3IPMO

Crystal structure of archaeal 20s proteasome in complex with the c-terminus of pan
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
219
Chain Sequence
b'KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAVEAHATIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEADNLGVAVQHAVLKVIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRGGHLDVLYR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome subunit alpha
publication title Interactions of PAN's C-termini with archaeal 20S proteasome and implications for the eukaryotic proteasome-ATPase interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 82
structure length 219
sequence length 229
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 3ipmO01
1YAUO 1FNTc 1Z7Qc 3JSEO 3IPMO 3JTLO 1YARO 1YA7O 1AVOB 3JRMO
chains in the Genus database with same CATH superfamily
2E87A 2R7RA 4H4KC 2IXPA 3U3FA 2Q9BA 3HJCA 1XZQA 3JSZA 1RKEB 1VMAA 2GFHA 4JJGA 4O79A 3ABMC 4MNDA 3T6GB 2R03A 1ORSC 1S05A 2M64A 2KC3A 1CPQA 3C8GD 1A0BA 4YT2A 1ZYRF 4MVMA 1ZHWA 2HZ8A 4LDKA 4NY3A 3B29A 3EH1A 4YL1A 3SXKA 4DVYP 2O9XA 5KYYB 1ZU4A 1TFOB 1YJGA 4CS7A 4JCZA 2WL8A 1M57C 1WN0A 5TJ5E 2EIJC 1VLSA 3IHUA 2IBFA 2XL6A 4P6IC 2DYSC 1OKKA 1V4AA 2HMQA 3SXMA 4CDVA 1A7DA 3GM3A 5E33A 3NYLA 3ZQVA 1FMWA 5L0GA 5AC4A 2YLDA 3DAGA 3QW1A 4YN0B 2IXNA 4FWVA 4MVUA 4HEAJ 3JRTA 3T6JA 4P9TA 4EBKA 4G7OF 3DD7A 5EGYA 3VRCA 3B0VC 1QPUA 4PFPA 2XM0A 3GEHA 3S28A 4OIRF 1AVOB 2PF4E 4L6RA 3C8GA 4GEHA 4DOZA 3V5YA 1T5OA 3LESA 5DS6A 1VYKA 4LDRA 4MTFA 1J8YF 5D92A 1E83A 5T3TA 2A0UA 2R05A 3KYJA 4JE9A 1VB5A 1PCXA 2Z15A 3K1IC 4EHPA 3LLIA 4OIPF 2XL8A 1OCOC 3Q7LA 2D4UA 4U5EE 3PHF2 3J06A 1U89A 1MMNA 1Z5ZA 1Q0DA 4PR9A 3RVZA 3DM5A 4DVZA 5L0JA 4PJMA 1UG7A 2G3KA 4N06A 1KTMA 1SMYF 3U8VA 2A0BA 2JD3A 2OOCA 1E86A 2J9UA 2A6EF 2W9YA 3LNMB 1E2XA 2OQMA 4RD9A 4O6MA 1HMOA 2Q00A 3UGPA 2PFDA 2WB7A 1OQCA 4A4AA 3EG9A 3SXYA 2BC5A 1C17M 3M15A 1IZMA 4MVOA 4Q7CA 2NSFA 2GAQA 2R02A 1OCRC 256BA 4JURI 5B1BC 4JJFA 4K1OA 3V5ZA 2HKVA 4CIHA 1QKRA 5EHHA 3ZVRA 1FNTc 2H7BA 5D91A 1V55C 3C63A 2Y3GA 4B6IA 1Z3IX 3MYFA 4LLCA 3C18A 1XZPA 2YL0A 4I3MA 3JSEO 2OKUA 3I4UA 3U3BA 3ZTMA 4BJ5A 3U0CA 2J7PD 3X1OA 4IARA 2UUHA 3GM2A 3LS1A 1D0XA 4WABA 5KYNA 1HE1A 3Q6MA 1WATA 4JTAB 4FAPB 2J9BA 5L0HA 1WGWA 1RJ9B 2XS1A 3MX3A 2W4BA 1T6IA 3ATPA 2QUPA 3QVYA 4BEMJ 4AX2A 5KYWB 2B0HA 4F4BA 4G7ZF 5A69A 1CPRA 4BJ1A 3AQCA 2EINC 2P0NA 1MMDA 1WTYA 2UUIA 