3IPRA

Crystal structure of the enterococcus faecalis gluconate specific eiia phosphotransferase system component
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
137
structure length
137
Chain Sequence
MLGIVIATHGALSDGAKDAATVIMGATENIETVNLNSGDDVQALGGQIKTAIENVQQGDGVLVMVDLLSASPYNQAVLVINELEPALQKKIFVVSGTNLPMVLEAINHQLLGTPIAEAAQAIVAQGKESVQAWDISM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PTS system, IIA component
publication title Structure of the Enterococcus faecalis EIIA(gnt) PTS component.
pubmed doi rcsb
source organism Enterococcus faecalis
molecule tags Transferase
total genus 47
structure length 137
sequence length 137
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2009-08-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03610 EIIA-man PTS system fructose IIA component
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.510 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Phosphotransferase system, mannose-type IIA component 3iprA00
2JZNA 3GDWA 3IPRA 3LFHA 3B48A 3CT6A 3MTQA 3GX1A 3BEDA 5T3UA 5IM4F 3CR3C 4TKZA 1VRCA 1VSQA 1PDOA 2JZOA
chains in the Genus database with same CATH superfamily
1DHRA 4TT8A 2HRDA 2QN9A 4V38A 3BREA 5COAA 2O5EA 2R2AA 3NG1A 1JR2A 3OQIA 3P7MA 1GR1A 1V8DA 1YS7A 1RPJA 2MYUA 3CZMA 3O3NB 4LCBA 1OXVA 3I2FA 4B85A 4L8LA 2IPNA 4DNQA 3MAAC 2I2AA 3NJRA 4B3GA 2A0XA 3FCUB 3W3AD 1DIOB 4IKEA 2YMLA 1MNAA 1VIDA 3PS9A 3O93A 4PBRA 5LL6P 4L27A 2PH3A 3N2EA 3EIQA 2I6TA 3MCUA 4WY2A 1N5DA 2PWPA 3ZEIA 2BHRA 2CV2A 8GPBA 5M5BA 2K5UA 3PEYA 4HDSA 4UOQA 1OI3A 2RARA 5ALYA 2VH2A 3NW9A 2O7QA 4G37A 3ROZA 3L7NA 4P3XA 1Z47A 1H3FA 3L8ZA 3L8YA 3MWLA 3T7EA 3UV7A 4JMPA 4BVFA 4DIBA 2V7XA 1P7YA 1N2GA 3RYCB 1I2ZA 1DFGA 1I80A 1U0OC 1UOPA 3FWNA 4QJBA 4DY6A 4ZEVA 1GSHA 2Y4NA 3RTEA 3WGZA 2GWRA 5HKOA 2J0SA 3IIEA 3KU1A 1FRZA 3KJIA 2FMKA 3B52X 3LS2A 4EG6A 4F71A 5B7QA 3CKMA 3U13A 2GXUA 4ICIA 2A0WA 1KORA 3VYUB 4EVQA 2FSSA 1U80A 3EXHA 3G9XA 3MINB 3I0NA 3Q8MA 4YR7A 3ICVA 4C7JA 2KYRA 2H1FA 3F2VA 4G5GA 1RKBA 4YAOA 1A9PA 1N2ZA 3K0HA 4QUKA 3TN7A 1J97A 1BHSA 3FBGA 3EG9B 1V6SA 5J59A 5HPYB 1CS4C 4IIJA 1FXSA 1O57A 4G67A 3K6RA 5TEWA 4PN7A 4Q6BA 3QTTA 4OTZA 1T2CA 4W5TA 2JZOA 3TLZA 2HCJB 2DE0X 5F33A 3PHGA 2O1XA 5AJUA 4KE7A 2LP4Y 3PICA 2WW8A 2P1DA 4NBKA 1GSIA 1USVA 2ZIXB 3AV0B 4F5ZA 1YVDA 3IKVA 3L1IA 4MR8A 1T8WA 3DD1A 3GGOA 2Y66A 1EZZA 4OQXA 5KEIA 3A1UA 3DHEA 3OLCX 1ZAYA 2V0GA 5CT4A 1QCDA 5JQWA 2DQYA 4L6IA 1HV8A 4ND8B 3NYRA 4HUJA 1J2YA 1JEOA 1E8MA 2JFNA 2PX6A 1UPFA 3QIAA 4F12A 4MVJF 4V1CA 1U3TA 4YFVA 5L3ZA 3THWA 3BGDA 1NY5A 4XJVA 3NTLA 5TXGA 4UEJA 4YI5A 1JZQA 3ZV5A 1GFIA 4DYHA 4UVGA 1N2OA 5C4GB 5M2QA 4TLEA 2H65A 1QHNA 3E1SA 4LHWA 3EDOA 4AWAA 2ABWA 2JFYA 3WB1A 2C5LA 1KPGA 4G97A 1C3LA 1IZZA 4QFBA 3QZUA 1AF4A 2I71A 4R2MA 2CVQA 1HZZC 4TL7A 3KPVA 4U2GA 1N1EA 1ZM9A 3ZHXA 3V48A 2J41A 2NYVA 4O8CA 2F9MA 3HJTA 3DE2X 2WM9B 1RKXA 2YWFA 1M0EA 4L85A 3PJRA 3G2OA 5EXEA 4QU5A 1ENOA 2OCIA 5DT2A 3E7PA 4FFBA 2DBZA 1FMCA 1MJGM 5LKRA 3LPLA 5EG5A 1R18A 2O8DB 4AJ9A 4HPJB 3QMWA 3TIFA 1VL1A 3ILYA 1T2UA 3IODA 2DSTA 4C2BA 1UC4B 1JTVA 3A32A 1PJAA 1I7PA 4BXOB 2A59A 2WF8A 3H5NA 1NE7A 4LOIA 1U5CA 4RSMA 4DT1B 4EAAA 4MUAA 2WF5A 2Y0DA 2HIAA 3OJFA 1FFXA 5CGZA 4XWAA 4LGVA 1KE1A 3RQSA 1X42A 2FXIA 5ILOA 1QHXA 4LV6A 1E5QA 4S1WA 4KFRA 3JR3A 3ANNA 3D8BA 2APJA 4CF6A 1VHJA 2VL7A 5AM4A 3H16A 1NMZA 1S01A 4MGHA 5THQA 1SIOA 3ESXA 5C37A 1YU9A 3O91A 1X70A 1ML4A 2IXBA 1PTJA 2QW8A 5EFOA 1IATA 3H11A 1CU1A 4AYWA 3K0FA 5CCBA 1H8HD 4TYMA 4PVCA 1ACLA 1YI0A 1GA1A 3FYTA 5F5NA 1Y7PA 4NYJQ 4GE3A 1E6LA 1WCWA 4MKZA 1N5KA 4JHXA 4X6XA 2C88A 3P9CA 5KNBD 1BDMA 1CF2O 5AVTA 2G17A 5CU7A 4MLDA 2RK4A 1IBCA 3C4JA 3OJWA 2OHGA 3VSEA 4X62B 4Z4HA 3ZJUA 1UBCA 1UK7A 1MXFA 2Q3EA 3A3NA 3AK4A 1AKMA 3JQFC 3FPLA 4RFSA 4TT3A 4X54A 4DLZA 4IEIA 4QNRA 5K0CA 3EQZA 1ZC3A 4INZA 3W6UA 4URVR 3ZD7A 2HJGA 1ADYA 1OZHA 4UC0A 2OOSA 1ZXXA 1TAUA 1IN6A 4KH1A 4BL5A 4LZPA 2JKYA 1XI2A 2ZAIA 2RAPA 4GLBA 4TKUA 3S55A 1A2BA 3ZGLA 3GRVA 2YH2A 2JLXA 2RBKA 2CFIA 3VOAA 3VGPA 1A8UA 3C24A 1UBSB 1VCOA 3C48A 3LSTA 4P0PB 1P8JA 2GCIA 3PC8A 2X5NA 3RJTA 3UMBA 2VQFB 5J43A 4ZMRA 3RRNA 4DNOA 1NR1A 1SXJB 3DP9A 4B9AA 1LVHA 2GEBA 4X24A 2GBPA 4CDGA 1CQWA 1Q0HA 2PN1A 3BXFA 2WIAA 1JDNA 1RC1A 3A2MA 3DE1X 2Q5OA 2QRGA 1N8TA 1XE3A 1N0VC 1EDOA 1XTSA 2GCNA 4OBBA 4DIOA 3DV0B 1EH5A 3RSHA 3E2IA 3ZDZB 3FYUA 3BIXA 1PJRA 4BO5A 4LMAA 4GGMX 3MHPA 1GGNA 5B2EA 5FFFA 3UK1A 5MFZA 1ZH0A 5KSPA 1DDIA 5DGCA 3Q3IA 4Z9YA 2YYSA 5F12A 3CZRA 1QGUA 3SZUA 3ESQA 3SDZA 3RIGA 3KWFA 2ISQA 3FFWA 1GZVA 4WXYB 5ALDA 2HT1A 1LUAA 1AXGA 1ZK3A 2F1OA 3KXDA 4RHUA 3V4FA 2FHSA 2X9NA 2Q5QA 2NXCA 1J8MF 5K45A 4AO6A 1RPTA 3IJ5A 1FRFS 2Q0XA 4C3OB 1FW8A 2HQOA 4U5QA 1P91A 1RIIA 1SHUX 3QEOA 3X1KA 1O2DA 5EMHA 1D4AA 1PU2A 3FLMA 4F3YA 4BQPA 1FTNA 3I6YA 1PSDA 1XVTA 5EESA 5B1HA 1XEXA 1L4HA 4EW6A 1QP0A 3NBUA 1PIWA 4CHGA 4PLWA 3RRYA 3TFOA 1DPFA 3LKBA 1WUYA 2R47A 1K8QA 1RTKA 2BUAA 4W5JA 1TUEA 4BP9A 2DPXA 2IQIA 3HYCA 1X80A 2YOGA 4WA8A 2IY8A 2Y93A 1YQXA 1W0CA 3NKFA 4ZC8A 5L3QA 5K8TA 4RV9A 4LCEA 1TLLA 1IXZA 3IXQA 3QUCA 3TQSA 3VNUA 2IS6A 2Y2VA 1Y8QB 1QCZA 3DPIA 2LIVA 1X1RA 3HXTA 1EVQA 