3IPMO

Crystal structure of archaeal 20s proteasome in complex with the c-terminus of pan
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
219
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAVEAHATIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEADNLGVAVQHAVLKVIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRGGHLDVLYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Interactions of PAN's C-termini with archaeal 20S proteasome and implications for the eukaryotic proteasome-ATPase interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
molecule keywords Proteasome subunit alpha
total genus 82
structure length 219
sequence length 229
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 3ipmO01
1FNTc 3JTLO 1AVOB 1YA7O 1Z7Qc 3IPMO 1YARO 3JRMO 3JSEO 1YAUO
chains in the Genus database with same CATH superfamily
4XWJA 5COFA 1Q0DA 2IXNA 3LJBA 3TULA 5DQZA 4Q4ZF 2BC5A 5JP7A 2TMVP 3U3FA 4OIRF 5EK0A 2NUTB 2LD6A 2CGEA 3E70C 2P6VA 4KNWA 5A6BA 1YZAA 2OU6A 2H7BA 4BEMJ 5JS5A 1TKNA 2XL8A 2XS1A 2ZD9A 3LEOA 2ICWG 3MBGA 1CGNA 3IQ6A 3KPHA 4HFFB 4JTCB 4ONSA 3S27A 4MVZA 5B1BC 4Z9HA 3PCVA 1JR8A 3B29A 3RH3A 4LDQA 3ZTZA 5EGYA 4UDVA 4E0IA 1OCCC 1CPQA 5BQIA 3F47A 1PV3A 3L0IA 5B3SC 4CSAC 4AL1A 2Q3TA 3K1HA 4CJGA 3K33A 4CS9A 1D1BA 1A7DA 1NFNA 4EBBA 4B6IA 3V5ZA 3QTHA 3RYLA 1T6IA 1HW1A 2ZXPA 2KQ9A 3G4ZA 5DVWA 3SYNA 2L6GA 3ASOC 1V4AA 3W8HA 4BPMA 3W4YA 3DD7A 1EQ1A 4JIOA 4R32A 4JC7A 4EUKB 3PDMP 2H7VC 2J7PD 2A0UA 3N2ZB 4U5GA 4NCQA 3ABLC 4YL3A 2PX3A 3A9CA 3C63A 5JT4A 1EI7A 2J46A 1JAFA 1AVOB 3I5PA 2HSQA 3DMDA 1LS1A 5CI8A 2ZXRA 1BBHA 2LSEA 2PP4A 4D4NA 3UGPA 1MMDA 2BE5F 2Y3BA 3C18A 1NLXA 4PJNA 3X2QC 3S28A 4JURI 2J8WA 2O9XA 2C03A 2BL2A 3US6A 1CGME 1ORSC 1AUEA 1QSPA 1HE9A 3ITFA 1UFBA 2D4UA 3GWLA 4I3MA 4E7SA 4RDAA 4ER9A 4QDLA 1TWHA 2KYHA 2YL0A 4HEAJ 2M64A 2QY9A 2X51A 2YLGA 3EGDA 2HV6A 4ULWA 2R03A 3DKAA 3HTKC 4MTOA 4Q7CA 5GPGB 3T9OA 4E7ZA 4A4AA 3EH1A 4E17A 3RQEA 5DS4A 3L8JA 2L6FA 1RCPA 1SMYF 1RKEA 3C7JA 3GM3A 1JPJA 2LP4A 3EPVA 1FR0A 2Q4FA 2QE9A 2XL6A 2ZXWC 1K40A 1OCRC 3UNGC 4JCZA 4JJGA 2YVKA 3NDBB 2YLDA 2X0CA 2J9UA 2KK1A 4YT8A 1YAUO 5KYYA 3CQZA 3U0CA 1VK5A 1TWAA 2XLHA 4AX2A 2EPNA 4MQ9F 3IPMO 4JEBA 4EWCA 3S29A 2R7SA 2A68F 1VYIA 2B0HA 3LNMB 1A7VA 4C7OB 3W2WA 1OKKD 2P61A 4M63A 4P9TA 5CI9A 1S7ZA 2GWWA 3GM2A 1Q0GA 2VCBA 1ORJA 4DVZA 4JRZA 3S90A 4WABA 4DVYP 2RSEB 1HMOA 2W45A 2YL7A 3LNRA 1MMAA 2HJ3A 