4DRHB 4AL0A 2MYSA 5JT4A 2R7VA 2Q4FA 1NU7D 1T6QA 4YL3A 2KK1A 2G3VA 4NTBA 2C03A 2ETSA 2QNLA 2VH3A 3WAQA 3JTLO 4IJJA 3C8GB 1K04A 4G78A 2CGEA 2HSQA 2J7PA 1WASA 1EQ1A 3EH2A 2J45A 1BR2A 3DMDA 3HLZA 1SZIA 2VCBA 4XPWA 3TJ6A 3GANA 5BQHA 3W8IA 4E7SA 4PJNA 1Z7Qc 1H6GA 3NG1A 3ECSA 4CJOA 3ZIBA 3ZQYA 4Q4ZF 4K7BA 3OA1A 2Y3BA 2Q3TA 5JP7A 2VASA 2AVKA 3NMIA 2KSFA 3UMKA 4IGGA 3LLKA 1VTMP 2L6GA 1QLEC 2VCCA 2NG1A 4JC7A 3EG9B 4IRUA 3I5QA 4C3BA 3PDMP 3CAXA 1HMDA 3DZAA 1MNEA 1TWGA 5CIVA 5HV9A 1FFHA 2EPNA 4NTAA 3A9CA 4IB4A 3IQ5A 3N2ZB 3UMIA 4G7HF 1CGME 3T4RA 1ORJA 4J30B 3R7CA 3JT1A 3NMJA 2HUJA 2YEVA 2H7VC 4W8PA 4YWQA 5L3VA 2CNWD 3UGOA 1SYQA 1YDIA 1U6HA 3O55A 4M63A 3Q6NA 3ASNC 1J8MF 2C04A 5B1AC 3DJNB 4PFOA 3FMSA 1ORYA 3RQEA 3SZRA 2YL3A 4JIOA 3L8JA 4CBEA 4EUKB 3FDQA 1Q0MA 3F46A 2YQYA 4DRJB 4LERA 1TFKB 1AEPA 3H65A 3QTHA 3CSKA 2Y3DA 1E85A 1PV3A 3AJMA 3O10A 3DE9A 4KC9A 2EIKC 2P1AA 3PCVA 1WWPA 4NTFA 1A7VA 3QW0A 4U9DA 4QI0A 1OR2A 1OR3A 2F22A 1QVXA 3BRJA 4EKWA 2XLEA 3EJNA 1C02A 1EA8A 1T9KA 4U5FE 3ZDLA 4OIQF 2YHSA 2XLHA 1RJ9A 3NYMA 3VAYA 4C3EA 2XLMA 4D4NA 3N24A 1OW8A 5KYWA 1H7IA 1OXKA 2CNWA 2NUPA 3T6BA 3M4BA 2I15A 4BPMA 4MVZA 2GWWA 1D1AA 4CS9A 1Y4CA 4NC3A 1ZW3A 3DKAA 1ZW2A 1UFBA 3KL4A 2V26A 3U5SA 3ZSUA 2CYDA 4G0HA 5A6KA 1Z6AA 2Q7RA 1TWHA 2XLOA 3WODF 2X51A 1HW1A 1HE9A 3AG1C 3G50A 1FFTC 4J7YA 5BQGA 4XWJA 3US6A 1Q0GA 4CS8A 1GGQA 1CGOA 1YVIA 2Y3HA 3DWWA 4A2NB 4CSAA 5JUAA 4EBJA 5COGA 5B3SC 1JAFA 2ASRA 3L0IA 2LFFA 2A1DD 3RF3A 2YLGA 3MLGA 5DS5A 3E70C 4PJLA 3AOUA 1Z63A 1T6UA 5T1DB 2QY9A 2KNHA 4Z9JA 1MMAA 4XLNF 5K0IA 4KBLA 1I4ZA 2LD6A 2I8BA 2L6HA 1XWJA 4HE8D 3IQCA 4O6YA 4MVSA 5CI8A 3MYIA 2YZSA 3CQZA 1LPEA 3SXZA 2YL7A 5A6JA 3U8PA 4BJ5C 1EKYA 1A41A 2AP3A 4RDAA 1RCPA 3WG7C 3ABKC 4MW8A 3JYYA 1NZEA 3ASOC 4PJJA 1MMGA 3M1CB 4BJ6C 4JZAA 1Z23A 1K05A 2A6HF 1OW6A 4D4XA 3S9OA 3UNGC 4YT5A 1T01A 3GEIA 3HTKC 1VK5A 3FOPA 2HS5A 2Q9AA 5KYXB 1K40A 4MVQA 3IQTA 3SEOA 4BJTA 2XSEA 4CDYA 2R25A 1PD0A 2ZPAA 1D1BA 2HJ3A 4H54A 5F5HA 4AE4A 1YARO 2R7QA 3KPHA 4E17A 1JPJA 1OXBA 2KGOA 3LNRA 5COMA 4JKVA 3RQFA 1ZZPA 4I44A 4E0HA 2FAPB 2HMZA 5JSLA 4N6HA 4Z9HA 1GS9A 4XPYA 4K0DA 3TD7A 1RMVA 2QTVA 1QZXA 2XM4A 2MHRA 3AGUA 4PK4A 1LS1A 4I1MA 1V74B 2P61A 3M4CA 4ER9A 4XPXA 4XQ1A 3ABLC 3HNJA 2LK4A 2ICWG 3FAPB 2NUPB 2IXMA 3K6BA 2J0WA 3OWTA 2H8AA 2Q9CA 4YJWA 1G4US 1NBBA 2IOQA 2XLVA 3RQGA 1YAUO 4U5CE 5E3CA 4C7OB 4UDVA 1BZ4A 3GM1A 2CW0F 4X0RA 2Y39A 3DAFA 1ZHTA 