1ILEA 1CZLA 1F3OA 3DV9A 4QLBA 2NVUA 3AHGA 2GZMA 3COPA 4AAYA 4MEJA 1TEZA 5IVHA 5CA0B 3ZKWB 2B8EA 2G80A 2YHIB 3F4LA 3NGXA 1V9CA 4HAUA 5FNVB 4FDUA 3I9FA 1GFSA 2WKQA 3LZ6A 4J0JA 1U90A 2B4YA 1S2LA 4K9SA 4M0CA 3TECE 3L1JA 1K5DA 3U5TA 4X3CA 1E4EB 2FN4A 4PLTA 2VQDA 4G4GA 4RKWA 3H9EO 4G81A 2QZ4A 5JVDF 2X2EA 4M37A 4OSPA 2ZB8A 1K97A 1US8B 1JDSA 3GELA 4EG8A 4H08A 5JSUA 4P5EA 3C8UA 3AZPA 2FE4A 2O4UX 3GBSA 2NZWA 3M3PA 1ADJA 2XJ9A 3N2IA 2WWHA 1AQUA 1FNDA 2WUDA 4LISA 5FTMA 2B5WA 3BK1A 3EA5A 3D6TB 1DMSA 1YULA 2BGUA 2ZULA 2AMYA 1QGZA 2Q3BA 3E7WA 2AC7A 3KAPA 2IYPA 2MINA 2V6JA 2V0CA 2I03A 3H5RA 5AKJA 3UUEA 1QP7A 2W58A 3THRA 3OO0A 1E9EA 2P2CA 1SNYA 2PXHA 1GKUB 5CGQB 5A4DA 3JALB 3EIXA 1M2OA 3UKDA 3DAGA 1B1AA 3HABA 3G2IA 3MMPA 3OKAA 3OP1A 4HC4A 2C1ZA 3GA5A 1YDGA 2FFQA 2ZE8A 4QECA 4YJ3B 1SXJE 3FW1A 2CUZA 4HI0E 3K0KA 4N54A 5BSHA 1V1MB 5FLEX 3JV7A 5KPJA 5CD9A 1G20A 1NLUA 2P3OA 2OCXA 1WHSB 4OQQA 1BGVA 2QQ5A 5BYKA 1FS6A 3AJEA 2ZQZA 4E2FA 3IOCA 1WF6A 2C9CA 3BHNA 3OLXA 5FV7A 4GZLA 1XWWA 1QRTA 2Y1DA 3OOSA 3LCJA 5HUHA 4DJEC 2XDYA 4TZKA 4C6TA 3HDQA 4RESA 3SX2A 5K8LA 2CK3A 3BA1A 1DOHA 2ONCA 3RSCA 3KJGA 4MW0A 3ZJVA 3F7NA 2PRYA 3TD9A 5AKYA 4JXZA 1XRRA 4BBJA 3M5DA 5AICA 2OR3A 4YUXA 1C29B 2MOKA 2NSYA 1Z68A 4MJ7A 3U44B 1JHMA 4GPIB 3IAFA 3RVBA 4BY9E 4J16C 3HCFA 5CT6A 3K9FC 2JFZA 1JDUA 1HEYA 5DNYB 2G82A 3MA0A 2FEPA 2RAUA 4OUDA 1J22A 4J3NA 4EPTA 5GM2A 4NDNE 1KP3A 2YIDA 4Q48A 2WI8A 2G5GX 1MV8A 3E22A 5CM8B 2I29A 3IVAA 4RJ2A 5E8JA 4N40A 2W6QA 4FOSA 3I05A 4YLGA 2ADOA 1JQDA 2VWGA 4D43A 3M34A 2IX3A 1MP0A 2C4UA 4PSVA 4XYBA 4EW2A 2M6RA 4IJQA 2GF9A 2Z4SA 1U2GA 3GLHE 3H9UA 4WK0B 5JZ9A 4TROA 1R8YA 1A8SA 2GNOA 2PZJA 2XLCA 3EAGA 1MB2A 3EF1A 3V6LA 2O57A 4EK9A 4D42A 2YS7A 4XB2A 2A84A 2C2HA 1NFRA 2HF7A 1R4NB 4RHYA 2OHXA 1KSHA 3DONA 3GT4A 2GJSA 3BC1A 1AQ6A 2NZ2A 1XDWA 1NVBA 2W6MA 2QSZA 2IYFA 2PJUA 3CPJB 2D2IA 4KWTA 3FM9A 2WNHA 1N4AA 1KEEB 3G8YA 3PL1A 4Q21A 3SQWA 4KH0A 1WXEA 2BKVA 3KJQA 3PBKA 2WFMA 3LFUA 3KFVA 1XAJA 4QOHA 3RNOA 3G7SA 3AVVA 4A0QA 5WRFA 4V0LA 2CEAA 4D45A 1F5SA 3QPAA 4M9UA 3AVQA 3R23A 1BX0A 3LUKA 1XDSA 4UXIA 5B4UA 4BPBA 4O2BA 2WZCA 3I83A 3N8IA 3IP8A 4PZCA 3V4VB 4MIKA 3WADA 3FOBA 4YX9A 1HFWA 1FP1D 1NNI1 3JY6A 4XEHA 2D0OB 2Z2ZA 1JJAA 1L1QA 4HNSA 5C3MA 2C92A 2D8AA 4EDFA 1HQYE 2AI1A 1D3AA 2JAOA 3ZWKA 3PG5A 1XK7A 3N8NA 4V02A 1ZGAA 5EE9A 5G0VA 1UZNA 4OA5A 1ZQ9A 3D6FA 3DVSX 1F1JA 1MX5A 3OX1A 4PX2A 1WHTB 1RKVA 5DNEA 5HBRA 3ZWOA 4IZHA 2EP7A 3VO9A 1A7AA 5IEBA 4TRMA 3OZWA 4AJOA 3NV7A 4M0UA 2XI4A 3H0KA 4TT3D 3RIHA 1A2OA 3ETHA 5FPTA 2VBIA 4KC0A 1Q0TA 4QYIA 1P17A 5F35A 1JFTA 1RW4A 2IOFK 3MMSA 2RGXA 2OUKA 2C8VA 2LKCA 1D0VA 3VPHA 4JJEA 4CN9A 4UM7A 5E4FA 4YHHB 3AHDA 2H1OA 2Z1NA 3LDAA 2EIXA 3MQ4A 1SQGA 1FPMA 4YP1A 4UCXA 2YVKA 3PE4A 3S5UA 3KALA 4RPKA 1SG0A 3GQBA 1RCFA 2P35A 3CC8A 3UUWA 3W9YA 3TVTA 2IP1A 4HZUA 3RU3A 2ZRGA 4GPTA 1OBCA 5A0VA 4G0XA 1FTQA 1LK7A 2JAHA 4NBRA 5AESA 4G1EB 1A9RA 1G8SA 5KJCA 1IB6A 3TZLA 1IC6A 4M60A 5EN4A 1Z3IX 5EIBC 3ULKA 5BMVB 3ZZMA 1QS0A 1Y8RB 4YIKA 3DZIA 4GWLA 4IEEA 4UM5A 2QVZX 4LRXA 2H5LA 2K4MA 3LAWA 3LKZA 1AA6A 4XQGA 4DPMA 3D6JA 3IUJA 4QASA 9GPBA 2XYVA 4FD2A 2W0SA 4S24A 2PPLA 3BBPA 3PNLA 5FI5A 3WDMA 2FMIA 3A4NA 3TQOA 5ALSA 1QK5A 1U9ZA 4UBNA 4MLCA 1PZGA 2A5YB 4RPJA 3GGDA 2VTBA 1FK8A 1N1DA 2BELA 3IBTA 4X20A 1XO1A 1MJNA 3SJAA 3WB9A 3AUJB 3T7JA 4GSYA 1AQYA 2QD4A 1IN8A 4WBNF 5IN5A 1G8FA 1KQOA 1Q1AA 3LCMA 1Z0KA 4NBUA 5LVAA 5IZCA 2OZLB 3VU9B 4DIFA 2F64A 3CTMA 1AQNA 3TQQA 8AT1A 4EJ0A 2F43A 5JYDA 2DHQA 4NESA 1ZCFA 4MUGA 2BDEA 4QOEA 1WX1A 3RFCA 1L7AA 3WHPA 3KSMA 1Z75A 5IVDA 4MPDA 3RSSA 3KT6A 2J3KA 3OIVA 1MX9A 4M49A 1KVRA 3ID6C 3U7QB 5J4KA 3FNIA 1G60A 3GLUA 1F0KA 4XX1A 1DG3A 5ALNA 2XA2A 3ABOB 2I1QA 3OF5A 4D0NA 3II6X 3ISJA 1BMFA 3SIPA 1I3LA 3D6NB 2J5XA 3I76A 4OXQA 4JMLA 3CKYA 4DYVA 1ZOIA 4ZICA 2PRIA 3T7TA 5I7HA 2DBRA 1NNEA 3GJ6A 2HU2A 3M6IA 4G9EA 3VU3A 1XDBA 4C05A 3LVFO 2FPMA 4IX1A 3GLFA 3EPRA 3ZHVA 3FI9A 4P53A 4QXOA 3RASA 5B55A 3ETDA 3FNRA 2Z57A 5IJAA 4Z5XA 2P0AA 4YAEA 3GLKA 4D26A 5E6RA 3BQ9A 2ERCA 2OPHA 2F8TA 3MFQA 2EJUA 3P0EA 2O8BA 3PQ7A 1SU4A 4PPNA 4BX2A 2MYTA 3V3TA 5BNIA 2GD6A 2XTMA 3NHUA 3LY8A 5J2UF 5GINE 1L4LA 4NFSA 3EDRA 3WXBA 1OHHA 3EYWA 1PT9A 2WIKA 3V34A 3AVTA 1CEXA 4Y2UA 5F4BA 2W98A 5G0SA 3TIVA 1JG3A 2DLCX 3UENA 1GU1A 1SIUA 2OENG 4FFWA 3PRHA 4MRNA 4WASA 3DG9A 3RIMA 3ZX5A 5BWLA 1SOUA 1C9YA 4KR7A 3K15A 2J4CA 4RTQA 4AD8A 2BM9A 5J2TB 4KBFA 4HNAA 2TMYA 2W2LA 4QUHA 1NI3A 2VF5X 4N65A 1TYDE 1M73E 4J3JA 13PKA 1TC2A 2GD1O 3M1YA 1RXYA 4I36A 5B3JA 4DLYA 2WSSA 4EDHA 1AKTA 3LK6A 4NV0A 4URHA 5GVSA 2IPAB 3IO3A 3KZNA 5DGTA 4URFA 2FDCA 1H66A 1E1LA 2WDZA 1EP2B 2CUKA 3ND9A 3TRJA 3OZEA 3W7AA 1EVIA 4P3YA 3V00A 2V1XA 1MEJA 4HAZA 3K5HA 3MFYA 3NOXA 5JFTA 1K3UB 4JBLA 5LMNB 4IQ4A 1IN7A 3I6MA 1ZM7A 2DPLA 2IHJA 3MLAA 3MWEB 4JJGA 1MV5A 4EI8A 1Y9DA 3O26A 4OX9Y 5IBQA 4W1QA 1SBCA 4QGFA 2Z98A 3JYHA 3FOWA 3D3QA 4R2XA 2PYDA 2Z0MA 3KZXA 3T9CA 3OO1A 4REOA 1BVUA 2ZR8A 4L9SA 1I2DA 3IBCA 3OE4A 4MJLA 1W88B 5AK3A 5FPHA 3SF8A 5LDHA 4LRQA 4LQ4A 3KYIB 4K9QA 4F6RA 5ALWA 4JI0B 1P5FA 2XRMA 1NDQA 3WFJA 3IDAA 3K9NA 3CEHA 4KPFC 3UIEA 3ZD6A 4Z4FA 2QM8A 4C4YA 2CK3D 1DGQA 