3A11A 2H8AA 1A41A 2YKZA 4ZLCA 2YL3A 5E2QA 1MNDA 4PFPA 2IXOA 3SEOA 1FNTc 1ZHTA 3SZRA 2NG1A 4YL0A 4CS8C 3WG7C 3IQ5A 4NY3A 1EA8A 1ST6A 2IOQA 1U6HA 1YJGA 2EINC 2ZXOA 2QUPA 3AG1C 4LERA 1QPUA 3KKBA 3B71A 4MVRA 5COGA 4OIOF 1QZXA 1E86A 2GDCA 5L0IA 2HKVA 1ORYA 2Q9AA 3H65A 5IY5C 2J0XA 4CBEA 4XEVA 2YWAA 4NTBA 3FMSA 5FCLA 3FDQA 3QMKA 4JEAA 2NPUA 4MVMA 1O5HA 1GM5A 5D92A 5BQGA 4YWQA 1PD1A 4K7BA 1J8MF 2OCCC 3DE9A 1KU2A 3Q7GA 5KYXA 1R4TA 5KYUA 4O79A 2EIMC 2PFDA 3ABKC 3KYIA 1QKRA 3LUTB 3FAJA 4CS9C 4U5CE 1YDIA 1JRAA 5KYWB 2WVQA 3X1OA 2FFHA 1QLEC 3B0PA 1T01A 2MWQA 2R25A 2YZSA 4Q5SF 1FFHA 3IQCA 2W9YA 1Z7Qc 1YYJA 5B1AC 3JYHA 4JCHA 3VF0A 2L6HA 3TOLA 2WZGA 1J8YF 4IGGA 2Q7RA 2VC9A 2V26A 3EZHA 3RF3A 3RFYA 1YLMA 3C8ZA 2OOCA 2Y39A 3ZQVA 4CS8A 5AGFA 4H54A 4E0HA 5L0DA 1Z23A 3RW0A 1H6GA 2GAQA 1M2VB 1LE4A 1Y6DA 2GFHA 1C02A 5JLIA 3H2VA 4XPXA 2R7TA 3QVZA 5FZTA 4A2NB 2KJGA 2NSFA 3E9VA 4IJJA 5TJ5E 1AEPA 1BZ4A 3AQCA 2Z15A 3DZAA 4FX5A 4ANJA 5JUAA 3AQBA 4J30B 1OKKA 4Z9IA 3UMHA 1M2OA 4BJ5A 1Q0MA 2J45A 3CZ6A 2B0JA 2R7OA 4L6RA 2CNWD 2XLMA 2J9BA 3EHMA 3KH2A 3H2UA 1WOLA 1ZU4A 1JMWA 1GGQA 2AU5A 2KSFA 2VH3A 2XL4A 2OKUA 4BJTA 5F5HA 4G7ZF 1LVKA 3EHNA 4U5EE 2LFFA 1SF8A 3JZ0A 4P9FA 1QQ3A 2AVKA 3EQLF 5L3VA 4BG0A 5DLJA 3FOOA 3HNJA 5L3QA 1HW2A 4O6MA 3TK0A 3EG9B 2NSGA 2J9VA 3ASNC 4U5BE 4CDYA 2XM4A 3QVYA 4XPYA 5EHHA 5HV9A 5L0CA 3K6BA 3OWTA 2Y69C 3JTLO 3HLZA 4IRUA 1G4US 4N6HA 4OD4A 3S0XA 2UUIA 1VLSA 1FMWA 3AJMA 3EGDB 4KBLA 1OW8A 4JTAB 3DM5A 1RKCA 2CW0F 4OD5A 3TOMA 3FAPB 5L0JA 1APCA 4EKWA 4MTGA 3ZVRA 3V7OA 4I1MA 2YRFA 2VASA 2XLWA 3HNKA 2L9JA 5JVEA 3LLIA 5E3AA 4G7HF 3HNIA 5T3WA 4U5DE 2C04A 2FAPB 4XEFA 2LIGA 2OJED 1CPRA 4JKVA 2P1AA 1U0BB 2Y3GA 1GQAA 2NUPA 3CAXA 1Z5ZA 3MYIA 1RJ9B 2RD9A 4WJ0A 2CNWA 2PNOA 5E3CA 3ZG1A 2D5RB 4DRHB 3NKDA 1ZZPA 4EHPA 2LK4A 3SNHA 1A0BA 1M57C 4IARA 3RVZA 3J06A 1FMVA 3U8PA 3AG2C 1H9TA 1TWGA 3ATPA 2I8BA 3SP1A 2LQGA 4LDRA 3NMJA 1BDJB 1ZU5A 4YN0B 3V5YA 1HY5A 3W8IA 4AE4B 2WZLA 3I5QA 2R7WA 4JW1A 5T1DB 2WVNA 4XLNF 3FXHA 3JT1A 1BR4A 2HV7A 4U9EA 4ULVA 3SXMA 2R7RA 3ZIBA 4W8KA 1WATA 2ETSA 2EPLX 4W8PA 5A6JA 3TJ5A 1DOWA 3O10A 3U8VA 3ECSA 4KNVA 5A6AA 1SYQA 1ZHWA 1WASA 1LI7A 1SR2A 1ZHZA 2QTVA 4PR9A 2PF4E 5AC5A 3GANA 3WODF 2XLVA 4PJLA 1RXQA 3LS0A 1WN0A 2ZPAA 2WL8A 3MFNA 1E84A 3B0VC 4DOZA 1Z6AA 1C17M 1NFOA 3VAYA 4U5FE 3K7DA 5DQTA 1OQCA 1DOVA 2MYSA 1YA9A 3U9JA 3MX3A 3U5SA 2I15A 3UR3C 4CDAA 3T6BA 2IXPA 3ZDLA 3FVYA 3O39A 