2VCAA 4HFFB 2WZLA 3EFOA 3TOMA 4WJ0A 4EWCA 1E84A 1G5ZA 2R7UA 2W45A 4WGZA 3B0PA 3SYNA 1YZAA 3AG2C 1M6TA 1I4YA 2EIMC 3L34A 3FHDA 4O6NA 4NCQA 2AU5A 3IEEA 4YT4A 3EZIA 3GORA 3U9JA 4DBRA 1FMVA 4MW3A 3TOLA 1BR1A 2PX3A 1TKNA 1ZHXA 2XS8A 3ITFA 4EBBA 4XEFA 1B68A 4DBQA 3B71A 2OU6A 2J46A 4KNWA 4CIPA 2M4EA 1IW7F 2CDQA 1A7EA 3TQOA 2OCCC 3HNLA 4CDAA 1LIHA 1OW7A 2AWYA 2P6VA 4U5HA 2R7WA 1QQ3A 2QE9A 3KYIA 5CI9A 2XL4A 3I5PA 1JMWA 5F28E 3H2VA 3SNHA 2PX0A 3AG4C 3U2MA 4XLPF 1ST6A 4GQHA 4W8KA 5L3QA 3S0XA 3WHNA 1OCCC 4JRZA 3POVA 2J8WA 2KQ9A 2HV6A 4AE4B 4MQ9F 1TR2A 3CZ6A 4DRIB 4JW1A 1H9GA 3W2VA 3X2QC 4AK9A 4CS9C 2IYLD 3R2PA 3S29A 4AL1A 4IAQA 4HFKB 2B0JA 3UMHA 1NLXA 1FAPB 3DM9B 3FAJA 3M79A 5KYXA 1FTSA 1LI7A 4J32B 2AWCA 1RKCA 3EGDB 3NKDA 1NFOA 2ZXPA 4MTGA 3ZWIA 2ZD9A 2R7XA 1O87A 3AQBA 2W4MA 3L8IA 2EPKX 1S7ZA 5DS4A 3NRHA 2YRFA 2DB4A 5BQIA 2VB6A 3HNIA 1ZU5A 3KMIA 5T3WA 2PP4A 3G4XA 4CX9A 1BR4A 2DYRC 3ZC4A 5L0FA 3LJBA 1O5HA 3V7OA 1Q0KA 3EGXA 4C7OA 4PACA 4ULVA 4QI2A 3LS0A 3SP1A 2ZXRA 3Q7GA 1DOWA 1NU9C 2YVKA 3TJ5A 1YYJA 1DOVA 3EFOB 4LLEA 2XLWA 1VOMA 3CEXA 3O6XA 2L9JA 3QZCA 4Q5SF 2FFHA 2J9VA 3HNKA 5E3AA 4N4WA 4ULWA 3HKKA 1BDJB 2WVOA 1R5ID 3FOOA 2RD9A 3GWNA 5GPGB 1OCZC 2LQGA 1SR2A 5DLJA 1AUEA 3N0TA 4BEJA 1M2VB 2BE5F 1D1CA 2NUTA 2NSGA 1APCA 3K1HA 4I1OB 4E18A 2PNOA 2J0XA 3OEOA 1D0ZA 3DJUB 2GDCA 1YLMA 2OEVA 2R7OA 4NQFA 2FGYA 1EI7A 2YKZA 3C8ZA 3GODA 3EPVA 4KI2A 4U5BE 3QVZA 3LUTB 2JX0A 2RSEB 1VLTA 3F47A 1MNDA 4R32A 3ZTZA 3KKBA 4ANJA 1Y6DA 3RFYA 4U5DE 2OEXA 2P7VA 1YYXA 4OD5A 3W4YA 1HY5A 1TQGA 3GWLA 4CJGA 2MWQA 3TULA 1YZCA 3RH3A 2NPUA 5AGFA 3VM6A 1NSGB 3VYWA 5L0DA 2WZGA 3LAYA 3B9QA 3K33A 3AG3C 2XXAA 3EQLF 2OJED 2WVQA 3U9MA 2KYHA 4ONSA 1TWCA 4WGYA 2TMVP 4C3DA 2WZFA 1SF8A 4MVRA 1V54C 4FESA 4JCHA 5KYUB 1YA7O 4LACB 5A6BD 3EHNA 3JRMO 1D0YA 3IQ6A 3B0UX 4O7GA 4JEAA 3K1IA 2HFIA 1JR8A 1VYIA 4OINF 1M2OA 3C7JA 2EPLX 2IXOA 5FCLA 1PD1A 1TWAA 3EGDA 4XEKA 5AC5A 4LDQA 2R7TA 4U5GA 3V5XA 5L0CA 3NYJA 1JRAA 3MBGA 5B3IA 1L7CA 3EHMA 1LI5A 1G4WR 1KU2A 1U0BB 3VF0A 1NFNA 1FR0A 1LM3B 5FZTA 2L81A 2DGJA 2H7OA 5DQTA 5COFA 3EGXB 4MS2A 5DVWA 2KJGA 1ZHZA 4XTKA 2KW3C 2HSBA 2YWAA 2WVNA 1RKEA 2ZXWC 3JZ0A 3JYHA 1O3UA 1RXQA 3JCUQ 4IWBA 4YL0A 4JVSA 1MQVA 3UR3C 3RW0A 3L1MA 1LS4A 3RKOF 3K66A 3MFNA 2LP4A 4IAOA 4Z9IA 5JS5A 2Y69C 2A68F 3RVYA 5HSWA 3O39A 2DI3A 4BJ6A 1KNYA 5A6BA 5KYYA 2GA0A 3BEHA 3DI5A 1LE4A 2JPUA 4RBNA 4OD4A 1N1CA 3TK0A 3FXHA 3RIPA 4KNVA 1L3PA 