3IPRA

Crystal structure of the enterococcus faecalis gluconate specific eiia phosphotransferase system component
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
137
structure length
137
Chain Sequence
b'MLGIVIATHGALSDGAKDAATVIMGATENIETVNLNSGDDVQALGGQIKTAIENVQQGDGVLVMVDLLSASPYNQAVLVINELEPALQKKIFVVSGTNLPMVLEAINHQLLGTPIAEAAQAIVAQGKESVQAWDISM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTS system, IIA component
molecule tags Transferase
source organism Enterococcus faecalis
publication title Structure of the Enterococcus faecalis EIIA(gnt) PTS component.
pubmed doi rcsb
total genus 47
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 3iprA00
3LFHA 5IM4F 5T3UA 2JZNA 2JZOA 3BEDA 3IPRA 3MTQA 1VRCA 1PDOA 1VSQA 3CR3C 3GDWA 3B48A 3GX1A 4TKZA 3CT6A
chains in the Genus database with same CATH superfamily
3DOCA 1NONA 1WXIA 3MW8A 1WP9A 3HCOA 4IY1A 4GOKA 4J4BA 5FUYA 4YRIA 1APBA 1R1DA 3D5EA 3GELA 3D8BA 1N4DA 2BM8A 4ZJZA 1DC5A 1IU9A 2G6BA 2QAJA 5E38A 1DCKA 2CNOA 2C2WA 1A69A 4XIYA 5FPYA 5T7BA 1EJ0A 3A3NA 1QHSA 1U02A 4K6MA 4QOHA 4UEJA 1Z82A 4CEIA 1UBTS 1N8TA 1KS2A 3BIWA 4OCZA 1NBMA 2X0JA 3BE8A 5A62A 4N0PA 5LZ2A 4GH5A 3GD5A 5F2EA 5K8CA 4ZVMA 4IXNA 4K9MA 1T5BA 3D0KA 5ENZA 4UM5A 5F98A 2BMDA 2XKBA 2YXDA 1Z07A 2NLOA 3SQOA 3KQTA 1JVNA 4NBTA 4OTZA 4A2PA 1II0A 2PU5A 3VU0A 1NHWA 3EMBA 4AUNA 5A4JA 1PL8A 4WXPA 3H1AA 4GC5A 4JH0A 3QUAA 4Y8VA 3JU3A 4YREA 2ZE8A 2H1CA 1UBFA 2OGUA 2PX0A 3DF9A 2ZFUA 1VG1A 5F12A 5FDFA 3SZGA 3W4JA 1L7AA 1ORHA 4FC6A 1JFVA 5FAXA 4AN0A 4CM1A 2A1TS 4HFRA 5AMXA 3TRJA 2DPXA 4HPWA 3DEAA 4YV0A 1AS2A 2ZU0C 1ZMRA 2EJBA 5BWBA 1MNQA 5KYXB 1JDSA 5DHTA 2WAYA 2W00A 3JWIA 2J45A 4KODA 2VHTA 4RACA 1RAFA 4PHFA 3D2BA 1OX4A 3PEFA 2O9JA 2QTGA 3NTOA 1NI4B 4P4UA 5L51A 2UXDB 1AB5A 3IUEA 4F46A 4DNXA 2QTAA 1JXMA 3JQEA 3W78A 2KM1A 3TIXB 2FJPA 4RMHA 5ESWA 4GYYA 1VE5A 3D6VA 5AVVA 4PLHA 4Y6QA 3UKJA 2JIZD 4FFOA 4DOMA 1NMSA 5ERYA 4IIBA 2RBKA 4O08A 1QGZA 2QA5A 3KOWA 4UULA 3WGYA 5LIPA 3G5AA 4K0KB 4GX1A 4IIJA 1KR2A 2FOLA 2D1QA 3U4AA 4EARA 5IANA 4LZLA 5H8WA 3NKLA 3UFXA 4X7BA 4OH7A 4DW8A 3FFTA 1KVTA 1SM4A 4RDCA 4PSVA 3WBJA 1FFCA 2FPKA 1N0UA 1WY7A 4FYIA 1IZ8A 1DE0A 1P0PA 1THTA 3I9V6 3ANSA 2WTXA 4RKFA 5FP0A 3ZJ5A 2D1YA 3ZBUA 1V11A 4B2IA 2Z04A 5ADWA 3O9ZA 5JCJD 3UBTA 3O31A 4I2VA 3DUFB 4NAHA 1AGNA 2HZBA 1KJQA 5B58T 1RVDA 3GEBA 1KEEB 1SURA 3KB6A 4ZOQI 1NXTA 1Y5MA 3RYCB 1HK7A 4IICA 1H1LA 2I54A 2DWQA 2ZIXA 3WB0A 2APJA 5HFAA 1PR4A 2PT9A 4R31A 4OFZA 4LJKA 3DCJA 4ID9A 3O5AA 3UOAB 5C5IA 3CLKA 1Y37A 2NVUA 2ZJ7A 1QGUA 3LIPA 4HGQA 4PTLA 4NX2A 5SYMA 3TKYA 4S2EA 1X8KA 4RJKA 3JW8A 5JC1A 1J70A 3CNHA 4WGFA 1O7JA 2FLKA 2XSZA 4OI2A 4BKRA 1YOVA 4RKEA 1FBTA 2PEYA 1PR1A 3IVGA 3PQ3A 5AVKA 3ZLBA 2GTIA 5CEFA 2CLLB 2HN9A 4RYDA 5K3FB 5K3AA 3BHJA 5CM8B 2P4UA 4L08A 3W2EA 2VQ3A 4MW6A 3E3AA 3UMRA 2AG5A 5FNZA 4M22A 5DZSA 1OLUA 2TMDA 3K1TA 3NIBA 4Q39A 5BYKA 1O3YA 3AP3A 4K9KA 2B5VA 4BBPA 2GK7A 2P2CA 4BRSA 4EY8A 5FV4A 2XGSA 2HMYB 1EWKA 4LF9B 4R71A 1LZKA 1ZKDA 4TN1A 3NTQA 2VRNA 1YB4A 4CF6A 3GDOA 4IWNA 2H2IA 4PO3X 1TA9A 4M98A 2NXJA 3A9SA 2Q2QA 4YP5A 5T4EA 1RZUA 1YRQA 5EHGA 4WZZA 3JALB 5D3MB 4MQBA 1CDDA 3HSSA 4QDOA 4OEHA 4WPGA 2F55A 3DOOA 2FWRA 4LJ5A 4C30A 2LE0A 1L1EA 1X7GA 5HQ3B 1IM5A 2C5EA 3LKDA 4BQRA 1CF2O 3Q1KA 2RHJA 4QM7A 5ER9A 3OOSA 1CF9A 3H13A 1SHZA 3Q11A 3QFSA 3FNGA 4ZJPA 3DW1X 3E05A 4MV7A 2V58A 2XB6A 1GKLA 3P2JA 2IOQA 4IQ0A 4PYLA 3BXOA 5HIKA 1I24A 1QSGA 5BO5A 5I9BA 1OFHA 3OPVA 1MEOA 3JQ8A 3GRUA 1ZGHA 1YSCA 4LPKA 1DCMA 1DRKA 1Q0PA 2QUKA 2IYWA 4H08A 5LMUB 4BZXA 6PFKA 1RHUA 2J3LA 4HZUB 4PLFA 5FRDA 2DUUA 5HWSA 4MQ4A 2ZWVA 5B58C 3UPUA 3DT6A 1CP3A 2P35A 3RNOA 3TL3A 3JQCA 1WXDA 4P2GA 5KJ6A 1Y1QA 3BGDA 4UDXX 1XXHE 3G7UA 5A4KA 5EZYA 3MSXA 5KTSA 1QKIA 2ISQA 1IATA 2QRVB 1SXGA 5DK6A 1FFEA 1MO6A 3V1NA 4Z1MD 1Z0UA 2PX3A 5CT4A 1PE0A 3JATB 2OGTA 4XYGA 1GR1A 3TFOA 4UUNA 1A27A 3T4UA 2ZAYA 1ZOIA 2E89A 1R9MA 2I6XA 2Q50A 3X3HA 1EESA 4NFSA 4E5NA 4A73A 5EIEA 2NUBA 5G1NA 4C4ZA 1Q84A 1PJ3A 1P1HA 4C14A 2GKSA 4Z9BA 3FYTA 4E5KA 1TUBB 4Y7CA 5BVHA 2RGRA 4YN3A 5EJ4A 4F92B 1TEHA 1QG6A 3W3AH 4COOA 5JCPA 3KQPA 1U28A 2CNKA 1IN4A 1P60A 2J5KA 3LUBA 2IS6A 2YXLA 1VJGA 2WIKA 4KN6A 4MVJD 3UTDA 1CETA 2PGDA 1KGDA 3Q87B 4NBSA 3NTXA 3RSOA 4JWKA 2A4KA 1IIRA 1OAOA 3M6UA 2BFAA 4C4PA 5M7EA 1HYQA 1QZUA 4X3CA 1RJ9B 2Q1YA 4FJ1A 3TH5A 2IYTA 3GFRA 3ZDFA 2PIAA 3B7WA 4AKHA 1FRZA 3PEWA 3I5MA 4MUMA 3T7IA 2EF0A 3HKEA 4OYYA 5I4BA 2XX3A 4QEKA 5I7FA 1A9TA 5A3VA 1FIUA 2NYVA 2VOEA 2BFNA 3U3JA 3J81A 3HXOA 1GNRA 5FBVB 1QS0B 4AO7A 1HSZA 3TD2A 5C8YB 1JU4A 3O8DA 2GARA 4DNOA 3U61B 3CGGA 3JQGA 2ACWA 2ZU6A 4X71A 5F21A 4CMBA 1P4JA 1IUOA 4NL4H 1EVIA 4JHXA 2W4QA 4YRGA 4KLCA 2O8NA 1OX4B 3KDAA 2C2YA 4J4HA 4B71A 5IT9A 1YC5A 3LRTA 3UYKA 3V4ZA 1C8BA 1K98A 1VHTA 3AF4A 4OKNA 2Y0DA 4XM0A 3W9SA 4NYIQ 1GNQA 3JYOA 3ZWCA 3R44A 1ZI6A 1GHTA 1N5MA 3FCUB 5EWLB 3EGDA 3USZA 5I7VA 2O8BB 1E3QA 4XTCS 3N6VA 3V1YA 2EW1A 4RLSA 4UUMA 2VDJA 1BNCA 5BURA 1L7DA 4YGXB 4DRXB 1TZ2A 4MQMA 1NIJA 1U7DA 2C98A 4HDSB 4HQLA 4QUGA 1W75A 4DLZA 4F56A 2CYBA 1PZEA 1W5BA 1YVPA 1PT9A 4B44A 3ZHTA 1Y3CE 1PL0A 5EZQA 