1WABA 3DFMA 5HR5A 2GEFA 2RHCA 3QFSA 2H3HA 1JSCA 1CLEA 1G291 2EW1A 2D3WA 1PW7A 2OP0A 3IT3A 1LV8A 4QYTA 4RIFA 5TDHA 3H6HA 2GN2A 3ER6A 2FSIA 4I50A 4P08A 4CM9A 5IJ9B 4W5OA 5CRIA 2HQRA 2OHJA 4TLCA 3DBLB 4NC9A 4JP2A 4AJLA 1HE4A 1I10A 4IZOA 3SX4A 1D7AA 3VSCA 4MW7A 5C8ZA 3KAKA 5E38A 3QOXA 3GJRA 1QB8A 4IIVA 4DLNA 9MHTA 2VYNA 1XQWA 2QTFA 3IAAA 2B8WA 3M82A 5DM0A 4BNNA 4CN8A 1H1LA 3PKJA 2VYFA 3B6MA 1TMGE 1UT5A 3W4JA 5L3VA 2QGFA 3HGTA 4DCOA 4R98A 3URMA 5AW3A 1FSPA 1W1UA 1FF9A 4NCNA 4XCQA 4RVUA 3MAJA 3PFGA 4M1TA 4PYMA 3RUDA 4MRVA 3ANXA 1NR5A 3AR3A 3F7MA 3BWDD 2IW3A 3HYTA 4QTXA 1VMIA 4L5YA 1NXWA 4MQFB 2WKRA 3BFKA 3L6DA 4QPCA 4QSMA 2C2MA 3UCXA 3NVAA 4N41A 1N5IA 1XVLA 4L5IA 1CFJA 2BLNA 1W2GA 2VNAA 4CI0B 1W30A 1XEWX 3A10A 4X6LA 5SYNA 4DHEA 1IAVA 4DQ0A 3Q72A 3LP8A 3K7EA 3SX0A 3UMJA 2BUBA 2FZ4A 2BP7A 1SEVA 1V4BA 1XMQB 3D7MA 4DXAA 1VFPA 3DVRX 4B1FA 3ZS8A 3T3OA 1F1BA 3WR5A 1PQUA 1AY0A 4NS4A 3N7TA 3C87A 1OTYA 4ZZ3A 4J0FA 1FDVA 1KU0A 3RC1A 2R2GA 1GPBA 5KNBA 5LCXA 2OFFA 3EXFB 2FP4B 3H75A 1HK7A 2I6XA 4LAFA 4DIKA 1M6VA 3HU1A 2VZ9A 2J5QA 2HR1A 3EZXA 4C6HA 4A16A 2ZUFA 3DUFA 5LA6F 4AS1A 1GKKA 2RJNA 3LUBA 2PG3A 4DG5A 2I9PA 3FE2A 4NNOA 3ZK8A 4E5UA 1WSWA 2RGCA 3I1YA 2VS1A 1XVUA 4FHZA 1J7KA 1LKZA 4UFPA 5AM1A 3EXIB 1IG3A 4U5XA 3NETA 4D4KA 1U1EA 1E9DA 5AOCA 2GPBA 1OXKB 4NJMB 3I12A 2R8YA 2YBEA 3E23A 1D07A 1TADA 1KMHB 2QRVA 1A9TA 2BGTA 3AF1A 5KVSA 3OPQA 2AKYA 1Z2OX 4E2XA 3JVIA 2JLZA 4QTZA 4CW7A 5F2KA 2JGDB 7YASA 2F3UA 3CLKA 5E1OA 3B2EA 1O03A 1UMBB 4UOEA 1ZOOA 3AOEC 3K1AA 2C9BA 4UQPA 1YS9A 821PA 4P34A 4PS0A 3FLAA 3GT3A 1HZZA 3O4VA 1YJ5A 3BDIA 1U65A 4G0NA 2I0FA 3PGVA 4MWDA 1P0FA 2PV7A 1NRWA 2HA4A 3O8OA 4FI3F 1TF2A 5CDGA 2UXCB 4ALLA 1YK0A 2GLTA 4OUKX 1NRIA 4C2AA 1NP6A 4PR0A 5IXYA 5M04A 3JARA 3QIVA 1SXIA 5KYXB 1SY7A 4H7HA 2Z6AA 1R9MA 3AETB 2Q6OA 2QR3A 2YIJA 3IAS1 5HKLA 3ZW9A 1DJMA 4NIMA 2O05A 3PJFA 1FVXA 2HIHA 3BWYA 4GOLD 5T4BA 4KO2S 4BS9A 3HJFA 4KHPB 2Q3MA 4GRDA 4XZ3A 4CT5A 2DQZA 2AXEA 4Q4AB 1Z37A 3JZFA 1NF9A 4RA9B 2SCUA 2YICA 4XLTA 1V16A 5JNLA 2ZYHA 2VHQA 3GBPA 3Q9SA 1VFNA 1YBFA 1CE8B 2O06A 3PDJA 4O4LA 4G1UC 2XT6A 1OXMA 5DTEA 2VRCD 4DDTA 5HKKD 2GARA 3INGA 1B0ZA 2FWMX 1XTVA 4MRPA 4F4HA 3AG5A 1W4LA 5DU2A 1THZA 1A4XA 1A4RA 1SUSA 1Y9JA 3R3SA 1I3NA 1UFQA 3FYSA 4RFVA 4IGEA 2VDJA 1YUNA 4KW7A 2JKZA 3BMOB 3LGXA 4G8BA 5ALPA 3URKA 1XN1A 1HA3A 1YZGA 2FZ5A 3G9QA 5T8KA 5CXUA 2ODPA 1AF7A 5TJHA 3W4IA 2EARA 1CQJB 4E4TA 4ZCIA 1PUXA 2ZM5A 1ZWKA 2N42A 1QG0A 2QTWB 2JH3A 3A9VA 2JLQA 3G9TA 1ZISA 1K8ZB 4M6WB 4WFJA 3IHWA 4V39A 4A26A 2M98A 4FMPA 3HEAA 4RIGA 5EHNA 2PH5A 3AYXB 4X8HA 3VQTA 2EZ8A 4QX6A 3NHSA 4B2IA 5IH7A 3TLMA 3TS1A 4KYTA 4CKBB 3MGCA 3P2OA 2J7KA 3JQEA 4EYKA 3UHOA 2J3JA 3RF7A 3ZJ5A 2BH9A 3RUHA 4N49A 1SCKA 1XRJA 2CNLA 3PB3A 3TQHA 4Y0VA 5A2QA 5TARA 1E69A 2VH1A 3RVJA 5FHRA 4UJ5A 3OQIB 3KJEA 3IILA 4RZUA 1EG7A 2PUHA 4Q1FA 4QELA 1SXHA 1XSEA 1XWIA 2WRZA 2I4OA 3KEGA 4HTAA 4KOAA 4U02A 3TE7A 2OFPA 1VHWA 4NONA 3U40A 1ZIXA 1PNVA 2XADA 3H84A 3IE1A 5AXCA 2PMDA 4FE7A 1UAGA 1DAGA 4U8HA 4XUEA 3B1XA 4HEJA 4MB0A 1KBZA 5D01A 1DEXA 1BMFD 4A10A 1IN1A 4RFLA 1SUEA 4GYWA 3OIYA 2N47A 2GAIA 2XEXA 3KHUA 5NULA 5LUAA 3CO5A 4WRRA 4OLBA 4OQFA 2HF9A 3LOQA 1CNEA 1MB3A 1PLJA 3O8QA 4EY3A 1Y98A 3KQYA 4RTLA 1O89A 1HDOA 3WC4A 1HSZA 1KMMA 2WD8A 3IQGX 3ZBTA 2C94A 4WKGA 2JFOA 3QVGA 4PZZA 1YQGA 3EXEA 2QAGB 3KKOA 3T1OA 3EXHB 2QTNA 2H2GA 1JPVA 1P6XA 4CDRA 1RJ9A 1Q5PA 3WLLA 3IUYA 1ZN8A 4CIYA 1K98A 5JAZA 1ZI8A 3BGVA 4UBJA 5TGDA 3CGWA 4OI2A 2OV6A 2CHUA 1ZRHA 2XKKA 1E5VA 1E9SA 1OHHD 2OKGA 2G71A 3C39A 1HNWB 3GR6A 4HFRA 3A4YA 4J76A 4F45A 3KJNA 4HYEA 4D3SA 5AMXA 3FRIA 3I01M 4X1IB 4K9KA 4G1MB 1RI5A 3IR6A 1SHZA 1VSBA 5I47A 3I2KA 2IEGA 1U02A 3AKEA 4ZYWA 4QU9A 3GRCA 2JASA 4LOHA 2BZ0A 5LQRA 1KAOA 3EIWA 3MWDA 3FCOA 4YP6A 4BCDA 2PXAA 1C8BA 5AK5A 2FPIA 1I4WA 1ZQ1A 2QGZA 4REQA 2WSSD 4CM8B 3BIJA 1X7WA 4OMUA 3CF6R 4C5AA 5KS2A 2UYCA 4C4AA 2C9ZA 3GP8A 3ANTA 1UJ6A 2JAUA 5EUQB 3E58A 5MFPA 1P2BA 2HHCA 4L7VA 4X6YA 4JI5B 2B7LA 4RCVA 5HWSA 2G1KA 3FRJA 3SD7A 2YN0A 2V7PA 5KB3A 2ZRDA 1E1QA 1L4EA 3GVXA 3W3ZB 4C4RA 4DQUA 4YYZA 1USKA 5E4JA 2BZ1A 1Y6RA 3DKKA 2PX0A 5DLPA 5HJ7A 1X86B 1YZTA 2BDTA 5LNK1 2XYPA 1G21A 3QUBA 5ECDA 2Y8EA 4HD8A 5DRYA 4LBYA 3S2UA 3SHVA 4ESEA 3WWZA 3UBTA 4Q1CA 3IA7A 4JVOA 4F21A 4F3TA 2YWJA 3BRSA 4OLFA 5KSYA 4QWMA 1LPPA 4MR9A 2YCLA 3GZ4A 3OA2A 1GEEA 4EMTA 3L92A 4EGJA 4GZ5A 5D8DA 5JY6A 3KSAC 3TJRA 1WSBA 4PX3A 3GPCA 2CBZA 4E2YA 4FZ5A 5KSWB 3DV2A 1VQ1A 4OQDA 1W49A 4FR5A 3UB2A 2NLOA 4CM9D 3UKJA 3GRAA 4CQNA 4G26A 4UUMA 3L0SA 1UXHA 4X7RA 1CW2B 1U2RA 2JKVA 3W7VA 3TBKA 4RK5A 1GTJ1 4WN9A 5IXSA 4KG7A 1S3SA 2WIGA 4H59A 3RSZA 3EOAI 1U5BA 5I9MA 3BGSA 2JK0A 3A9CA 4QUDA 4C0SA 2L0XA 3CVYA 2K6GA 2EDCA 1MT0A 2Q2QA 3LBNA 1VL0A 4B83A 5IJ0A 3ZVNA 4QPNA 1E9BA 1SQFA 3K0FB 3LHKA 4MZDA 5LUBA 5K2OA 2HTEA 1T2FA 3EDMA 5HP4A 2QTMA 3IESA 5A2GA 5L8VA 3CUYA 2HV8A 4GH5A 2IZZA 1ZNYA 2B83A 2KX7A 2OZKA 2FNAA 1Z63A 2B69A 1N9KA 3BCSA 1FUIA 1KSGA 2CV0A 1MGOA 3DXYA 1LBIA 3WHIA 5A0TA 2O9JA 3K1TA 1NQTA 1AC5A 1EBFA 2CDRA 2DR3A 3Q3EA 5AVWA 2ZT7A 3UPUA 4ZZIA 2B99A 1AX9A 3ZCQA 1EWQA 3K35A 3U4DA 2JIDA 2J9YB 4I5IA 1FSGA 2BEVB 4V2UA 5CFRA 