3C62A 2LFDA 3K7DA 3NDBB 1NG1A 3ZG1A 5EK0A 2R7SA 1C03A 2OJQA 5E2QA 2NUTB 5DQZA 5JVEA 4OIOF 1M2VA 2LIGA 3DXJF 2EPOA 4JTCB 3GEEA 4QDLA 1ZVZA 4XEVA 1BBHA 1LVKA 3AGTA 3NMKA 5IY5C 4FX5A 1GQAA 2PBEA 2IM8A 1YA9A 3IPMO 3U2LA 4ZLDA 3A11A 4N6CA 1ZHYA 2BL2A 4EIYA 2OG2A 4YK5A 3LEVA 2XRHA 2L7AA 3FVYA 4ZLCA 2ZXOA 2X0CA 3G4ZA 5L0IA 1Q0FA 2LCHA 5JRAA 4U9EA 3QMKA 3S27A 1F1MA 1LE2A 4YT8A 2XXAB 3E9VA 4MTOA 3S90A 3W2WA 2CCYA 2EILC 3S84A 1LKXA 1G8XA 2QLAA 2L6FA 5JLIA 4JTDB 4P9FA 1H9TA 2YL1A 2HV7A 2R9RB 3EZHA 3KH2A 4GYTA 3DE8A 5A6AA 2G62A 4BG0A 3NKEA 1M56C 4E0IA 2YLIA 5KYUA 3RYLA 3T9OA 1R4TA 2J9WA 2VC9A 4DJ9A 1W2WA 3PMRA 1OKKD 1I5NA 2EPMX 1QSPA 2D5RB 4DXWA 3W8HA 1JOGA 3H2UA 4J7TA 4CS8C 1JPNA 2LSEA 2HJMA 1GM5A 1HW2A 5F5FA 2V3CC 1CGNA 1WOLA 2XLDA 5BUOA 4JEBA 4CSAC 3LEOA 2A69F 4E7ZA
chains in the Genus database with same CATH topology
1YAUO 1FNTc 1Z7Qc 3JSEO 3IPMO 3JTLO 1YARO 1YA7O 1AVOB 3JRMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YAU O;  1FNT c;  1Z7Q c;  3JSE O;  3IPM O;  3JTL O;  1YAR O;  1YA7 O;  1AVO B;  3JRM O; 
#chains in the Genus database with same CATH topology
 2E87 A;  2R7R A;  4H4K C;  2IXP A;  3U3F A;  2Q9B A;  3HJC A;  1XZQ A;  3JSZ A;  1RKE B;  1VMA A;  2GFH A;  4JJG A;  4O79 A;  3ABM C;  4MND A;  3T6G B;  2R03 A;  1ORS C;  1S05 A;  2M64 A;  2KC3 A;  1CPQ A;  3C8G D;  1A0B A;  4YT2 A;  1ZYR F;  4MVM A;  1ZHW A;  2HZ8 A;  4LDK A;  4NY3 A;  3B29 A;  3EH1 A;  4YL1 A;  3SXK A;  4DVY P;  2O9X A;  5KYY B;  1ZU4 A;  1TFO B;  1YJG A;  4CS7 A;  4JCZ A;  2WL8 A;  1M57 C;  1WN0 A;  5TJ5 E;  2EIJ C;  1VLS A;  3IHU A;  2IBF A;  2XL6 A;  4P6I C;  2DYS C;  1OKK A;  1V4A A;  2HMQ A;  3SXM A;  4CDV A;  1A7D A;  3GM3 A;  5E33 A;  3NYL A;  3ZQV A;  1FMW A;  5L0G A;  5AC4 A;  2YLD A;  3DAG A;  3QW1 A;  4YN0 B;  2IXN A;  4FWV A;  4MVU A;  4HEA J;  3JRT A;  3T6J A;  4P9T A;  4EBK A;  4G7O F;  3DD7 A;  5EGY A;  3VRC A;  3B0V C;  1QPU A;  4PFP A;  2XM0 A;  3GEH A;  3S28 A;  4OIR F;  1AVO B;  2PF4 E;  4L6R A;  3C8G A;  4GEH A;  4DOZ A;  3V5Y A;  1T5O A;  3LES A;  5DS6 A;  1VYK A;  4LDR A;  4MTF A;  1J8Y F;  5D92 A;  1E83 A;  5T3T A;  2A0U A;  2R05 A;  3KYJ A;  4JE9 A;  1VB5 A;  1PCX A;  2Z15 A;  3K1I C;  4EHP A;  3LLI A;  4OIP F;  2XL8 A;  1OCO C;  3Q7L A;  2D4U A;  4U5E E;  3PHF 2;  3J06 A;  1U89 A;  1MMN A;  1Z5Z A;  1Q0D A;  4PR9 A;  3RVZ A;  3DM5 A;  4DVZ A;  5L0J A;  4PJM A;  1UG7 A;  2G3K