3GEHA 3ZWIA 5F5FA 1MQVA 3OA1A 3KMIA 2L81A 1T9KA 4IAQA 3QZCA 1C03A 2PBEA 2QNLA 4JE9A 4IB4A 3KYJA 4XQ1A 4MVUA 2XXAB 1PCXA 1VLTA 3Q6NA 2IBFA 3DAGA 3UMIA 4C3BA 1NBBA 4CIHA 3L34A 2M4EA 1KNYA 1D0XA 4KC9A 2G3VA 3M79A 3TQOA 1M56C 4AL0A 1OXKA 4BJ6A 4NTFA 3QW1A 1XZPA 3BRJA 3U3BA 2DI3A 2A0BA 4XTKA 4EBKA 3BEHA 4MW8A 3C8GB 4K1OA 4G0HA 2HZ8A 3LS1A 3LESA 2R02A 3CEXA 2EPKX 5A69A 1D0YA 1TFKB 1JOGA 3W2VA 2XSEA 3NRHA 1TFOB 5JSLA 2EIKC 4C3DA 1GS9A 1RKEB 1G4WR 2Y3DA 4NQFA 5HSWA 3M15A 1HE1A 3UGOA 1KTMA 2XM0A 4MTFA 2ASRA 2IM8A 4XLPF 4CDVA 5BUOA 4PJMA 2DYRC 4PFOA 3M1CB 1TR2A 1LM3B 2Q00A 3IQTA 1ZYRF 3RVYA 3ZSUA 2R7VA 3NYJA 4LDKA 1E2XA 3O55A 3M4CA 2KC3A 1XWJA 4DBQA 1O3UA 1T6UA 3R7CA 4N6CA 3WHNA 3JYYA 4OINF 2R7UA 4MW3A 1D0ZA 2Y3HA 4YJWA 1FTSA 2OJQA 1I5NA 2OQMA 1U89A 4GQHA 3T4RA 5DS6A 1OW7A 2J7PA 1NU7D 3B0UX 3DAFA 2HUJA 2J9WA 3R2PA 4E18A 2R7QA 1OW6A 4JZAA 3T6JA 3JRMO 4AE4A 2KNHA 3ZTMA 4CS7A 3DJNB 3G50A 2HMQA 3OEOA 2WZFA 4U9DA 2LCHA 3RKOF 1V74B 3SXYA 3T6GB 3U2LA 3G4XA 4YT2A 2HSBA 4NTAA 1N1CA 3F46A 2R05A 1R5ID 2EIJC 2KGOA 2LFDA 1L3PA 1WTYA 3C8GD 1ZW2A 4C3EA 3LLKA 3UMKA 2E87A 2YL1A 1Z3IX 4IWBA 3U9MA 1IZMA 3NG1A 4WGYA 1Y4CA 1YA7O 3K1IA 4QI0A 3NMIA 3Q6MA 3VYWA 1S05A 4PACA 1LI5A 2OEXA 3I4UA 1LIHA 3K1IC 3S9OA 2V3CC 2HFIA 3NYLA 2AWCA 5BQHA 1OR2A 3M4BA 2XLEA 3DI5A 3IEEA 5T3TA 1VYKA 2MHRA 2VB6A 2DYSC 4YT5A 1WGWA 3AGTA 5A6BD 2EPOA 1B68A 1T5OA 4G78A 1VOMA 1RJ9A 1MMGA 2CCYA 3U2MA 2NUPB 4MS2A 3TD7A 4FAPB 5B3IA 2W4MA 3FOPA 1OR3A 3HNLA 1ZW3A 4ZLDA 256BA 3V5XA 5L0HA 1LPEA 4MVSA 2NUTA 4J7YA 1BR1A 4EBJA 5KYYB 1UG7A 4MVOA 1SZIA 3SXKA 2DGJA 3AOUA 5L0FA 1V55C 4FWVA 3EH2A 4J32B 2J0WA 4O6YA 1WWPA 5KYNA 2CDQA 2FGYA 1NZEA 1F1MA 4DRIB 4HFKB 3MLGA 3EG9A 1JPNA 2A69F 5E33A 1YZCA 2XXAA 1OXBA 3PMRA 3PHF2 3S84A 5CIVA 3HJCA 2YLIA 1D1AA 4PK4A 1E83A 2AWYA 2H7OA 3ZQYA 4D4XA 5KYUB 1D1CA 3CSKA 5D91A 2A1DD 1XZQA 1VTMP 2XLDA 1BR2A 3GORA 1LE2A 5AC4A 4QI2A 1V54C 4YL1A 1RMVA 1YARO 1IW7F 1M2VA 3GEEA 1G5ZA 4JJFA 4RBNA 1OCZC 1OCOC 1QVXA 1ZHXA 4CX9A 3NKEA 2HMZA 3Q7LA 4MNDA 4KI2A 2XLOA 4O7GA 4CSAA 3EFOB 3EZIA 1LS4A 4GEHA 2JX0A 3K66A 4OIQF 2G3KA 4NC3A 4BJ1A 1TWCA 4O6NA 2YEVA 3AGUA 3AG4C 3IHUA 3POVA 1FAPB 4LACB 2IXMA 3DJUB 4FESA 3HKKA 3LEVA 3NYMA 2JD3A 2OG2A 4J7TA 4DBRA 1E85A 2PX0A 1K04A 2VCCA 1Q0FA 2A6EF 3JSZA 3VM6A 1MNEA 1W2WA 3QW0A 1M6TA 1EKYA 3L1MA 3N0TA 2QLAA 4K0DA 1H9GA 4XEKA 2L7AA 2VCAA 3GM1A 4P6IC 2HS5A 4BJ5C 4CJOA 2Q9CA 1I4YA 3GODA 4LLEA 5COMA 