3U4GA 3F6YA 1PEAA 3QNUA 2G76A 4CHTA 4Q7QA 1D2AA 1QQTA 4IIYA 3BGWA 4OU4A 3GPBA 4YRCA 1R37A 4LF6B 4GKVA 2G6TA 2HWUA 1I1NA 1D07A 2GNOA 3AW8A 1DRWA 2ZSEA 3MTIA 1N3YA 1XZ8A 5AHRA 5E6SA 4CIDA 5JADA 1OZAA 4MGIR 5EZ5A 3WWYA 3ZGYA 4G0PA 5KC8A 5F23A 1YZ3A 3CRVA 3FZEA 2RHDA 4N9QA 3JPYA 3C5CA 1K6IA 4N3BA 4EHDA 2FA9A 1GUDA 1U3VA 2YBEA 1GKUB 5F33A 1JKFA 2JVKA 2ODBA 1T36A 1I9GA 3WL5A 5TLSA 1RHKA 5B12A 4CKYA 1YZLA 3D6UA 1XG5A 4X8HA 4BNLA 2R86A 3GCZA 2MINB 1INLA 3L43A 1OH8A 1PR2A 4OQYA 3EC2A 4KUGA 2OBFA 3L4KA 1GZHB 5JSHA 3WB9A 4HPXB 3C7AA 3DE0X 3A7EA 1R6BX 2CDNA 3JS5A 4J9VA 1GUBA 5KQPA 5HJ5A 3M6LA 3A31A 3GC6A 3O8OA 4Z9FA 1FLVA 4REMA 4CQLB 1B2RA 2A57A 4E94A 3K0SA 1FLNA 1UZUA 1Z13A 1VLVA 3DE5X 3WLTA 1M9NA 3IXQA 3IGFA 1TI7A 3N28A 4L0DA 1WW3A 1QF9A 4PIVA 4RQTA 5A02A 3TQCA 3CB4A 5KNCD 3RR2A 4NBWA 4JB8A 3M0EA 4TXHA 5E4TA 4B35A 1TM2A 1FTQA 2WTEA 3H2KA 1SN7A 2LIVA 2IV3A 1SVKA 4FEGA 4NHEA 4G1UC 4KAAA 5JCOA 1T8UA 4P4SA 4BFTA 4IOMA 2VDQB 4BQQA 2AMLA 2P68A 3ZE0B 1YBAA 3HN6A 1JPVA 1QQ6A 1FUKA 1RYHA 1O0CA 3I04A 3WK8A 3IVMA 4F4HA 1LZLA 1HBJA 5FI1B 5A05A 1A5TA 2W6JA 3NIGB 2VPPA 4FS8A 2DM6A 4MCAA 2X13A 1S2IA 2WK1A 5IC5A 4EHLA 3MCVA 1QPBA 2H0AA 1SVMA 3ANYB 4LS3A 4QOEA 5B37A 3SX2A 1DDIA 3L6UA 3TSWA 3CGWA 1NDHA 1XEFA 1XYGA 4NY1A 4J16C 4QFDA 2QTRA 5JZVA 2AW3A 1ZU5A 2F17A 1KO8A 3DAHA 4EYKA 3E5MA 5K09A 4G9EA 3QENA 1UMDA 2CFCA 4OBXA 1Y42X 4IO1A 1Q1QA 2YVKA 2MINA 2RC5A 4YRLA 3H5VA 4PSUA 4Y9TA 3T3HA 5HJEA 1ZK3A 3DLHA 2RGYA 4MVJM 4Q19A 1EDOA 3SJ7A 4MKHA 4EPTA 2FUG1 4N8SA 2DG2A 2PVSA 3AFHA 3QVWA 4Q6BA 4TLBA 5FO0A 1XQYA 1FYFA 2Q5IA 4YUWA 1LSJA 1YBHA 2PNFA 3VXKA 1IJBA 1S1MA 4FBGA 1H1TA 1JXOA 2VG8A 5BW8A 1Z6TA 3C16C 1SC1A 1OLSB 4EMSA 2GESA 5AUNB 5KREA 4KR6A 1A8HA 1FP4B 3PD7A 4PZCA 1E1RD 1MC8A 4UKDA 2JZOA 3AL2A 1KERA 3KR9A 3NVAA 4B83A 4DCCA 3CXRA 2G0NA 3I9LA 4UNIA 3QEMA 2A1UB 1YL7A 4OHWA 2BEWB 4I8IA 1C41A 4N3AA 1TLLA 4TVBA 3O2NA 3VR4D 3NWOA 3E1GA 2NG1A 2FSPA 1ECJA 2WWFA 3A70A 4XRRA 1RWOA 2G36A 1WLYA 2CWWA 2E82A 3O1HB 3ON5A 2B3DA 3PXXA 4TRJA 3LXMA 3MJDA 3SSMA 3ELBA 5DGTA 4DXDA 3WGMA 4WJZA 4GS5A 1C7FA 3JQBC 1QHFA 5A5EA 5JJCA 5L4NA 5BSKA 2QSZA 4IDEA 1NXVA 1D6JA 2SKCA 3H2ZA 3G1WA 2J3IA 4GZ3A 5EP2A 1EZ4A 2KI5A 3T1OA 2QIOA 5CFZA 5HZMA 2YZ2A 4CKCB 1NQAO 3LRPA 4P7BA 5A5DA 5EKTA 1OB5A 2L0XA 2QT9A 1RJWA 4LZZA 4AJ4A 1UFQA 2UZ3A 4JBGA 3R3YA 2WI8A 2H1VA 1ORVA 4EABA 1QRTA 3KL4A 1TPZA 3GRVA 2IYLD 2WPDA 3CWQA 2PBFA 3TZBA 4PZDA 4BKOA 1UKAA 3LE8A 3C7KA 2DH5A 3TTUA 3VKVA 5JLAA 4RS3A 4Q9KA 2C7GA 4RPLA 5I01A 4HAXA 4DC1A 4RHEA 1XVIA 2E5LB 3L7CA 3VJKA 4S04A 1AF4A 4IXDA 4BZQA 2K4MA 2PMDA 1OFGA 3RC2A 1EHYA 4CUJA 4Q7LA 2VJDA 4D0SA 3TIIA 4O25A 5K0NA 1PZHA 1NP6A 4XVHA 5E6UB 2FEPA 5CAEB 1A2QA 2QVZX 4K6HA 1DVRA 5EFZA 4PBTA 1K8QA 5LP6A 3KEGA 1CR1A 3GT7A 5LKAA 1P9NA 1GCOA 4HJXA 4LC1A 5CCDA 2QBYB 3KQHA 3QSYA 2VUTA 4KVGA 2V6MA 1RJ9A 1Z5ZA 2P9GA 2BRUA 3EYWA 3H65A 4MYHA 3GLVA 5CP8A 6ABPA 2NP6A 1LXCA 2J9FB 4QUBA 5EMNA 2NSJA 1KGSA 3FBWA 3T12A 3LXRA 2OSVA 4C4TA 5G0WA 4HYQA 4I4NA 2CVFA 3PSHA 4IDQA 2DC1A 2FPPB 1BJRE 1AN9A 2OCXA 1XRMA 2QTWB 2XBUA 3EY4A 5DBHX 1ZVQA 2ZSIA 1AKTA 4BLQA 3NUZA 3VKFA 1XEXB 4I4LA 2HIHA 1KI8A 1ENOA 3TE6A 3P9ZA 2Z4SA 1H4QA 2ZZNA 1FNNA 3LUFA 1B0UA 1ILEA 1U81A 4YLGA 4RK7A 1T4GA 4TS4A 3KL2A 4MITA 2H4YA 3LO5A 4MJXA 1WX1A 1EYZA 3EMDA 1T3TA 3K30A 3VYVA 2P6PA 2IPNA 4KWTA 1ZH4A 3DMTA 4JELA 3EUWA 2V4MA 5LMZA 4G0WA 2GRAA 2X8AA 5T41A 1CUJA 1F60A 3AM4A 4DCJA 1S8FA 3HWSA 1SCJA 4PV7A 3R09A 2RD2A 3CZ9A 3P94A 4LK3A 3B48A 4C5AA 4M36A 3I4LA 3C97A 3KE9A 3ZV5A 4ZCIA 4BGDA 1JHXA 5FYDA 4LC9A 5JQWA 4ZYXA 1L4EA 4GGOA 5TMPA 3Q9NA 4LTNA 3MGGA 4JLBA 2IVZA 4N5NA 4RENA 1T0UA 4DQ0A 1BDHA 1NLYA 4BDTA 5INTA 1P1IA 1LBHA 3W9BA 4RTMA 1IN7A 1IFXA 1OOEA 2W6IA 2BFOA 3E22A 4XDZA 2EWMA 1R0BA 4BQIA 2W48A 1TB4A 3NXKA 4IIDA 3OP1A 1G3QA 3GGGA 4QGGA 4HBZA 3SE7A 2DZDA 4HQNA 4RPGA 2FVYA 3B6KA 5G0SA 4DILA 3C8UA 3I1FA 4GOMD 5CJ2A 2DUWA 4MW5A 4IVQA 3UATA 3KTOA 2RCNA 1E61A 3P8ZA 3JZMA 4KDRA 3DOEA 2DY1A 1TYZA 4GE0A 3R3JA 1L5OA 1TIPA 2PKQP 4K1XA 1E77A 4L4RA 3L7LA 5KJ1A 1ULBA 3OECA 3TOZA 3OP4A 4DHEA 1JEEA 1NV9A 1USIA 2P77A 4R68A 3TDKA 2VHZA 1G8PA 4MLPA 4LA4A 3VKUA 4ETMA 3ZDBA 1NVWQ 4QYWA 5EYPA 2FEOA 2ZSDA 3CX3A 3WLQA 1QJCA 1K08A 3K09C 4C4RA 2E49A 3CHYA 4AQ7A 3WLNA 2V6IA 4LSZA 2NTVA 3RS5A 5CFLA 4QQRA 2HSZA 1TAQA 2C92A 1UBSB 4OREX 3ZBPA 1ISPA 4EELA 3O95A 1JFLA 3SYRA 4Z3OA 2CL7X 5DV9A 3ZWYA 2RAUA 4LF5B 2P30A 2EW2A 1QTIA 3TD9A 4ZDWA 1Q1ZA 4J94A 4M1OA 1Y3AA 2KW5A 1UINA 5DLEA 3SBDA 2MR5A 3LUGA 3MLBA 2BR5A 2PUGA 4MV9A 3WNCA 1V3QE 2JS7A 3HBJA 3VU9A 1MQ9A 3EVBA 3IUMA 5LBIA 3LLCA 1U8EA 3N8KA 4LNAA 5SICE 1F4VA 1LVHA 4HLQB 2VQEB 1E7QA 3MT9A 4UM8B 4OM7A 8OHMA 2R87A 1U8CB 1GFSA 5HF5A 1Q74A 2I4OA 3AEYA 4E32A 4GVLA 1QPZA 4X8LA 3VISA 4JEIA 2NZXA 4MCHA 4KN8A 3BIJA 4QOGA 3W2HA 1JG1A 3F3MA 4DLNA 3L82B 4RSGA 4B3DA 4G0XA 3EA5A 3MFYA 3AB3A 3DA8A 5TEWA 1L8AA 1T1EA 3UQYS 1W49A 2P78A 3PHIA 4HQOA 4QIHA 2GLUA 1RACA 1R16A 2XECA 3ZV4A 1QZZA 3BMCB 3IBSA 4JY7A 2CMDA 1R2QA 2VNJA 4J07A 3FVQA 4D8WA 4MR7B 1AKQA 4P38A 2OGZA 1QMGA 1O0BA 1VKHA 2MOKA 2MWMA 2R6ZA 1WCIA 1XRNA 4YAEA 1COWD 3QLUA 3WYAA 1PDWA 