3IPMO

Crystal structure of archaeal 20s proteasome in complex with the c-terminus of pan
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
219
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAVEAHATIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEADNLGVAVQHAVLKVIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRGGHLDVLYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome subunit alpha
publication title Interactions of PAN's C-termini with archaeal 20S proteasome and implications for the eukaryotic proteasome-ATPase interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 82
structure length 219
sequence length 229
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 3ipmO01
3IPMO 1FNTc 1YARO 1Z7Qc 1YAUO 1YA7O 1AVOB 3JTLO 3JSEO 3JRMO
chains in the Genus database with same CATH superfamily
3IPMO 2JX0A 3U8PA 1ZYRF 3KYJA 3EQLF 4MTOA 1E83A 1YYJA 1A7EA 2XL6A 1UFBA 1PD1A 4RBNA 1NU7D 3PHF2 5FCLA 2XLHA 1IZMA 3ZSUA 1FR0A 4G78A 1DOVA 4P9FA 3HKKA 3IQCA 4DBQA 1NZEA 1UG7A 1TWAA 1JMWA 3AGUA 4XLNF 3GORA 4JVSA 3O10A 1BR4A 4DJ9A 4KNVA 2XLVA 2ZXOA 3L8JA 3DE8A 3WAQA 2ETSA 3T9OA 5B1AC 2EILC 1NFOA 3DE9A 3DMDA 1Y4CA 4HFKB 3ASNC 5TJ5E 4LDKA 2QNLA 2VCBA 4CX9A 4A4AA 2P61A 4YT8A 2AWCA 2HKVA 1OR2A 2QY9A 1QSPA 3KL4A 3MLGA 4R32A 3RH3A 3JZ0A 3ZG1A 2XLDA 4WABA 1I4YA 1PCXA 3I5QA 2HUJA 5DLJA 2XXAA 3GEHA 2R7RA 2YWAA 5T3WA 1YA9A 1HY5A 1A7VA 2R7OA 2NG1A 4IARA 3SNHA 4MNDA 4O7GA 5L0GA 2OCCC 4QDLA 2R9RB 3JRTA 5DS4A 3J06A 1XWJA 3NMIA 5E3CA 1FNTc 2PNOA 2OG2A 4XEFA 5AC4A 1D1AA 1KNYA 2QLAA 2AVKA 1PD0A 2HJMA 4BJ6C 4K1OA 2HMQA 4EHPA 1I5NA 2HS5A 4WGZA 1E85A 1KU2A 1NFNA 2YL0A 3W2WA 5D92A 1JOGA 4KC9A 1LE2A 2CNWA 4AK9A 4I1MA 1MMDA 1M2VA 1D1BA 3SYNA 4D4NA 1ZHTA 1OW8A 1NBBA 2XLOA 1VB5A 3NYLA 2OOCA 2YQYA 2YHSA 2D4UA 1NSGB 3GM1A 2WZFA 1QQ3A 3C7JA 4O6YA 4U5CE 3EH1A 3UMKA 1K40A 1YVIA 5COFA 3AG3C 3UNGC 4PFPA 2JD3A 2L7AA 2NSFA 5B3IA 1YZAA 1QVXA 3QMKA 2V26A 3WG7C 3SXMA 1RKEA 1DOWA 2G3KA 2KGOA 3W8IA 1BBHA 1FMWA 2EPNA 3KMIA 4IWBA 3EHNA 3ABMC 2TMVP 2V3CC 2DGJA 2J9BA 4ANJA 3IQ6A 1ST6A 1GS9A 4XPYA 4U5EE 3U5SA 1SF8A 4MVSA 4YL3A 1RMVA 3W2VA 2IOQA 5L0IA 3JYYA 2ZD9A 5F5HA 1ZU4A 4CDYA 1ZW3A 5E2QA 1HMDA 3RW0A 4CS9C 5F5FA 3UGPA 2J9VA 2CCYA 2Y3DA 1K04A 1FFHA 1ZHZA 4YT4A 1FTSA 1K05A 4JURI 5BQHA 1YZCA 3MBGA 3HLZA 4HFFB 3VF0A 2YLDA 3DAGA 2HV6A 2EINC 2P7VA 3M79A 2MHRA 3DWWA 3DXJF 4J7TA 1L7CA 1QKRA 2A0UA 5A6AA 3RVYA 2C03A 