5A6KA 1H7IA 5L0GA 2HJMA 4XPWA 2GA0A 1VMAA 2WB7A 1YVIA 3AG3C 1MMNA 1CGOA 1I4ZA 3LAYA 4GYTA 3MYFA 3WAQA 4BJ6C 3EGXB 4X0RA 3B9QA 3DE8A 2YQYA 3JRTA 5F28E 5JRAA 2EILC 4DRJB 1Q0KA 3L8IA 2AP3A 4N4WA 4F4BA 5KYXB 4LLCA 4JVSA 2CYDA 1NG1A 1NSGB 4JTDB 2W4BA 2IYLD 1HMDA 3SXZA 2KW3C 2YHSA 3TJ6A 1PD0A 2A6HF 2Q9BA 4H4KC 4EIYA 3ABMC 3EFOA 2UUHA 4DXWA 4HE8D 3DM9B 5DS5A 4YK5A 1ZVZA 1ZHYA 4G7OF 4MVQA 3JCUQ 3ZC4A 3C62A 3DXJF 2DB4A 2JPUA 2P0NA 3RQGA 4DJ9A 1O87A 2XS8A 3NMKA 4OIPF 2EPMX 4Z9JA 1L7CA 2G62A 2R7XA 1TQGA 3JSEO 5KYWA 3C8GA 1K05A 3FHDA 3N24A 4U5HA 3VRCA 5K0IA 4WGZA 2OEVA 3RIPA 1NU9C 2P7VA 4BEJA 4RD9A 1T6QA 1Z63A 3EGXA 2F22A 2R9RB 3GEIA 2XRHA 3EJNA 3KL4A 4I1OB 4N06A 1LKXA 4C7OA 2WVOA 4PJJA 1VB5A 4AK9A 4IAOA 3O6XA 4CIPA 1FFTC 3DWWA 1G8XA 4YT4A 3GWNA 4I44A 1A7EA 3RQFA 1YYXA
chains in the Genus database with same CATH topology
1FNTc 3JTLO 1AVOB 1YA7O 1Z7Qc 3IPMO 1YARO 3JRMO 3JSEO 1YAUO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FNT c;  3JTL O;  1AVO B;  1YA7 O;  1Z7Q c;  3IPM O;  1YAR O;  3JRM O;  3JSE O;  1YAU O; 
#chains in the Genus database with same CATH topology
 4XWJ A;  5COF A;  1Q0D A;  2IXN A;  3LJB A;  3TUL A;  5DQZ A;  4Q4Z F;  2BC5 A;  5JP7 A;  2TMV P;  3U3F A;  4OIR F;  5EK0 A;  2NUT B;  2LD6 A;  2CGE A;  3E70 C;  2P6V A;  4KNW A;  5A6B A;  1YZA A;  2OU6 A;  2H7B A;  4BEM J;  5JS5 A;  1TKN A;  2XL8 A;  2XS1 A;  2ZD9 A;  3LEO A;  2ICW G;  3MBG A;  1CGN A;  3IQ6 A;  3KPH A;  4HFF B;  4JTC B;  4ONS A;  3S27 A;  4MVZ A;  5B1B C;  4Z9H A;  3PCV A;  1JR8 A;  3B29 A;  3RH3 A;  4LDQ A;  3ZTZ A;  5EGY A;  4UDV A;  4E0I A;  1OCC C;  1CPQ A;  5BQI A;  3F47 A;  1PV3 A;  3L0I A;  5B3S C;  4CSA C;  4AL1 A;  2Q3T A;  3K1H A;  4CJG A;  3K33 A;  4CS9 A;  1D1B A;  1A7D A;  1NFN A;  4EBB A;  4B6I A;  3V5Z A;  3QTH A;  3RYL A;  1T6I A;  1HW1 A;  2ZXP A;  2KQ9 A;  3G4Z A;  5DVW A;  3SYN A;  2L6G A;  3ASO C;  1V4A A;  3W8H A;  4BPM A;  3W4Y A;  3DD7 A;  1EQ1 A;  4JIO A;  4R32 A;  4JC7 A;  4EUK B;  3PDM P;  2H7V C;  2J7P D;  2A0U A;  3N2Z B;  4U5G A;  4NCQ A;  3ABL C;  4YL3 A;  2PX3 A;  3A9C A;  3C63 A;  5JT4 A;  1EI7 A;  2J46 A;  1JAF A;  1AVO B;  3I5P A;  2HSQ A;  3DMD A;  1LS1 A;  5CI8 A;  2ZXR A;  1BBH A;  2LSE A;  2PP4 A;  4D4N A;  3UGP A;  1MMD A;  2BE5 F;  2Y3B A;  3C18 A;  1NLX A;  4PJN A;  3X2Q C;  3S28 A;  4JUR I;  2J8W A;  2O9X A;  2C03 A;  2BL2 A;  3US6 A;  1CGM E;  1ORS C;  1AUE