4KITB 1CJVC 4JR1A 2QP3A 1M10A 1E32A 3OZWA 4YMLA 3GFFA 3T1NA 4F5YA 4P92A 1JPJA 4BP1A 4B5KA 4DIFA 4EYSA 1Z45A 3U4DA 1QTRA 4FDUA 5BPFA 3MGKA 1T6BY 4KJZA 4MWEA 1XCPA 3U48A 4NCIA 4B6PA 1Z88A 4N82A 3LHSA 1FF9A 4ZTUB 3I2GA 4H3KB 1JLLA 1N6PA 5HMLA 1V8ZA 1E6MA 2AGVA 1FNCA 2FMTA 4BO4A 3IKMB 1F3OA 2X9GA 1NQUA 2BHRA 4X93A 1YZQA 9LDTA 3H1EA 3IXMA 3EPLA 4BVLA 4MQ6A 3J81k 5IW8A 1KI9A 2K6GA 3K1JA 1G2OA 2WOOA 5ANRB 3BAFA 3BFJA 4TVKA 5JAZA 2C7BA 4O3MA 3RBXA 1GPKA 4ZJUA 4UTPA 2XJ4A 2ZRNA 4ZT7A 3A4MA 3FRJA 3KAPA 1QK3A 5BRNA 3FZQA 4BJ1A 1LDGA 2WLSA 4U2EA 1CS0A 5B2ZA 1F06A 2DT5A 1Y1LA 3OUUA 1NNEA 5AWFC 4OKIA 1QC5B 2GPTA 2QL7A 5DX1A 3C3DA 4LJ9A 3T9DA 3FYSA 2JAPA 4FE7A 5BNZA 3PRHA 3ST7A 4YLEA 2XUDA 1O6FA 3IXLA 4IDFA 2SKEA 3HB1A 3TSOA 2Q9CA 3M81A 4EW6A 5BWMA 3L5OA 1R6VA 3I9FA 4Q18A 1EDBA 4PQGA 2IUEA 4DLRA 1Y33E 5KYGA 2J08A 1QWOA 1V8OA 1Y1TA 2OUIA 4QUJA 4TV9A 5ENDA 4OSOA 4C03A 4OHYA 1IDOA 3GDHA 3O75A 2PK3A 4LXUA 1X7XA 1Y6RA 1Z38A 5J4KA 4B84A 1DOAA 4UM7A 3EK2A 4NBRA 3VZPA 1AKWA 4UCXA 4AC9A 2OQVA 2I1QA 2WJYA 1CQJB 2JJMA 2QXYA 3ILHA 2O8EB 2NMVA 3S2UA 3KJGA 3A05A 2EJCA 1TZBA 3NPMA 4OD0A 1CUYA 3RFVA 3L7YA 1ZCJA 1SA0A 1SGWA 3O8OB 1VL5A 4LCJA 5I7AA 1QRDA 2XUKA 4BJHB 2EFJA 2FZCA 4V1CI 4RIHA 2AJTA 4OGFA 4X6XA 3LC2O 3AEUB 4BWGA 5DM60 1NMYA 4AVYA 4A5SA 1U0GA 2KQUA 1B43A 5KNBD 4CHGA 5CDYA 4ZQGA 3PDJA 3EXIA 3LWZA 1ZN2A 4DNPA 1ZHFA 3CPEA 3UJDA 1VSUA 1VP3A 3ZV6A 2PPVA 5COBA 1IBRA 1UZMA 1O87A 2GYVA 4PCLA 1TECE 3ZX4A 2XV1A 1FNBA 2X15A 1CNEA 3E6AA 4RA6B 1VL0A 3SJZA 5M2QA 1JQ5A 1AHIA 1KDOA 2P2SA 3ANNA 2PO7A 1YCGA 1VIMA 1E60A 4OJTA 1YQQA 4MDYA 1ECPA 4BX9A 4N0QA 3FH0A 3K1AB 4LHEA 5GGXA 4M54A 4PLYA 1Z18A 4K6GA 1WXQA 5IVKA 5CVEA 4HWPA 1B6GA 3TR5A 3VOSA 3AJ8A 4IVPA 4WE3A 5IAEA 5C4MA 5K3OA 3KKLA 1NUPA 4W5WA 2I2CA 4MVCA 1J07A 1ZD9A 1EFRD 2X6QA 4H7KA 4U2BA 4ENWA 5C2JB 2VYVA 4LN1A 2I7VA 4INZA 1YR2A 4S1WA 4I55A 4ZIRA 3THXB 1N2JA 1KO4A 3IIMA 3INNA 3ZX5A 1TM7E 4U00A 3CMCO 3EUAA 1ACLA 4ZEXA 2CXRA 2M1XA 4WBNB 3FZGA 3FYDA 3ZBQA 4PNPA 1G5TA 1FU8A 4LWPA 2Y1XA 2DKOA 3AWIA 1I3LA 1XTBA 3PK0A 2PT6A 5JSQA 2R65A 4CL3A 1EMDA 4TZKA 2J9ZB 4PC2A 1EWYA 4D41A 4FGUA 3D3EA 4ZKEA 2B35A 4F3NA 1XAGA 2BC9A 5T57A 3EQZA 4KVZA 1OILA 4Q24A 4DF3A 5HYVA 2VTBB 1OFTA 3E22B 1M2WA 4NQRA 5KUTA 1ADCA 1GN9A 3ZWAA 1HQKA 3SQMA 3AV0B 3ZS9A 3OJFA 3AO0B 1JHMA 4GBED 3LXXA 2OD2A 2V6JA 1R0XA 3CG0A 3ND9A 4J7AA 4X44A 4POAA 1NVEA 1BKYA 3RVNA 4EKIA 5IDWA 4WQMA 1I13A 1XWIA 1TCBA 4KXVA 3W5UA 3S8EA 1GIAA 3IEVA 3HU3A 5FOWA 2A78A 3N7UA 3Q2KA 1PZMA 2XE6A 4YACA 2JGRA 1X7DA 4M83A 1H69A 5HUJA 4BLTA 2M6KA 2XLCA 5IN5A 3MYYA 2IHTA 6Q21A 1FNDA 1MKYA 2VHQA 2XIJA 3B52X 3OO1A 4WL0A 3UT5A 4JQCA 1GUFA 3C7TA 1T4BA 1VJCA 2NX2A 2C2OA 2PH3A 2QNBA 1LEHA 1SKYB 3MQ4A 3P9RA 2OYCA 1HNXB 1DG9A 3ZWOA 1YASA 5IDXA 1DJLA 5FPKA 1DO2A 2AC7A 2EKQA 3RANA 1F5SA 2IODA 2PJDA 3H17A 1Z0JA 1N2CB 2Y1OA 3VTKA 1N75A 1EFHA 1PZXA 1JQ3A 4BEJA 3ORSA 1KHTA 2W2KB 3C5WP 3HCRA 3IV7A 2QJWA 4AYXA 2AN5A 3ZCSA 3T9BA 1GUZA 1GG5A 4KWCA 1GZ3A 3EH2A 2CV1A 2YTZA 1T43A 4QAJA 3BPSA 2X1LA 3JQ7A 4XLZA 4ZAXA 4AB1A 3NNSA 2BGWA 2WKRA 3K0FA 1N8KA 1R0ZA 2J3QA 1R4MA 3FI0A 1R18A 3FLMA 5EMJA 5AW5A 3ZWVA 3ZHSA 5HKKA 2YHUA 3HBFA 1FZQA 4L15A 3UWMA 5HIJA 3ICOA 2AVNA 1A3CA 3PC6A 1E1DA 2GVDC 1RSZA 3GLHE 4QYTA 1ZUIA 2GRUA 4KPYA 1C1HA 1DIGA 2H0RA 1GPDG 3CLSC 5ALHA 1VMAA 4Q48A 5JJBA 2GBCA 3PJEA 1U28C 4OYRA 1GILA 2PZEA 2JIOA 4EUFA 3QOYA 2FPPA 1K0FA 1E2FA 3B6EA 1QO0A 2VAPA 3OFKA 2YV2A 1JLHA 2H1HA 1QHEA 1LVGA 1P4GA 2QZJA 3D2CA 4IS2A 4HVTA 3VBCA 4E2XA 3CH5A 3K9HA 1T25A 2DXIA 4INAA 2FX5A 1JFFA 4IS3A 1ZJYA 2J48A 2V3VA 4FFVA 1PR5A 2JHCA 3I28A 2H00A 2ZYWX 3KFXA 6NULA 2JFQA 3ZTWA 2C7QA 4YCSA 1F8UA 1XEAA 5IUJC 2WT9A 2XYGA 4JBLA 4FNMA 5JAHA 1BE6A 2UYQA 4UZSA 5FBKA 2ZT6A 1M5RA 3WIOA 2IXFA 2RH5A 621PA 2VC2B 1JHDA 3V1TC 4KWHA 5BT8A 3ESBA 4XWKA 1D1SA 3H2JA 2WMDA 4OG2A 1YRHA 4B81A 3TLAA 2HH9A 1QIHA 1KKMA 1EB8A 4GM1A 4UHHA 1NJFA 1ZK4A 3I0NA 3KDPA 2R8OA 2VF5X 5IUNC 3HKCA 3NRCA 2TRSB 3KJXA 1BE0A 2DPLA 5I5GA 2J3HA 5EMKA 1UJ4A 5LLDA 1MAVA 1UM8A 2CXUA 1UPXA 3F71A 3OF2A 4NE9A 4V0QA 4EHKA 2IKSA 5HNKA 2WUGA 5HGJA 1QANA 3GRKA 3H75A 1SCQA 1U6KA 2HPHA 1EP3B 2OAQ1 3LWNA 4TS3A 4Y2SA 1UKVY 4Q4HB 3W8RA 3ZGOA 1A5BB 2PPLA 2Z2ZA 3KJEA 4M1SA 1EM8B 3V5NA 3PX7A 3FNQA 4MVJP 1QR6A 4S2UA 3CF0A 2HUNA 3THOA 3K4HA 2A9RA 2PXXA 2QMQA 4IUYA 2PUAA 3OKFA 1F6DA 4IRXA 4N8EA 5HKLA 4M8KA 3HR7A 3VNAA 1G7RA 1R5BA 5ERXA 1HM5A 1TT5B 2QIPA 3UFXB 3H6GA 3K31A 4ZYVA 2D5BA 4JENA 3KPWA 4L7QA 5AW7A 2WQ7A 1CUDA 3HCCA 5JVDF 1ID1A 1OTYA 4IPTA 5JYDA 3RHZA 2DQYA 3W1WA 3AU8A 1NNSA 1TK2A 2JD2A 3IUNA 2OHHA 1UCFA 2QTMA 1B7GO 1N2ZA 1E3MA 3TUIC 5M04A 4GPBA 4XRGA 1BHO1 2ZB8A 2H4FA 2GWHA 4L50A 3MXTA 1QOPB 2RH8A 2XEXA 2NUPA 2RKOA 3MXOA 4YMWA 2AG8A 1POWA 2EJUA 3LCMA 2WP0A 4QWMA 4UHCA 3RS4A 5HIIA 2IPAB 3N75A 2ECPA 4DYHA 1U3FA 4WZBB 3S1AA 2QAGA 1XVLA 1U98A 2ODEA 5E95A 1LD3A 1AUOA 3H11A 2FFAA 4QOIA 5F78A 4AW9A 3V46A 2XITA 2XXAB 2ZW9A 2QX4A 3LYUA 3EXHA 1A7KA 1CUZA 3G0BA 1N9ZA 1VDMA 1XV5A 2I3ZA 5G0TA 3NDJA 2JGIA 3KUXA 3QPDA 1U3DA 3OEHD 4I4TB 3VR2A 4WV3A 1HI9A 1GJRA 5IUKC 5IYZF 1BQ4A 1FVXA 1X3SA 4G1VA 4MEBA 