5GPGB 2PX3A 4OD5A 5CI8A 1Q0DA 1VLSA 3ABKC 3IQTA 5AGFA 1U6HA 4AL1A 3EGXA 5KYUB 2IXPA 4H54A 1RJ9A 1V74B 3C8ZA 1NLXA 4C7OA 4GQHA 5CIVA 2A1DD 4E17A 3C63A 4ZLDA 3ZWIA 3EFOA 2OKUA 5BQIA 2HJ3A 4DOZA 4KBLA 5E3AA 3S84A 5CI9A 1S7ZA 2AP3A 1D1CA 3ITFA 4XEVA 4YT2A 4K0DA 3MFNA 5KYUA 2R7QA 5HSWA 4OINF 4BJTA 1VYIA 2BL2A 2J9WA 3H65A 4U5FE 3QVZA 3ECSA 4NCQA 3VYWA 3T6BA 3W4YA 2WZGA 1LI7A 3AG1C 3LAYA 1WATA 4IJJA 1XZQA 4G0HA 2YL1A 1MMNA 5KYYA 4U5HA 3SZRA 4OIOF 2EPMX 3EG9A 3DJNB 4DBRA 5E33A 1HE9A 3RQEA 5EHHA 4XLPF 1JPJA 1TFKB 1HW2A 1GGQA 3EZHA 1FFTC 1TWGA 4OIPF 4E18A 3R7CA 2XSEA 4EKWA 2IYLD 3C8GD 3ZIBA 5DS5A 1GQAA 1NG1A 4U9EA 3DM9B 2EPKX 2XRHA 4MTGA 1VMAA 2DI3A 5A6KA 3AJMA 1G5ZA 1H6GA 3NKEA 3DD7A 5JRAA 1A0BA 4MVMA 1T9KA 1T6IA 3LNRA 3LUTB 2C04A 4MTFA 3X1OA 4CDVA 2VH3A 2A6HF 3RYLA 2NSGA 2IBFA 4W8PA 1VYKA 1Z6AA 4LLCA 1ZHYA 3UMHA 2R02A 3KH2A 2I15A 2PBEA 1D0XA 2EIMC 1TWCA 2J7PD 3ZQVA 4E7ZA 3JT1A 2OEXA 2KC3A 2ASRA 2P0NA 4FWVA 1FMVA 2IXMA 3L8IA 4JTAB 1CGOA 3S90A 2XM0A 3JSEO 4O6MA 2XXAB 3EPVA 2X51A 4CS8C 3U9MA 5L0HA 3ASOC 1VLTA 1Z63A 3CZ6A 3TJ5A 5JP7A 1J8MF 2QE9A 4P9TA 1Q0GA 3RQGA 4E0IA 3HNJA 1OXBA 3JRMO 2MYSA 3OEOA 2VC9A 3NMJA 4IGGA 3M15A 4BJ1A 4EBBA 3QZCA 1G4US 2A68F 2YVKA 3NG1A 1VOMA 4C3BA 2Q7RA 4CS7A 4DXWA 2R7XA 3MYFA 4LLEA 3I4UA 1MQVA 1D0ZA 3CSKA 3EH2A 3T4RA 5T1DB 2Q3TA 2CGEA 1RKCA 5B1BC 2LCHA 2OEVA 3DI5A 2GDCA 3RKOF 4JTDB 1Z7Qc 1M2VB 2W9YA 4N6CA 1IW7F 3MYIA 3NYJA 4ONSA 3X2QC 4CS8A 2F22A 1I4ZA 2KSFA 2WL8A 2YKZA 3IQ5A 3KYIA 2Q9CA 1ORJA 3K1IA 4PJNA 2XLMA 4NQFA 5JSLA 1TQGA 2IXOA 1EI7A 3GANA 1N1CA 4BG0A 3KPHA 3ZDLA 2AWYA 4PJLA 5A69A 4G7ZF 1WTYA 3FVYA 1O5HA 5L0DA 3B71A 1HMOA 2BE5F 3K7DA 3OA1A 4K7BA 3E9VA 1RKEB 2AU5A 2RD9A 2HFIA 4J30B 3JYHA 4MVOA 3TK0A 3WHNA 2DYSC 1JPNA 3SEOA 4B6IA 4BPMA 4MW8A 3Q6NA 5KYWA 1Y6DA 1H9TA 4ULVA 3VAYA 1QLEC 1F1MA 1A7DA 4Z9JA 2EPOA 2FFHA 2NPUA 4PJJA 4U5DE 3FAJA 3V5ZA 2J0WA 1VTMP 3IHUA 3GEEA 1V55C 4JJFA 2ICWG 2LP4A 2XL4A 4WGYA 4YK5A 2OU6A 2Q4FA 1CGME 5DVWA 2R03A 4Z9HA 5BUOA 5KYXA 4NTBA 3K6BA 1AVOB 4RD9A 3CQZA 3MX3A 3SXZA 4BEJA 3QTHA 2XS1A 4EIYA 4QI0A 4DVZA 5HV9A 3M4CA 3PDMP 1SMYF 1AUEA 4DRIB 3LEVA 3EJNA 3AG2C 3L1MA 4FESA 3GEIA 4HE8D 1H9GA 1HW1A 3EGXB 1RJ9B 4XPXA 4Z9IA 3ZTMA 4F4BA 4C7OB 2NUTA 2PX0A 2QTVA 2H7BA 3B29A 3EFOB 4AE4A 1E86A 4D4XA 4N4WA 2PF4E 2XLEA 4X0RA 2GFHA 4XPWA 4UDVA 4JCZA 2YLGA 4JIOA 2Y3GA 1CPRA 4NY3A 3N0TA 3R2PA 3ABLC 1LS1A 4E0HA 3L34A 2Y3HA 3FMSA 3HNLA 2W4BA 