A;  4N06 A;  1KTM A;  1SMY F;  3U8V A;  2A0B A;  2JD3 A;  2OOC A;  1E86 A;  2J9U A;  2A6E F;  2W9Y A;  3LNM B;  1E2X A;  2OQM A;  4RD9 A;  4O6M A;  1HMO A;  2Q00 A;  3UGP A;  2PFD A;  2WB7 A;  1OQC A;  4A4A A;  3EG9 A;  3SXY A;  2BC5 A;  1C17 M;  3M15 A;  1IZM A;  4MVO A;  4Q7C A;  2NSF A;  2GAQ A;  2R02 A;  1OCR C;  256B A;  4JUR I;  5B1B C;  4JJF A;  4K1O A;  3V5Z A;  2HKV A;  4CIH A;  1QKR A;  5EHH A;  3ZVR A;  1FNT c;  2H7B A;  5D91 A;  1V55 C;  3C63 A;  2Y3G A;  4B6I A;  1Z3I X;  3MYF A;  4LLC A;  3C18 A;  1XZP A;  2YL0 A;  4I3M A;  3JSE O;  2OKU A;  3I4U A;  3U3B A;  3ZTM A;  4BJ5 A;  3U0C A;  2J7P D;  3X1O A;  4IAR A;  2UUH A;  3GM2 A;  3LS1 A;  1D0X A;  4WAB A;  5KYN A;  1HE1 A;  3Q6M A;  1WAT A;  4JTA B;  4FAP B;  2J9B A;  5L0H A;  1WGW A;  1RJ9 B;  2XS1 A;  3MX3 A;  2W4B A;  1T6I A;  3ATP A;  2QUP A;  3QVY A;  4BEM J;  4AX2 A;  5KYW B;  2B0H A;  4F4B A;  4G7Z F;  5A69 A;  1CPR A;  4BJ1 A;  3AQC A;  2EIN C;  2P0N A;  1MMD A;  1WTY A;  2UUI A;  4DRH B;  4AL0 A;  2MYS A;  5JT4 A;  2R7V A;  2Q4F A;  1NU7 D;  1T6Q A;  4YL3 A;  2KK1 A;  2G3V A;  4NTB A;  2C03 A;  2ETS A;  2QNL A;  2VH3 A;  3WAQ A;  3JTL O;  4IJJ A;  3C8G B;  1K04 A;  4G78 A;  2CGE A;  2HSQ A;  2J7P A;  1WAS A;  1EQ1 A;  3EH2 A;  2J45 A;  1BR2 A;  3DMD A;  3HLZ A;  1SZI A;  2VCB A;  4XPW A;  3TJ6 A;  3GAN A;  5BQH A;  3W8I A;  4E7S A;  4PJN A;  1Z7Q c;  1H6G A;  3NG1 A;  3ECS A;  4CJO A;  3ZIB A;  3ZQY A;  4Q4Z F;  4K7B A;  3OA1 A;  2Y3B A;  2Q3T A;  5JP7 A;  2VAS A;  2AVK A;  3NMI A;  2KSF A;  3UMK A;  4IGG A;  3LLK A;  1VTM P;  2L6G A;  1QLE C;  2VCC A;  2NG1 A;  4JC7 A;  3EG9 B;  4IRU A;  3I5Q A;  4C3B A;  3PDM P;  3CAX A;  1HMD A;  3DZA A;  1MNE A;  1TWG A;  5CIV A;  5HV9 A;  1FFH A;  2EPN A;  4NTA A;  3A9C A;  4IB4 A;  3IQ5 A;  3N2Z B;  3UMI A;  4G7H F;  1CGM E;  3T4R A;  1ORJ A;  4J30 B;  3R7C A;  3JT1 A;  3NMJ A;  2HUJ A;  2YEV A;  2H7V C;  4W8P A;  4YWQ A;  5L3V A;  2CNW D;  3UGO A;  1SYQ A;  1YDI A;  1U6H A;  3O55 A;  4M63 A;  3Q6N A;  3ASN C;  1J8M F;  2C04 A;  5B1A C;  3DJN B;  4PFO A;  3FMS A;  1ORY A;  3RQE A;  3SZR A;  2YL3 A;  4JIO A;  3L8J A;  4CBE A;  4EUK B;  3FDQ A;  1Q0M A;  3F46 A;  2YQY A;  4DRJ B;  4LER A;  1TFK B;  1AEP A;  3H65 A;  3QTH A;  3CSK A;  2Y3D A;  1E85 A;  1PV3 A;  3AJM A;  3O10 A;  3DE9 A;  4KC9 A;  2EIK C;  2P1A A;  3PCV A;  1WWP A;  4NTF A;  1A7V A;  3QW0 A;  4U9D