4K6FA 1WMFA 3O4RA 4BGVA 3QJYA 4GMGA 5U9CA 1E0SA 4DSOA 1ZU4A 1G5QA 3EZ9A 1NU6A 3SVTA 4LWOA 1QG2A 2WWIA 3ITDA 5JH7F 3GGDA 1CP2A 3WA6A 1KWKA 5EJGA 3U1TA 4UHEA 3G2OA 3WIBA 1LU9A 4NU0A 1XFDA 2VNAA 3GAAA 3IAAA 4YAIA 2EZ4A 4RA6A 4H60A 1UJBA 4ITRC 1L6RA 1U1EA 5ECDA 3RRJA 4EJSA 5CITA 4YROA 1HTBA 1VYUA 1KDVA 4W5TA 1G59A 2G1KA 1TF7A 2G0TA 2IGTA 2RJ3A 4DCNA 4WUVA 3IFSA 4ZARA 2FUEA 1OASA 1Z7WA 5TB5A 4G3XA 3VNQA 1F0KA 1WVIA 1JKMA 1UFKA 2E4UA 4MKRA 1WCYA 2PBRA 2Z8YM 4DAOA 3DHYA 2EP7A 1UBLS 2J9XB 3Q3VA 2EP5A 4A5OA 1O94A 4FXPA 1KH2A 1YXMA 3HRHA 5AXBA 4Y30A 1JVSA 1RW4A 3RKUA 5FHQA 3SVZA 5HW0A 2Q8PA 1ULZA 3CX7A 4LV6A 1GU0A 4PS0A 4JOSA 3GFVA 2PMKA 4LQLA 3NOVA 2PJUA 1AS3A 2R6FA 5B30A 1Z06A 2R9VA 2ASEA 2AUTA 2CXXA 2E9SA 4JGGA 4M99A 3AVWA 5K3DA 1WD5A 1YMQA 3M5WA 4G0MA 3A1CA 3I1JA 1NFFA 4ALMA 3IV9A 4O4HF 2OG1A 2HUPA 4YRZA 4Y2PA 3RFXA 1IN8A 1E1MA 2F1IA 3LM8A 5CT5A 4YP9A 5CX1A 3CNOA 1GPAA 1P2SA 3LZ6A 2HJGA 3QEAZ 2GD2A 3AU9A 3B53X 1QZXA 2ZANA 3JQ7B 1P72A 3B82A 4F96A 4MLZA 1TTHA 5C7YA 3B6IA 4QTTB 2X5OA 4M1MA 4LOLA 1GITA 3NEYA 3WRXA 2HHHB 4NR0A 2NGRA 1QH1A 1MPTA 1D9XA 3QW4B 5LQJA 3TLCA 5KQMA 1L3BA 4KDCA 1DJPA 2FPIB 4TT3A 2I55A 3F9IA 4ZVNA 5LOVA 1AA9A 2GJSA 4R41A 1GGFA 1VRWA 2WF5A 5FF9A 1FXWF 4YECA 1NPDA 1JAHA 5CURA 4EJSB 4BMDA 1ONBA 1DBQA 2O2YA 3FUUA 1V48A 3BFVA 2GERA 4O0LA 1E7SA 2QRKA 3KAKA 2W8ZA 5EJFA 5BV0A 2R6GA 3X44A 1E5QA 1GRVA 5ALPA 5EXEA 1U8AA 2RAVA 1C3JA 2CEAA 4FHZA 1Q12A 3M8KA 3WAKA 3MEQA 3EBOA 1CQJA 1B14A 1D7AA 2AC2A 3B3GA 4OXKA 3WIUA 2QV0A 5CIYA 4MHOA 1F9EA 4X90A 2R2AA 4LYDA 1CD5A 4E7OA 5A3SA 1R8SA 2KMLA 4UMFA 3UWDA 3ZQ4A 4RF3A 3THYA 1M2NA 3AUUA 3GGJA 3FSJX 3VKWA 4I36A 3WK6A 3I12A 4FCTA 4FSXA 1FTYA 4KOEC 2XEDA 4BAZA 1HYGA 1Q44A 2FWJA 3IPCA 4HPJB 3OLXA 4JXKA 3PUYA 2QUBA 3WX0A 2Y6UA 3B1FA 1G98A 4AULA 5JZBA 3AEXA 3EQ8A 2CUKA 2RKBA 4BUJA 1A88A 4AMGA 1EFAA 1XA0A 4B4DA 2OLEA 1AV7A 1L7RA 3P5BA 1IIBA 2I2FA 5HBRA 3WLSA 4HWTA 3WMFA 1G2PA 2HWXA 3ZU4A 1AKNA 4B45A 2CBXA 2QVYX 2X0RA 2WEKA 2O6HA 4DRXA 4DDMA 3S8YA 3ZKWA 1T24A 5IC6A 4ENPA 2XD4A 2IUYA 3GROA 3AILA 1BEUB 4WFKA 3TCXB 3W6NA 4B8YA 1BS2A 4ZDKA 3O21A 1YRYE 3C1UA 2P2DA 4S35A 3HDGA 2LNDA 4XUEA 3RHFA 3ZS8A 1KJIA 4PZYA 4D9GA 1E79A 4XW2A 4KR9A 2B7LA 1HFEL 3L93A 1PWXA 4MDFA 1I7SB 2XQFA 1XZKA 8ATCA 5LDDC 4JZKA 1PDVA 2LP4Y 1TQDA 2VJCA 3OZSA 3PCTA 2DQSA 3C3PA 4HDMA 4JAVC 4E14A 4TXNA 2CXPA 2D54A 1OTHA 4UHJA 1KFKB 4UNRA 5C3MA 4WK2B 3FW1A 1VL8A 3OU7A 3VH3A 2DWOA 1H6BA 2XI4A 1KJWA 5AT1A 1C9YA 2GF0A 4ZXPA 3MRVA 1ZRHA 4N0EA 3CPJB 3ENKA 3D7RA 4TKMA 5HCNA 1L6IA 4KBFA 2HT6A 4P3KA 5C34B 1WLSA 1P2DA 1S3GA 1CQIA 3U0VA 5KDLA 1OD6A 5JSYA 5KNBH 5IASA 1HOXA 3GEMA 2CXSA 4YHBA 4O02B 2YV3A 1YJBA 2IEYA 3W6OA 2EX1A 1P91A 4QUDA 1GCGA 1QONA 1Y48E 1ZGBA 1FUYB 3RU9A 2CE7A 3QXGA 3HJBA 2WOJA 3NOXA 4W6QA 1U90A 3O03A 3T8YA 4B32A 3KQNA 1XZIA 2VR1A 4L9WA 5B7PA 5E9AA 4DSAA 2FXIA 5BSGA 4LZPA 5AW2A 2QROA 1EUYA 1IHXA 4PBSA 2C8VA 2MYTA 3NTLA 4E88A 5IT5A 4NZYA 2QN8A 2WD7B 2H0QA 3HZOA 4GECA 4PXSA 4RV5A 4XOUA 2VPZA 5JUWA 3LZDA 4ETIA 3SQWA 5TY0A 3DV9A 3RASA 3ZDYB 1PUXA 3PPXA 2ZRGA 1AUQA 3AVQA 1PEYA 1P2BA 4S1PA 1T2CA 3KSRA 2I33A 3PPVA 2PH7A 5F64A 5ETJA 1EB9A 1LF5A 4F8EA 2YIDA 2VUIB 4NULA 4Z86A 4F9FA 3WLEA 2W2XA 4TSKA 2BDTA 5F9MA 5ITZA 4POOA 4NYIR 2Z9CA 3OZTA 1O89A 2Q3DA 2JH8A 3M6XA 3OO0A 2VQFB 3SKXA 2D59A 1U5BB 2R25B 4RD4A 3V2HA 4Z7JA 1UPFA 2G5TA 4LAFA 2NO1A 3C43A 1XZNA 4KQXA 3T7AA 4EKEA 2E0IA 2DWUA 1J21A 3IHLA 4PYMA 2I80A 4BJ6A 1NVGA 2BW0A 4IZHA 1F2DA 3L8ZA 3GGSA 4K81B 2OO7A 4ZC1A 2HV8A 4N47A 2X7JA 2G80A 1HZZA 4EVQA 1N25A 2A33A 4FGZA 1LLUA 1CPYA 4B48A 3FNBA 1OYYA 3QI2A 5EXDA 4H6VA 3QA3E 3W04A 4DCOA 4TVSA 3K9NA 4ZN6A 2ZBGA 2DBYA 5EI5A 2JI8A 4PLWA 4JDPA 3MPUA 2F1KA 1DUSA 4RSHA 4CI0B 4OK3A 3UZUA 4QOSA 4BV3A 5CA0B 2LTAA 3R9IA 1DBPA 3RSZA 1OREA 1E2KA 2L42A 3TDNA 4AKIA 1OWOA 3KUCA 4PYRA 5H9VA 1CUBA 3L2OB 4HH4A 1ZGJA 1KEZA 4EF6A 3S8MA 3ZD9A 4CTJA 1RPZA 1RXWA 4FBLA 1YF3A 4LW8A 3QKRB 4HGNA 1KJ8A 2R8ZA 2FJ0A 1A4IA 1TYCA 4Y2XA 4CDGA 3ZDRA 3EVAA 5CDUA 2PU7A 2Q4RA 4N5MA 1XHEA 1YBMA 3VC1A 1I4EB 2WSIA 3E7PA 2DFKB 2O2EA 2O5RA 1TKRA 2I2WA 3VNRA 3X1MA 3QEOA 1YA4A 3RUHA 3ESCA 3SC4A 4AG3A 3R7NA 2G72A 1M6NA 1QCDA 1U4OA 2RSLA 4GP6A 1Z8NA 1XQ9A 4UUQA 3IP8A 4W8HA 4PO1A 4B4OA 1YB5A 2EC5A 4NXMB 4MNTA 4ETNA 1CIVA 3L18A 4ZVSA 4ADSG 1A04A 1UH5A 5EE9A 1EP1B 2YZ7A 3F5FA 3G8YA 5BUCA 4EPYA 1G3UA 2PJZA 3ROQA 1THZA 1HL7A 2DTEA 3IQXA 4A2CA 4BKMA 1AVTA 1FK8A 1SU7A 2O0HA 1K8ZB 2QXTA 3LPNA 4YONB 3FCSB 3AXTA 2Q3JA 3EF3A 1Q2UA 5CYGA 3KT0A 2GAOA 1IB0A 3BMNA 2OFWA 4CKCA 3EPHA 5BN1A 2C95A 4JP3A 3GLIB 1JIKA 1NF8A 1KYXA 5CLFA 3QMPA 4FHDA 1ISJA 4F2PA 2XADA 2X42A 3DV0B 1XTKA 2ERCA 4HF7A 2ZJFA 4FUQA 4FP9A 1MEEA 2D00A 2RI1A 4NF2A 3CZMA 4WGGA 3HDVA 2WC1A 4DCTA 1KQPA 1XP8A 3FLEA 4G0OA 2IHZA 1CZKA 3R5SA 3ETHA 4O2BA 2ZRQA 2IZ6A 2XBMA 3IT2A 1QGUB 1XIVA 1E9BA 3OH8A 5FOTA 3TL2A 1QHNA 3WK9A 3WOHA 1K4MA 4GX5A 2VF2A 3A0RB 5AVOA 2W7TA 1HDZA 1IZ0A 4Q1BA 1WQ1R 4W82A 1T6ZA 2VDWA 3EW7A 3F7OA 4ZOBA 5HMMA 1ZXBA 5ICFA 1E4YA 1ECCA 4MGZR 5C7OO 1BH2A 1LW6E 2FHSA 3BXEA 4KQ6A 4LSWA 2JFPA 4CTMA 3C0KA 3IUSA 3I6BA 3G2QA 3EJ6A 3PQFA 1ETHA 2HTEA 