4IRUA 2PP4A 1WWPA 4J32B 3U9JA 4CIHA 1TWHA 1YARO 1YA7O 1LM3B 2CYDA 4J7YA 3VM6A 4JCHA 5A6JA 3TOMA 3QW0A 4LDRA 4NTFA 4W8KA 1Q0MA 2UUHA 3Q6MA 4KNWA 2DB4A 3GODA 1YAUO 3UR3C 3B0PA 2R7TA 2LK4A 2OJQA 2YZSA 3DJUB 3NRHA 3TD7A 5KYYB 4EUKB 1M57C 3EG9B 5JVEA 3TJ6A 5D91A 3JSZA 4JKVA 3SP1A 3C8GA 5A6BD 2Z15A 1R4TA 1VK5A 4L6RA 4IAOA 3H2VA 5L0CA 2HZ8A 4LACB 3FOOA 4YL1A 1R5ID 3C18A 4YN0B 4KI2A 3LNMB 4MVRA 3EGDA 3S29A 1H7IA 2FAPB 2M64A 3NMKA 4EWCA 3N24A 3TULA 3GM2A 2KQ9A 3TOLA 1BZ4A 1C02A 2J7PA 1OCOC 2Y3BA 5COGA 2X0CA 3T6GB 1Q0KA 3GWLA 1W2WA 2P6VA 4LERA 4EBJA 5L0JA 2L6HA 3F47A 4JW1A 3S9OA 2LQGA 3FOPA 4CSAC 2Q00A 3M4BA 3ZVRA 1M6TA 2XLWA 1SZIA 3PCVA 2VASA 1G4WR 5EK0A 2KYHA 3RF3A 1WGWA 3LESA 2H8AA 4G7HF 3V7OA 4JEBA 2YRFA 1OR3A 4U9DA 4ZLCA 2VCAA 4EBKA 256BA 1YDIA 4ER9A 1EQ1A 5COMA 4FX5A 2R7WA 1GM5A 3M1CB 3LS1A 3NDBB 3LS0A 2IM8A 2LIGA 3FAPB 2LFFA 3EZIA 4IAQA 3K33A 3W8HA 2QUPA 3DZAA 4CJGA 3VRCA 3K1IC 4CSAA 3K66A 3QW1A 4I44A 4PACA 3FDQA 1QZXA 2VB6A 4JC7A 2GWWA 1Z5ZA 3C62A 4U5BE 2HSBA 2J46A 1J8YF 1OKKD 2ZXWC 5DQZA 3SXKA 2YLIA 1OQCA 2EIKC 2Y69C 3FXHA 3Q7LA 4I3MA 4P6IC 1Z23A 2YL3A 3O6XA 2Q9AA 2YEVA 1Q0FA 3ATPA 5B3SC 1M56C 1TR2A 2JPUA 1OCCC 1YJGA 2Y39A 3CAXA 4OIRF 1E84A 3SXYA 4PK4A 1BR1A 3NKDA 1U0BB 3U3FA 1EKYA 4MVUA 3U2LA 4XQ1A 5KYWB 1PV3A 1MNDA 1LE4A 1OW6A 2R25A 2KW3C 2R7VA 4C3EA 3U2MA 3RFYA 2L9JA 1ZHWA 1HE1A 2D5RB 3LEOA 4NTAA 1BR2A 2A69F 4JRZA 2MWQA 3BRJA 3G4XA 1V4AA 3U0CA 2L6GA 3DKAA 3GM3A 2R7UA 4H4KC 3AGTA 4HEAJ 3OWTA 1Z3IX 2EPLX 2FGYA 2J45A 3IEEA 5BQGA 3QVYA 3U3BA 4DRJB 3NYMA 1APCA 5JLIA 5KYXB 1LKXA 2NUPB 3PMRA 1AEPA 2CDQA 4N6HA 5JUAA 4JZAA 3V5YA 2LD6A 1T6UA 3LLIA 3O39A 3T6JA 4JE9A 5KYNA 3JTLO 1V54C 2GAQA 4MQ9F 1RCPA 4XTKA 3B9QA 5IY5C 4Q4ZF 2R7SA 3LJBA 1MNEA 3S28A 1ZHXA 2GA0A 1LVKA 3AQBA 3GWNA 3O55A 4XWJA 4FAPB 1KTMA 4YL0A 3G4ZA 2NUPA 2NUTB 4PJMA 1WN0A 1BDJB 2VCCA 4AE4B 1LIHA 1XZPA 3S0XA 5L3QA 3AG4C 3US6A 2ZXRA 3POVA 3HJCA 4PR9A 3FHDA 1C03A 4IB4A 2PFDA 1TKNA 1SR2A 1JR8A 1L3PA 1EA8A 1LS4A 2B0HA 3Q7GA 3L0IA 5F28E 2CW0F 1O3UA 4RDAA 2A6EF 2G3VA 2YL7A 3TQOA 1LI5A 4BJ6A 2XM4A 1OCRC 1G8XA 3ZQYA 4M63A 5DS6A 1B68A 2EIJC 2XS8A 2CNWD 2DYRC 2J9UA 4JTCB 4MW3A 3RQFA 5L3VA 3JCUQ 5A6BA 1RXQA 1MMGA 1OW7A 3G50A 3S27A 1FAPB 2XL8A 4JEAA 4OIQF 3C8GB 1CGNA 1JAFA 1S05A 2LFDA 2LSEA 2WVOA 4MS2A 2G62A 4MVZA 3UMIA 3AQCA 4CBEA 2E87A 1T6QA 4Q7CA 2WVNA 4QI2A 4CDAA 2W4MA 1WASA 3EGDB 5FZTA 4DRHB 3RVZA 1MMAA 4CIPA 2A0BA 3KKBA 