3IPMO

Crystal structure of archaeal 20s proteasome in complex with the c-terminus of pan
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
229
structure length
219
Chain Sequence
KRAALIQNLRDSYTETSSFAVIEEWAAGTLQEIEGIAKAAVEAHATIRNSTYGRAQAEKSPEQLLGVLQRYQDLCHNVYCQAETIRTVIAIRIPEHKEADNLGVAVQHAVLKVIDELEIKTLGSGEKSGSGGAPTPIGMYALREYLSARSTVEDKLLGGGSQSPSLLLELRQIDADFMLKVELATTHLSTMVRAVINAYLLNWKKLIQPRGGHLDVLYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Proteasome subunit alpha
publication title Interactions of PAN's C-termini with archaeal 20S proteasome and implications for the eukaryotic proteasome-ATPase interactions.
pubmed doi rcsb
source organism Thermoplasma acidophilum
molecule tags Hydrolase/hydrolase activator
total genus 82
structure length 219
sequence length 229
chains with identical sequence P, Q, R, S, T, U
ec nomenclature
pdb deposition date 2009-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF02252 PA28_beta Proteasome activator pa28 beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.180 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Proteasome activator pa28, C-terminal domain 3ipmO01
1YA7O 3JTLO 3JSEO 3JRMO 1YAUO 1FNTc 3IPMO 1Z7Qc 1YARO 1AVOB
chains in the Genus database with same CATH superfamily
1Y4CA 2AWCA 1OQCA 3PMRA 3ASNC 3UMIA 3J06A 1LVKA 2NSGA 4EKWA 4MTGA 1T01A 4PJNA 1C02A 1ZW2A 4CBEA 1HE9A 3EGXA 3EG9B 4LDKA 2J9VA 1HW2A 3IQ5A 1QQ3A 1V55C 4AL0A 256BA 3C62A 1UG7A 2V3CC 3ABMC 5DS5A 4DVYP 1VYIA 2NPUA 2P1AA 3H2VA 4N6HA 3RF3A 4G0HA 4R32A 3ATPA 3AGTA 3C63A 2R02A 2GWWA 1VYKA 4JTDB 1FAPB 3LESA 3DMDA 1ZW3A 4ZLDA 4HFKB 2PF4E 3C8GB 3LJBA 4YT2A 1SR2A 4JE9A 5BUOA 2XL4A 3OA1A 3ZDLA 3ZSUA 1NFOA 2L6HA 3EGDA 2AVKA 4BJTA 1GM5A 1LE4A 1WOLA 2G3KA 3TOMA 1LI7A 1ORSC 5KYWB 2XL8A 2W45A 3JZ0A 4Q7CA 3B9QA 3EJNA 3IEEA 3NMKA 5COGA 4E0HA 3IQ6A 3EPVA 1ORYA 2WVQA 5AC4A 3HNLA 1D0YA 1VB5A 4YT5A 3C18A 4JJFA 4MVOA 5KYNA 2J45A 3W4YA 2ICWG 1WN0A 1VTMP 3GEHA 4CJGA 1VOMA 3GM3A 3NMJA 3JYYA 3QTHA 4JVSA 2GAQA 4BG0A 3CAXA 4BJ5C 2CW0F 3AG1C 3HNKA 3Q6MA 4OIQF 3K33A 1NG1A 4M63A 4O6NA 2OQMA 1RMVA 4EIYA 1VK5A 3QVZA 1U0BB 2PNOA 2EIKC 3KKBA 4C3DA 4FESA 4CS8C 4HFFB 3A11A 2ZXOA 3HLZA 1D1BA 2QE9A 3JRMO 3W2WA 5JS5A 4HE8D 4U5GA 2PX3A 4BPMA 2GDCA 1QKRA 1CGME 3W8HA 2XLHA 1CGNA 4O7GA 4D4NA 2IM8A 2C03A 2Q9BA 4KBLA 4PK4A 3ASOC 3RFYA 3U2MA 3TJ6A 4E18A 2V26A 2CDQA 3SXZA 1G5ZA 3ZQYA 3SZRA 1NU9C 2I8BA 3EFOB 4PJLA 1BBHA 2XS8A 5F5HA 3V5YA 1I4YA 5DLJA 