2GK3A 3WTCA 3NYWA 3G49A 5JRDS 1MX1A 3ZI0A 5T57A 3MRTA 1SC1A 4OCZA 2MU1A 3AUAA 4HH4A 2GPNA 2NOAA 3KXPA 2FCAA 3F9CA 3L8CA 1O5OA 1V1JA 1R88A 4IMPA 2CVOA 3G2KA 5C51B 5BN1A 3SZGA 4AMUA 1J25A 1ZM3A 3EUFA 3R76A 2DBQA 3TGWA 3U2QA 4AP5A 1XZMA 1RM0A 1MB4A 2ZRPA 3QJ5A 4UMEA 3AUXA 4FFOA 1TM3E 2ZRCA 3Q3CA 4B71A 3O21A 1NPDA 5CX1A 3KUUA 2P3QA 1T0HB 3DMRA 3HNRA 4MO9A 3NT4A 2R66A 1G6KA 3QBDA 4FFSA 3GCXA 4NE2A 1ZD3A 1Y1QA 3DXFA 5DN9A 1GGEA 4D6YA 4Q01A 2GVNA 2DLDA 4L8FA 4TXNA 4ZVNA 5DHUA 3VZQA 2Q28A 1WXXA 1MT3A 3UAWA 3W1EA 4J16A 3HU2A 2E5WA 2HV9A 4Y7DA 2O1SA 3OLWA 2WJ3A 2Z2YA 4ZYTA 1HGXA 2ADFA 3B9BA 3D2BA 3E9CA 4MOWA 4OLJA 5CH5A 1OBOA 4UNRA 1N36B 1HE8B 4MVJM 1K6JA 1VGQA 2PWBA 4UJ3A 1GGMA 5FEUA 3SYMA 3Q40A 5TY0A 1W4RA 4LV5B 4GPAA 5FD8A 5FL3A 2K2QB 2EBFX 5IJXA 3P2MA 2EJVA 2NUAA 3OY7A 2O6HA 2N75A 1NULA 2FW9A 1ULZA 4CJXA 1AN0A 2FZLA 1I3OA 1GADO 1EE2A 1VYTA 2HY7A 2X0IA 1QONA 1G7CA 2ZRKA 1Q1QA 3VBEA 1G8HA 2C7PA 1PSZA 1E6CA 2A3RA 5IULC 4IV8A 2J0VA 3NNNA 1XJQA 1TU0A 3C3BA 4FYMA 5CFPA 2YWGA 2X6RA 3M4XA 4A4DA 1JDBB 4Z1MA 1T1SA 2IVFA 3QI7A 2IH4A 2WWVD 1U81A 5AW1A 3GCZA 3M3HA 1TCAA 4LS3A 4Q3LA 1FL9A 1LI7A 1T8SA 5DYIA 3LBAA 2B21A 4RQBA 1CDEA 1J5PA 1RI3A 2DY1A 1NBEA 4H27A 4NZZA 2A57A 5AK0A 4YGYA 5DM4A 1GYPA 3EF0A 4C9BA 4RABA 2D1QA 4JVNA 1I7LA 2PEZA 4QREA 1AN9A 1DJPA 5GPBA 3WNDA 1XEXB 4BB9A 1E3MA 3NALA 3N86A 4OA8A 2YRWA 2W2KA 4D98A 3TLBA 2QYTA 1QZTA 1VJ5A 1G7SA 3GMDA 1X80B 2OYSA 2C7OA 1JQAA 1YOBA 3K9WA 2QQEA 2XF2A 2YY5A 5JQGB 1CUYA 1XFDA 4K6CA 4DYDA 1KY5A 3PQCA 4IOJA 1HUQA 4N3NA 1P0PA 3B89A 3ZHZA 3PTZA 2PRZA 3TD2A 4M9QA 3M5PA 3QVUA 4NV1A 6PFKA 1M1ZA 2QV7A 1DEHA 3HADA 5CEEA 1BXGA 3TL2A 1V48A 1MVOA 3BGOS 3COWA 4N8EA 2PS1A 1N2EA 1Z5GA 4UD2A 1P77A 1JIVA 1PHPA 4MGIR 5GJVC 3KUDA 4V0OA 5CVJA 4MPTA 5DDIP 4B17A 2GAFA 2DWPA 4IJVA 4JU8A 4DQKA 2OV1A 3PZRA 4CU5A 1LPOA 1ULBA 4P38A 1ND5A 2CLFB 1N7GA 1BH2A 3KVNA 3DMYA 5K0NA 3HO8A 1B15A 1NOIA 2W6PA 2W8BB 3G6KA 1H65A 4HYQA 1ENYA 3EDYA 3AU9A 4K40A 4KPYA 3LW8A 5TIIA 4LNAA 4MVWA 2E4XA 1DRVA 4OGKA 3H6GA 1A82A 1C9JA 4B6GA 1WQ4A 3G2PA 1USIA 2ONZA 3QWBA 1WIWA 3DUWA 4GI1A 3AI3A 4YECA 1UQUA 2H11A 4P2GA 3N6XA 1IQ0A 1JEEA 2O8FB 3GW8A 3NCTA 4I8XA 2YV4A 3FB4A 1C3XA 4ZDWA 1N2CA 4M21A 2HA6A 1KO4A 1OYWA 4EY5A 1JAXA 4UHEA 1ACJA 1YJCA 3IUMA 4L0DA 1B3RA 5AFSA 1M2OB 1A5ZA 3UJ8A 1JR4A 4NAUA 1V8FA 3FKQA 1FVFA 2QRJA 3DDSA 1ZKMA 1YCFA 4DV3B 3KPJA 1KJIA 3R4CA 4FYIA 3MRSA 3PUZA 3QUQA 3I32A 4BKMA 3A2NA 5JS8A 1B42A 3L4BC 5JBNA 4JQZA 5HIMA 2C9OA 4AXBA 1G20B 1RHRA 1WTAA 2CVHA 5GV7A 4C7KA 4D80A 1VSUA 4GR4A 4NHEA 2JJYA 2LDBA 3B82A 4PY2A 3HZRA 3RO7A 4ALIA 4EA9A 4Z8XA 4IBOA 4ZPJA 3MT7A 3LQKA 5I8PA 1EFPB 3ESRA 2P9FA 1P9WA 1P72A 5CTJA 5NLLA 5F7XA 5CBPA 1L1EA 1XELA 3NBZC 4LJRA 1YC5A 3W5JA 3VZCA 2V3VA 4U39A 4C6TB 1A7JA 2CLMB 2QRNA 4PPFA 3HTXA 1XMXA 1C80A 4MGZR 4EGSA 4OG2A 1KBOA 5KMGA 2ZJ3A 4EKEA 2H2FA 4UDXX 2ENWA 1VLVA 2CXQA 5DASA 4EO7A 1X92A 1FJGB 1P73A 3LRTA 4P3KA 4EZIA 3IQWA 3SS9X 4C21A 1PZFA 2V9ZA 4MWZA 1GNLA 1GGVA 1L9XA 3FFTA 4Q15A 2NT3A 5JTUA 3AJ8A 2EJCA 1ZM4A 5K03A 3VVMA 2C5AA 5SYAA 3V7FA 4YP9A 1IPHA 1I7DA 1VLHA 3QE2A 5E7QA 2FPGA 3VOSA 2FPSA 2ORIA 4W5WA 1NA5A 4RM3A 4OUDB 4ZZ0A 1RADA 4JDUA 3TSWA 3R7NA 3A26A 1Q91A 4MI3A 1OWPA 1ESNA 2HMYB 4GX2A 4FGZA 2OYRA 1X77A 3CEAA 1E99A 3N3AC 1JDTA 1JDVA 1ZMXA 3LX6A 4BLUA 2Z3VA 3DEAA 1V2HE 5C7YA 5KYUA 1RD4A 4QG3A 3P9XA 1PCXA 3PF9A 1KI4A 1NUHA 1K7EB 3E15A 3EVZA 1UWCA 3H5TA 4IV5A 5K99A 3TOVA 1EVYA 3ZU5A 1KXZA 4R05A 4NECA 2RBEA 1BD4A 1CBUA 2GR9A 2L2QA 3ZVMA 1FFYA 2AMFA 4BMPB 2YHBA 3NRJA 1JWBB 4M1QA 2BEUB 3ELUA 2H52A 4ADSG 4ES6A 1AHPA 2X8LA 3TTVA 3EF3A 1KS9A 3GIDA 4K5QA 3T7IA 4MVJI 5AD1A 3I01A 1S89A 3PHJA 4NNPA 1PZXA 1KSJA 1R0SA 3AERB 1QAOA 2HZ7A 2WQZA 3VNRA 1UBMS 1Z6QA 3IPRA 5JCOA 1F3LA 1AXRA 1HKHA 4AQYB 3CH4B 3CLTC 3FSEA 2G8NA 1Q44A 1OSNA 1K4MA 2CHQA 3PGLA 3RVRA 3HMKA 4Y6PA 5HFJA 3CT6A 4GR9A 4P7BA 1Y6QA 2V7TA 1U7UA 4N6GA 1XBTA 4ARUA 5I7SA 5B2FA 3OQVA 2ST1A 4RZXA 1IPEA 2AG6A 2QRQA 3IXMA 5DYTA 4YWJA 5LZ9A 2VDKB 1JV2B 2C7GA 1YZFA 4KACA 4MV0A 4GP7A 3NHWA 2FFAA 4EVRA 1FSSA 2ZIWB 1KYVA 3D3EA 4PO8A 1F14A 1Z83A 2VTVA 1C1YA 4BO0A 4MYTA 2JFPA 4CCSA 3W05A 3SR3A 3H8SA 3C41J 1F06A 1L9KA 2WE8A 4XJTA 3RIYA 1GPKA 3H3XA 5ADUS 4XD7A 1WY5A 3ZOZA 1H2ZA 4LDPA 2BHLA 4ZA2A 3MPOA 4HJRA 4CVNA 1QFMA 3A1SA 4IKPA 3RK0A 3MTBA 5I8WA 4J90A 1XNGA 3QPWA 3L49A 4PE5B 1G1MA 1MOQA 2R0QC 2B1JA 1IBLB 1U1CA 1LGYA 1TVKA 1Q11A 3OCJA 4C0WA 1XGKA 3R7LA 1K0UA 4JI4B 1A27A 1IAQA 2XB8A 4O2LA 4EZBA 4CLDA 1G20E 2WVAA 4HRYA 2X6TA 1IVYA 4RL6A 2AMVA 2HK8A 2RE8A 4C4SA 3A0UA 1N32B 2GWHA 4QEZA 4QBTA 4URXR 1XX6A 3L7YA 5JCXA 1JBQA 4GKJB 4M0MA 4EY8A 4MUEA 2HRBA 3ED5A 2VAMA 5FPYA 1NTOA 4HNVA 4NYJR 4NR0A 4LXXA 1SUPA 4HZUB 4NNJA 4F1JA 3RC8A 1C0EA 1CY0A 4MRMA 1H6AA 1YGYA 4BLQA 4XTCS 2NSJA 3DNMA 4LYYA 4FMCB 4D7AA 1VKZA 2NVOA 3HYNA 1CR1A 3P0HA 4LWPA 1R9NA 1ZUNB 1UFRA 1D6JA 5KTPA 1LA2A 2H17A 2ET6A 2GBLC 4P3PA 1XLWA 4R7TA 3RC9A 1BTOA 1HFKA 1EVZA 2JLYA 2XCOA 1VL6A 1XDZA 4J4HA 2OPBA 5AKHA 1UANA 7ABPA 3GVCA 4XJXA 3ZEAA 2J32A 4C0KA 1AGRA 2RGWA 3R3VA 5K1ZA 3V32A 2YVQA 4HEQA 3ZE0B 2JAPA 5DIFA 3KZCA 1ORDA 1U3VA 1Y81A 2FQWA 2XNDA 3KSUA 3E5RA 4M0FA 4RTRA 