2JBHA 1MDFA 2IXAA 2W9XA 2IXBA 2X8BA 3DMFA 1TJ5A 2KS6A 4H6WA 4JQSA 4L0QA 4MVXA 2OFFA 4B6GA 4K8RB 5K0FA 3NPAA 4BGUA 2M6LA 3WXMA 5EIXA 3V00A 2O05A 2UZ0A 3ZPXA 4LGCA 1X19A 3PHJA 3D1LA 1EXVA 4ML3A 1OXXK 1P80A 4MK4A 1RQ2A 4ZRMA 1H2XA 3KQSA 3H4MA 3EHEA 2YJGA 1R27A 4QGFA 3IOEA 3BSSA 3QV2A 3S2YA 3I0ZA 4N0DA 1ODIA 2WAAA 3U0BA 1Y82A 1KXZA 5ECGC 2G5CA 4AJKA 3BRCA 1LBSA 3N1UA 3Q0EA 1ECFA 5C53B 2OHOA 3UHOA 2ECQA 5EPOA 1ND6A 4NAVA 2WWTA 1DAEA 5MFPA 1GU7A 1HX7A 1U99A 3BB3A 1TQHA 1Y8RA 5IVDA 2RAPA 1GDDA 1EWVA 1JNXX 2ATCA 1UODA 1F4LA 3HJCA 5JQGA 1I6LA 4B0OA 4DRZA 4ZEMA 1WIWA 2OWDA 5TVGA 5A3RA 4IM7A 4PYOA 4MW7A 4MQFB 5ITVA 3GT0A 4LEIA 3DLIA 5CTJA 5BUZA 1QYWA 3U4QA 3HLKA 3LP6A 3BWDD 4FTWA 2GYWA 1FP6A 4L5YA 1QGOA 4LGVA 1XYYA 3WL6A 4YUXA 2POQX 1A4XA 5IJZA 4LNHA 4Q9AA 3CLRD 3PTAA 1V5FA 5J2UB 2ZSFA 4FILA 2QM3A 4AROA 2E7ZA 4AG5A 1XR3A 3DZCA 1GAQA 2D0OB 3JXEA 5K0JA 2FLVA 3OY2A 4HATA 2PD4A 4CBVA 1DWQA 5LQRA 4RU1A 4LOJA 4HC4A 3E2IA 4JLNA 4NCHA 4PPNA 4I99A 1WSWA 1QVRA 3K4PA 2I3GA 5ALQA 3WLKX 1ZMTA 1AKUA 4JUFA 1W76A 5C1IA 3CUVA 1V9CA 3T7EA 3GLGB 4DV0B 5FOXA 3NIWA 5DTEA 2BSQA 3T34A 4U3JA 1KVQA 4Z8YA 1YAHA 2ZSJA 3V42A 1P7WA 5C3UA 4BLRA 3V7UA 5K01A 2ID7A 4TWIA 2GZHA 2PZFA 3BREA 3CZRA 4L3OA 5AQ1A 3CE6A 5TS3A 1UEXC 3TTSA 4IFEA 3T1VA 1GYQA 1OX6A 2QLTA 4GD3Q 1QNLA 4XARA 2A9PA 1Q77A 4C20A 2C7OA 1JLMA 3FXAA 1BDMA 2BFCB 2REQA 2OZEA 5PNTA 1Z34A 4TQAA 3V32A 1ZZEA 3FOBA 2RGGA 4CETA 1CE8B 2VO1A 4RF4A 5THKA 2I91A 4K9NA 3LRXA 1D2HA 1E3WB 3PGKA 3WGLA 1TGVA 3M1IA 3TFWA 3N07A 3HEBA 1RHMA 1SXPA 1MX9A 1O5OA 1O9BA 1A0OA 1DAFA 5D86A 1U7PA 1ZLYA 4YC7A 5LFAA 1NBAA 5L7WA 2DCMA 3S29A 2K87A 3NNDA 3NTRA 3SP1A 5AXAA 2RGXA 3C6ZA 4II2A 4LTMA 4RVUA 1RU3A 4AF6A 4EYOA 5IFLA 2H7CA 4RPKA 4HH3C 4KVFA 2Q1SA 2GCGA 4TTTS 1LRJA 2O07A 3ABZA 2W2QA 5CB4F 4U7GA 2P9EA 4I1RA 2WJ4A 2PL1A 1WXXA 1EGAA 3V8VA 2C9DA 4CT5A 4WNCA 1RZVA 1O4WA 2BCJQ 1B93A 5CJJA 1QAMA 3ZJYA 3I3SR 1DX6A 5AKZA 4ASUA 1KIAA 4PC1A 1ZN8A 2XYQA 1J49A 3PITA 3HSKA 4DQXA 1DFIA 1REQA 3E9NA 1HE3A 3D43A 3RS0A 3PUVA 1IK6A 4PZ9A 1SEVA 4LDRA 4N7RA 3F6EX 2XOKD 2VP9A 2Z1MA 3VTAA 1UBEA 2JAQA 2NU7B 4GBMA 3A9UA 3WE7A 1NVFA 1CR4A 4YEDA 3I1YA 3MBKA 3OWOA 4GEGA 4NDAA 1H22A 1NF2A 5T8KA 4X60A 4NPAA 2C7PA 4A1OA 3S5UA 1NXSA 4YT2A 2OILA 1OLXA 3IERA 3C1OA 2D1FA 4KH1A 1E4OA 3AG5A 2J0SA 2LCIA 3ASUA 2X41A 1S2MA 1M54A 1NXQA 3ND8A 4D9EA 1JG2A 2RONA 3GAFA 2Y66A 3HV2A 3V8BA 3KYBA 1WZEA 2Z2XA 4FOTA 1Q1BA 1OXBB 1V41E 3KETA 4HS4A 4UHKA 2ZSHA 1ZD2P 3GJ6A 2FN7A 2J3DA 3MPOA 2ESRA 2A88A 2WT8A 4EY5A 2QTZA 3KWFA 3KFVA 3R7SA 5IF9A 3NWBA 1Y1KE 3GOQA 1JTVA 4KMOA 5TSDA 3GUHA 4YVFA 4EUHA 1NBME 3TCKA 2B99A 4ZO4A 5BVGB 3PHCA 3QMMA 1MJNA 2YW9A 1M1YB 1Z2EA 3ZXSA 2XUHA 3SXJA 4B7AA 4D5EA 2DYKA 3OQJA 4NBUA 4N8DA 3DOHA 4AP9A 1BX3A 4D98A 5JDIA 1BRMA 1Z4MA 2IP4A 4ZO9A 5T6BA 1JG7A 4NE2A 3ZBTA 5M34A 4XWWA 7GPBA 1KFBB 221PA 4ZT3A 4A36A 3O8LA 2HWYA 3DEKA 3I58A 3I8XA 2OCIA 3DFZA 3RRBA 4Y1EA 1BMFA 3MJ4A 1BN6A 1PUJA 3IEMA 2JLYA 3DR3A 3I1IA 1NQVA 2O7QA 1I9CA 4OB7A 5D01A 5DSTA 2XMZA 3RRFA 3VSCA 4F91B 3E84A 4I5DA 4V1CA 3HY3A 4EJ0A 2ODPA 3RB8A 4BFVA 3F49S 1Z0AA 1ZL2A 2IHYA 3FIUA 4BASA 3L8MA 1RNLA 2X1HA 2GO1A 1T3GA 3MJSA 1RIIA 1VE9A 1V8BA 2P7IA 2R47A 3N2ZB 2FQ1A 4NCNA 3RIYA 1Y5RA 2ZDGA 5CDTA 4XKJA 2VSOA 4L27A 2C9BA 3LDGA 2DKNA 5JAPA 3WHIA 3UGTA 4HDRB 2ZULA 3O26A 4R2IA 2JGDB 5CX4A 3TJZA 1Z4QA 1J7JA 1NSYA 4KVAA 4XJTA 5BRAA 4BXOB 1TUGA 4R1QA 5EXSA 1GL9B 2C82A 1QQAA 4MDEA 1P9OA 3B1VA 1WOMA 3ASZA 4YK7A 2H3EA 4MJLA 3GUVA 3ZY6A 4ZOEA 1R0KA 4ZI5A 2YJNA 4D6YA 3ER9A 3ASVA 3HCFA 3OEEA 4AQDA 1DXQA 1GO2A 1IQ0A 3LFHA 3NP9A 1OWPA 2NXEA 3QXXA 4OHBA 3FCAA 5EXXA 3MMXA 2CWDA 2NZVG 1Q16A 3IIJA 4TSFA 4S24A 2PKCA 3PXAA 5D5PA 3LUPA 4MYSA 5AW6A 1E6UA 2A9VA 2ZIWB 1D5WA 3ESYA 3IQIX 4HN2A 3WLMA 3BS4A 2PLAA 4HWRA 1E2JA 1E2NA 3B8HA 1UXOA 1WUJS 3FCYA 3WMRA 3ZWQA 1E0AA 3ZXYA 2O3TA 1BMTA 1BTOA 3NP7A 4E3ZA 3LQ2A 1RM5A 5GONF 3ZDZB 4KX3A 3PC8C 2Q1XA 3WHKA 5K5EA 2WWGA 4RELA 4BKUA 4IDCA 5ABPA 1GGMA 2Q2NA 1Z5GA 3L92A 1PR6A 1YKFA 1SZCA 3LBIA 1YI0A 1SC9A 1RZ3A 4MARA 3R7DA 1Q1NA 3OZBA 3K2BA 5CRIA 4A8JC 4ARUA 4JMLA 4KXWA 3L4BC 4GKBA 3LVFO 4C4OA 2VJAA 4HNVA 2BFPA 1OW3B 3LSTA 3ONFA 2PS3A 3LZCA 5TQJA 2GGSA 3WLRA 1PW5A 1ZD4A 1HMPA 1I3MA 2B6NA 1NF9A 2A7XA 3HCEA 3H2GA 2NUAA 1KOFA 4KGDA 2L69A 2P6NA 2Q5JA 4C0WA 4E6EA 3AESA 4GR9A 1JKIA 1WCWA 3E9EA 5HG0A 3LQ1A 3LX4A 3BMNB 2PT7A 4ZICA 4ECEA 3K1AA 3LA8A 5D3QA 4CM5A 1IWOA 4C05A 3EQ2A 3KZNA 2HHCA 2Q6VA 4NVRA 2HW8A 1U9YA 4TUYF 1NI5A 1G0NA 4UUOA 5BR4A 3THWA 5REQA 5KB3A 1RBZA 1X8XA 4YJ3A 3DDCA 1VXOA 3QXJA 1IY8A 3DCNA 4U4AA 2ZI7A 1WXEA 3TOCA 1UKYA 2GBIA 1P75A 2CLMB 2V55B 3DE1X 1GNTA 2XD9A 3FVWA 3VU1A 1IY2A 2QHXA 4W7SA 3FYCA 3RYFB 2DKFA 3ND6A 4PR0A 2XZPA 3IQFA 4O4HA 3OI7A 4Z7NB 2J09A 3IBFA 5BSTA 3VZDA 1G8JA 1DDOA 2VRCD 5CFNA 4DY6A 4KACA 1UFRA 3OZRA 5K4GA 3G0GA 3UWKA 4OXIA 3CVOA 2NTEA 3V7FA 2C99A 3SN6A 1EK0A 4GWLA 5AOBA 1XP5A 3IKJA 3RCBA 4A10A 4D8YA 5IFKA 1R9JA 3IAM6 2MDTA 4OXQA 4IAOA 2GM4A 2FSUA 5KWEA 3BDAA 3P96A 5C8VA 1KJJA 3MIZA 3AZPA 3R6DA 1QF6A 4LDPA 3HWRA 2B8NA 1PJBA 1WOYA 3BXZA 1L7BA 1ZJ6A 3QF7A 4BTLA 3QF4B 2AT1A 4G63A 