1K40A 2YRFA 1A7EA 4JCZA 1H6GA 4W8KA 3FDQA 2CCYA 4JRZA 2LQGA 2EPLX 1OCOC 2R05A 1LKXA 2Q9CA 3I4UA 3UR3C 2AWYA 5A69A 2DYSC 1D0XA 4IARA 1G4US 2A68F 2LFFA 4JC7A 5L0IA 2YHSA 1H9GA 4OIRF 3WAQA 4IRUA 5L0DA 4L6RA 4A4AA 2H8AA 2NSFA 4NTFA 5A6BD 1FMWA 1HW1A 4U5CE 2DB4A 4CSAC 1M57C 4FWVA 4ULVA 3T4RA 5L0GA 1ZVZA 3RH3A 3V7OA 3DKAA 3LEVA 1ZHZA 2HZ8A 2VCAA 3C8ZA 3EGXB 2KYHA 3RKOF 5EK0A 2CNWA 4NC3A 3VF0A 3BRJA 2H7BA 2HSQA 4I1OB 3L0IA 4MS2A 3UMKA 3JRTA 3S84A 4U5DE 2NUTA 1XZQA 4H54A 2J8WA 2Y3GA 2D5RB 4KI2A 1PCXA 1TWCA 3AG3C 3RQGA 5JVEA 2Y3DA 1RXQA 2Q4FA 4WGZA 1APCA 4BJ6C 2NUPA 3SXMA 1G4WR 1HMOA 1OKKD 1YVIA 3B0PA 3EH1A 4JKVA 4P9TA 3LLKA 1WWPA 4P6IC 2Q9AA 1NLXA 1M6TA 3QZCA 1LS1A 1I5NA 4U5BE 2J7PD 4I1MA 2QLAA 3EGDB 1V74B 2L7AA 2W4MA 3HNJA 4A2NB 2KK1A 4OIOF 2UUHA 3LNMB 2LIGA 5DS6A 3KMIA 1E86A 1QVXA 2GFHA 2EIMC 4CIHA 2R7SA 3SYNA 4BJ5A 4WGYA 4AL1A 1IZMA 4NCQA 5DVWA 2WZFA 3DE9A 3SXKA 1BR4A 4EWCA 2L6GA 3B0UX 4O6MA 4XEVA 1PD0A 4D4XA 1NFNA 2YL7A 1Q0GA 1U6HA 2XLEA 4CS8A 2OEVA 2EINC 3JSZA 5B3SC 2QY9A 4J30B 4MQ9F 3FAPB 1Z7Qc 1ORJA 1R5ID 2OEXA 3V5XA 2EPNA 3JCUQ 3O10A 2L81A 1RJ9A 3ZIBA 2WVNA 3SNHA 5A6AA 4H4KC 3KYIA 2BL2A 4CX9A 1KNYA 2JPUA 1J8YF 3FOPA 3GM2A 3OWTA 3NYMA 4DVZA 5HSWA 2HMZA 3K1IC 3MLGA 2WB7A 4XEKA 2Y3BA 3U3BA 4MTOA 2R7VA 1RKCA 3QVYA 3C7JA 4P9FA 2ZPAA 1T6UA 3O39A 3O55A 1QZXA 4YL1A 4AE4A 4JURI 3TQOA 1MNEA 4PR9A 4RD9A 3U9MA 2LP4A 3AQCA 1WASA 3EHNA 1F1MA 1JRAA 3GM1A 5L0CA 1QLEC 2R25A 2I15A 4GQHA 2J9WA 2R03A 3I5QA 3Q6NA 4QI0A 1MQVA 1Z5ZA 2HV7A 1E85A 4CSAA 3US6A 2R7QA 3Q7LA 3ABLC 2P7VA 1ZZPA 4DRJB 1Z63A 1Z6AA 5JSLA 2DYRC 4Z9HA 3U8PA 4E0IA 2VC9A 4DOZA 2HKVA 3R2PA 3ZC4A 5AC5A 4KNWA 5AGFA 3RYLA 2TMVP 4XEFA 3ECSA 3M4BA 2LK4A 4FX5A 4UDVA 4PACA 2MYSA 3S27A 2IYLD 5L3VA 3L34A 3U8VA 5B1BC 5EHHA 3IPMO 2XSEA 1KTMA 2HS5A 3KL4A 4OD5A 5B1AC 3G50A 3AQBA 1XWJA 2KJGA 3F47A 4BJ6A 4AX2A 2RD9A 1ZU5A 3B71A 1EI7A 1M56C 1AEPA 2C04A 5T3TA 3MX3A 2D4UA 3G4XA 1YA7O 1JMWA 3JTLO 2P6VA 1MMDA 2EIJC 4BEJA 4CDYA 3C8GD 2NG1A 2WL8A 4K7BA 4O6YA 3DM9B 5FZTA 3T6JA 1G8XA 4JTCB 2J0WA 1YLMA 2NUPB 3IQCA 3ZVRA 2XLWA 4I44A 1TKNA 1TWAA 4IGGA 2WZGA 3FOOA 4NTBA 1GQAA 4JJGA 4CDVA 3HKKA 3H65A 5JLIA 2ZXWC 1M2VA 3WHNA 5KYUA 4YJWA 5BQGA 1E2XA 1R4TA 1J8MF 2A0BA 2G62A 3R7CA 2A6EF 3I5PA 3GODA 3M15A 1CPQA 3VAYA 2KNHA 2HUJA 4WJ0A 1OR2A 2ETSA 2GA0A 3EZIA 1V4AA 3JT1A 3W8IA 2CNWD 4EHPA 3UGPA 2W4BA 2L9JA 3N2ZB 1WGWA 3B0VC 2EPKX 3POVA 4ZLCA 1LI5A 3ITFA 1TWGA 3TULA 4MVRA 2R7TA 4N06A 5L0FA 1Z3IX 1RKEA 4XPYA 1U89A 