2OQRA 1EXDA 1ECFA 3I42A 4CU2A 3UQYS 1VIMA 2VTBB 2LRHA 3WRYA 1IY0A 1GAQA 4E14A 1PT7A 1K66A 2H1RA 3OOYA 1L5RA 2P9CA 5EP1A 4I08A 3E84A 4DM4A 2V96A 4O1IA 4RDIA 2CDAA 1GP2A 2X1MA 3AESA 4LYHA 4NFLA 1Y33E 4WCFC 3GL9A 1T29A 3NHAA 4J1TC 3TXYA 4GPBA 4II7A 4TQUS 4B79A 4Z1MD 4ZIRB 5TMPA 3AVOA 3D8TA 2FV8A 4C22A 4JCCA 4B31A 1TQ8A 3EZ7A 2IF2A 3OHSX 1Z38A 2VQ6A 2ZP1A 1QIEA 4XB6B 4NPHA 2C0PA 2WYHA 3HUEA 3I73A 1SKYE 4UCWA 1HDYA 4IG9A 2XNKA 5DGIA 1D2NA 4NYIQ 5BRJA 2VDOB 2ZXUA 3FMFA 4XSHA 3HKEA 3L18A 1DEAA 3H5VA 5L7WA 1KQ3A 1KS2A 1ZOPA 1EVEA 2X8WA 1GQYA 1Q84A 4UTPA 1PV4A 3UJPA 3NWEA 2OL4A 3D7KA 1RZRA 4FDVA 4RJLA 5DTQA 2ZCVA 4MYHA 1NUAA 2AHRA 3FUVA 3KR9A 3L8HA 1BE1A 1Q3KA 2J3DA 3PUJA 5JNTA 4DLLA 2C5SA 3OZTA 4NBVA 3RS5A 2RGBA 1H2YA 3GZNA 1PUIA 1I8TA 3MS7A 3ADCA 2J31A 5CUQA 4EFLA 2J0UA 5KHAA 3QGMA 1HO3A 5K6RA 1XYYA 2C7RA 1RT9A 2Z2XA 3T9BA 5KTOA 1GPUA 2CT8A 1XU9A 5EKXA 4DV7B 2GM3A 2QRHA 1FNSA 3ENKA 4BN0A 2BTEA 5JCJA 4NX2A 1YZYA 1L4UA 3A3YA 4GWKA 4AY4A 5C5CA 4BX8A 3H1AA 1CQIA 3PUWA 1FFWA 4Z53A 3AOEA 3RB8A 2ZSAA 1C7IA 2ZI7A 4G41A 4IQFA 4IX9A 2QD5A 5FOXA 3STWA 3PLAE 2EKBA 5I9SA 3WRXA 1VHTA 5AUQA 1AURA 1GSAA 4OJNA 1ZOLA 1WZ2A 4XM2A 1GTL1 1Y4ZA 2IDMA 4YT8A 1GXSB 2Q3HA 3JD0A 4RXMA 3HBAA 2FDRA 1J21A 3QENA 4TSKA 4MKRA 5JDCC 3ZCXA 4BQOA 2XNCA 1MAHA 2HF2A 4CMBA 4ZVSA 1WAMA 1HYHA 2DAPA 3QEJA 1EDZA 3KO8A 4DILA 2MSKA 3OOEA 3QXXA 1N2IA 3GD7A 4IO0A 1FYFA 1T91A 1KQPA 1Q3TA 2FW0A 3C6ZA 1DQSA 3A6ZA 1DRUA 4J29A 2WIDA 3JAKA 3MTEA 3NFRA 5FQOA 5L3RA 1QJCA 4BX9A 4CKEB 4YRBA 2HWUA 3GYGA 1M2KA 4JC5A 5CR9A 1M2EA 5FBVB 5BV2P 1YZHA 2J87A 4QHTA 2QB5A 3ZKAA 3PVZA 2W93A 2A92A 1QH9A 3F49S 3KZMA 2GN0A 3CPSA 4FCCA 4LYEA 5JMOA 4DV4B 4JBGA 5M29A 3QEBZ 2PWAA 2OHIA 4Q7LA 5J63A 1WQ1R 2EU8A 1E0JA 2C04A 4QUJA 4JJ8A 3O4RA 4MYUA 2XLBA 4Q9IA 1EFVB 2A35A 2O3SA 4D74A 2DHCA 4A82A 2ZT6A 2WMDA 3WV5A 1Z88A 4WCFB 2J6IA 3AL3A 3CN7A 1SBIA 1TMYA 5IKPA 1CZKA 4AZTA 1OZ0A 1TB4A 2WHYA 1C7QA 3KE9A 3UH0A 4DNPA 4LQCA 3KX2A 2DERA 2V97A 4BQSA 1Y0BA 2EF1A 3FGOA 3HP4A 1U4OA 3PYLA 1U28A 1QDUA 4BNVA 2DOKA 2C00A 1SH7A 4QU0A 1KI9A 4R8LA 2PGIA 3R9XA 2Q9UA 3NUGA 4PRKA 4ODIA 1SWWA 3NEAA 1KAEA 3E1KA 4E5VA 4XPIA 5IARA 3LX5A 2DHDA 3EOZA 1QTNA 4KIFA 9LDTA 4RKYA 3H4MA 2P0EA 2CFTA 1YTLA 1N78A 1Q15A 2FSVC 4UVDA 2BJWA 1TTQB 3R44A 3ROKA 3D64A 4MYSA 4CLRB 1Z5OA 4KXLA 3MG9A 1RBYA 2DTXA 2X5XA 1VJ0A 3SYRA 1I32A 1TQ6A 2ZWPA 4RENA 3V1KA 4EHFA 4HT3B 5JLJA 2QRMA 1SCBA 2XNJA 3ZTTA 4D3XA 2IPXA 3KEFA 4BJ5A 5KBYA 4Y2JA 5F1PA 4FSDA 1EI9A 5P8WA 5JWRA 1VP9A 5K7SA 1C4OA 1UMCB 1VYUA 4Y9SA 4D8VA 1U98A 3VH1A 5CB4A 3HJAA 1QX4A 2XECA 3BSFA 4W63A 5B7GA 3LC2O 2ZUEA 1RXSA 3IXLA 1NY6A 4S1VA 2XGMA 3ENNA 1Q3HA 4FXPA 2GN8A 1M8KA 2GYUA 4MULA 1V5WA 3VHLB 2OCDA 1K6IA 3PFKA 3GLFE 1W36C 3WLSA 5KX5A 1ISSA 3EQ7A 3Q5GA 5EMLA 3OM0A 3NHMA 4M4SA 1UAYA 1ODTC 5ECGC 4Y8VA 1ECJA 3LUAA 3PGKA 4L4UA 2VDMB 1FPQA 1KETA 5AKGA 3EVCA 1ZR4A 3RVSA 2I3GA 2ZETA 4EKYA 4RV5A 1RYYA 2C5EA 3U80A 2KMLA 3GIWA 1P5JA 1KYWA 2BBOA 3EVBA 4DVJA 1UDWA 4K26A 4DBZA 5B57C 4D97A 2CFSA 3F5DA 1C4KA 2A5LA 3C7DB 2ZUCA 1PV2A 4I19A 3EASA 1O9HA 3S5JA 1DCKA 3A0RB 3UKOA 3VU0A 2C0CA 3I62A 1I24A 2ECOA 3ZHBA 5D6NA 3C74A 1USGA 3E3LA 1N6OA 3L8EA 1W52X 1GQFA 2ENUA 4O2AA 2C20A 2I6FA 3ZOKA 1VOTA 3GVHA 5IDYA 4ZHQF 3D2LA 4TYQA 1HDRA 1M2GA 3PHCA 1VBFA 3B9RA 1A9SA 2O0JA 3U4MA 2X2PA 5BYAA 3WGNA 1G5PA 4R68A 1U0HC 4XD7D 4A2QA 4FKZA 1ZNZA 1MZPA 1HT2E 3JTMA 3M33A 4R4JA 1IPFA 3G5LA 4CKCA 1JXMA 3QKTA 3PV0A 1C3JA 5KJ6A 1O4VA 3UICA 4PS1A 2QP4A 1UPCA 2QVYX 3WICA 3WKEA 1SUDA 2AUMA 2ZSDA 1UIRA 5KNCH 5AYVA 1AMUA 2R6FA 1J56A 1ORWA 4P80A 4IDCA 2TSYB 3FFAA 4S1NA 4N0MA 4M1SA 2DH6A 2CF5A 1HY3A 1MO5A 3CLUC 3I9LA 4ZT3A 1Q2XA 1QGOA 3L40A 3SR0A 1XA3A 1R10A 4WOBA 5DM1A 2WY2D 1YONA 1G6OA 3X43A 1VPVA 3BILA 4JBWA 1LPMA 2B1GA 2VO1A 2AUTA 2ZYGA 4M1YA 4GYKA 2SCUB 1CUSA 1G5HA 3LLSA 4LPSA 4ER3A 5BN5A 1T8YA 1T8RA 4GOMD 3TR0A 2II6A 3F3SA 4BVKA 2CVFA 2G63A 1NMQA 4WKBA 2JLSA 5JAQA 3RS4A 5EXPA 1DJLA 1YASA 3GJ3A 3TKLA 2J08A 4E70A 1Z4QA 1IWPB 1RE1A 2Q4EA 3JQAD 2W2NA 4K7JA 3V6MA 3V4SA 5IDWA 1YQEA 1EFRA 4B0OA 1JLHA 2R6JA 5AO9A 5L3SB 5GWXA 3SYNA 3R40A 4RPLA 1M5RA 1F8XA 3EH1A 4KEAA 2JI9A 1XU7A 3ACDA 3HBMA 4AO8A 4JN6B 4K9MA 2XNDD 2GI4A 3IIKA 4AI6A 2B7BA 5JSQA 4J6EA 3EY9A 1T4CA 5BQFA 3HS3A 4WDQA 3MHTA 1EX9A 2C4HA 2VWHA 3HJNA 2EKPA 4QVGA 1IY8A 2BYTA 2YVAA 1RQRA 4E11A 2VYCA 2R68A 2YIMA 2I4MA 2NTEA 1E2MA 2PRKA 1OMOA 3BKXA 3L5KA 4Y2GA 3UNXA 4BZQA 3RVPA 3GFPA 3GJXC 2G36A 4Q5IA 4B43A 3RANA 4AKEA 4WINA 1CJMA 3TQIA 3RKRA 4BNXA 4ZI2A 3NANA 3QSGA 5FTWA 3N2KB 3T1YB 4ZOCA 1X13A 3DC7A 2N1BA 1K1EA 2NU7A 3D4LA 1Q92A 2IYTA 1A98A 3TQRA 1I0IA 4YUAA 5JPCA 1YS6A 1ZH6A 1R5OA 4FIDA 1LD3A 2NVBA 3EOBI 3FDZA 3UJDA 4D4MA 4ABTA 1VG9B 4H18A 1JECA 5KC8A 2R6R1 2WFZA 1ZRMA 1HE2A 3E27A 1LLDA 4QUEA 1RZRD 2JLRA 4E0BA 1UJCA 1V9LA 2C97A 3O3CA 5CT5A 1Z25A 2I67A 1WVMA 1F20A 1EFTA 4I3FA 4PPQA 3O8QB 4IFEA 2EOAA 1KZ6A 4OQYA 1I4TD 3CG0A 3L0BA 4YV1A 1CUEA 2H6EA 2HF8A 2ONYA 3CCCA 3R7DA 5HQ3B 1NRXA 1TGYA 1FFAA 3LA6A 4MUBA 4YJ3F 1W5FA 3P0JA 2LDXA 2XRFA 3JSXA 3V97A 1PR4A 3LX4A 1LRKA 4HRXA 3EXEB 4RE5A 5C18A 1IU9A 3IVMA 1Y1LA 1C2TA 3IAUA 4O0MA 3N39C 4BV9A 4TZ6A 1RJ9B 