1C3OB 2QTBA 4ZPJA 5EUCA 2G9VA 3MGAA 3EBLA 3DEHA 2W6ID 1YQDA 4V38A 3QU5A 2AOWA 1YZGA 2X9LA 4OHPA 2JAOA 4P7KA 4EVSA 3EGXA 3OZCA 3LUHA 3DSRA 1CUAA 3AQ4A 4KGXA 1S7CA 1TO2E 1WDTA 1QVVA 1XMSA 2Z1NA 5P21A 1CQWA 4IH4A 2R6CA 4KN9S 1RYMA 2JFOA 2VYFA 3DV0A 3ISJA 4OQPA 5AJVB 4BNXA 4CU2A 4H15A 5DIFA 2ROQA 2OAEA 5SYNA 1Z7GA 5H68A 3IJRA 2D1RA 3IA7A 3BK1A 2DP4E 1T3HA 5JPIA 2DF8A 5J2UF 1N8NA 1NG1A 2C4NA 3CZAA 5J2TF 3RYFA 3UY4A 1WMSA 2WU3A 3AXSA 4AT1A 2CZCA 2ZXEA 4A0SA 2QRVA 4NMMA 2XAAA 1JDBC 5DI3B 1RJDA 3HA3A 2IDZA 4JR2A 4XIIA 3VSDA 1LK0A 1V16B 1T2EA 2Y0BA 5F1KA 1R5NA 4I50A 4G5FA 4EW1A 5C35A 1XLWA 1L7MA 2HRRA 2XKKA 3MCAA 2QTLA 3ZLJA 1SBNE 2EX0A 4URWR 3U62A 2BKLA 3REQA 5H80A 2WIAA 2PMWB 4UCWA 7REQA 3O2SB 5H4GA 5JU6A 1GAXA 3L07A 3CURA 5AKYA 4L74A 2HJVA 4C04A 2G07A 2R5NA 3AUXA 1KVSA 3NM6B 1IHYA 2CNDA 2G17A 3LPCA 2WB4A 4HG2A 1EFVA 4YAWA 5J63A 1Z16A 3TK1A 5UKDA 5KYWB 2QDKA 4CQJA 5GONA 1NGSA 1UEIA 3L6CA 3ZU5A 1ZDMA 1F4PA 2P9FA 3U7RA 2GN2A 1FS6A 1BROA 1G20E 2P1RA 1NQWA 1BA2A 3KSDO 3RIHA 2QRQA 1P0IA 2IIVA 2W8BA 2X0NA 4P3XA 1K7CA 1CJSA 3ROZA 4E1BA 1MIOA 3CLUC 3DDWA 3HVIA 1L0BA 4I2NA 4PFSA 1Z0DA 4QEDA 3CW9A 1Z26A 5DHRA 4X1IB 1ZIOA 3OIGA 2Q62A 2XTAA 2D2IA 2XUQA 4R9UC 3WSWA 4DC0A 4L72A 4PTYA 1I8TA 4QZVA 4NYMQ 1RQNA 2QQGA 1M6VB 1T1JA 3RC9A 3OFSA 3SM9A 4URYR 2VXOA 5A3JA 2Z2IA 1RWKA 2QORA 2Q7XA 2R00A 3B89A 4BNYA 3BF8A 3T3NA 3LY5A 4BO5A 1W7AA 1JHYA 2YWEA 1RPNA 3BQ9A 1NUHA 3ENQA 3FF4A 3HVKA 3P9QA 2XF2A 1B0ZA 4RF2A 3U4CA 5I7WA 4RABA 3Q2IA 3LC7O 4YCLA 2VXBA 5K03A 1XZBA 3V55A 3RKSA 1I1QB 4PU0A 3ZK8A 5I45A 1B74A 1ND5A 1Z4OA 2BD0A 1IOWA 1KP9A 3UJHA 1P7CA 2XW6A 2XUZA 2BMFA 1XMQB 4J0CA 2RHMA 3SPXA 3T3IA 3M9WA 3X1YA 1EM8A 1HYBA 3C5EA 4FBMA 5ALUA 4DA9A 3IAFA 3BWBA 5EKSA 3KU4A 5EWLA 2X2PA 3WKCA 1Y8ZA 3WGHA 2P5SA 4RVDA 4GOJA 1U63A 3GL9A 3G0HA 2CHVA 3Q8LA 2YVUA 1F8XA 4RCZA 3EAGA 1Q3KA 3GZTB 5F73A 3CZ5A 1PW7A 4U5QA 4OM8A 4W6ZA 2R7AA 3AZOA 3AVYA 1J2JA 2R4QA 1NJ6A 5I6DA 5M3BA 1MX1A 1ZO8A 1YGYA 2NT3A 1CVIA 2RHWA 3HGQA 1OI2A 4F4CA 3CWCA 2AQKA 1BQ3A 1KFEB 3QEJA 4RAOA 1CEXA 5H5JA 1XLTC 3WY9A 5JAUA 4DJTA 5A7FA 4JXZA 2VHEA 3HYCA 3KSBC 1NURA 2QRUA 3TI9A 4QXOA 4LCEA 1BHJA 3G6KA 3GN2A 4TS1A 3HFSA 1M6VA 3I8OA 1XA4A 4F06A 2HLHA 5A03A 2NQ2C 2PUBA 3DEZA 1GL6A 3CLHA 4RZXA 2ZJBA 4XD7A 5DXFA 2Z56A 2W2TA 1K7EB 4YTEA 3M1AA 1BX0A 3JQAB 2IVFA 3LQYA 5JFOA 4N9WA 4LFAB 1M34E 3B1ZA 1W5TA 3RWOA 1J00A 3JTMA 3A1NA 3AI3A 3L05A 4L3VA 4MR8B 4CW7A 1PVOA 4DM3A 4P32A 1C3OA 5DM70 1CQPA 4ZPXA 2FEMA 4RF5A 2H5LA 4U3JB 3AVUA 1RS0A 3K1ZA 1ICEA 2HF9A 1WSAA 2ZIVB 3QVUA 4KGZA 4S1VA 1ZIXA 3KB1A 3SR4A 4MV3A 4JROA 2EKLA 4DUZB 3B51X 3RRZA 2PSHA 3AFIA 3GT4A 2PA3A 4MQLA 1E8NA 5EUBA 1Y6JA 5AJUA 3PQEA 4L5AA 5KYVA 3E2PA 5EPUA 2GSDA 4QO7A 5DYGA 3PTLA 4MR9B 1QE0A 2V7PA 5CH3A 1N4AA 3D6JA 1RLMA 5IBCA 4HNGA 5C1OA 2WDPA 2FMXA 3U7EB 3IRUA 3EXFB 1L7OA 2QTHA 4J76A 4NEHB 5A5GA 5BOVA 3QKUA 3MWEA 3OE7A 3IMFA 4D3XA 1IG0A 2XDAA 5TJ9A 4BOYA 1ZNXA 5DI3A 5DNUA 2NVWA 4LYJA 3EISA 4QGSA 2HK9A 4DVGA 5J47A 2BUAA 1CJUC 1PP4A 1PO7A 2BMJA 1RJEA 1E1CB 2VTEA 3JQFA 4M1QA 4QDJA 2XT0A 3HL0A 5IWCA 2RK6A 4H1VA 4WZBE 2G9QA 3LHFA 4LKOA 3GLQA 3RK1A 4PAGA 2R6HA 3A7DA 3H2HA 1HDXA 1JRLA 1U2GA 4N6NA 4PX2A 5E0KB 2J3EA 2R85A 3BICA 3GNLA 1OZHA 4P33A 3SR0A 2XVXA 1DMSA 1P2UA 5E9JA 1GNPA 2QQ5A 3K16A 1NAHA 5B55A 5IVHA 5DX8A 1QH1B 5I9LA 1MZPA 5KYWA 2PUTA 4FLEA 1Z2DA 3KKPA 3QLTA 4JVNA 1AZTA 3TLXA 2E4ZA 1S01A 2VJNA 3AUKA 4LTDA 3EGIA 3L0SA 3PFGA 4IP0A 3CW2A 4IHJB 4J43A 5DCUA 4AAYA 4TTQA 4Y0AA 1NMZA 3TS1A 2Z9DA 2CL6X 1MJGA 4J7CA 4D42A 5TS2A 3FNHA 3ZWKA 4FN5A 1AKEA 3IEUA 2HRCA 3IEIA 3G2KA 4JLAA 2P9HA 4N5LA 4QBKA 1FRQA 1E1LA 2ACVA 1FSZA 2GDZA 2XCOA 4WZAA 1QQ7A 3I53A 3GEEA 4DGSA 4RSRA 4PWZA 3GA0A 4BNIA 1UC8A 1N77A 4Z4EA 1F6WA 1ZPDA 2JJ1A 4D97A 1R6DA 1AQYA 2F3PA 2HGSA 2ZQ5A 3W06A 2XNDD 4CF4A 3IQGX 4D79A 4ZQFA 1Q20A 5CVUA 2W2OA 4J90A 1T1GA 5H3CA 2XB8A 2EFDB 1JFSA 3L6EA 1U9ZA 3RH0A 3BM5A 4W7HA 2Q8QA 4I3GA 4DLUA 4REQB 4PYNA 4ALIA 2ET6A 3H6HA 3NR2A 1C8KA 1FFWA 4LY0A 2I3BA 5GONB 3IP9A 2ASVA 5IT0A 3E0QA 4JYAB 1TD1A 5JNSA 2I0FA 3RYHA 3E4DA 3M5PA 4P5DA 2O3RA 3EEQA 2XKAA 3GEGA 2VKTA 3N05A 4OV6B 2QE7D 5DT2A 5E6RB 2JBAA 4KQHA 4UTZA 5FOQA 1FYDA 2V97A 1WNTA 3KOZA 4X6UA 1QV9A 2B69A 3OZVA 1DAIA 4LRWA 4YJ2F 1NR5A 3V6MA 5JASA 3ADKA 2Z98A 2ZK7A 5AVJA 4M7RA 3ZIAD 4C7BA 2L18A 3C6BA 1OWMA 4ENTA 5KKNB 2NUAB 3C3AA 2GPSA 4HJRA 3SQDA 1N6KA 1TVCA 3H8WA 1W52X 5IG2A 2WUDA 1ISFA 2XTZA 3VTFA 3WIVA 4BDSA 4ZYYA 4AY6A 1VE1A 4HDAA 1NN1A 4FFSA 4QGBA 4JX9A 4YYZA 4M1KA 4IKEA 4XCXA 5LCXA 3SBOA 2VLBA 3UGJA 2B8WA 2C4HA 1N6RA 2ZKIA 1AXRA 2HCRA 2GH1A 5K8UA 3BERA 1PGJA 3BTOA 3GRZA 1F0NA 1EWTA 2D4HA 4BFZA 3HBNA 2FPWA 4WA8A 4YAFA 1G8HA 4Z9XA 4H17A 3CKYA 4UHDA 4QARA 4UVGA 2BV3A 2AXPA 2HBRA 2I7TA 4XVCA 2CVHA 4BQSA 3CNLA 3ECCA 2QW1A 1GSHA 3S2FA 3FUWA 2DR3A 4ARVA 1NNI1 2WFAA 4JNKA 1GD1O 4XIJA 1E62A 2ZBRA 2ZSKA 4R54A 3E9RA 4UDOA 3THRA 5F3WB 3CRRA 3V8MA 3MERA 3LHKA 1NM5C 2BTEA 3BMQA 1KPIA 4TQUS 1G64A 2PRSA 3DKIA 4MGYR 4TRRA 3K70C 1E5VA 2JBAB 1C0PA 3EEBA 1E2UA 5JY6A 2BGMA 2SCUB 2Z08A 4Q3DA 3NBXX 1XRRA 2XDYA 4CLDA 1FFHA 1NRIA 3AF0A 4UAJA 5K3EA 1XYVA 