A;  1QSP A;  1HE9 A;  3ITF A;  1UFB A;  2D4U A;  3GWL A;  4I3M A;  4E7S A;  4RDA A;  4ER9 A;  4QDL A;  1TWH A;  2KYH A;  2YL0 A;  4HEA J;  2M64 A;  2QY9 A;  2X51 A;  2YLG A;  3EGD A;  2HV6 A;  4ULW A;  2R03 A;  3DKA A;  3HTK C;  4MTO A;  4Q7C A;  5GPG B;  3T9O A;  4E7Z A;  4A4A A;  3EH1 A;  4E17 A;  3RQE A;  5DS4 A;  3L8J A;  2L6F A;  1RCP A;  1SMY F;  1RKE A;  3C7J A;  3GM3 A;  1JPJ A;  2LP4 A;  3EPV A;  1FR0 A;  2Q4F A;  2QE9 A;  2XL6 A;  2ZXW C;  1K40 A;  1OCR C;  3UNG C;  4JCZ A;  4JJG A;  2YVK A;  3NDB B;  2YLD A;  2X0C A;  2J9U A;  2KK1 A;  4YT8 A;  1YAU O;  5KYY A;  3CQZ A;  3U0C A;  1VK5 A;  1TWA A;  2XLH A;  4AX2 A;  2EPN A;  4MQ9 F;  3IPM O;  4JEB A;  4EWC A;  3S29 A;  2R7S A;  2A68 F;  1VYI A;  2B0H A;  3LNM B;  1A7V A;  4C7O B;  3W2W A;  1OKK D;  2P61 A;  4M63 A;  4P9T A;  5CI9 A;  1S7Z A;  2GWW A;  3GM2 A;  1Q0G A;  2VCB A;  1ORJ A;  4DVZ A;  4JRZ A;  3S90 A;  4WAB A;  4DVY P;  2RSE B;  1HMO A;  2W45 A;  2YL7 A;  3LNR A;  1MMA A;  2HJ3 A;  3A11 A;  2H8A A;  1A41 A;  2YKZ A;  4ZLC A;  2YL3 A;  5E2Q A;  1MND A;  4PFP A;  2IXO A;  3SEO A;  1FNT c;  1ZHT A;  3SZR A;  2NG1 A;  4YL0 A;  4CS8 C;  3WG7 C;  3IQ5 A;  4NY3 A;  1EA8 A;  1ST6 A;  2IOQ A;  1U6H A;  1YJG A;  2EIN C;  2ZXO A;  2QUP A;  3AG1 C;  4LER A;  1QPU A;  3KKB A;  3B71 A;  4MVR A;  5COG A;  4OIO F;  1QZX A;  1E86 A;  2GDC A;  5L0I A;  2HKV A;  1ORY A;  2Q9A A;  3H65 A;  5IY5 C;  2J0X A;  4CBE A;  4XEV A;  2YWA A;  4NTB A;  3FMS A;  5FCL A;  3FDQ A;  3QMK A;  4JEA A;  2NPU A;  4MVM A;  1O5H A;  1GM5 A;  5D92 A;  5BQG A;  4YWQ A;  1PD1 A;  4K7B A;  1J8M F;  2OCC C;  3DE9 A;  1KU2 A;  3Q7G A;  5KYX A;  1R4T A;  5KYU A;  4O79 A;  2EIM C;  2PFD A;  3ABK C;  3KYI A;  1QKR A;  3LUT B;  3FAJ A;  4CS9 C;  4U5C E;  1YDI A;  1JRA A;  5KYW B;  2WVQ A;  3X1O A;  2FFH A;  1QLE C;  3B0P A;  1T01 A;  2MWQ A;  2R25 A;  2YZS A;  4Q5S F;  1FFH A;  3IQC A;  2W9Y A;  1Z7Q c;  1YYJ A;  5B1A C;  3JYH A;  4JCH A;  3VF0 A;  2L6H A;  3TOL A;  2WZG A;  1J8Y F;  4IGG A;  2Q7R A;  2VC9 A;  2V26 A;  3EZH A;  3RF3 A;  3RFY A;  1YLM A;  3C8Z A;  2OOC A;  2Y39 A;  3ZQV A;  4CS8 A;  5AGF A;  4H54 A;  4E0H A;  5L0D A;  1Z23 A;  3RW0 A;  1H6G A;  2GAQ A;  1M2V B;  1LE4 A;  1Y6D A;  2GFH A;  1C02 A;  5JLI A;  3H2V A;  4XPX A;  2R7T A;  3QVZ A;  5FZT A;  4A2N B;  2KJG A;  2NSF A;  3E9V A;  4IJJ A;  5TJ5 E;  1AEP A;  1BZ4 A;  3AQC A;  2Z15 