2BE5F 2ASRA 1TFKB 3V5ZA 3AG4C 3K1IA 3K7DA 2OG2A 4MW8A 2HFIA 4LLCA 4N4WA 4C7OA 3DAGA 4CS9C 1OXKA 3VRCA 3S90A 5L0JA 4U5FE 3WODF 1RJ9B 2YLIA 1ZHYA 3LS0A 4E7SA 4OIPF 1DOWA 2E87A 2J9UA 3DJUB 2A6HF 1CGOA 4MTFA 4DJ9A 3GEIA 1YA9A 3HJCA 1C17M 4IB4A 4E7ZA 5CIVA 2XLOA 3JYHA 4MVSA 5B3IA 3S9OA 1SZIA 3E9VA 3L8IA 3DD7A 3CEXA 3KH2A 4CJOA 4AE4B 1JR8A 2A69F 2R9RB 5DQZA 1JOGA 3N0TA 3NYLA 3U5SA 1VMAA 2DI3A 2XM4A 1D0ZA 3QW1A 4HEAJ 4MVUA 4XLNF 2YL3A 3LUTB 1N1CA 3NKEA 3U3FA 4XQ1A 1L3PA 4Z9IA 4IAOA 2OJQA 2IXOA 2Z15A 4DRIB 3HTKC 4EBKA 1B68A 1MMAA 2ZD9A 2H7VC 5KYXA 1MNDA 5D91A 1LE2A 1YAUO 1YZAA 5JRAA 4JW1A 3AOUA 3LLIA 3S28A 1L7CA 2HJ3A 4U9EA 1FFHA 4U5EE 2P61A 2H7OA 2YLDA 3S0XA 1QSPA 1OXBA 1YJGA 2UUIA 4J32B 1OW7A 2AP3A 3T6GB 1T9KA 1BR2A 3VM6A 1A7DA 1KU2A 5JP7A 3UMHA 2L6FA 4G7ZF 1NU7D 1TQGA 3M79A 2AU5A 2XS1A 3GWNA 4JEAA 3E70C 4IAQA 5COFA 5COMA 4PJJA 3M4CA 2O9XA 3DAFA 3LEOA 4Z9JA 1AUEA 1XZPA 3FMSA 1OCRC 3TK0A 4ANJA 5DS4A 1HY5A 4YT4A 1EKYA 2JD3A 2BC5A 2RSEB 4WABA 5A6BA 1S7ZA 4NY3A 3TOLA 3UNGC 2YWAA 3UGOA 2X51A 3H2UA 4ULWA 3X2QC 1LPEA 3K6BA 1OR3A 1FMVA 5E3AA 4C3BA 5HV9A 1M2VB 3T6BA 3DXJF 3U2LA 3ZWIA 3GORA 2KQ9A 3L1MA 1EA8A 2YVKA 3FAJA 3Q7GA 4G78A 3PDMP 1ZHXA 2EPMX 2ZXPA 2Y39A 1AVOB 2FAPB 1LM3B 2Y3HA 4CS9A 5T1DB 1OKKA 3LS1A 3U0CA 3DM5A 4F4BA 2J0XA 1NSGB 2J7PA 2J46A 1RKEB 3MYIA 5E33A 1E84A 3CZ6A 3ZG1A 2QNLA 1OW6A 4FAPB 4G7OF 1BDJB 1V54C 4C7OB 4IJJA 1OW8A 2MHRA 2XLMA 2M4EA 3DJNB 1LS4A 4B6IA 3JSEO 5K0IA 2J9BA 2R7OA 2R7RA 3NMIA 2Q3TA 2Y69C 4XPXA 1D1CA 1WATA 2OKUA 5BQIA 2HJMA 4K1OA 5EGYA 3GANA 1OCCC 4DBRA 1O3UA 4QDLA 2M64A 4XPWA 1WTYA 3K1HA 2QTVA 3EHMA 1JPNA 1H9TA 1JAFA 4IWBA 1SYQA 1I4ZA 2NUTB 5T3WA 2YZSA 1BZ4A 1M2OA 3MBGA 1TR2A 1SMYF 3LAYA 4Q4ZF 2LD6A 4MVZA 1ZYRF 4I3MA 3U9JA 3F46A 1FR0A 1C03A 5KYYA 3TJ5A 1DOVA 1ST6A 5KYXB 4KNVA 5F5FA 1IW7F 3X1OA 4JEBA 4U9DA 1NBBA 2VASA 4GYTA 2A1DD 2XRHA 4N6CA 3FVYA 1PD1A 3AG2C 4NTAA 2Q7RA 3W2VA 2G3VA 1Q0MA 4LERA 3RIPA 3QW0A 2KC3A 3RQFA 4ONSA 2XLDA 2YL1A 1A0BA 2LCHA 3EH2A 2LSEA 1Y6DA 2ZXRA 3DE8A 3RVYA 2F22A 2B0JA 4LLEA 2FFHA 3NYJA 4MW3A 2R7XA 2PX0A 2MWQA 3B29A 4YN0B 4AK9A 2VB6A 3N24A 3CQZA 1JPJA 3ZTZA 3NRHA 4JTAB 2R7UA 4EBBA 4MNDA 1FTSA 1E83A 5E3CA 3VYWA 2FGYA 2KSFA 2OU6A 4PFPA 1K05A 3NG1A 1Q0KA 2YQYA 4JCHA 3SXYA 3ZQVA 5FCLA 2IBFA 4LDRA 1BR1A 1Q0FA 2A0UA 1QPUA 3RQEA 2VH3A 3ZTMA 3IQTA 5JT4A 3EG9A 3A9CA 3PHF2 1YDIA 4JIOA 3CSKA 1SF8A 4C3EA 4YT8A 4LDQA 2IXNA 1HMDA 4PJMA 1GS9A 2VCCA 4OINF 1LIHA 3LNRA 4PFOA 1PV3A 1MMGA 2JX0A 5JUAA 