2V6GA 3HI4A 1PJCA 2QL7A 2X40A 3A28A 2Y92A 3ACBA 4FLEA 3M4ZA 5IT9A 2VP4A 3T3MB 1ISIA 5HK9A 1D0IA 3F5QA 3UUGA 1WY7A 3CUVA 1QUFA 2IYXA 4DLTA 4MS3B 1GD1O 5C1BA 1SURA 1BRMA 2PA3A 1Z34A 2P7IA 5E6UB 2P3LA 2E48A 3FB1A 4H77A 4COKA 5IDVA 5B4TA 3BD6A 1IXYA 2D7DA 3ANLA 3GT7A 3K9HA 3TM5A 5F3DA 4F5DA 2Q3FA 1PWYE 1IXSB 2P2NA 1DTWA 2VI5A 2FPIB 2YJ6A 3DR3A 1ZGGA 3FH0A 4REQB 5CT8A 3TLKA 3VI4B 4B81A 2Q3DA 3IAS6 2E4VA 3HKDB 4BFUA 1M0SA 2GILA 1VMDA 3PWKA 4K9PA 1FVHA 5FEMA 3R9WA 1BG6A 5JOQA 1VL2A 2PL3A 1ZD8A 2UYGA 4F8EA 2EFCB 2Q5CA 1WCIB 2AFRA 4RORA 3BDAA 2BFBB 2W2OA 4NF2A 3X44A 1JIJA 2VUTA 4CMIA 2D5CA 3E8XA 2PT5A 3QEAZ 3ORQA 1VKRA 3D9QX 4R8SA 1MQ8B 4A27A 1F6BA 2F1KA 5K0FA 4WE3A 4ZCQA 2ZIFA 1UJNA 1XNJA 4WK2B 2M1ZA 4TVBA 4UREA 3IS3A 2YW2A 2NU9A 1EK5A 5IANA 4CG2A 1QDEA 1CVIA 1G21B 2WM3A 2DECA 1SKAA 2CDCA 2ZRFA 3KHKA 5KYGA 2EYQA 3E4CA 1FNCA 1SU7A 4RY0A 4Y1RB 5IKXA 1P4RA 3I6BA 4MV4A 4W9NA 3WS7A 4MR9B 3NVMB 4ZAXA 2CE2X 5FWAA 2RKOA 1A2QA 2AYYA 3A6FA 3K1ZA 4TXJA 4KHZA 3QTBA 4NK4A 1O94C 5ELLA 2W42A 3DLHA 2OD2A 2YJ5A 5TC4A 1GPLA 2HA2A 3UBMA 1P3Y1 3Q9LA 4X1KA 1BJRE 3NPAA 4QDKA 3VI3B 4MCAA 2Q1YA 1G6Q1 4L3OA 3HO1A 4CF4A 5ALEA 3RKUA 3U0BA 16PKA 1XAGA 4QOSA 4BWYA 2CSXA 4PWYA 2TECE 1XRLA 1Y3FE 2XUFA 2H9AA 4Q4JB 3WNZA 4TYYA 1I1QB 1CJSA 1XKQA 2CMGA 2VT7A 2WAXA 1VA4A 3OJXA 4MH0R 2GDJA 3FLBA 1VJGA 4KMRA 4XR9A 5U1PA 1W76A 2I2BA 1CEYA 1RWXA 5PNTA 1EAYA 2VHYA 3BKWA 3IPLA 3Q6MA 4QNMA 3SN6A 5CEFA 1U5BB 3QE3A 3NT5A 1UAAA 1B0AA 1CIVA 4O4IF 5IJ0B 3CNBA 4B4UA 1ZMTA 2EWVA 1R00A 1VRCA 3DSRA 3JQGB 5TR9A 3SS7X 3KKKA 3FSGA 4WESA 1B3BA 2ZUVA 4QM7A 4JI1B 1JPUA 1SVSA 2PIDA 2Q4DA 4PAGA 1P2UA 4LZWA 1YV9A 3ED1A 4MWGA 4HHEA 1DMRA 2YDXA 4LSZA 5KWVA 1MDBA 3DMFA 1DBIA 1NQOA 3ZCUA 1NI4A 3M6AA 2VG8A 2YRFA 4WLEA 2VA9A 4OFZA 4QYXA 3TBHA 4CQMB 5EJGA 1RLJA 2W2QA 5DVZA 4DEXA 3BXOA 1A71A 5KQRA 4K6GA 2WTAA 4R7GA 3ZV4A 1WUHS 3H2YA 2JG3A 3KPYA 1DS6A 2P9JA 3HA5A 4EO9A 5DM70 2F4VB 4XWOA 5JSKA 4M86A 4BRSA 4EHHA 1Z35A 2GEUA 3G0BA 3TW0A 4B6RA 1I5EA 4LF7B 1ZMOA 3AI2A 4HB3A 3ZHTA 5BUCA 4H3KB 4LJAA 1JTEA 1E2BA 2W0MA 3AUFA 4ETMA 1CRQA 4MTLA 1KOGA 4G4SO 4X97A 2D59A 5AJYA 2HBQA 5T4FA 4RPHA 3HKBA 1CS0B 1T9CA 2EKDA 3AIKA 5ADHA 1KF0A 3H6KA 3W1VA 1PYOA 4R6XA 5TNXA 2RH5A 3JVEA 3VH2A 1SJ9A 3V4PB 4NZMA 3TMYA 4F2GA 4RW0A 1MHPA 4IIFA 1XQ9A 3ZWCA 1T0UA 3K20A 4F91B 1TVCA 1GDHA 5BT9A 3I61A 2DUNA 4LZJA 4TMKA 2B2CA 4QBIA 1AZTA 2TMKA 3RSOA 2UDPA 1CB7A 2ICAA 4AY5A 3NAGA 4G5HA 1ZIDA 1ZN9A 2CD7A 3CRMA 3F6RA 4M76B 4QL3A 3WKDA 3MOGA 1MZVA 1ZG3A 3KXKA 5L51A 1E1DA 2PCJA 1UK9A 5DSXA 5BV7A 1RJWA 4O59O 3STHA 5TRTA 3N8GA 2UV8A 4LOJA 3PT9A 2G9NA 3SBOA 5J4VA 3DLBA 4RHXA 4I6EA 1JLLA 1QIMA 2QJRA 3SC2A 2EJBA 3OEEA 3SJCA 2IL1A 4CM6A 4DANA 3IURA 4GF5A 3CISA 2Q0SA 3EEYA 3ZLBA 4J0KA 3RUPA 4JL5A 5CW1A 1AHIA 3FCAA 3H3FA 5LNK6 1GLNA 1MTZA 1KA9H 3OA0A 3ROXA 2C7QA 4ZOLB 1G21E 4YCAA 1M2VB 2H7CA 1M10A 1T6BY 2XMBA 4ZO4A 3TTYA 2XKAA 3AB7A 5FADA 3R3UA 1JQJC 1Z7YA 2JIQA 4G1VA 1U0BB 3FCXA 4R51A 2D6FA 2OORA 1CWUA 2HRCA 2PMFA 2JZNA 3CW8X 5ICMA 1F2UB 2BFWA 2AV6A 4FNOA 4RKFA 4D96A 2NUTA 1R0YA 2W4QA 2V8OA 1YFZA 3VDQA 1JIUA 2Y9MB 1KE2A 3SBXA 4BP8A 3I64A 5LBTA 3HVUA 3SHOA 3WMXA 3N58A 3W5DA 4X84A 1R0BA 4RK1A 2BGGA 3SYKA 2ZZNA 2AJTA 3O47A 4LJLA 4B7UA 4QJIA 2E4WA 3LLMA 1ZLXA 3OAAA 4XARA 1S4QA 2Z6VA 3LYUA 3O5AA 5ER9A 3CF0A 1FQJA 3CVVA 2F17A 2WJ6A 2XQJA 3B1VA 3HE3A 1WUJS 3HSKA 3ZXUB 3AVYA 2H7YA 3NHRA 4JGBA 3O8BA 2FEWB 3T3PB 1CZOA 2YNMC 4HWPA 4PZLA 4TWRA 1S8OA 2HM7A 4D3YA 1W36B 1DG1G 5BORA 3T52A 2HA7A 1TYEB 1IJBA 1YQDA 2I78A 3EGXA 3KOZA 3CZQA 1T1RA 3EUEA 3HZHA 4QAJA 4BQRA 2GD0A 5U4QA 3ZI4A 1XDGA 3NATA 3RHFA 3ZDXB 2SNIE 1LTHR 3WQHA 2CSUA 3LW7A 4EG1A 4IXDA 3DHWC 1L5LA 1X19A 4X65B 1TKBA 2VSNA 4MUNA 2WTMA 2R6HA 2IV2X 1U6JA 4OP3A 4R1MA 5CAEA 3WL4A 3G2NA 2HL6A 2I62A 4MV8A 3U61B 5E6SA 2XE8A 2G67A 2G07A 3I9V1 3Q7RA 4R5HA 3DTVA 5K3CA 5JS2A 3B8HA 1N8SA 1DU4A 1U3CA 4TSFA 1WDTA 1DT5A 4BRZA 1PN3A 2VJYA 3IP3A 3ZIAA 4RD0A 4I55B 5JH7A 1DZ3A 1X0XA 3C3KA 2XYGA 1SZCA 3HPQA 4EY6A 2UZAA 1EKXA 3DP7A 2ZWIA 1J90A 1VJTA 2RHHA 3UVEA 5FB3A 4QBFA 4ZTUB 3NDJA 2YMPA 3S2IA 4JSRA 3VRHA 1RRPA 4AIRA 5C8YB 1VECA 4HGOA 4RCYA 1KK0A 4M7WA 2XIJA 4H6VA 3UCFA 4Q4HB 4V3CA 1OLUB 4CT4B 3AB3A 4PQRA 1U2ZA 2XT9A 1DAFA 3ITDA 3Q1KA 3JWIA 2BUCA 1I2MA 5BSVA 1MB0A 5I7UA 1CIJA 1NVVQ 2FOXA 3VPAA 1A3CA 4PLFA 3DMTA 4HNGA 1JLKA 2EQAA 2DWCA 2AFHE 1VM6A 5K2MA 1OD6A 3T8YA 2ZR7A 4B4OA 1MIOB 4MQEA 4G0ZA 1DX4A 1W94A 3WDKA 1V7ZA 2ZUWA 4HGNA 1HLPA 3KLMX 3OCWA 3WDLA 4BIIA 2HXSA 2IWHA 3DZGA 4M0EA 1R0CA 1G3IA 1NYQA 2X0KA 5EWJB 3QBVA 4LVNA 1GAXA 3E0QA 2XV1A 3S27A 3GEHA 1DJOA 4GOJA 1N0HA 3OSUA 3KLNA 4KTTE 1CZHA 4M7RA 3H13A 1NG9A 4NBWA 5CA1F 1KI1A 1JEQA 1J5XA 3K9QO 3KUCA 1SK9A 2BJVA 2DJIA 4I2NA 3MJTA 3ZTYA 4J1TA 4LOKA 3S1LA 5IK2A 4TX1A 1O96A 4CKXA 5KMGB 5IVKA 3FOAA 4EHLA 4LJSA 4TMZA 3OQMA 2C3UA 3BJEA 1Z2DA 3MWKA 1NDUA 1KR2A 4K6FA 1UOQA 1XZBA 1WP9A 3JQ7A 3LQFA 4FILA 4TLAA 1ADFA 4GGOA 4YALA 1JFSA 4LF4B 4OAOA 1OB5A 3C2QA 4D4LA 5EWLA 2A7XA 1EFLA 2QX8A 5KQMA 3OE5A 4GXRA 4MV6A 5CVUA 4ZZ1A 3MBIA 1ZH2A 4Q24A 1EX1A 2BGKA 1L5HA 2G9ZA 2NU6A 3L79A 2B34A 1PFQA 2O7SA 3Q6IA 4GT1A 3QFRA 3PPVA 3R0IA 2QJWA 3EMKA 