A;  4QI0 A;  1OR2 A;  1OR3 A;  2F22 A;  1QVX A;  3BRJ A;  4EKW A;  2XLE A;  3EJN A;  1C02 A;  1EA8 A;  1T9K A;  4U5F E;  3ZDL A;  4OIQ F;  2YHS A;  2XLH A;  1RJ9 A;  3NYM A;  3VAY A;  4C3E A;  2XLM A;  4D4N A;  3N24 A;  1OW8 A;  5KYW A;  1H7I A;  1OXK A;  2CNW A;  2NUP A;  3T6B A;  3M4B A;  2I15 A;  4BPM A;  4MVZ A;  2GWW A;  1D1A A;  4CS9 A;  1Y4C A;  4NC3 A;  1ZW3 A;  3DKA A;  1ZW2 A;  1UFB A;  3KL4 A;  2V26 A;  3U5S A;  3ZSU A;  2CYD A;  4G0H A;  5A6K A;  1Z6A A;  2Q7R A;  1TWH A;  2XLO A;  3WOD F;  2X51 A;  1HW1 A;  1HE9 A;  3AG1 C;  3G50 A;  1FFT C;  4J7Y A;  5BQG A;  4XWJ A;  3US6 A;  1Q0G A;  4CS8 A;  1GGQ A;  1CGO A;  1YVI A;  2Y3H A;  3DWW A;  4A2N B;  4CSA A;  5JUA A;  4EBJ A;  5COG A;  5B3S C;  1JAF A;  2ASR A;  3L0I A;  2LFF A;  2A1D D;  3RF3 A;  2YLG A;  3MLG A;  5DS5 A;  3E70 C;  4PJL A;  3AOU A;  1Z63 A;  1T6U A;  5T1D B;  2QY9 A;  2KNH A;  4Z9J A;  1MMA A;  4XLN F;  5K0I A;  4KBL A;  1I4Z A;  2LD6 A;  2I8B A;  2L6H A;  1XWJ A;  4HE8 D;  3IQC A;  4O6Y A;  4MVS A;  5CI8 A;  3MYI A;  2YZS A;  3CQZ A;  1LPE A;  3SXZ A;  2YL7 A;  5A6J A;  3U8P A;  4BJ5 C;  1EKY A;  1A41 A;  2AP3 A;  4RDA A;  1RCP A;  3WG7 C;  3ABK C;  4MW8 A;  3JYY A;  1NZE A;  3ASO C;  4PJJ A;  1MMG A;  3M1C B;  4BJ6 C;  4JZA A;  1Z23 A;  1K05 A;  2A6H F;  1OW6 A;  4D4X A;  3S9O A;  3UNG C;  4YT5 A;  1T01 A;  3GEI A;  3HTK C;  1VK5 A;  3FOP A;  2HS5 A;  2Q9A A;  5KYX B;  1K40 A;  4MVQ A;  3IQT A;  3SEO A;  4BJT A;  2XSE A;  4CDY A;  2R25 A;  1PD0 A;  2ZPA A;  1D1B A;  2HJ3 A;  4H54 A;  5F5H A;  4AE4 A;  1YAR O;  2R7Q A;  3KPH A;  4E17 A;  1JPJ A;  1OXB A;  2KGO A;  3LNR A;  5COM A;  4JKV A;  3RQF A;  1ZZP A;  4I44 A;  4E0H A;  2FAP B;  2HMZ A;  5JSL A;  4N6H A;  4Z9H A;  1GS9 A;  4XPY A;  4K0D A;  3TD7 A;  1RMV A;  2QTV A;  1QZX A;  2XM4 A;  2MHR A;  3AGU A;  4PK4 A;  1LS1 A;  4I1M A;  1V74 B;  2P61 A;  3M4C A;  4ER9 A;  4XPX A;  4XQ1 A;  3ABL C;  3HNJ A;  2LK4 A;  2ICW G;  3FAP B;  2NUP B;  2IXM A;  3K6B A;  2J0W A;  3OWT A;  2H8A A;  2Q9C A;  4YJW A;  1G4U S;  1NBB A;  2IOQ A;  2XLV A;  3RQG A;  1YAU O;  4U5C E;  5E3C A;  4C7O B;  4UDV A;  1BZ4 A;  3GM1 A;  2CW0 F;  4X0R A;  2Y39 A;  3DAF A;  1ZHT A;  2VCA A;  4HFF B;  2WZL A;  3EFO A;  3TOM A;  4WJ0 A;  4EWC A;  1E84 A;  1G5Z A;  2R7U A;  2W45 A;  4WGZ A;  3B0P A;  3SYN A;  1YZA A;  3AG2 C;  1M6T A;  1I4Y A;  2EIM C;  3L34 A;  3FHD A;  4O6N