1YYXA 2I8BA 3B0UX 1ORYA 1T01A 5JT4A 4E7SA 3HNKA 4I1OB 2WVQA 3CEXA 1D0YA 4BJ5C 4XEKA 3B0VC 3A9CA 4Q5SF 1C17M 3HNIA 1ZVZA 2M4EA 2R05A 3A11A 3AOUA 2IXNA 4G7OF 1WOLA 4A2NB 1YLMA 4LDQA 2BC5A 2OQMA 1OXKA 1TFOB 1O87A 1OCZC 1QPUA 1SYQA 3DM5A 3E70C 4GEHA 4GYTA 4JJGA 2H7VC 4AL0A 3N2ZB 4CS9A 1LPEA 1ZU5A 3WODF 5DQTA 3ZC4A 4C3DA 3H2UA 4YT5A 5AC5A 3V5XA 3UGOA 1CPQA 1A41A 4PFOA 4DVYP 1T5OA 2ZXPA 2KJGA 2OJED 1ORSC 4YJWA 1JRAA 2W45A 1E2XA 3K1HA 4NC3A 3DAFA 4O6NA 2J0XA 3HTKC 1M2OA 2H7OA 5L0FA 1U89A 4BEMJ 4BJ5A 3LLKA 4YWQA 2P1AA 2Q9BA 2ZPAA 5JS5A 2KNHA 3RIPA 4MVQA 2O9XA 3BEHA 2HMZA 2L81A 5K0IA 3I5PA 4ULWA 2L6FA 4WJ0A 2RSEB 4O79A 3EHMA 1OKKA 3U8VA 4N06A 4AX2A 1ZZPA 3ZTZA 1ZW2A 2HSQA 4CJOA 2WB7A 4OD4A 5EGYA 2WZLA 2KK1A 2UUIA 2HV7A 3F46A 1NU9C 2B0JA 4U5GA 5T3TA 2J8WA
chains in the Genus database with same CATH topology
3IPMO 1FNTc 1YARO 1Z7Qc 1YAUO 1YA7O 1AVOB 3JTLO 3JSEO 3JRMO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3IPM O;  1FNT c;  1YAR O;  1Z7Q c;  1YAU O;  1YA7 O;  1AVO B;  3JTL O;  3JSE O;  3JRM O; 
#chains in the Genus database with same CATH topology
 3IPM O;  2JX0 A;  3U8P A;  1ZYR F;  3KYJ A;  3EQL F;  4MTO A;  1E83 A;  1YYJ A;  1A7E A;  2XL6 A;  1UFB A;  1PD1 A;  4RBN A;  1NU7 D;  3PHF 2;  5FCL A;  2XLH A;  1IZM A;  3ZSU A;  1FR0 A;  4G78 A;  1DOV A;  4P9F A;  3HKK A;  3IQC A;  4DBQ A;  1NZE A;  1UG7 A;  1TWA A;  1JMW A;  3AGU A;  4XLN F;  3GOR A;  4JVS A;  3O10 A;  1BR4 A;  4DJ9 A;  4KNV A;  2XLV A;  2ZXO A;  3L8J A;  3DE8 A;  3WAQ A;  2ETS A;  3T9O A;  5B1A C;  2EIL C;  1NFO A;  3DE9 A;  3DMD A;  1Y4C A;  4HFK B;  3ASN C;  5TJ5 E;  4LDK A;  2QNL A;  2VCB A;  4CX9 A;  4A4A A;  2P61 A;  4YT8 A;  2AWC A;  2HKV A;  1OR2 A;  2QY9 A;  1QSP A;  3KL4 A;  3MLG A;  4R32 A;  3RH3 A;  3JZ0 A;  3ZG1 A;  2XLD A;  4WAB A;  1I4Y A;  1PCX A;  3I5Q A;  2HUJ A;  5DLJ A;  2XXA A;  3GEH A;  2R7R A;  2YWA A;  5T3W A;  1YA9 A;  1HY5 A;  1A7V A;  2R7O A;  2NG1 A;  4IAR A;  3SNH A;  4MND A;  4O7G A;  5L0G A;  2OCC C;  4QDL A;  2R9R B;  3JRT A;  5DS4 A;  3J06 A;  1XWJ A;  3NMI A;  5E3C A;  1FNT c;  2PNO A;  2OG2 A;  4XEF A;  5AC4 A;  1D1A A;  1KNY A;  2QLA A;  2AVK A;  1PD0 A;  2HJM A;  4BJ6 C;  4K1O A;  2HMQ A;  4EHP A;  1I5N A;  2HS5 A;  4WGZ A;  1E85 A;  1KU2 A;  1NFN A;  2YL0 A;  3W2W A;  5D92 A;  1JOG A;  4KC9 A;  1LE2 A;  2CNW A;  4AK9 A;  4I1M A;  1MMD A;  1M2V A;  1D1B A;  3SYN A;  4D4N