5H8WA 4QTTB 1CUBA 1OT5A 5AI5A 1E0AA 1JKJB 4RKQA 1CHNA 1TYAE 2VPPA 5KAPA 4JBXA 2JH8A 3K9LA 2CNDA 2PAFA 5EMMA 2ZTUA 1CRLA 3AM5A 2Q5IA 3EIFA 3H65A 3DOUA 4UMDA 1ABEA 1GRNA 3ZV7A 4WX2B 1W6UA 1QG4A 4RVFA 5HZKA 1U2PA 5DYWA 5K3OA 2YCBA 1XVVA 4M0DA 1VRWA 4XUDA 4FUQA 4JC4A 1JU9A 2WABA 5KC9A 3ABIA 4PXAA 5A6SA 1GARA 3T7AA 4LXQA 1C0KA 4TSRA 3CG4A 3Q2KA 3FPKA 1IQRA 2ORVA 2UU9B 1BVYF 2ACKA 1DLIA 3R3XA 5DNWA 2BBSA 1Q1BA 1Q1NA 2XMRA 3OZBA 3GLTA 1GTSA 4EYOA 3TIGA 1Y6JA 2EX0A 4YCSA 2ZBFA 4H6PA 2JGMA 1TYCA 3DLTA 3S2YA 2ZSHA 1GYRA 1HOTA 2F9FA 3OMWA 2YDYA 5BWCA 4AUNA 4LXTA 1JEJA 3RVNA 1OGYA 1KZ4A 5L7TA 2C2XA 1KL7A 4H4CA 2XJ4A 2BEJA 4YJDA 5KOJA 1DAIA 4DMGA 1KJZA 3ZU2A 4OBEA 4ZODA 4CDMA 4HYYA 2IDKA 4UM9B 5JR3A 3FSGD 3B3AA 2WSBA 1UOEA 4J4TA 5D3MA 5BVGB 1X6VA 1KDTA 3HG7A 4JQYA 2ZUBA 1CFZA 4TXMA 4EVIA 3ITNA 4Q93A 1HDGO 2ZIEA 2FJPA 3W0LB 4JYZA 3ZJTA 1KI3A 1N2CE 2C29D 2WJAA 4LWOA 1A95A 4OGGA 4KQ9A 4OAPA 1FYEA 2X2FA 1Q21A 4UPVA 4CPDA 1JFFA 1OASA 3TI9A 4HDOB 5FFMA 1AO3A 5SZKB 4DCTA 1LLQA 4BVJA 1S3IA 4JJ6A 2W70A 1BKSB 2C31A 3VOTA 2CHVA 1E6MA 2GN9A 3A9RA 4YRKA 4DUGA 5LMZA 5FI0B 2MMGA 1O8CA 4KDRA 1QZUA 2WHEA 4Y2TA 2HHHB 3ZVLA 1C4WA 2PFGA 1LPBB 1Z17A 1Z8FA 2AC4A 3K8QA 3QW4B 4HCJA 3L9WA 3ZR4B 1HNZB 1HOXA 2HDOA 2Y0BA 4UCQA 2I2DA 4RHEA 4GEKA 4ESOA 4IHJA 4KSYA 3GROA 4BLSA 2BEWB 1CDOA 1N1MA 4BBAA 4B3MB 1CZUA 5K3FB 3U7JA 4AFNA 4RTNA 4PG6A 2HD4A 1V47A 2Q9CA 3DEHA 3UWKA 4HGQA 4JP5A 4INPA 2PX8A 3EIEA 4BFTA 3P97A 7AT1A 2L19A 3ESDA 5I9BA 1TU3A 1UP4A 3EWNA 5HIJA 2AFIA 1NT4A 5F64A 1SHKA 4LZLA 5IVPA 1KFCB 4LOLA 2PNFA 5FOQA 4GLOA 5KOHB 1A1VA 2XQKA 4X1YA 5CJPA 2OYCA 1UKYA 3W8NA 3EN0A 2VWQA 4B87A 4NDAA 2E85A 2GF0A 3DO8A 1FE8A 3QLEA 4BNIA 5IZ4A 5B30A 3ONEA 4U0KA 2BMEA 3M49A 1NXQA 2Y1CA 3NBYC 3FA2A 3MJ4A 2V98A 1QWOA 3I9KA 4BMCA 3F3KA 1M34A 2ZAYA 3OEED 6Q21A 4KXVA 3JVVA 3T6KA 4GLLA 4KR9A 3WB2A 4BO1A 5LYJA 1JH8A 5AVZA 3VPXA 2OM2A 1X1TA 1PX2A 1Y5NA 2PX4A 2ZIUB 3CGGA 1KJ8A 3GG9A 4RSHA 3WLNA 1KNQA 1KIAA 3HV0A 4URWR 3JWJA 4OREX 5A3VA 3V4RA 1VDZA 1YH3A 3AESB 3EISA 2W71A 5AKEA 3TSOA 3AQIA 3C3PA 5EHXA 4YP5A 1DV2A 1JKIA 4F4JA 4ZEWA 1J23A 2OWDA 2WTBA 2MIIA 2H4FA 2R6DA 4G0PA 2G8LA 2QI9F 1UCFA 1M83A 4PRZA 1PVOA 2OAQ1 5DEOA 4AZ0A 3OURA 1ISFA 4MIOA 3WMWA 2YJGA 2P1RA 4YXFA 3CLTD 3FF1A 3UV3A 3COSA 1R6UA 2WPDA 1C1XA 3HKEB 3PRJA 1TYZA 2X4GA 4D1YA 4KO4S 5D00A 4TTAA 4Q7MB 3VYTB 1IJEA 2IUFA 4PSCA 3OAAD 1E4YA 1RU3A 3CCBA 2CB0A 5H4HA 3BMCA 4FFVA 4P93A 1SPXA 4MKGA 1UJBA 2IYAA 1XZGA 5HIIA 1E58A 1H2RS 2GJ4A 3GZNB 4HUQA 2OGWA 5EEHA 521PA 3TIXB 5LZ2A 2VQEB 1HNXB 1ISRA 5F23A 3PHIA 2J4FA 3ILXA 3QA9A 1SCQA 2DSNA 3EC7A 2P4UA 3IOYA 5TF0A 4TTIA 3VUFA 2PUWA 1FFCA 2QVCA 3WMFA 2C3OA 2BSXA 5JSYA 1U5AA 5MGNA 2QTHA 4OYLA 5B3LA 1GKLA 4I8IA 4NBLA 1P7WA 4BFSA 1NVXQ 4EENA 1BCSA 3ZHOA 2YV1A 3E7DA 1Z56C 3LCRA 3PIIA 4KP7A 1K5HA 1G1AA 4I1UA 4CMAA 2OCBA 2G0AA 1M1YB 1W2HA 1XZCA 2A9OA 1H4VB 2F00A 3MERA 3MTGA 3PXEA 4IIJF 2PA0A 1CQIB 4LDJA 3EEIA 1KDRA 4ZO7A 5ICFA 1QGED 4ZRNA 4BQQA 1X9GA 3C3YA 1CQZA 1CY1A 2DM6A 2FP3A 1AZLA 2FUNB 2OZVA 3BTSA 2GZ2A 3DTVD 1HQCA 4KB5A 4KQGA 5CDUA 1Z5ZA 4TSFD 2H4HA 2PKEA 1J33A 2JBAA 2WWRA 3K4PA 5SICE 3WWCA 4G0YA 3ZIAD 3VMFA 2FRXA 2UZIR 3BCRA 4ARAA 1Y1RA 2ILTA 3DMPA 1RYFA 3SM9A 5CYGA 2QYSA 3FWKA 4LYGA 4ZAVA 3LDHA 5JLAA 2BFCB 2C78A 3T4PA 1L4KA 1ZNWA 5JFOA 1AKUA 1IB0A 1JBEA 3FWYA 3PFFA 1GZ6A 1PZMA 4YNBA 2XXAB 2WT4A 3AYZB 3RVDA 3MVEA 3N6VA 4YT2A 1QFJA 1ZVVA 3PXUA 4OKNA 5J58A 3FOCA 3NHFA 3ZQJA 3C5VA 3F5MA 3F5SA 1E2EA 2A33A 2GASA 5EJ7A 4K6HA 5FNZA 3WMRA 4KE9A 5DWQA 2C5BA 3PUIA 1XXLA 2QLNA 3OX4A 1QMGA 3GLGA 2QYOA 1BD3A 5IS2A 1GKIA 2HTFA 2KSQA 2QQGA 4JBYA 2GLUA 2WB4A 4W6ZA 3UN1A 3CVUA 4MQ6A 3BK7A 4E46A 2AEFA 2BHNA 5BURA 3N5KA 4RIHA 3O03A 4YREA 1UBOS 2ID9A 5FYDA 3RIEA 3LDFA 4Q3CA 4B6PA 3IVCA 4IQ0A 1Z6XA 5BYJA 4FSXA 1SCDA 4DDHA 4NU6A 4Y2RA 2YN4A 5HCUA 1C7EA 4KQIA 4C6SA 3DS8A 3DT8A 4PYIA 3ZWVA 1ZW6A 3RH0A 1NW6A 1WR8A 5CLHA 1WKCA 2IRWA 3B12A 4LJ7A 3INRA 1LK5A 3RADC 3D3JA 4PHHA 3HRHA 2I7DA 2TYSB 2FU5C 3IGFA 3AEKA 4Q7KA 5GGYA 3LGAA 4KE8A 3QNUA 2FPOA 2LW7A 4XPIB 2Z30A 1E1YA 2NQ8A 2O8EA 2XWJI 2AQHA 1O58A 3U1TA 4EMUA 3KRTA 3UYLA 2PUBA 2A9QA 3CH6A 5I7AA 1DQZA 2QPOA 1BEUB 2XTAA 3ZYCA 5C0OE 1JIIA 4JASB 3RLIA 3HFGA 3SHWA 1C3OB 4O25A 4TTQA 2XW6A 4W1SA 1T3ZA 2QXYA 3UAZA 3B1WA 4AMZA 1XLTC 4FNGA 4JI6B 4C0QC 1DIAA 1Q7EA 2P3SA 2D7JA 3PDHA 1NDHA 4XLLA 1P9NA 4DVGA 2NX2A 4E09A 2DUWA 2ZUDA 3SNHA 5CB4B 4B46A 5IRCD 2WG1A 3EVDA 2P5TB 1R1DA 2QE7D 4I3HA 2BHSA 5JYEA 2GTIA 2KJQA 4WPGA 1AK1A 1GZ5A 2RHDA 4F2WA 3MYRA 3PR2B 3Q9NA 4WKOA 4PW0A 2Q50A 2ZWOA 3GRPA 4GMFA 2QV0A 5ELXA 1Z0DA 3LCVB 1VA5A 2VJPA 3E9EA 5FF9A 3RAFC 4TXLA 4WWHA 1DQNA 3I30X 2V7UA 5E9AA 2J33A 4LGMA 1IJKA 1JWAB 1TEHA 2O5RA 4L4YA 1OZAA 2A5DA 4Y1GA 5JD5A 3FWZA 2ZDGA 3PGJA 3S4YA 5BR8B 3WYGA 4CEHB 3AF4A 5CVVA 3AY7A 1T0BA 3WYFA 1FQKA 4KK4A 1EGMB 2AVNA 1MJFA 4MS4A 2PGDA 2B92A 5K3DA 2HSJA 1HDCA 7GPBA 5FLXA 2RI1A 5CLIA 2GPYA 2JFXA 4GOOD 3TZEA 4F93B 2R7NA 2VDQB 3VVBA 2O3RA 3W6OA 1D9ZA 4BUCA 4DR1B 4X8OA 2Q2NA 2YJNA 3EUWA 1L7VC 4MVJP 2VUSA 3OCZA 1RXIA 2QN7A 4P54A 2AOTB 2H0AA 3QPDA 3ICWA 2NNLD 4RZIA 3OCXA 4BP3A 3M81A 2GNPA 4W9RA 1HE1C 2Q1UA 1ZD1A 