A;  4NCQ A;  2AU5 A;  3IEE A;  4YT4 A;  3EZI A;  3GOR A;  3U9J A;  4DBR A;  1FMV A;  4MW3 A;  3TOL A;  1BR1 A;  2PX3 A;  1TKN A;  1ZHX A;  2XS8 A;  3ITF A;  4EBB A;  4XEF A;  1B68 A;  4DBQ A;  3B71 A;  2OU6 A;  2J46 A;  4KNW A;  4CIP A;  2M4E A;  1IW7 F;  2CDQ A;  1A7E A;  3TQO A;  2OCC C;  3HNL A;  4CDA A;  1LIH A;  1OW7 A;  2AWY A;  2P6V A;  4U5H A;  2R7W A;  1QQ3 A;  2QE9 A;  3KYI A;  5CI9 A;  2XL4 A;  3I5P A;  1JMW A;  5F28 E;  3H2V A;  3SNH A;  2PX0 A;  3AG4 C;  3U2M A;  4XLP F;  1ST6 A;  4GQH A;  4W8K A;  5L3Q A;  3S0X A;  3WHN A;  1OCC C;  4JRZ A;  3POV A;  2J8W A;  2KQ9 A;  2HV6 A;  4AE4 B;  4MQ9 F;  1TR2 A;  3CZ6 A;  4DRI B;  4JW1 A;  1H9G A;  3W2V A;  3X2Q C;  4AK9 A;  4CS9 C;  2IYL D;  3R2P A;  3S29 A;  4AL1 A;  4IAQ A;  4HFK B;  2B0J A;  3UMH A;  1NLX A;  1FAP B;  3DM9 B;  3FAJ A;  3M79 A;  5KYX A;  1FTS A;  1LI7 A;  4J32 B;  2AWC A;  1RKC A;  3EGD B;  3NKD A;  1NFO A;  2ZXP A;  4MTG A;  3ZWI A;  2ZD9 A;  2R7X A;  1O87 A;  3AQB A;  2W4M A;  3L8I A;  2EPK X;  1S7Z A;  5DS4 A;  3NRH A;  2YRF A;  2DB4 A;  5BQI A;  2VB6 A;  3HNI A;  1ZU5 A;  3KMI A;  5T3W A;  2PP4 A;  3G4X A;  4CX9 A;  1BR4 A;  2DYR C;  3ZC4 A;  5L0F A;  3LJB A;  1O5H A;  3V7O A;  1Q0K A;  3EGX A;  4C7O A;  4PAC A;  4ULV A;  4QI2 A;  3LS0 A;  3SP1 A;  2ZXR A;  3Q7G A;  1DOW A;  1NU9 C;  2YVK A;  3TJ5 A;  1YYJ A;  1DOV A;  3EFO B;  4LLE A;  2XLW A;  1VOM A;  3CEX A;  3O6X A;  2L9J A;  3QZC A;  4Q5S F;  2FFH A;  2J9V A;  3HNK A;  5E3A A;  4N4W A;  4ULW A;  3HKK A;  1BDJ B;  2WVO A;  1R5I D;  3FOO A;  2RD9 A;  3GWN A;  5GPG B;  1OCZ C;  2LQG A;  1SR2 A;  5DLJ A;  1AUE A;  3N0T A;  4BEJ A;  1M2V B;  2BE5 F;  1D1C A;  2NUT A;  2NSG A;  1APC A;  3K1H A;  4I1O B;  4E18 A;  2PNO A;  2J0X A;  3OEO A;  1D0Z A;  3DJU B;  2GDC A;  1YLM A;  2OEV A;  2R7O A;  4NQF A;  2FGY A;  1EI7 A;  2YKZ A;  3C8Z A;  3GOD A;  3EPV A;  4KI2 A;  4U5B E;  3QVZ A;  3LUT B;  2JX0 A;  2RSE B;  1VLT A;  3F47 A;  1MND A;  4R32 A;  3ZTZ A;  3KKB A;  4ANJ A;  1Y6D A;  3RFY A;  4U5D E;  2OEX A;  2P7V A;  1YYX A;  4OD5 A;  3W4Y A;  1HY5 A;  1TQG A;  3GWL A;  4CJG A;  2MWQ A;  3TUL A;  1YZC A;  3RH3 A;  2NPU A;  5AGF A;  3VM6 A;  1NSG B;  3VYW A;  5L0D A;  2WZG A;  3LAY A;  3B9Q A;  3K33 A;  3AG3 C;  2XXA A;  3EQL F;  2OJE D;  2WVQ A;  3U9M A;  2KYH A;  4ONS A;  1TWC A;  4WGY A;  2TMV P;  4C3D A;  2WZF A;  1SF8 A;  4MVR A;  1V54 C;  4FES