A;  3DZA A;  4FX5 A;  4ANJ A;  5JUA A;  3AQB A;  4J30 B;  1OKK A;  4Z9I A;  3UMH A;  1M2O A;  4BJ5 A;  1Q0M A;  2J45 A;  3CZ6 A;  2B0J A;  2R7O A;  4L6R A;  2CNW D;  2XLM A;  2J9B A;  3EHM A;  3KH2 A;  3H2U A;  1WOL A;  1ZU4 A;  1JMW A;  1GGQ A;  2AU5 A;  2KSF A;  2VH3 A;  2XL4 A;  2OKU A;  4BJT A;  5F5H A;  4G7Z F;  1LVK A;  3EHN A;  4U5E E;  2LFF A;  1SF8 A;  3JZ0 A;  4P9F A;  1QQ3 A;  2AVK A;  3EQL F;  5L3V A;  4BG0 A;  5DLJ A;  3FOO A;  3HNJ A;  5L3Q A;  1HW2 A;  4O6M A;  3TK0 A;  3EG9 B;  2NSG A;  2J9V A;  3ASN C;  4U5B E;  4CDY A;  2XM4 A;  3QVY A;  4XPY A;  5EHH A;  5HV9 A;  5L0C A;  3K6B A;  3OWT A;  2Y69 C;  3JTL O;  3HLZ A;  4IRU A;  1G4U S;  4N6H A;  4OD4 A;  3S0X A;  2UUI A;  1VLS A;  1FMW A;  3AJM A;  3EGD B;  4KBL A;  1OW8 A;  4JTA B;  3DM5 A;  1RKC A;  2CW0 F;  4OD5 A;  3TOM A;  3FAP B;  5L0J A;  1APC A;  4EKW A;  4MTG A;  3ZVR A;  3V7O A;  4I1M A;  2YRF A;  2VAS A;  2XLW A;  3HNK A;  2L9J A;  5JVE A;  3LLI A;  5E3A A;  4G7H F;  3HNI A;  5T3W A;  4U5D E;  2C04 A;  2FAP B;  4XEF A;  2LIG A;  2OJE D;  1CPR A;  4JKV A;  2P1A A;  1U0B B;  2Y3G A;  1GQA A;  2NUP A;  3CAX A;  1Z5Z A;  3MYI A;  1RJ9 B;  2RD9 A;  4WJ0 A;  2CNW A;  2PNO A;  5E3C A;  3ZG1 A;  2D5R B;  4DRH B;  3NKD A;  1ZZP A;  4EHP A;  2LK4 A;  3SNH A;  1A0B A;  1M57 C;  4IAR A;  3RVZ A;  3J06 A;  1FMV A;  3U8P A;  3AG2 C;  1H9T A;  1TWG A;  3ATP A;  2I8B A;  3SP1 A;  2LQG A;  4LDR A;  3NMJ A;  1BDJ B;  1ZU5 A;  4YN0 B;  3V5Y A;  1HY5 A;  3W8I A;  4AE4 B;  2WZL A;  3I5Q A;  2R7W A;  4JW1 A;  5T1D B;  2WVN A;  4XLN F;  3FXH A;  3JT1 A;  1BR4 A;  2HV7 A;  4U9E A;  4ULV A;  3SXM A;  2R7R A;  3ZIB A;  4W8K A;  1WAT A;  2ETS A;  2EPL X;  4W8P A;  5A6J A;  3TJ5 A;  1DOW A;  3O10 A;  3U8V A;  3ECS A;  4KNV A;  5A6A A;  1SYQ A;  1ZHW A;  1WAS A;  1LI7 A;  1SR2 A;  1ZHZ A;  2QTV A;  4PR9 A;  2PF4 E;  5AC5 A;  3GAN A;  3WOD F;  2XLV A;  4PJL A;  1RXQ A;  3LS0 A;  1WN0 A;  2ZPA A;  2WL8 A;  3MFN A;  1E84 A;  3B0V C;  4DOZ A;  1Z6A A;  1C17 M;  1NFO A;  3VAY A;  4U5F E;  3K7D A;  5DQT A;  1OQC A;  1DOV A;  2MYS A;  1YA9 A;  3U9J A;  3MX3 A;  3U5S A;  2I15 A;  3UR3 C;  4CDA A;  3T6B A;  2IXP A;  3ZDL A;  3FVY A;  3O39 A;  3GEH A;  3ZWI A;  5F5F A;  1MQV A;  3OA1 A;  3KMI A;  2L81 A;  1T9K A;  4IAQ A;  3QZC A;  1C03 A;  2PBE A;  2QNL A;  4JE9 A;  4IB4 A;  3KYJ A;  4XQ1 A;  4MVU A;  2XXA B;  1PCX A;  1VLT A;  3Q6N