4U2GA 3VZCA 1S02A 4DR2B 5E9WA 4C07A 2XA1A 4L3WA 3UMJA 2CVZA 2LIPA 2JEZA 3KHSA 4ABTA 4I4IA 4QGHA 4B6SA 2Q3CA 3QW2A 1FYEA 4YWHA 1KI6B 1RLOA 2ZP1A 4X62B 1CW2B 1JIXA 4IX9A 4F8YA 1NA5A 5G4KB 4L5BA 5DP2A 3D4IA 1V1MA 4M7OA 2WWWA 3B6MA 1QCCA 3DJFA 4Q3AA 1GV0A 3CEHA 1KZ7B 3WMWA 1LI5A 4ZQBA 1DOZA 2JCXA 4DQLA 1KAEA 5L6MB 1ZONA 4E5YA 4BNTA 2AEMA 2V7GA 4G86A 2H1WA 3SJUA 1HLDA 2B83A 2VJPA 5P8WA 2AN4A 1DQPA 5CA1B 5DE3A 4IHJF 2P2YA 3NT5A 4MVJA 5BQFA 5LQUA 3DBRB 3VR6D 5AOVA 1MVOA 1N2CA 3WO1A 1PTKA 1Q6YA 1TADA 2QD5A 2Z5GA 3R3SA 2CMFA 2B92A 1E4EB 3I2IA 1SKAA 1DI0A 1CEYA 1JV2B 1QLJA 3NNNA 2IV7A 4BE9A 2REBA 3AW9A 1NDQA 2CL5A 2ZYVX 4ZYWA 5AW8A 1JW9B 1PS9A 3TECE 3NYIA 4EVIA 3BYZA 2Q2WA 4Q12A 2C57A 5TV2A 2PBZA 5JMOA 5ITZB 1AD2A 3TOSA 3MWDA 2BONA 2BIFA 2ZJ6A 4RJIA 3VPAA 3LP8A 4X45A 1PK9A 4FOPA 5KKAA 1HLFA 1VMEA 1BN7A 1SH7A 2Q5CA 4QUIA 2IU0A 3RABA 5IP5A 3CEMA 1ZJWA 1OF1A 1YHNA 3LDAA 4FI3C 5GV7A 3K6KA 4WZAB 4HT3B 1EIZA 1TCCA 2F59A 3VI4B 1YWGO 4IINA 3N6XA 8ABPA 2IA5A 1QLWA 1EFPA 3QPBA 1J9GA 1K97A 2GCEA 4OI1A 3RNLA 3RROA 3EA0A 3VPFA 3WNDA 4BFWA 2BOVA 4UVDA 2GXAA 1KF0A 4ENSA 1VE6A 2Q27A 1GFWA 2E4VA 3Q3GE 2FSVC 1GTL1 3ZZMA 4C0BA 1ML4A 3MT7A 1Z36A 3NASA 2B4AA 4NFLA 2UXBB 3H5NA 3PXDA 2H1SA 4IV8A 4NMWA 4OGGA 1M83A 3GLFB 3BK7A 2ZUEA 4KQKA 2O1WA 3SYMA 2B3TA 4J1TA 4E51A 2IPXA 5TJHA 4IF4A 5EMMA 2LWIA 1CQXA 4HL6A 4DDKA 4LDQA 2FEWB 4OQEA 3GJ3A 2PH5A 4QEZA 1GL7A 1VZ3A 1PBTA 4N5DA 1L5LA 3LT2A 4P5PA 1K6JA 3TRDA 5AESA 2OQRA 5AIBA 1UAYA 2IBSA 1MG5A 1LPMA 1TMOA 3STUA 1RRCA 4L1KA 2AFRA 4L95C 5B1HA 3UAOA 4OGLA 2YVQA 4PG7A 1MT3A 3K72B 2QQ0A 1P3JA 2C2ZA 4F38A 4AFNA 2ZUWA 3AKZA 1V1RA 3U56A 4OJMX 1R8XA 1WPGA 3KT8A 4NPHA 3V1LA 3L3BA 1K1EA 4WESB 2Q1TA 1WRBA 3KVYA 2B78A 3T5CA 5K9ZA 4GSKA 1KJYA 3TVYA 4U8HA 3THSA 1M1ZA 3CU5A 3OEHA 1QVAA 3IIEA 4WK4B 4A03A 1BG6A 2YH2A 3HUUA 3WDMA 2WUFA 4KPEC 1IZZA 1WNFA 4GI2A 2IWHA 1G8AA 1RHQA 4OLHA 1BFUA 4PHTA 3IKVA 1G0OA 4I1IA 5JC8A 3MOSA 4M55A 1I6MA 5DGCA 4H27A 3EEYA 3ICWA 4UCQA 1W36C 4CI9A 3F8TA 5F7ZA 2Z8ZA 4IFIA 2Y99A 1QHIA 2Z3VA 4FX2A 4WASA 4YNBA 1XTSA 2HJRA 1C1XB 1Q14A 2HFKA 3G13A 4DWVA 1E64A 4NESA 5K0SA 1T5SA 2W2LD 1PKXA 2X5KO 3EHDA 1R15A 1N3LA 1YCHA 4UAUA 3LDFA 1ESMA 2BPOA 1HKUA 3JY6A 5H0IA 3SHTA 1F3LA 2PLFA 1RWPA 1JJFA 1KYVA 1UWVA 3H86A 5ARDA 2BJWA 3P2EA 3P9IA 4EENA 2V8OA 1PQYA 1L5VA 4NICA 2FGJA 3DLCA 5AVWA 5KEIA 4EB8A 4MEAA 4RJLA 4E7PA 4G5RA 1ODSA 2IEZA 1UPUA 3OOHA 4MUBA 4Q21A 4KFTA 1DCTA 5EY5B 4YT8A 3P4XA 1JSLA 4Y9UA 2GJAA 4I6JA 3RS3A 5E4FA 1SUIA 5CNIA 2GZSA 5IZ4A 5FLYA 2BVNA 1R74A 4XSGA 1DJQA 1I3OA 3LA6A 1FRFS 4G56A 3CVUA 4L8LA 3A6EA 2B82A 5BNFA 1EGVB 1U65A 2HLPA 2R751 2PYIA 1XO1A 1YJQA 3FG9A 4NOJA 4QYIB 5L3RA 4ER6A 1DIBA 5FD8A 3DZBA 4RDIA 1SUCA 2BDUA 2GBGA 1XXHA 2ZIAA 1DC4A 1L5HA 2WF9A 2WSSA 1T0BA 3FSGA 1MC5A 4N3GA 4NH4A 1F8YA 1PNVA 2B4QA 4QUKA 2C8KA 2W6NA 2WKPA 4RV9A 5AUPB 2KLHA 5J43A 4X61A 4GKKB 1MO3A 1ZC4A 2Z2KA 1E9SA 4R3UC 1DRVA 2QJFA 2LXNA 4QA9A 4RK4A 4DL9A 1L5ZA 3OIVA 2CJFA 4NV0A 5H83A 3DQPA 1N1EA 3AIIA 1CKEA 3GJSA 4KL8S 2FR8A 2YS7A 3W8NA 1XDSA 4Y1RB 1E2QA 3K0CA 4JU9A 5EN4A 4Q5IA 2C0CA 2R1ZA 2D8MA 3UJ7A 3GP8A 2D4AA 3TJMA 1LY1A 2CNWD 5AI0A 1L7EA 4BB5A 3NEJA 3MOGA 4BFXA 1FFYA 5KTKA 2OL4A 1CR0A 2N9UA 5A4AA 1ZRNA 1OBFO 3LOUA 1DSSG 3VR4A 1B3BA 4KEAA 4QU9A 4CMHA 3G9XA 5KNBA 2ATIA 5HVNA 1SPBS 2M2IA 3BCRA 4GIBA 1XZFA 4IO0A 1ODCA 3BX1A 2ZWIA 1S2GA 3IOCA 4WLNA 2BE9A 4MPJA 3ZHQA 3ZHUA 3C8ZA 4XI9A 3KTDA 3EWSA 4EGFA 1OMOA 1ZESA 3R9XA 3BGVA 1EFVB 3L4BA 3E18A 4O4LA 1DKNA 1GAEO 5F5XA 2FF7A 4OOFA 4EP1A 1CE8A 5A1TA 1RBMA 2VT3A 4IDPA 4ZV7A 2IH5A 4K40A 1XWWA 5LM3A 5LIRA 5LNK1 4K9RA 1WB9A 1HE4A 3R3ZA 3BBPA 3B2NA 1BKDR 3QI7A 3BJRA 2ISCA 4N6GA 3ITNA 5EZSA 2EFYA 2ZR0A 4UEQA 4ZU3A 3HVUA 5IABA 3TKAA 4ALKA 4Q3BA 1G5IA 2NIPA 3DULA 3TYXA 5U1PA 4RCYA 4FGSA 1N32B 4NOLA 2P2NA 2GUGA 3NRJA 2L19A 4EA6A 5IDVA 2HBZA 2ZRFA 1SZPA 4EEKA 3U5ZB 3TGPA 2GM5A 2Q29A 4MXDA 4M0KA 1ZAYA 1VKOA 2GN0A 4XA8A 3R41A 3HBMA 3OQMA 1EVLA 3P0RA 4YP0A 1SC4A 1VCIA 2GYYA 1A7AA 3KZXA 1HE5A 2VJOA 4FMCF 4EI7A 1D2RA 1WBJB 3QXHA 2GHRA 3R0XA 3ZGZA 2OHFA 1BW9A 2H63A 1JEJA 3HXTA 3BFXA 1FDOA 3CCBA 3CX4A 3DBIA 1Y7IA 2O0JA 1EDZA 4LGMA 5DP1A 3GLSA 4DIMA 3GQBB 1KZ6A 2IHJA 3DUFA 1MFPA 1L1FA 1O8BA 2P3LA 3NX4A 4U7JA 3U37A 3UN1A 5BUSA 3EAQA 4G5OA 4D82A 4EW2A 2PZ8A 4F3TA 1SBHA 3MMPA 1XMVA 1NBOA 1NZJA 1ZOPA 3AETA 5LYYA 2VK2A 3DZJA 3ZCXA 2DSTA 4M21A 2JJYA 2C31A 2GAJA 2DLNA 4M60A 4UEOA 1PLKA 2B1IA 1OV6A 1P6UA 2AL7A 2H2GA 3C3CA 2OCAA 3P2YA 4Z8XA 3A1EA 4A16A 4I50F 1C9EA 2C8LA 2RHOA 3K9GA 4NIMA 2F8SA 5CXQA 2ZTMA 3PD0A 4EJSC 3IL2A 1NKSA 1WD7A 2C5LA 4TKUB 1XJ0A 1MR3F 3EVNA 3M6MD 1MNAA 3RJ5A 4DABA 2EW8A 1T6XA 4JP2A 4QDUA 2O8DA 1PSDA 3MT8A 4BNVA 3M4JA 2P0AA 2FUG6 4XQEA 2FPGA 2GZ2A 2YHBA 2RBGA 1ZNWA 1J8MF 2Z57A 3QOXA 2VYNA 3GJYA 3RYIA 2HDWA 1YMUA 2A94A 1KIMA 2NV0A 2FUNB 4LRYA 1U3WA 4P7FA 3MHTA 5ESDA 3MGBA 1XZHA 2OGWA 2BBTA 3O82A 1SXJD 1ZJJA 3IDFA 1J0BA 1DPFA 2IBTA 4QSHA 2PQ2A 3S28A 3IBGA 5BYJA 1E6LA 3EGVA 3PQ5A 1RXUA 3PNYA 4HHEA 4BFYA 4DZTA 3RRMA 3KEOA 1DBWA 3AHHA 3DGFC 3JYPA 2GFHA 2W22A 4AWBA 3CY6A 4J8PA 2BFFB 4G1CA 4KYTA 5ED0A 3ZCTA 