2OOCA 3DZAA 5IY5C 1OCZC 2IXMA 2LFDA 5GPGB 5L0HA 4CDAA 3C8GA 4QI2A 1T6IA 2OCCC 4XWJA 4MVQA 3RVZA 4CIPA 1ZHTA 5KYWA 2VCBA 3SEOA 2XXAA 3T9OA 1TWHA 5CI9A 3EQLF 1FNTc 1MMNA 3NDBB 2PFDA 2IOQA 1O5HA 2B0HA 3OEOA 1W2WA 4J7YA 3S29A 4K0DA 3WG7C 2X0CA 2R7WA 4GEHA 3GWLA 4O79A 2CGEA 4W8PA 5A6KA 3GEEA 4YL3A 2QUPA 4RDAA 4EBJA 1K04A 4NQFA 2P0NA 4EUKB 2IXPA 2YEVA 2XM0A 3MFNA 2WVOA 4KC9A 2HV6A 1Q0DA 3MYFA 3TD7A 4ER9A 4BEMJ 5BQHA 4Q5SF 3ABKC 4JZAA 1A41A 1ZHWA 2XL6A 4DRHB 2W9YA 2YKZA 2EILC 3BEHA 1YZCA 3SP1A 1S05A 2HMQA 4E17A 1O87A 4XLPF 1VLSA 1FFTC 1YARO 2XLVA 2KW3C 4DBQA 3FXHA 1ZU4A 1Z23A 4BJ1A 4YWQA 2WZLA 3KYJA 3NKDA 4RBNA 3QMKA 2PP4A 3AJMA 5D92A 4X0RA 5F28E 1CPRA 3G4ZA 3KPHA 1EQ1A 4LACB 4MVMA 5KYYB 3FHDA 5DQTA 3M1CB 2XXAB 1A7VA 2OJED 1D1AA 2CYDA 1YYXA 3O6XA 2DGJA 1H7IA 2YL0A 3EFOA 3PCVA 5KYUB 2HSBA 5L3QA 4XTKA 4G7HF 4YL0A 2YLGA 5CI8A 5A6JA 1T6QA 3K66A 4U5HA 3AGUA 3L8JA 3DWWA 4CS7A 1T5OA 1TFOB 2PBEA 2Q00A 1UFBA 4OD4A 1NZEA 1RCPA 2KGOA 3DI5A 1GGQA 1HE1A 4J7TA 5TJ5E 2EPOA 3IHUA 5E2QA 3RW0A 3EZHA 4YK5A 4DXWA 1YYJA 3HNIA 1VLTA
chains in the Genus database with same CATH topology
1YA7O 3JTLO 3JSEO 3JRMO 1YAUO 1FNTc 3IPMO 1Z7Qc 1YARO 1AVOB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YA7 O;  3JTL O;  3JSE O;  3JRM O;  1YAU O;  1FNT c;  3IPM O;  1Z7Q c;  1YAR O;  1AVO B; 
#chains in the Genus database with same CATH topology
 1Y4C A;  2AWC A;  1OQC A;  3PMR A;  3ASN C;  3UMI A;  3J06 A;  1LVK A;  2NSG A;  4EKW A;  4MTG A;  1T01 A;  4PJN A;  1C02 A;  1ZW2 A;  4CBE A;  1HE9 A;  3EGX A;  3EG9 B;  4LDK A;  2J9V A;  1HW2 A;  3IQ5 A;  1QQ3 A;  1V55 C;  4AL0 A;  256B A;  3C62 A;  1UG7 A;  2V3C C;  3ABM C;  5DS5 A;  4DVY P;  1VYI A;  2NPU A;  2P1A A;  3H2V A;  4N6H A;  3RF3 A;  4G0H A;  4R32 A;  3ATP A;  3AGT A;  3C63 A;  2R02 A;  2GWW A;  1VYK A;  4JTD B;  1FAP B;  3LES A;  3DMD A;  1ZW3 A;  4ZLD A;  4HFK B;  2PF4 E;  3C8G B;  3LJB A;  4YT2 A;  1SR2 A;  4JE9 A;  5BUO A;  2XL4 A;  3OA1 A;  3ZDL A;  3ZSU A;  1NFO A;  2L6H A;  3EGD A;  2AVK A;  4BJT A;  1GM5 A;  1LE4 A;  1WOL A;  2G3K A;  3TOM A;  1LI7 A;  1ORS C;  5KYW B;  2XL8 A;  2W45 A;  3JZ0 A;  4Q7C A;  3B9Q A;  3EJN A;  3IEE A;  3NMK A;  5COG A;  4E0H A;  3IQ6 A;  3EPV A;  1ORY A;  2WVQ A;  5AC4 A;  3HNL A;  1D0Y A;  1VB5 A;  4YT5 A;  3C18 A;  4JJF A;  4MVO A;  5KYN A;  2J45 A;  3W4Y A;  2ICW G;  1WN0 A;  1VTM P;  3GEH A;  4CJG A;  1VOM A;  3GM3 A;  3NMJ A;  3JYY A;  3QTH A;  4JVS A;  2GAQ A;  