A;  4JCH A;  5KYU B;  1YA7 O;  4LAC B;  5A6B D;  3EHN A;  3JRM O;  1D0Y A;  3IQ6 A;  3B0U X;  4O7G A;  4JEA A;  3K1I A;  2HFI A;  1JR8 A;  1VYI A;  4OIN F;  1M2O A;  3C7J A;  2EPL X;  2IXO A;  5FCL A;  1PD1 A;  1TWA A;  3EGD A;  4XEK A;  5AC5 A;  4LDQ A;  2R7T A;  4U5G A;  3V5X A;  5L0C A;  3NYJ A;  1JRA A;  3MBG A;  5B3I A;  1L7C A;  3EHM A;  1LI5 A;  1G4W R;  1KU2 A;  1U0B B;  3VF0 A;  1NFN A;  1FR0 A;  1LM3 B;  5FZT A;  2L81 A;  2DGJ A;  2H7O A;  5DQT A;  5COF A;  3EGX B;  4MS2 A;  5DVW A;  2KJG A;  1ZHZ A;  4XTK A;  2KW3 C;  2HSB A;  2YWA A;  2WVN A;  1RKE A;  2ZXW C;  3JZ0 A;  3JYH A;  1O3U A;  1RXQ A;  3JCU Q;  4IWB A;  4YL0 A;  4JVS A;  1MQV A;  3UR3 C;  3RW0 A;  3L1M A;  1LS4 A;  3RKO F;  3K66 A;  3MFN A;  2LP4 A;  4IAO A;  4Z9I A;  5JS5 A;  2Y69 C;  2A68 F;  3RVY A;  5HSW A;  3O39 A;  2DI3 A;  4BJ6 A;  1KNY A;  5A6B A;  5KYY A;  2GA0 A;  3BEH A;  3DI5 A;  1LE4 A;  2JPU A;  4RBN A;  4OD4 A;  1N1C A;  3TK0 A;  3FXH A;  3RIP A;  4KNV A;  1L3P A;  3C62 A;  2LFD A;  3K7D A;  3NDB B;  1NG1 A;  3ZG1 A;  5EK0 A;  2R7S A;  1C03 A;  2OJQ A;  5E2Q A;  2NUT B;  5DQZ A;  5JVE A;  4OIO F;  1M2V A;  2LIG A;  3DXJ F;  2EPO A;  4JTC B;  3GEE A;  4QDL A;  1ZVZ A;  4XEV A;  1BBH A;  1LVK A;  3AGT A;  3NMK A;  5IY5 C;  4FX5 A;  1GQA A;  2PBE A;  2IM8 A;  1YA9 A;  3IPM O;  3U2L A;  4ZLD A;  3A11 A;  4N6C A;  1ZHY A;  2BL2 A;  4EIY A;  2OG2 A;  4YK5 A;  3LEV A;  2XRH A;  2L7A A;  3FVY A;  4ZLC A;  2ZXO A;  2X0C A;  3G4Z A;  5L0I A;  1Q0F A;  2LCH A;  5JRA A;  4U9E A;  3QMK A;  3S27 A;  1F1M A;  1LE2 A;  4YT8 A;  2XXA B;  3E9V A;  4MTO A;  3S90 A;  3W2W A;  2CCY A;  2EIL C;  3S84 A;  1LKX A;  1G8X A;  2QLA A;  2L6F A;  5JLI A;  4JTD B;  4P9F A;  1H9T A;  2YL1 A;  2HV7 A;  2R9R B;  3EZH A;  3KH2 A;  4GYT A;  3DE8 A;  5A6A A;  2G62 A;  4BG0 A;  3NKE A;  1M56 C;  4E0I A;  2YLI A;  5KYU A;  3RYL A;  3T9O A;  1R4T A;  2J9W A;  2VC9 A;  4DJ9 A;  1W2W A;  3PMR A;  1OKK D;  1I5N A;  2EPM X;  1QSP A;  2D5R B;  4DXW A;  3W8H A;  1JOG A;  3H2U A;  4J7T A;  4CS8 C;  1JPN A;  2LSE A;  2HJM A;  1GM5 A;  1HW2 A;  5F5F A;  2V3C C;  1CGN A;  1WOL A;  2XLD A;  5BUO A;  4JEB A;  4CSA C;  3LEO A;  2A69 F;  4E7Z A; 
#chains in the Genus database with same CATH homology
 1YAU O;  1FNT c;  1Z7Q c;  3JSE O;  3IPM O;  3JTL O;  1YAR O;  1YA7 O;  1AVO B;  3JRM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...