A;  1ZHT A;  1OW8 A;  1NBB A;  2XLO A;  1VB5 A;  3NYL A;  2OOC A;  2YQY A;  2YHS A;  2D4U A;  1NSG B;  3GM1 A;  2WZF A;  1QQ3 A;  3C7J A;  4O6Y A;  4U5C E;  3EH1 A;  3UMK A;  1K40 A;  1YVI A;  5COF A;  3AG3 C;  3UNG C;  4PFP A;  2JD3 A;  2L7A A;  2NSF A;  5B3I A;  1YZA A;  1QVX A;  3QMK A;  2V26 A;  3WG7 C;  3SXM A;  1RKE A;  1DOW A;  2G3K A;  2KGO A;  3W8I A;  1BBH A;  1FMW A;  2EPN A;  3KMI A;  4IWB A;  3EHN A;  3ABM C;  2TMV P;  2V3C C;  2DGJ A;  2J9B A;  4ANJ A;  3IQ6 A;  1ST6 A;  1GS9 A;  4XPY A;  4U5E E;  3U5S A;  1SF8 A;  4MVS A;  4YL3 A;  1RMV A;  3W2V A;  2IOQ A;  5L0I A;  3JYY A;  2ZD9 A;  5F5H A;  1ZU4 A;  4CDY A;  1ZW3 A;  5E2Q A;  1HMD A;  3RW0 A;  4CS9 C;  5F5F A;  3UGP A;  2J9V A;  2CCY A;  2Y3D A;  1K04 A;  1FFH A;  1ZHZ A;  4YT4 A;  1FTS A;  1K05 A;  4JUR I;  5BQH A;  1YZC A;  3MBG A;  3HLZ A;  4HFF B;  3VF0 A;  2YLD A;  3DAG A;  2HV6 A;  2EIN C;  2P7V A;  3M79 A;  2MHR A;  3DWW A;  3DXJ F;  4J7T A;  1L7C A;  1QKR A;  2A0U A;  5A6A A;  3RVY A;  2C03 A;  5GPG B;  2PX3 A;  4OD5 A;  5CI8 A;  1Q0D A;  1VLS A;  3ABK C;  3IQT A;  5AGF A;  1U6H A;  4AL1 A;  3EGX A;  5KYU B;  2IXP A;  4H54 A;  1RJ9 A;  1V74 B;  3C8Z A;  1NLX A;  4C7O A;  4GQH A;  5CIV A;  2A1D D;  4E17 A;  3C63 A;  4ZLD A;  3ZWI A;  3EFO A;  2OKU A;  5BQI A;  2HJ3 A;  4DOZ A;  4KBL A;  5E3A A;  3S84 A;  5CI9 A;  1S7Z A;  2AP3 A;  1D1C A;  3ITF A;  4XEV A;  4YT2 A;  4K0D A;  3MFN A;  5KYU A;  2R7Q A;  5HSW A;  4OIN F;  4BJT A;  1VYI A;  2BL2 A;  2J9W A;  3H65 A;  4U5F E;  3QVZ A;  3ECS A;  4NCQ A;  3VYW A;  3T6B A;  3W4Y A;  2WZG A;  1LI7 A;  3AG1 C;  3LAY A;  1WAT A;  4IJJ A;  1XZQ A;  4G0H A;  2YL1 A;  1MMN A;  5KYY A;  4U5H A;  3SZR A;  4OIO F;  2EPM X;  3EG9 A;  3DJN B;  4DBR A;  5E33 A;  1HE9 A;  3RQE A;  5EHH A;  4XLP F;  1JPJ A;  1TFK B;  1HW2 A;  1GGQ A;  3EZH A;  1FFT C;  1TWG A;  4OIP F;  4E18 A;  3R7C A;  2XSE A;  4EKW A;  2IYL D;  3C8G D;  3ZIB A;  5DS5 A;  1GQA A;  1NG1 A;  4U9E A;  3DM9 B;  2EPK X;  2XRH A;  4MTG A;  1VMA A;  2DI3 A;  5A6K A;  3AJM A;  1G5Z A;  1H6G A;  3NKE A;  3DD7 A;  5JRA A;  1A0B A;  4MVM A;  1T9K A;  1T6I A;  3LNR A;  3LUT B;  2C04 A;  4MTF A;  3X1O A;  4CDV A;  2VH3 A;  2A6H F;  3RYL A;  2NSG A;  2IBF A;  4W8P A;  1VYK A;  1Z6A A;  4LLC A;  1ZHY A;  3UMH A;  2R02 A;  3KH2 A;  2I15 A;  2PBE A;  1D0X A;  2EIM C;  1TWC A;  2J7P D;  3ZQV A;  4E7Z A;  3JT1 A;  2OEX