4BG0 A;  3CAX A;  4BJ5 C;  2CW0 F;  3AG1 C;  3HNK A;  3Q6M A;  4OIQ F;  3K33 A;  1NG1 A;  4M63 A;  4O6N A;  2OQM A;  1RMV A;  4EIY A;  1VK5 A;  3QVZ A;  1U0B B;  2PNO A;  2EIK C;  3KKB A;  4C3D A;  4FES A;  4CS8 C;  4HFF B;  3A11 A;  2ZXO A;  3HLZ A;  1D1B A;  2QE9 A;  3JRM O;  3W2W A;  5JS5 A;  4HE8 D;  4U5G A;  2PX3 A;  4BPM A;  2GDC A;  1QKR A;  1CGM E;  3W8H A;  2XLH A;  1CGN A;  4O7G A;  4D4N A;  2IM8 A;  2C03 A;  2Q9B A;  4KBL A;  4PK4 A;  3ASO C;  3RFY A;  3U2M A;  3TJ6 A;  4E18 A;  2V26 A;  2CDQ A;  3SXZ A;  1G5Z A;  3ZQY A;  3SZR A;  1NU9 C;  2I8B A;  3EFO B;  4PJL A;  1BBH A;  2XS8 A;  5F5H A;  3V5Y A;  1I4Y A;  5DLJ A;  1K40 A;  2YRF A;  1A7E A;  4JCZ A;  1H6G A;  4W8K A;  3FDQ A;  2CCY A;  4JRZ A;  2LQG A;  2EPL X;  1OCO C;  2R05 A;  1LKX A;  2Q9C A;  3I4U A;  3UR3 C;  2AWY A;  5A69 A;  2DYS C;  1D0X A;  4IAR A;  1G4U S;  2A68 F;  2LFF A;  4JC7 A;  5L0I A;  2YHS A;  1H9G A;  4OIR F;  3WAQ A;  4IRU A;  5L0D A;  4L6R A;  4A4A A;  2H8A A;  2NSF A;  4NTF A;  5A6B D;  1FMW A;  1HW1 A;  4U5C E;  2DB4 A;  4CSA C;  1M57 C;  4FWV A;  4ULV A;  3T4R A;  5L0G A;  1ZVZ A;  3RH3 A;  3V7O A;  3DKA A;  3LEV A;  1ZHZ A;  2HZ8 A;  2VCA A;  3C8Z A;  3EGX B;  2KYH A;  3RKO F;  5EK0 A;  2CNW A;  4NC3 A;  3VF0 A;  3BRJ A;  2H7B A;  2HSQ A;  4I1O B;  3L0I A;  4MS2 A;  3UMK A;  3JRT A;  3S84 A;  4U5D E;  2NUT A;  1XZQ A;  4H54 A;  2J8W A;  2Y3G A;  2D5R B;  4KI2 A;  1PCX A;  1TWC A;  3AG3 C;  3RQG A;  5JVE A;  2Y3D A;  1RXQ A;  2Q4F A;  4WGZ A;  1APC A;  4BJ6 C;  2NUP A;  3SXM A;  1G4W R;  1HMO A;  1OKK D;  1YVI A;  3B0P A;  3EH1 A;  4JKV A;  4P9T A;  3LLK A;  1WWP A;  4P6I C;  2Q9A A;  1NLX A;  1M6T A;  3QZC A;  1LS1 A;  1I5N A;  4U5B E;  2J7P D;  4I1M A;  2QLA A;  3EGD B;  1V74 B;  2L7A A;  2W4M A;  3HNJ A;  4A2N B;  2KK1 A;  4OIO F;  2UUH A;  3LNM B;  2LIG A;  5DS6 A;  3KMI A;  1E86 A;  1QVX A;  2GFH A;  2EIM C;  4CIH A;  2R7S A;  3SYN A;  4BJ5 A;  4WGY A;  4AL1 A;  1IZM A;  4NCQ A;  5DVW A;  2WZF A;  3DE9 A;  3SXK A;  1BR4 A;  4EWC A;  2L6G A;  3B0U X;  4O6M A;  4XEV A;  1PD0 A;  4D4X A;  1NFN A;  2YL7 A;  1Q0G A;  1U6H A;  2XLE A;  4CS8 A;  2OEV A;  2EIN C;  3JSZ A;  5B3S C;  2QY9 A;  4J30 B;  4MQ9 F;  3FAP B;  1Z7Q c;  1ORJ A;  1R5I D;  2OEX A;  3V5X A;  2EPN A;  3JCU Q;  3O10 A;  2L81 A;  1RJ9 A;  3ZIB A;  2WVN A;  3SNH A;  5A6A A;  4H4K C;  3KYI A;  2BL2 A;  4CX9 A;  1KNY A;  2JPU A;  1J8Y F;  3FOP A;  3GM2 A;  3OWT A;  3NYM