A;  2IBF A;  3DAG A;  3UMI A;  4C3B A;  1NBB A;  4CIH A;  3L34 A;  2M4E A;  1KNY A;  1D0X A;  4KC9 A;  2G3V A;  3M79 A;  3TQO A;  1M56 C;  4AL0 A;  1OXK A;  4BJ6 A;  4NTF A;  3QW1 A;  1XZP A;  3BRJ A;  3U3B A;  2DI3 A;  2A0B A;  4XTK A;  4EBK A;  3BEH A;  4MW8 A;  3C8G B;  4K1O A;  4G0H A;  2HZ8 A;  3LS1 A;  3LES A;  2R02 A;  3CEX A;  2EPK X;  5A69 A;  1D0Y A;  1TFK B;  1JOG A;  3W2V A;  2XSE A;  3NRH A;  1TFO B;  5JSL A;  2EIK C;  4C3D A;  1GS9 A;  1RKE B;  1G4W R;  2Y3D A;  4NQF A;  5HSW A;  3M15 A;  1HE1 A;  3UGO A;  1KTM A;  2XM0 A;  4MTF A;  2ASR A;  2IM8 A;  4XLP F;  4CDV A;  5BUO A;  4PJM A;  2DYR C;  4PFO A;  3M1C B;  1TR2 A;  1LM3 B;  2Q00 A;  3IQT A;  1ZYR F;  3RVY A;  3ZSU A;  2R7V A;  3NYJ A;  4LDK A;  1E2X A;  3O55 A;  3M4C A;  2KC3 A;  1XWJ A;  4DBQ A;  1O3U A;  1T6U A;  3R7C A;  4N6C A;  3WHN A;  3JYY A;  4OIN F;  2R7U A;  4MW3 A;  1D0Z A;  2Y3H A;  4YJW A;  1FTS A;  2OJQ A;  1I5N A;  2OQM A;  1U89 A;  4GQH A;  3T4R A;  5DS6 A;  1OW7 A;  2J7P A;  1NU7 D;  3B0U X;  3DAF A;  2HUJ A;  2J9W A;  3R2P A;  4E18 A;  2R7Q A;  1OW6 A;  4JZA A;  3T6J A;  3JRM O;  4AE4 A;  2KNH A;  3ZTM A;  4CS7 A;  3DJN B;  3G50 A;  2HMQ A;  3OEO A;  2WZF A;  4U9D A;  2LCH A;  3RKO F;  1V74 B;  3SXY A;  3T6G B;  3U2L A;  3G4X A;  4YT2 A;  2HSB A;  4NTA A;  1N1C A;  3F46 A;  2R05 A;  1R5I D;  2EIJ C;  2KGO A;  2LFD A;  1L3P A;  1WTY A;  3C8G D;  1ZW2 A;  4C3E A;  3LLK A;  3UMK A;  2E87 A;  2YL1 A;  1Z3I X;  4IWB A;  3U9M A;  1IZM A;  3NG1 A;  4WGY A;  1Y4C A;  1YA7 O;  3K1I A;  4QI0 A;  3NMI A;  3Q6M A;  3VYW A;  1S05 A;  4PAC A;  1LI5 A;  2OEX A;  3I4U A;  1LIH A;  3K1I C;  3S9O A;  2V3C C;  2HFI A;  3NYL A;  2AWC A;  5BQH A;  1OR2 A;  3M4B A;  2XLE A;  3DI5 A;  3IEE A;  5T3T A;  1VYK A;  2MHR A;  2VB6 A;  2DYS C;  4YT5 A;  1WGW A;  3AGT A;  5A6B D;  2EPO A;  1B68 A;  1T5O A;  4G78 A;  1VOM A;  1RJ9 A;  1MMG A;  2CCY A;  3U2M A;  2NUP B;  4MS2 A;  3TD7 A;  4FAP B;  5B3I A;  2W4M A;  3FOP A;  1OR3 A;  3HNL A;  1ZW3 A;  4ZLD A;  256B A;  3V5X A;  5L0H A;  1LPE A;  4MVS A;  2NUT A;  4J7Y A;  1BR1 A;  4EBJ A;  5KYY B;  1UG7 A;  4MVO A;  1SZI A;  3SXK A;  2DGJ A;  3AOU A;  5L0F A;  1V55 C;  4FWV A;  3EH2 A;  4J32 B;  2J0W A;  4O6Y A;  1WWP A;  5KYN A;  2CDQ A;  2FGY A;  1NZE A;  1F1M A;  4DRI B;  4HFK B;  3MLG A;  3EG9 A;  1JPN A;  2A69 F;  5E33 A;  1YZC A;  2XXA A;  1OXB A;  3PMR A;  3PHF 2;  