A;  2KC3 A;  2ASR A;  2P0N A;  4FWV A;  1FMV A;  2IXM A;  3L8I A;  4JTA B;  1CGO A;  3S90 A;  2XM0 A;  3JSE O;  4O6M A;  2XXA B;  3EPV A;  2X51 A;  4CS8 C;  3U9M A;  5L0H A;  3ASO C;  1VLT A;  1Z63 A;  3CZ6 A;  3TJ5 A;  5JP7 A;  1J8M F;  2QE9 A;  4P9T A;  1Q0G A;  3RQG A;  4E0I A;  3HNJ A;  1OXB A;  3JRM O;  2MYS A;  3OEO A;  2VC9 A;  3NMJ A;  4IGG A;  3M15 A;  4BJ1 A;  4EBB A;  3QZC A;  1G4U S;  2A68 F;  2YVK A;  3NG1 A;  1VOM A;  4C3B A;  2Q7R A;  4CS7 A;  4DXW A;  2R7X A;  3MYF A;  4LLE A;  3I4U A;  1MQV A;  1D0Z A;  3CSK A;  3EH2 A;  3T4R A;  5T1D B;  2Q3T A;  2CGE A;  1RKC A;  5B1B C;  2LCH A;  2OEV A;  3DI5 A;  2GDC A;  3RKO F;  4JTD B;  1Z7Q c;  1M2V B;  2W9Y A;  4N6C A;  1IW7 F;  3MYI A;  3NYJ A;  4ONS A;  3X2Q C;  4CS8 A;  2F22 A;  1I4Z A;  2KSF A;  2WL8 A;  2YKZ A;  3IQ5 A;  3KYI A;  2Q9C A;  1ORJ A;  3K1I A;  4PJN A;  2XLM A;  4NQF A;  5JSL A;  1TQG A;  2IXO A;  1EI7 A;  3GAN A;  1N1C A;  4BG0 A;  3KPH A;  3ZDL A;  2AWY A;  4PJL A;  5A69 A;  4G7Z F;  1WTY A;  3FVY A;  1O5H A;  5L0D A;  3B71 A;  1HMO A;  2BE5 F;  3K7D A;  3OA1 A;  4K7B A;  3E9V A;  1RKE B;  2AU5 A;  2RD9 A;  2HFI A;  4J30 B;  3JYH A;  4MVO A;  3TK0 A;  3WHN A;  2DYS C;  1JPN A;  3SEO A;  4B6I A;  4BPM A;  4MW8 A;  3Q6N A;  5KYW A;  1Y6D A;  1H9T A;  4ULV A;  3VAY A;  1QLE C;  1F1M A;  1A7D A;  4Z9J A;  2EPO A;  2FFH A;  2NPU A;  4PJJ A;  4U5D E;  3FAJ A;  3V5Z A;  2J0W A;  1VTM P;  3IHU A;  3GEE A;  1V55 C;  4JJF A;  2ICW G;  2LP4 A;  2XL4 A;  4WGY A;  4YK5 A;  2OU6 A;  2Q4F A;  1CGM E;  5DVW A;  2R03 A;  4Z9H A;  5BUO A;  5KYX A;  4NTB A;  3K6B A;  1AVO B;  4RD9 A;  3CQZ A;  3MX3 A;  3SXZ A;  4BEJ A;  3QTH A;  2XS1 A;  4EIY A;  4QI0 A;  4DVZ A;  5HV9 A;  3M4C A;  3PDM P;  1SMY F;  1AUE A;  4DRI B;  3LEV A;  3EJN A;  3AG2 C;  3L1M A;  4FES A;  3GEI A;  4HE8 D;  1H9G A;  1HW1 A;  3EGX B;  1RJ9 B;  4XPX A;  4Z9I A;  3ZTM A;  4F4B A;  4C7O B;  2NUT A;  2PX0 A;  2QTV A;  2H7B A;  3B29 A;  3EFO B;  4AE4 A;  1E86 A;  4D4X A;  4N4W A;  2PF4 E;  2XLE A;  4X0R A;  2GFH A;  4XPW A;  4UDV A;  4JCZ A;  2YLG A;  4JIO A;  2Y3G A;  1CPR A;  4NY3 A;  3N0T A;  3R2P A;  3ABL C;  1LS1 A;  4E0H A;  3L34 A;  2Y3H A;  3FMS A;  3HNL A;  2W4B A;  4IRU A;  2PP4 A;  1WWP A;  4J32 B;  3U9J A;  4CIH A;  1TWH A;  1YAR O;  1YA7 O;  1LM3 B;  2CYD A;  4J7Y A;  3VM6 A;  4JCH A;  5A6J A;  3TOM A;  3QW0 A;  4LDR A;  4NTF A;  