A;  4DVZ A;  5HSW A;  2HMZ A;  3K1I C;  3MLG A;  2WB7 A;  4XEK A;  2Y3B A;  3U3B A;  4MTO A;  2R7V A;  1RKC A;  3QVY A;  3C7J A;  4P9F A;  2ZPA A;  1T6U A;  3O39 A;  3O55 A;  1QZX A;  4YL1 A;  4AE4 A;  4JUR I;  3TQO A;  1MNE A;  4PR9 A;  4RD9 A;  3U9M A;  2LP4 A;  3AQC A;  1WAS A;  3EHN A;  1F1M A;  1JRA A;  3GM1 A;  5L0C A;  1QLE C;  2R25 A;  2I15 A;  4GQH A;  2J9W A;  2R03 A;  3I5Q A;  3Q6N A;  4QI0 A;  1MQV A;  1Z5Z A;  2HV7 A;  1E85 A;  4CSA A;  3US6 A;  2R7Q A;  3Q7L A;  3ABL C;  2P7V A;  1ZZP A;  4DRJ B;  1Z63 A;  1Z6A A;  5JSL A;  2DYR C;  4Z9H A;  3U8P A;  4E0I A;  2VC9 A;  4DOZ A;  2HKV A;  3R2P A;  3ZC4 A;  5AC5 A;  4KNW A;  5AGF A;  3RYL A;  2TMV P;  4XEF A;  3ECS A;  3M4B A;  2LK4 A;  4FX5 A;  4UDV A;  4PAC A;  2MYS A;  3S27 A;  2IYL D;  5L3V A;  3L34 A;  3U8V A;  5B1B C;  5EHH A;  3IPM O;  2XSE A;  1KTM A;  2HS5 A;  3KL4 A;  4OD5 A;  5B1A C;  3G50 A;  3AQB A;  1XWJ A;  2KJG A;  3F47 A;  4BJ6 A;  4AX2 A;  2RD9 A;  1ZU5 A;  3B71 A;  1EI7 A;  1M56 C;  1AEP A;  2C04 A;  5T3T A;  3MX3 A;  2D4U A;  3G4X A;  1YA7 O;  1JMW A;  3JTL O;  2P6V A;  1MMD A;  2EIJ C;  4BEJ A;  4CDY A;  3C8G D;  2NG1 A;  2WL8 A;  4K7B A;  4O6Y A;  3DM9 B;  5FZT A;  3T6J A;  1G8X A;  4JTC B;  2J0W A;  1YLM A;  2NUP B;  3IQC A;  3ZVR A;  2XLW A;  4I44 A;  1TKN A;  1TWA A;  4IGG A;  2WZG A;  3FOO A;  4NTB A;  1GQA A;  4JJG A;  4CDV A;  3HKK A;  3H65 A;  5JLI A;  2ZXW C;  1M2V A;  3WHN A;  5KYU A;  4YJW A;  5BQG A;  1E2X A;  1R4T A;  1J8M F;  2A0B A;  2G62 A;  3R7C A;  2A6E F;  3I5P A;  3GOD A;  3M15 A;  1CPQ A;  3VAY A;  2KNH A;  2HUJ A;  4WJ0 A;  1OR2 A;  2ETS A;  2GA0 A;  3EZI A;  1V4A A;  3JT1 A;  3W8I A;  2CNW D;  4EHP A;  3UGP A;  2W4B A;  2L9J A;  3N2Z B;  1WGW A;  3B0V C;  2EPK X;  3POV A;  4ZLC A;  1LI5 A;  3ITF A;  1TWG A;  3TUL A;  4MVR A;  2R7T A;  4N06 A;  5L0F A;  1Z3I X;  1RKE A;  4XPY A;  1U89 A;  2BE5 F;  2ASR A;  1TFK B;  3V5Z A;  3AG4 C;  3K1I A;  3K7D A;  2OG2 A;  4MW8 A;  2HFI A;  4LLC A;  4N4W A;  4C7O A;  3DAG A;  4CS9 C;  1OXK A;  3VRC A;  3S90 A;  5L0J A;  4U5F E;  3WOD F;  1RJ9 B;  2YLI A;  1ZHY A;  3LS0 A;  4E7S A;  4OIP F;  1DOW A;  2E87 A;  2J9U A;  3DJU B;  2A6H F;  1CGO A;  4MTF A;  4DJ9 A;  3GEI A;  1YA9 A;  3HJC A;  1C17 M;  4IB4 A;  4E7Z A;  5CIV A;  2XLO A;  3JYH A;  4MVS A;  5B3I A;  3S9O A;  1SZI A;  3E9V A;  3L8I A;  3DD7 A;  3CEX A;  3KH2 A;  4CJO A;  4AE4 B;  1JR8 A;  2A69 F;  2R9R B;  5DQZ A;  1JOG A;  3N0T