4UFPA 3DZGA 4E4YA 3L7IA 1YIAA 3LPMA 4DSNA 4L8GA 1JR3A 2GASA 2PO5A 3HJGA 1LLDA 1NU8A 1COZA 1W0KD 2WSMA 1PR0A 2HU2A 4LE0A 1Q7RA 1Y6QA 4JP1A 5DK4A 3ZDCA 1JYEA 3NBZC 4DANA 1FSPA 1WABA 4PNHA 2FW8A 4RUKA 4FEEA 3GZJA 1E8MA 2BGNA 2E48A 3EN0A 3HJTA 2XE7A 3D0OA 5TMBA 3C3BA 2IELA 2ALJA 4QQ8A 4PAWA 1J0DA 4D74A 5A06A 2J7PD 1ZK2A 1JEQB 3CF6R 1YVUA 4AM8A 1IUKA 4C29A 2M6SA 1B8NA 1QOZA 3IX7A 3ZY5A 5A4DA 2C4KA 5DCYA 3PFKA 4ZVUA 1J8QA 1GGEA 2O2HA 3AIOA 3CTMA 3Q8WA 3R5TA 1O54A 1WDMA 4YRBA 2QRLA 2A9FA 3DYBA 3U3MA 1EUQA 4ZTBA 1US8A 5GTDA 2ZE5A 1BOOA 1W88A 4K8OA 1KSGA 1GTRA 2ZGVA 5FH9A 5EXTA 4YJDA 4I9HA 5DRYA 2Y67A 3WSVA 4NS1A 4QBGB 1UMBA 1Y80A 3B38A 3GARA 3GWZA 5L3ZA 4PINA 1OLXB 4OMDA 4B09A 2RARA 1NDUA 4Z0TA 4YXWD 4QNMA 4JGIA 5KQRA 1X7HA 3W7AA 2WYWA 3IBTA 4W5JA 1ZOSA 4PN7A 4TKZA 4ZCSA 3CZPA 1SUBA 1IE3A 1EFCA 3M6AA 4KCGA 4V2UA 5KTRA 1YFLA 1HO3A 3NKFA 4I46A 4J0EA 3ZWMA 4B3FX 2NVUB 3YASA 1EAMA 8ADHA 4CMJA 1L4LA 2WZCA 3H0CA 4OHMA 4E5UA 3EIEA 1JQEA 5GQSA 3QVJA 2FDXA 4ZOLB 4XJVA 5IM5A 1LA2A 2HA3A 4FXOA 2A5GA 2IUUA 2XT6A 4PG5A 1EFKA 2ZYIA 4ILKA 3A11A 4C89A 3O94A 4HDSA 1JILA 1M2HA 1DOHA 4IQ8A 2Y1LA 3TZEA 3RVLA 1RZRA 1WXFA 3HDYA 3RRXA 3QVSA 5LQSA 4C7MA 3AGPA 5FBQB 3M7IA 1K9VF 3F6PA 1BYIA 2C2HA 1D8TA 2TMYA 1IL0A 2ZB2A 4RETA 4XVRA 4EUNA 3CB2A 5DISB 1USUA 4ZA2A 5LVAA 4U39A 5JNWA 3EQ7A 1X1SA 2F1HA 4ZMBA 2QPTA 1QHGA 3UMCA 4RL4A 1P5FA 4RESA 2JLQA 1K86A 3QITA 1TD9A 2JGEA 4IQFA 2QBYA 3BSYA 3K6SA 2Q28A 4EB3A 4RTNA 1N3IA 2JASA 4GDFA 3L8GA 5LOVF 3K0AB 3RVPA 3BTVA 3H4TA 2UV8A 3QUQA 4K05A 2JD1A 4Q00A 1RPAA 4L5CA 4NH0A 5CUQA 2A3RA 1EX7A 3X1JA 2FWNA 4RTSA 3B9RA 2VSQA 3UV7A 2H5JA 5KYYB 4Y9DA 1FDUA 2UYCA 1L8QA 2AMYA 4P0QB 3NTVA 4XB1A 5EE1A 3NVDA 4YCAA 3EG5A 3VPSA 3SNKA 5KQSA 4AKGA 4P4GA 3B1WA 4AD8A 1K66A 5CDGA 4C1BA 3NETA 3GLFA 1WP4A 1H9BA 4OQLA 3T1HB 2IH2A 1AO3A 1T29A 1U5AA 1LDMA 2XMGA 3HWWA 4FOSA 4WLFA 3UMFA 1KL7A 3FPFA 3V4SA 3A1SA 3NAMA 3RDPA 5DHSA 2WE8A 3G3EA 3P1JA 3OCYA 1G16A 3QWHA 5A7HA 4N76A 1VDZA 4DT1A 3EZXA 4TTJA 4FGLA 3VDNB 1SKYE 3OVMA 3IP6A 4ARZB 3O38A 1TXGA 2ZYDA 2W71A 5B4TA 1WA5A 3ZJUA 4DWWA 4JI8B 1JX6A 3W3AD 2IZ0A 4ACAA 2VK4A 4CG2A 1DINA 1HV8A 4NNJA 1EINA 4DEXA 1G4HA 4MVJH 4TKVB 4MUFA 2D7CA 1NIPA 2NU9A 4G65A 1PG0A 2E4WA 1FDSA 4FFRA 1KVRA 2AKAB 1O94D 3OUZA 5IC4A 4PPFA 1YQGA 3GR6A 3QKWA 3WQHA 1F0YA 5JY1A 1MW8X 4MUXA 1IVNA 2R2GA 2WNSA 2GD0A 1ZICA 2XOXA 2PUCA 3LKBA 4Y1GA 4Z0HO 1JXAA 1VECA 3AMVA 3SLGA 4ND8A 2YWCA 3AQIA 3GLHB 3T7JA 4MRAA 3DPIA 4QVKA 1NATA 3W1VA 3JD4A 2I7CA 5K20A 1DXHA 1RJGA 3VYSB 2QAGB 2YMMA 5JSZB 1FLAA 2I29A 5BSEA 4RDHA 5KYXA 4KQWA 3FLBA 3N2GB 1YULA 5KPJA 1UKBA 4A7PA 4ZI7F 5EOVA 1PFKA 2FZWA 2WAXA 2H16A 4UXJA 4F5DA 3GVPA 1TYEB 3G59A 4Q1AA 4DUYB 3KYJB 1QRUA 1L5KA 1YZTA 2XVAA 4AWAA 2ZBEA 3EFOA 3LWDA 1FYXA 2O6LA 4OBEA 4WCVA 1ZCAA 4EI8A 4DV5B 4W99A 1CUCA 4CLEA 5KQGA 3N0TA 2ZJ2A 2ZPAA 3D3KA 4YB8A 4QHSA 4DM7A 3BFPA 3RAPR 2WA1A 4MCJA 5DNYB 3LVRE 3ZIAA 3TNLA 4WFIA 1B1AA 3O3CA 1D1QA 5DNVA 2YN4A 4JASB 3ABQB 2ZBFA 4Y2JA 4N5HX 5EJ8A 4KXQA 7REQB 3ODPA 3IAEA 5BW5A 5B6IA 3SEZA 4GQIA 3DE4X 2Z5LA 3V1MA 2WJPA 3VNBA 4OH1A 2WLTA 4DR6B 2H08A 4MW0A 1ADJA 1S8AA 5LZ5A 2WWRA 1T9GR 4YJKA 3T9AA 1QCYA 4RJTA 3JYQA 4X85A 4B9EA 5CJPA 1P6QA 1ZK1A 3C1TA 2FWBA 4O1IA 3QFTA 4Y2YA 2B34A 4O3FA 2ZITA 5E6RA 2W2MA 5LLSA 4D4HA 4QREA 3PNPA 3S27A 4BLSA 4KRYA 3FPLA 3NVKI 5LN1A 3KKQA 4GZ5A 1E2DA 2GVNA 5CU7A 4ZO7A 5HPYB 1JI3A 3HA2A 4LSGA 3QVKA 2PZBA 4XDGA 5HS6A 2VPYA 1P77A 3UWSA 4BUZA 5EJ7A 4BVFA 4B9AA 2ZT8A 1TEZA 4CXMA 4I4TA 3PFHA 1E5TA 4CCSA 2VZEA 3FMOB 3NW9A 4JVSB 4G5GA 4FZRA 1IQRA 1XUOA 1JI0A 2IBMA 4OHOA 5DM1A 3T7KA 3AR5A 1KEWA 1NPYA 3LS2A 4KMMA 4URZR 1C5KA 4GPZA 3H2YA 1E69A 2XR1A 1P1JA 2PX8A 3UT6A 1N2OA 1TJ3A 2AJLI 3UOWA 2QX9A 3PR3A 2QGFA 1EVEA 3W9YA 3T1TA 1SOAA 3P97A 1OROA 1VHLA 2QR3A 3GYGA 3RQIA 1K8XB 1V7QA 2JI7A 3RTAA 4D4JA 1M1YA 2VJKA 1UDWA 1X7YB 1XXHB 5EE0A 4R2HA 4D44A 5JVDA 4DMRA 3FMIA 4TLLB 1CWUA 1PFYA 1QGYA 3HJFA 1UWCA 3HKBA 3RF6A 3WNQA 1JQLB 2H59A 2DLCX 4RGVA 4P3PA 4V0MA 3N59A 3G68A 2XHEA 3ROKA 3EXHB 3MMNA 3OPYI 3PRKE 2BFBB 1KS9A 4KO8A 4MP6A 1Q91A 1P29A 1FTSA 4MVJI 1ESDA 1PJZA 2QMUA 4HD8A 4KAXA 2A8YA 2Y1DA 2J9RA 1V5GA 1PJCA 2O2SA 4NHOA 3GJ5A 5A6VA 2YZNA 2ZEJA 4HYTA 3H4VA 2A7QA 3I37X 4EATA 1ZMXA 1Z0KA 4G4IA 4D3YA 1ZNYA 1KO1A 3LBNA 2GHQA 3K15A 2V74B 3W4IA 3QNMA 4GLBA 1S4QA 5FUVA 3GLUA 4DJJA 5CEJA 1N36B 3DL0A 1Y3IA 2BH9A 2I7XA 4HFMA 4X6LA 5BSVA 3MJHA 4ZEVA 5T67A 5EEHA 2YZKA 1CY1A 1W48A 1L5NA 1BW9B 4ZGWA 3I4FA 1M2OA 3JRNA 4M37A 5L4SA 1DIHA 1UPBA 3K8QA 4QPJC 1RMQA 2IYSA 1QG4A 5AW9A 1FRNA 3JQ9A 2WPNA 4HQ0A 5DBIA 2D1TA 5LU9A 4OMUA 4KHZA 1BU5A 2A4MA 3CFYA 4RDXA 2JCBA 3PQDA 5IU6A 3DP7A 4Z4GA 2PFGA 4AMBA 1GQ2A 1NJ5A 2Q3MA 3U49A 1QX4A 3HMQA 3IT3A 2QZSA 2NXNA 3UKOA 4R1UA 4U7HA 5DHPA 1Y8QB 3LCJA 4GI1A 1X8LA 2IZ5A 5EC8A 4I1UA 4GLFA 3RG8A 3KOUA 2J0UA 2V65A 1IZ9A 3BGOS 4HNRA 3PQ7A 2AFVA 4GZLA 4AX8A 1D7OA 2NADA 3P0HA 3U3XA 2LR0A 2XWSA 4ZKDA 5GVSA 2FSHA 4KNVA 1IPHA 2B20A 4G4JA 4R84A 5CLHA 2AKYA 3F8SA 3VR4H 2QYHA 5HCIA 4M2LA 2DETA 4JYBA 1H4VB 3BEDA 1ZINA 3BXXA 3HCAA 4MUNA 1Y6GA 1AXGA 1MQSA 2E3JA 4U2DA 3TOXA 1GZUA 3MWEB