4W8K A;  1Q0M A;  2UUH A;  3Q6M A;  4KNW A;  2DB4 A;  3GOD A;  1YAU O;  3UR3 C;  3B0P A;  2R7T A;  2LK4 A;  2OJQ A;  2YZS A;  3DJU B;  3NRH A;  3TD7 A;  5KYY B;  4EUK B;  1M57 C;  3EG9 B;  5JVE A;  3TJ6 A;  5D91 A;  3JSZ A;  4JKV A;  3SP1 A;  3C8G A;  5A6B D;  2Z15 A;  1R4T A;  1VK5 A;  4L6R A;  4IAO A;  3H2V A;  5L0C A;  2HZ8 A;  4LAC B;  3FOO A;  4YL1 A;  1R5I D;  3C18 A;  4YN0 B;  4KI2 A;  3LNM B;  4MVR A;  3EGD A;  3S29 A;  1H7I A;  2FAP B;  2M64 A;  3NMK A;  4EWC A;  3N24 A;  3TUL A;  3GM2 A;  2KQ9 A;  3TOL A;  1BZ4 A;  1C02 A;  2J7P A;  1OCO C;  2Y3B A;  5COG A;  2X0C A;  3T6G B;  1Q0K A;  3GWL A;  1W2W A;  2P6V A;  4LER A;  4EBJ A;  5L0J A;  2L6H A;  3F47 A;  4JW1 A;  3S9O A;  2LQG A;  3FOP A;  4CSA C;  2Q00 A;  3M4B A;  3ZVR A;  1M6T A;  2XLW A;  1SZI A;  3PCV A;  2VAS A;  1G4W R;  5EK0 A;  2KYH A;  3RF3 A;  1WGW A;  3LES A;  2H8A A;  4G7H F;  3V7O A;  4JEB A;  2YRF A;  1OR3 A;  4U9D A;  4ZLC A;  2VCA A;  4EBK A;  256B A;  1YDI A;  4ER9 A;  1EQ1 A;  5COM A;  4FX5 A;  2R7W A;  1GM5 A;  3M1C B;  3LS1 A;  3NDB B;  3LS0 A;  2IM8 A;  2LIG A;  3FAP B;  2LFF A;  3EZI A;  4IAQ A;  3K33 A;  3W8H A;  2QUP A;  3DZA A;  4CJG A;  3VRC A;  3K1I C;  4CSA A;  3K66 A;  3QW1 A;  4I44 A;  4PAC A;  3FDQ A;  1QZX A;  2VB6 A;  4JC7 A;  2GWW A;  1Z5Z A;  3C62 A;  4U5B E;  2HSB A;  2J46 A;  1J8Y F;  1OKK D;  2ZXW C;  5DQZ A;  3SXK A;  2YLI A;  1OQC A;  2EIK C;  2Y69 C;  3FXH A;  3Q7L A;  4I3M A;  4P6I C;  1Z23 A;  2YL3 A;  3O6X A;  2Q9A A;  2YEV A;  1Q0F A;  3ATP A;  5B3S C;  1M56 C;  1TR2 A;  2JPU A;  1OCC C;  1YJG A;  2Y39 A;  3CAX A;  4OIR F;  1E84 A;  3SXY A;  4PK4 A;  1BR1 A;  3NKD A;  1U0B B;  3U3F A;  1EKY A;  4MVU A;  3U2L A;  4XQ1 A;  5KYW B;  1PV3 A;  1MND A;  1LE4 A;  1OW6 A;  2R25 A;  2KW3 C;  2R7V A;  4C3E A;  3U2M A;  3RFY A;  2L9J A;  1ZHW A;  1HE1 A;  2D5R B;  3LEO A;  4NTA A;  1BR2 A;  2A69 F;  4JRZ A;  2MWQ A;  3BRJ A;  3G4X A;  1V4A A;  3U0C A;  2L6G A;  3DKA A;  3GM3 A;  2R7U A;  4H4K C;  3AGT A;  4HEA J;  3OWT A;  1Z3I X;  2EPL X;  2FGY A;  2J45 A;  3IEE A;  5BQG A;  3QVY A;  3U3B A;  4DRJ B;  3NYM A;  1APC A;  5JLI A;  5KYX B;  1LKX A;  2NUP B;  3PMR A;  1AEP A;  2CDQ A;  4N6H A;  5JUA A;  4JZA A;  3V5Y A;  2LD6 A;  1T6U A;  3LLI A;  3O39 A;  3T6J A;  4JE9 A;  5KYN A;  3JTL O;  1V54 C;  2GAQ A;  4MQ9 F;  1RCP A;  4XTK A;  3B9Q A;  5IY5 C;  4Q4Z F;  2R7S A;  3LJB A;  