A;  3NYL A;  3U5S A;  1VMA A;  2DI3 A;  2XM4 A;  1D0Z A;  3QW1 A;  4HEA J;  4MVU A;  4XLN F;  2YL3 A;  3LUT B;  1N1C A;  3NKE A;  3U3F A;  4XQ1 A;  1L3P A;  4Z9I A;  4IAO A;  2OJQ A;  2IXO A;  2Z15 A;  4DRI B;  3HTK C;  4EBK A;  1B68 A;  1MMA A;  2ZD9 A;  2H7V C;  5KYX A;  1MND A;  5D91 A;  1LE2 A;  1YAU O;  1YZA A;  5JRA A;  4JW1 A;  3AOU A;  3LLI A;  3S28 A;  1L7C A;  2HJ3 A;  4U9E A;  1FFH A;  4U5E E;  2P61 A;  2H7O A;  2YLD A;  3S0X A;  1QSP A;  1OXB A;  1YJG A;  2UUI A;  4J32 B;  1OW7 A;  2AP3 A;  3T6G B;  1T9K A;  1BR2 A;  3VM6 A;  1A7D A;  1KU2 A;  5JP7 A;  3UMH A;  2L6F A;  4G7Z F;  1NU7 D;  1TQG A;  3M79 A;  2AU5 A;  2XS1 A;  3GWN A;  4JEA A;  3E70 C;  4IAQ A;  5COF A;  5COM A;  4PJJ A;  3M4C A;  2O9X A;  3DAF A;  3LEO A;  4Z9J A;  1AUE A;  1XZP A;  3FMS A;  1OCR C;  3TK0 A;  4ANJ A;  5DS4 A;  1HY5 A;  4YT4 A;  1EKY A;  2JD3 A;  2BC5 A;  2RSE B;  4WAB A;  5A6B A;  1S7Z A;  4NY3 A;  3TOL A;  3UNG C;  2YWA A;  3UGO A;  2X51 A;  3H2U A;  4ULW A;  3X2Q C;  1LPE A;  3K6B A;  1OR3 A;  1FMV A;  5E3A A;  4C3B A;  5HV9 A;  1M2V B;  3T6B A;  3DXJ F;  3U2L A;  3ZWI A;  3GOR A;  2KQ9 A;  3L1M A;  1EA8 A;  2YVK A;  3FAJ A;  3Q7G A;  4G78 A;  3PDM P;  1ZHX A;  2EPM X;  2ZXP A;  2Y39 A;  1AVO B;  2FAP B;  1LM3 B;  2Y3H A;  4CS9 A;  5T1D B;  1OKK A;  3LS1 A;  3U0C A;  3DM5 A;  4F4B A;  2J0X A;  1NSG B;  2J7P A;  2J46 A;  1RKE B;  3MYI A;  5E33 A;  1E84 A;  3CZ6 A;  3ZG1 A;  2QNL A;  1OW6 A;  4FAP B;  4G7O F;  1BDJ B;  1V54 C;  4C7O B;  4IJJ A;  1OW8 A;  2MHR A;  2XLM A;  2M4E A;  3DJN B;  1LS4 A;  4B6I A;  3JSE O;  5K0I A;  2J9B A;  2R7O A;  2R7R A;  3NMI A;  2Q3T A;  2Y69 C;  4XPX A;  1D1C A;  1WAT A;  2OKU A;  5BQI A;  2HJM A;  4K1O A;  5EGY A;  3GAN A;  1OCC C;  4DBR A;  1O3U A;  4QDL A;  2M64 A;  4XPW A;  1WTY A;  3K1H A;  2QTV A;  3EHM A;  1JPN A;  1H9T A;  1JAF A;  4IWB A;  1SYQ A;  1I4Z A;  2NUT B;  5T3W A;  2YZS A;  1BZ4 A;  1M2O A;  3MBG A;  1TR2 A;  1SMY F;  3LAY A;  4Q4Z F;  2LD6 A;  4MVZ A;  1ZYR F;  4I3M A;  3U9J A;  3F46 A;  1FR0 A;  1C03 A;  5KYY A;  3TJ5 A;  1DOV A;  1ST6 A;  5KYX B;  4KNV A;  5F5F A;  1IW7 F;  3X1O A;  4JEB A;  4U9D A;  1NBB A;  2VAS A;  4GYT A;  2A1D D;  2XRH A;  4N6C A;  3FVY A;  1PD1 A;  3AG2 C;  4NTA A;  2Q7R A;  3W2V A;  2G3V A;  1Q0M A;  4LER A;  3RIP A;  3QW0 A;  2KC3 A;  3RQF A;  4ONS A;  2XLD A;  2YL1 A;  1A0B A;  2LCH A;  3EH2 A;  2LSE A;  1Y6D A;  2ZXR A;  3DE8 A;  3RVY A;  2F22 A;  