T A;  1F7U A;  1I6H C;  3FOF A;  2RGR A;  3I4N C;  3S14 K;  5IP7 K;  2V6T A;  5IYC K;  2PHC B;  3LAJ A;  3GTO A;  2A6H A;  1IL2 A;  4Q5S A;  1PJ5 A;  5IYB K;  2E2H A;  2JA7 K;  4AYB L;  3ERE D;  3GEI A;  4A3C K;  3S16 K;  1BS2 A;  1VH2 A;  3S15 K;  2A68 A;  4BXX C;  3G4C A;  4Y52 K;  3IPJ A;  4QIW D;  3L4K A;  5IP9 K;  1J6X A;  1EQR A;  3G4A A;  3GTJ K;  1RU0 A;  3M4O C;  2JA7 A;  1WQG A;  3FOE A;  4YFK A;  2E2I K;  3HOU C;  2XCO A;  1HI9 A;  1Y1V C;  2NVY K;  4C45 A;  4Q4Z A;  3GTM C;  4A3M C;  4KAR A;  2D6F C;  3VA7 A;  4BY1 C;  3SZY A;  3HKZ D;  4A93 C;  3GTJ A;  2R92 K;  4A3I K;  1TWG C;  4OIQ A;  4OIP A;  3S1M C;  3AQP A;  4KDD A;  1J98 A;  4YFX A;  2E2I A;  2B63 C;  1TWH K;  2Y0S L;  2NVY A;  5IOR A;  4GTD A;  2Y3P A;  4A3F C;  4GZY A;  1EK8 A;  3HOY C;  3PO2 K;  3H3V L;  3GTP A;  5C3E K;  3HOW C;  2R92 A;  2WAQ D;  3A8K A;  3GTK C;  4BBS C;  3AH5 A;  3JST A;  4A3J C;  1TWH A;  4MQ9 A;  1L0W A;  2WB1 L;  2GSN A;  4AH6 A;  1B4B A;  4KB2 A;  1TWC K;  4BBR C;  3TFI A;  4GTC A;  4C2M K;  1TWA C;  4KMA A;  1J6V A;  3AQO A;  4G7H A;  1XZP A;  5IOQ A;  2R7Z K;  1EH1 A;  4P5A A;  3GTG A;  4X6A C;  4G0U A;  1K83 C;  3ADA C;  1BJT A;  1XZP B;  2R93 K;  1TWC A;  4XLN A;  1ISE A;  1DCH A;  4XLP A;  5C44 C;  2BE5 A;  2YU9 K;  5E68 A;  2R7Z A;  1XXA A;  3FHZ A;  4OIR A;  1WCM C;  5D4D A;  3DXJ A;  3K7A K;  4YFN A;  3S2D C;  3I4M C;  1VLO A;  2PA8 D;  4C3I K;  5IOT A;  3QX3 A;  4A3G C;  4LOW A;  3HOZ K;  1I50 C;  2YU9 A;  3S14 C;  1TWF K;  3T01 A;  4MEY A;  2JA6 K;  3S1N K;  5IYC C;  1Y1W K;  2ZUE A;  3RZO K;  3M3Y K;  3S0X A;  2NVX C;  1SMY A;  2PMZ L;  4A3E C;  1UV7 A;  4RMF A;  4C3H K;  2W7V A;  5IYB C;  4A3B C;  2VUM K;  4LK1 A;  2JA7 C;  2V6U A;  5C4J K;  4BLB A;  1XXC A;  3MML B;  5TMF A;  4LK0 A;  1TWF A;  1WIH A;  2A6E A;  5HL8 A;  3ORE A;  2JA6 A;  1Y1W A;  1DCO A;  3TFH A;  2XCQ A;  4GTA A;  4M1X A;  1ZQ1 C;  1I3Q C;  4LQY A;  3GEE A;  4WJ4 A;  4KMD A;  3GTQ C;  3AD7 C;  1B4A A;  2VUM A;  5C4X C;  5JVO A;  3T02 A;  3EQL A;  3NUH A;  4JK1 A;  3GTL C;  5FJ8 K;  1VGX A;  4O2D A;  4KN4 A;  2E2I C;  5EGH A;  1YNN A;  3S17 K;  2NVT C;  1EFW A;  4A3L C;  5JFE A;  1R9T C;  1I6V A;  2E2J K;  2FQT A;  3GTP C;  4LJZ A;  4NOI A;  3M4O K;  1YCL A;  2PA8 L;  4KC6 A;  4KAW X;  3HOU K;  5FLM C;  5M3F K;  4C3J C;  4KB4 A;  1USM A;  5CHP A;  4OIO A;  3FKI K;  