4FLFA 3RAPR 4AUEA 2Z9CA 4CR8A 3QH4A 2AMLA 3PZBA 3LY9A 1UPXA 1JLSA 1KIMA 3VZPA 4EB8A 2EP5A 5F7JA 3QKSA 3KYJB 1GWNA 2EWWA 5H3HA 1EAMA 1FLDA 1YZQA 1RMQA 1J39A 4LVCA 2P79A 4QLOA 1Q20A 1L4FA 3CMCO 1Z0ZA 1EGAA 2EGHA 2ZYDA 2C07A 2HO5A 4O4HF 5JXIA 4RLSA 2WVGA 3BD8A 4M99A 2GZSA 5A71A 4N9WA 1N0WA 3S81A 1E2UA 5KQLA 3TCKA 3IOEA 3V33A 1XZJA 2IDJA 3DZ8A 1G8YA 3M2TA 3HN2A 2YZ7A 4E4YA 2WPNA 3E1GA 1UP7A 2CXSA 3CZ5A 3OZ7A 4MUFA 1T9BA 1SC4A 4PPGA 5FJIA 3WRVA 1ZC4A 4DEYA 1A9QA 2XCSB 3HVRA 3L7BA 1RPAA 1J1ZA 1JG6A 3KC2A 3TEFA 4AN0A 1KEZA 2LBPA 2OTCA 5E4YA 1LDYA 3DMNA 3OH8A 2PUEA 1PO7A 2VXOA 1Z6AA 5BN5B 4HQRA 1HG1A 1XYGA 2QJFA 5KINB 4P33A 1BQEA 3B7WA 2R86A 5HILA 4XXHA 2OO3A 3CH7A 5FP0A 1SGWA 1ZUWA 1RKQA 4JR1A 1IEWA 2EGUA 3SAJA 4DTIA 1QQAA 1TVEA 2H4JA 2PJDA 3G0GA 1HYGA 2NZJA 4K6KA 4G1CA 1S8FA 3BTVA 4HSEA 4OEHA 5B1EA 1TK3A 1M1NA 3AVPA 4R1SA 4ABYA 1CRWG 4IDEA 1WCV1 3G89A 1NVKA 1J1IA 4IDNA 1O87A 2IZOA 3BH0A 3N1UA 4L8VA 2WHPA 1LSJA 3L07A 1RAIA 1YQTA 3NPMA 4JOBA 1TM1E 1JAIA 3PC4A 3WIOA 4HWTA 1JW9B 1Z82A 2J30A 1LX6A 2QIPA 4BEVA 2CLIB 3TD6A 1O4WA 3WKAA 1A8PA 2H07A 2AF4C 4JXXA 3ROMA 1V8ZA 2OK7A 3GG2A 1FFHA 4MWSA 3N0XA 3LC1O 1W36D 2DYKA 4JLSA 2QR2A 1PFWA 1U8AA 4W6QA 3SXUA 2HC9A 4XIYA 2NXEA 5C1IA 3BMXA 1L5MA 1XYVA 1SCUB 4QTYA 3M7IA 5L40A 2H85A 3Q3HA 2PFSA 1N7HA 1M67A 1Q12A 4Q47A 1T9AA 4HTFA 2V54A 2H2DA 3HVJA 3KKPA 1G8MA 3EXG1 5AUOB 1RC8A 2WPDD 4X8LA 1E6KA 3C3AA 3UTCA 2Q8QA 3MQFA 5GY7A 4B3FX 3N07A 1YB1A 1WVGA 4DG9A 3EX7C 1J7JA 3KJXA 1IOVA 1CJUC 2YS6A 2R4UA 4OGLA 3ZI7A 4BV2A 5KWIA 5AHKA 2D1YA 5TT0A 1P7CA 2GO7A 2R65A 4MMXB 1RQXA 3M83A 4MI1A 2WFLA 5ARBA 3IAHA 2LWIA 3EXG2 2EC5A 3L41A 4AKTA 5C8VA 2YTZA 4ZKEA 2HXYA 1OLXB 1GPJA 3CX4A 1EP3B 3MUEA 4MROA 5AJTA 1BXZA 5K51A 2HN9A 3QVVA 4RGVA 4AW9A 3LP6A 1E60A 1EP9A 3LHSA 3L6CA 3Q3GE 2W43A 2BSQA 4FONA 4ZAZA 1BXRB 2FCRA 4HDRA 4RD2A 3T3DA 5T4HA 4DMFA 4EI9A 2HA5A 3LF1A 1CXZA 2PU5A 3A9UA 1F4VA 1XZLA 3QKWA 3WTBA 3W5AA 4LSGA 1AA9A 1T2VA 4NYIR 1H9BA 1I01A 2I99A 3L2OB 3JVDA 4FC6A 4TS4A 4U9IS 4X85A 5KOYA 5LWQA 3JWPA 3THXB 4N3GA 3ZLUA 1TF5A 1BVRA 2OT3B 4EPVA 4XIFA 3WGJA 1OAOC 3T7SA 2AX3A 2V7VA 3VHXB 4OI4A 3KZVA 4B4WA 5CCXA 4PGFA 4ZYYA 1P18A 4KPGA 3IMGA 3B1KA 1BX1A 2H5IA 2HB6A 4R0MA 1RWMA 3CLUD 1J0XO 1QC5A 4C0AC 3ERCA 3M4JA 1X87A 3GX1A 1ISMA 4MUXA 2N0SA 3D1JA 1PYDA 1NXXA 3GQVA 4GW3A 1ZJZA 1RWBA 4AS2A 4RYLA 2JCBA 2AN5A 2P9ZA 3SFTA 5BWNA 3ST7A 1Z4KA 3G5TA 3SE0A 1JHAA 1KMNA 4ZREA 1YL7A 3TLAA 2IP2A 2J46A 3F1KA 5BOVA 3SMQA 3H1FA 1W6RA 4MCJA 4YYEA 3BB3A 4CMIB 1H4SA 1A9ZA 3CZ9A 3I2YX 4IS3A 2AG5A 4K9NA 4BGEA 1LC0A 1OE0A 4UEQA 3A58B 4K86A 2HMTA 1G3RA 4X63A 4ZU3A 2NU8A 3KQMA 1H3EA 2Q7DA 2LCIA 5T3UA 2IKSA 4MKHA 3K70C 5EJIA 2ZJ2A 1JFRA 3WWEA 2QD2A 3ZD9A 1V3QE 2ZIAA 3PDWA 1U4NA 4LXYA 2NO9A 3PX2A 5U9CA 2RGUA 2FEOA 2OQIA 5AKIA 1Q14A 3Q41A 1B26A 4HUTA 1EGHA 1K89A 1NKTA 3EZ6A 3GD5A 1WSDA 4NQZA 5C52B 5ENVA 4EF5A 4IM7A 3QU5A 5DOZA 3P2IA 3TW8B 5ABPA 4AUKA 1XD2B 4CQLB 2QE6A 4JP8A 5BSTA 4AIIA 4MDFA 3ABZA 1OAKA 2Q9BA 3EIOA 4YRIA 3ZX4A 3PI6A 3LL7A 3T99A 2ANCA 1D2RA 1BE8A 1TFUA 4K9LA 5F1YA 1QX3A 3RK4A 3A1NA 3OTHA 1CDDA 2YR0A 1JU3A 4O2BF 4DLRA 4MS1B 4RQUA 2W6JA 2YVUA 4F85A 4NEGA 3LIIA 4Q66C 2QSYA 3QPBA 3ZCVA 4BFWA 3UFXB 5LQAA 3TLJA 1B23P 2NG1A 3VSDA 3U60B 1F4LA 5TPZA 2VHUA 3ASZA 4C4XA 1J2RA 1ST2A 5HK8A 1R4MA 2C57A 3ETLA 4E30A 2HJSA 1Q17A 3FBWA 3V4OA 5K0EA 3I2HA 3HKCA 4YRNA 1RFLA 4HWGA 3C7AA 3R3WA 2ECPA 4CR7A 9ABPA 3CR8A 4NOKA 2EW8A 2H9IA 2O5CA 4HVLA 1NMXA 3S68A 2DHRA 4ID3A 2Q49A 2PUFA 1BA3A 1THGA 3QLVC 4DPKA 2X15A 1XJ5A 4P82A 2PXXA 1K86A 5LDGA 3GN1A 2O52A 3PNMA 4RD4A 1XQYA 4PXYA 5BUSA 2J0EA 1BO6A 4AJIA 1NP3A 2IUUA 2QMEA 3DE3X 4V0MA 5AXBA 4PX9A 5FWYA 2VF8A 3IP1A 1R74A 1N0UA 3VUEA 2QTBA 3DCYA 1R6XA 5DNAA 2OLJA 2QRLA 5IBRA 3UT5A 5KTYA 1V5GA 1AGNA 1YQUA 2VHXA 3AUTA 3IPCA 1M75A 3QQ5A 3BD7A 4ECEA 1S7GA 1QF6A 3GFFA 4XYGA 4S35A 1NFQA 5FOUA 2AK3A 2SICE 3RQIA 3EHDA 5AI6A 3AKZA 4KLNA 1UEIA 2FLVA 4ZMBA 1LTQA 5INTA 1BWRA 3IP7A 2F62A 2WHXA 1DIHA 3F90A 4Q9JA 4HGPA 5HW0A 2QTGA 3T4UA 3IKTA 4M89A 5CH3A 3RSLA 1TFRA 2PV0A 3AWDA 3FR7A 5F9FA 3F96A 1ZZGA 3PNBA 1Y9EA 2WJIA 3PYXA 2GHIA 4ITRC 2XTJA 3EMDA 4B6SA 1B2RA 2PL9A 1DKRA 3JQBC 1ZMBA 1QOQB 3WK4A 3GNSA 1IY1A 3L4SO 5EKDA 3CURA 4JZYA 1S9HA 2XEDA 3KLOA 4UFNA 5TV2A 3UGKA 1AQJA 2R79A 1X8LA 3QE0A 3OWXA 1CY8A 1DTEA 4IIGA 4CETA 1YC2A 1KRHA 4OBWA 1JLLB 1VIYA 1ZLYA 4OHZA 4K05A 3W7BA 3G9UA 1LRLA 1FY2A 4GYYA 4RK6A 4ZKDA 1W25A 2RB4A 1YBVA 1RVDA 1QZ3A 2MT9A 2OQ2A 3G2JA 3LBFA 5EGNA 1X7ZB 3L6BA 1X8JA 1M0WA 2CL5A 2CZCA 5J2UB 2A9PA 1GT91 2E2WA 2FJ0A 3R7FA 2IH2A 4LYDA 1Q0SA 2G5CA 1E0KA 5ALUA 1FTGA 3DHNA 1N6LA 1W96A 5EIEA 3ZHCA 2VN8A 2Y77A 4DIUA 3A06A 3UMSA 1PGPA 4UNQA 2Q6LA 5H4GA 1UPUA 3FUWA 4KYIB 1E92A 2IITA 3HM2A 2GZDA 4CL2A 4DR2B 4ZP1A 5EYPA 5EZQA 1WBBA 2O2EA 2AIRA 4AL4A 1TOAA 4R2HA 4GMXA 5KIAA 4OAQA 1NGSA 3PPYA 2Y68A 3OT1A 3DFKA 4MKIA 1BHO1 2OV2A 2VC2B 5DTJA 1EM6A 4LE2A 1P74A 2NTJA 4JS0A 4LTMA 4OXXA 1YOVA 3DEIA 2PTHA 2V6IA 2C8KA 2HHLA 1P4AA 2WNIA 4EX7A 2FX2A 1G8AA 1ZY2A 4F72A 5CFNA 4GMDA 1JYSA 1X94A 2OV3A 3ZS9A 1NQVA 2FRVA 5MGBA 1ZRNA 2BFFB 2QMUA 2WU1A 5EJ6A 5HZGA 3BEOA 3AI1A 4CCWA 3VNVA 4KQCA 4F5EA