3S84 A;  5CIV A;  3HJC A;  2YLI A;  1D1A A;  4PK4 A;  1E83 A;  2AWY A;  2H7O A;  3ZQY A;  4D4X A;  5KYU B;  1D1C A;  3CSK A;  5D91 A;  2A1D D;  1XZQ A;  1VTM P;  2XLD A;  1BR2 A;  3GOR A;  1LE2 A;  5AC4 A;  4QI2 A;  1V54 C;  4YL1 A;  1RMV A;  1YAR O;  1IW7 F;  1M2V A;  3GEE A;  1G5Z A;  4JJF A;  4RBN A;  1OCZ C;  1OCO C;  1QVX A;  1ZHX A;  4CX9 A;  3NKE A;  2HMZ A;  3Q7L A;  4MND A;  4KI2 A;  2XLO A;  4O7G A;  4CSA A;  3EFO B;  3EZI A;  1LS4 A;  4GEH A;  2JX0 A;  3K66 A;  4OIQ F;  2G3K A;  4NC3 A;  4BJ1 A;  1TWC A;  4O6N A;  2YEV A;  3AGU A;  3AG4 C;  3IHU A;  3POV A;  1FAP B;  4LAC B;  2IXM A;  3DJU B;  4FES A;  3HKK A;  3LEV A;  3NYM A;  2JD3 A;  2OG2 A;  4J7T A;  4DBR A;  1E85 A;  2PX0 A;  1K04 A;  2VCC A;  1Q0F A;  2A6E F;  3JSZ A;  3VM6 A;  1MNE A;  1W2W A;  3QW0 A;  1M6T A;  1EKY A;  3L1M A;  3N0T A;  2QLA A;  4K0D A;  1H9G A;  4XEK A;  2L7A A;  2VCA A;  3GM1 A;  4P6I C;  2HS5 A;  4BJ5 C;  4CJO A;  2Q9C A;  1I4Y A;  3GOD A;  4LLE A;  5COM A;  5A6K A;  1H7I A;  5L0G A;  2HJM A;  4XPW A;  2GA0 A;  1VMA A;  2WB7 A;  1YVI A;  3AG3 C;  1MMN A;  1CGO A;  1I4Z A;  3LAY A;  4GYT A;  3MYF A;  3WAQ A;  4BJ6 C;  3EGX B;  4X0R A;  3B9Q A;  3DE8 A;  2YQY A;  3JRT A;  5F28 E;  5JRA A;  2EIL C;  4DRJ B;  1Q0K A;  3L8I A;  2AP3 A;  4N4W A;  4F4B A;  5KYX B;  4LLC A;  4JVS A;  2CYD A;  1NG1 A;  1NSG B;  4JTD B;  2W4B A;  2IYL D;  1HMD A;  3SXZ A;  2KW3 C;  2YHS A;  3TJ6 A;  1PD0 A;  2A6H F;  2Q9B A;  4H4K C;  4EIY A;  3ABM C;  3EFO A;  2UUH A;  4DXW A;  4HE8 D;  3DM9 B;  5DS5 A;  4YK5 A;  1ZVZ A;  1ZHY A;  4G7O F;  4MVQ A;  3JCU Q;  3ZC4 A;  3C62 A;  3DXJ F;  2DB4 A;  2JPU A;  2P0N A;  3RQG A;  4DJ9 A;  1O87 A;  2XS8 A;  3NMK A;  4OIP F;  2EPM X;  4Z9J A;  1L7C A;  2G62 A;  2R7X A;  1TQG A;  3JSE O;  5KYW A;  3C8G A;  1K05 A;  3FHD A;  3N24 A;  4U5H A;  3VRC A;  5K0I A;  4WGZ A;  2OEV A;  3RIP A;  1NU9 C;  2P7V A;  4BEJ A;  4RD9 A;  1T6Q A;  1Z63 A;  3EGX A;  2F22 A;  2R9R B;  3GEI A;  2XRH A;  3EJN A;  3KL4 A;  4I1O B;  4N06 A;  1LKX A;  4C7O A;  2WVO A;  4PJJ A;  1VB5 A;  4AK9 A;  4IAO A;  3O6X A;  4CIP A;  1FFT C;  3DWW A;  1G8X A;  4YT4 A;  3GWN A;  4I44 A;  1A7E A;  3RQF A;  1YYX A; 
#chains in the Genus database with same CATH homology
 1FNT c;  3JTL O;  1AVO B;  1YA7 O;  1Z7Q c;  3IPM O;  1YAR O;  3JRM O;  3JSE O;  1YAU O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...