1MNE A;  3S28 A;  1ZHX A;  2GA0 A;  1LVK A;  3AQB A;  3GWN A;  3O55 A;  4XWJ A;  4FAP B;  1KTM A;  4YL0 A;  3G4Z A;  2NUP A;  2NUT B;  4PJM A;  1WN0 A;  1BDJ B;  2VCC A;  4AE4 B;  1LIH A;  1XZP A;  3S0X A;  5L3Q A;  3AG4 C;  3US6 A;  2ZXR A;  3POV A;  3HJC A;  4PR9 A;  3FHD A;  1C03 A;  4IB4 A;  2PFD A;  1TKN A;  1SR2 A;  1JR8 A;  1L3P A;  1EA8 A;  1LS4 A;  2B0H A;  3Q7G A;  3L0I A;  5F28 E;  2CW0 F;  1O3U A;  4RDA A;  2A6E F;  2G3V A;  2YL7 A;  3TQO A;  1LI5 A;  4BJ6 A;  2XM4 A;  1OCR C;  1G8X A;  3ZQY A;  4M63 A;  5DS6 A;  1B68 A;  2EIJ C;  2XS8 A;  2CNW D;  2DYR C;  2J9U A;  4JTC B;  4MW3 A;  3RQF A;  5L3V A;  3JCU Q;  5A6B A;  1RXQ A;  1MMG A;  1OW7 A;  3G50 A;  3S27 A;  1FAP B;  2XL8 A;  4JEA A;  4OIQ F;  3C8G B;  1CGN A;  1JAF A;  1S05 A;  2LFD A;  2LSE A;  2WVO A;  4MS2 A;  2G62 A;  4MVZ A;  3UMI A;  3AQC A;  4CBE A;  2E87 A;  1T6Q A;  4Q7C A;  2WVN A;  4QI2 A;  4CDA A;  2W4M A;  1WAS A;  3EGD B;  5FZT A;  4DRH B;  3RVZ A;  1MMA A;  4CIP A;  2A0B A;  3KKB A;  1YYX A;  2I8B A;  3B0U X;  1ORY A;  1T01 A;  5JT4 A;  4E7S A;  3HNK A;  4I1O B;  2WVQ A;  3CEX A;  1D0Y A;  4BJ5 C;  4XEK A;  3B0V C;  3A9C A;  4Q5S F;  1C17 M;  3HNI A;  1ZVZ A;  2M4E A;  2R05 A;  3A11 A;  3AOU A;  2IXN A;  4G7O F;  1WOL A;  4A2N B;  1YLM A;  4LDQ A;  2BC5 A;  2OQM A;  1OXK A;  1TFO B;  1O87 A;  1OCZ C;  1QPU A;  1SYQ A;  3DM5 A;  3E70 C;  4GEH A;  4GYT A;  4JJG A;  2H7V C;  4AL0 A;  3N2Z B;  4CS9 A;  1LPE A;  1ZU5 A;  3WOD F;  5DQT A;  3ZC4 A;  4C3D A;  3H2U A;  4YT5 A;  5AC5 A;  3V5X A;  3UGO A;  1CPQ A;  1A41 A;  4PFO A;  4DVY P;  1T5O A;  2ZXP A;  2KJG A;  2OJE D;  1ORS C;  4YJW A;  1JRA A;  2W45 A;  1E2X A;  3K1H A;  4NC3 A;  3DAF A;  4O6N A;  2J0X A;  3HTK C;  1M2O A;  2H7O A;  5L0F A;  1U89 A;  4BEM J;  4BJ5 A;  3LLK A;  4YWQ A;  2P1A A;  2Q9B A;  2ZPA A;  5JS5 A;  2KNH A;  3RIP A;  4MVQ A;  2O9X A;  3BEH A;  2HMZ A;  2L81 A;  5K0I A;  3I5P A;  4ULW A;  2L6F A;  4WJ0 A;  2RSE B;  4O79 A;  3EHM A;  1OKK A;  3U8V A;  4N06 A;  4AX2 A;  1ZZP A;  3ZTZ A;  1ZW2 A;  2HSQ A;  4CJO A;  2WB7 A;  4OD4 A;  5EGY A;  2WZL A;  2KK1 A;  2UUI A;  2HV7 A;  3F46 A;  1NU9 C;  2B0J A;  4U5G A;  5T3T A;  2J8W A; 
#chains in the Genus database with same CATH homology
 3IPM O;  1FNT c;  1YAR O;  1Z7Q c;  1YAU O;  1YA7 O;  1AVO B;  3JTL O;  3JSE O;  3JRM O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...