1DD5 A;  2JA5 C;  1IW7 A;  5C3E C;  1USO A;  3H0G C;  1BGW A;  4FM9 A;  1TWG K;  1O2F B;  3Q3Q A;  3S1M K;  4LLG A;  3GTG C;  2KWA A;  3T00 A;  3S2H C;  3RZD C;  4GFQ A;  2B63 K;  4GTE A;  3N0B A;  3FKI A;  4QIW L;  1SFO C;  1O26 A;  3S1Q C;  3TFJ A;  4Y7N C;  3HOY K;  5IYD C;  3HOW K;  4BY7 C;  2R7Z C;  3GTK K;  1TWG A;  3LPX A;  4BBS K;  2JH3 A;  5M3M K;  4A3D C;  4A3J K;  3GSI A;  3HOV K;  3TTG A;  4AYB D;  4WJ3 M;  5IOS A;  4YG2 A;  5CJ9 A;  4BBR K;  2JA8 K;  3PO3 K;  3BP3 A;  1PJ6 A;  5TJ3 A;  3HKZ L;  1ZVU A;  4KMU A;  3BP8 C;  3GTK A;  3HOX C;  4A3K C;  2NVQ C;  1XZQ A;  4PAB A;  4X6A K;  1V5V A;  4G0V A;  4GTF A;  1ZXO A;  3GTO C;  1WOP A;  2R93 A;  4G7O A;  1IBA A;  4XCH A;  1XZQ B;  4G0W A;  2E2H C;  1IQ0 A;  3S1R C;  2GAG C;  4DDQ A;  1WQF A;  4LR2 A;  1J6W A;  5C44 K;  3CAG A;  4GT9 A;  1X31 C;  5IP7 C;  3CQZ K;  5M5X K;  2WAQ L;  1WCM K;  4WIL A;  3N3Y A;  4KAT A;  5M5Y K;  3I4M K;  4KN7 A;  4C3H C;  1WSR A;  1AB4 A;  4A3G K;  4A3C C;  3S16 C;  1I6H K;  2Y0S D;  1I50 K;  3I4N K;  1XXB A;  1ZBS A;  3S15 C;  4Y52 C;  3CQZ A;  5IP9 C;  1WOR A;  5EGE A;  1BDF A;  3H3V D;  3GEH A;  1WCM A;  2P5M A;  1KQ4 A;  4ILD A;  4ZH4 A;  1O28 A;  3V4G A;  2RH6 A;  4KM9 A;  2NVX K;  5M5W K;  3GTJ C;  2XCR B;  4A3E K;  4P5B A;  4A3B K;  4FZB A;  4KM8 A;  3WOD A;  2WB1 D;  1I50 A;  3BUE A;  4XSZ A;  3L4J A;  3S17 C;  4BXX K;  2NVY C;  4BLA A;  2A69 A;  4KAS A;  4OIN A;  3A8I A;  2GAH C;  2E2J C;  1WQH A;  1O24 A;  2NVX A;  1I3Q K;  4QJV A;  3GTQ K;  1O2A A;  2O5I A;  1C0A A;  2R92 C;  1JQW A;  4A3I C;  1WSV A;  5C4X K;  3A8J A;  1G51 A;  3OPF A;  3GTL K;  4QJV B;  1DCP A;  1O27 A;  1TWH C;  2NVT K;  1Y1V K;  1F93 A;  3GTM K;  4A3L K;  3GIR A;  4A3M K;  2ZFZ A;  3FKI C;  1R9T K;  4BY1 K;  1I3Q A;  4A93 K;  4GTB A;  3PO2 C;  5L46 A;  3GTQ A;  3GTP K;  1JVI A;  2GSO A;  3GTL A;  3GDZ A;  5FLM K;  1Y1V A;  4C3J K;  3GTM A;  1HQM A;  1R9T A;  1TWC C;  1YNJ A;  4A3F K;  1VJE A;  4P9S A;  4C2M C;  1O29 A;  2JA5 K;  1XPP A;  4G7Z A;  3H0G K;  2GSU A;  1YX2 A;  3SZZ A;  3GTG K;  2PMZ D;  3HOV C;  3S2H K;  1F9N A;  2B63 A;  3RZD K;  1O25 A;  2ZUF A;  2R93 C;  1IE0 A;  3N0C A;  2JA8 C;  1SFO K;  2CW0 A;  1TWA K; 
#chains in the Genus database with same CATH homology
 3IPJ A;  3BP8 C;  1O2F B;  1IBA A;  3BP3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...