2B0J A;  4LLE A;  2FFH A;  3NYJ A;  4MW3 A;  2R7X A;  2PX0 A;  2MWQ A;  3B29 A;  4YN0 B;  4AK9 A;  2VB6 A;  3N24 A;  3CQZ A;  1JPJ A;  3ZTZ A;  3NRH A;  4JTA B;  2R7U A;  4EBB A;  4MND A;  1FTS A;  1E83 A;  5E3C A;  3VYW A;  2FGY A;  2KSF A;  2OU6 A;  4PFP A;  1K05 A;  3NG1 A;  1Q0K A;  2YQY A;  4JCH A;  3SXY A;  3ZQV A;  5FCL A;  2IBF A;  4LDR A;  1BR1 A;  1Q0F A;  2A0U A;  1QPU A;  3RQE A;  2VH3 A;  3ZTM A;  3IQT A;  5JT4 A;  3EG9 A;  3A9C A;  3PHF 2;  1YDI A;  4JIO A;  3CSK A;  1SF8 A;  4C3E A;  4YT8 A;  4LDQ A;  2IXN A;  1HMD A;  4PJM A;  1GS9 A;  2VCC A;  4OIN F;  1LIH A;  3LNR A;  4PFO A;  1PV3 A;  1MMG A;  2JX0 A;  5JUA A;  2OOC A;  3DZA A;  5IY5 C;  1OCZ C;  2IXM A;  2LFD A;  5GPG B;  5L0H A;  4CDA A;  3C8G A;  4QI2 A;  1T6I A;  2OCC C;  4XWJ A;  4MVQ A;  3RVZ A;  4CIP A;  1ZHT A;  5KYW A;  2VCB A;  3SEO A;  2XXA A;  3T9O A;  1TWH A;  5CI9 A;  3EQL F;  1FNT c;  1MMN A;  3NDB B;  2PFD A;  2IOQ A;  1O5H A;  2B0H A;  3OEO A;  1W2W A;  4J7Y A;  3S29 A;  4K0D A;  3WG7 C;  2X0C A;  2R7W A;  4GEH A;  3GWL A;  4O79 A;  2CGE A;  4W8P A;  5A6K A;  3GEE A;  4YL3 A;  2QUP A;  4RDA A;  4EBJ A;  1K04 A;  4NQF A;  2P0N A;  4EUK B;  2IXP A;  2YEV A;  2XM0 A;  3MFN A;  2WVO A;  4KC9 A;  2HV6 A;  1Q0D A;  3MYF A;  3TD7 A;  4ER9 A;  4BEM J;  5BQH A;  4Q5S F;  3ABK C;  4JZA A;  1A41 A;  1ZHW A;  2XL6 A;  4DRH B;  2W9Y A;  2YKZ A;  2EIL C;  3BEH A;  1YZC A;  3SP1 A;  1S05 A;  2HMQ A;  4E17 A;  1O87 A;  4XLP F;  1VLS A;  1FFT C;  1YAR O;  2XLV A;  2KW3 C;  4DBQ A;  3FXH A;  1ZU4 A;  1Z23 A;  4BJ1 A;  4YWQ A;  2WZL A;  3KYJ A;  3NKD A;  4RBN A;  3QMK A;  2PP4 A;  3AJM A;  5D92 A;  4X0R A;  5F28 E;  1CPR A;  3G4Z A;  3KPH A;  1EQ1 A;  4LAC B;  4MVM A;  5KYY B;  3FHD A;  5DQT A;  3M1C B;  2XXA B;  1A7V A;  2OJE D;  1D1A A;  2CYD A;  1YYX A;  3O6X A;  2DGJ A;  1H7I A;  2YL0 A;  3EFO A;  3PCV A;  5KYU B;  2HSB A;  5L3Q A;  4XTK A;  4G7H F;  4YL0 A;  2YLG A;  5CI8 A;  5A6J A;  1T6Q A;  3K66 A;  4U5H A;  3AGU A;  3L8J A;  3DWW A;  4CS7 A;  1T5O A;  1TFO B;  2PBE A;  2Q00 A;  1UFB A;  4OD4 A;  1NZE A;  1RCP A;  2KGO A;  3DI5 A;  1GGQ A;  1HE1 A;  4J7T A;  5TJ5 E;  2EPO A;  3IHU A;  5E2Q A;  3RW0 A;  3EZH A;  4YK5 A;  4DXW A;  1YYJ A;  3HNI A;  1VLT A; 
#chains in the Genus database with same CATH homology
 1YA7 O;  3JTL O;  3JSE O;  3JRM O;  1YAU O;  1FNT c;  3IPM O;  1Z7Q c;  1YAR O;  1AVO B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...