3IQ5A

Crystal structure of an engineered metal-free tetrameric cytochrome cb562 complex templated by zn-coordination
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
106
structure length
106
Chain Sequence
ADLEDNMETLNDNLKVIEKADNAAQVKDALTKMAAAAADAWSATPPKLEDKSPDSPEMHDFRHGFWILIGQIHDALHLANEGKVKEAQAAAEQLKCTCNACHQKYR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evolution of metal selectivity in templated protein interfaces.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Soluble cytochrome b562
total genus 44
structure length 106
sequence length 106
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-08-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07361 Cytochrom_B562 Cytochrome b562
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.10 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Cytochrome c/b562 3iq5A00
4N4WA 1CGNA 4IAQA 4CX9A 3M15A 3TOMA 1QQ3A 4IB4A 2XLMA 1YZCA 2XLOA 5JT4A 3HNIA 3M4CA 3IQ6A 3ZTMA 1QPUA 256BA 2XM4A 2YLDA 3QVZA 4JEBA 4IARA 1YZAA 4ER9A 1CPRA 4CJGA 3HNLA 1E86A 3QVYA 3NMJA 1CGOA 2QLAA 3ZQVA 4U9EA 3ZTZA 2YL0A 4D4NA 4JE9A 3NMKA 2XLVA 2CCYA 1E83A 1BBHA 1YYJA 1CPQA 4D4XA 3DE8A 1EKYA 5JUAA 1RCPA 3VRCA 1E84A 4WGZA 2YLGA 3ZWIA 2YL1A 2XLEA 2YL3A 1APCA 4CDAA 4CDVA 2YKZA 1M6TA 1E85A 1NBBA 4CDYA 2XLDA 4ULVA 3C62A 2YL7A 2YLIA 3QW0A 2XLHA 4WGYA 5JP7A 1JAFA 2XLWA 4JKVA 5B3IA 3DE9A 1YYXA 2BC5A 3M4BA 4U9DA 2J9BA 5JS5A 1A7VA 3TOLA 4L6RA 4JEAA 3L1MA 5AGFA 3U8PA 4EIYA 2XL8A 1MQVA 1LM3B 4N6HA 4CJOA 3C63A 5JRAA 3NMIA 3M79A 3HNJA 3FOOA 5JVEA 3HNKA 2XL6A 3IQ5A 1S05A 5JSLA 4NC3A 4CIPA 3FOPA 5JLIA 2J8WA 1GQAA 2XM0A 3ZQYA 3QW1A
chains in the Genus database with same CATH superfamily
1LE2A 4Z9IA 2J7PD 2QUPA 2WVQA 3GWNA 3QMKA 4RDAA 3Q7LA 3SXKA 3AG4C 3S84A 4C7OB 2KGOA 4EBJA 4PFPA 1Z6AA 4B6IA 1I5NA 1Q0KA 2XL4A 2KJGA 2YQYA 3VYWA 2XLOA 3PDMP 2P1AA 3NG1A 1JPNA 1KTMA 3VM6A 3HNIA 2XS8A 3EH1A 2EILC 3IQCA 256BA 3HJCA 2YLDA 4N6CA 3QVZA 5L0IA 2EPNA 2J0WA 2LFDA 3N2ZB 4JEBA 3IQTA 5EGYA 4ER9A 2V26A 4XPXA 2KNHA 3RFYA 3FHDA 1TWAA 1T6QA 2CGEA 4NCQA 2KYHA 1TFKB 5FCLA 4PJMA 2WVOA 5T1DB 2OG2A 2OJED 3QVYA 3T6GB 3N24A 3ABLC 4G7ZF 3V5ZA 1I4YA 3TD7A 1FR0A 4H54A 4U9EA 3RQGA 3SZRA 4XEFA 4J30B 3RQEA 3ZTZA 3AG3C 4A4AA 4G0HA 1QLEC 3NYJA 1LS1A 1O3UA 1RKEA 2WL8A 4AE4B 4JRZA 1RJ9A 4LLCA 4HE8D 1ZHTA 3EH2A 1E83A 3X1OA 2EIMC 1CPQA 5L3VA 1QKRA 1Z23A 1Z63A 1K04A 2RSEB 2J0XA 2R25A 4BJ6C 4DXWA 1WWPA 5E33A 1YDIA 2R7SA 2J45A 3B0PA 2KSFA 3EGDA 1RKCA 4EWCA 3DM9B 2YLGA 3OA1A 3WAQA 4Q4ZF 3EHMA 2IOQA 3B9QA 3RVZA 3ABMC 2H8AA 1APCA 2WVNA 3K7DA 3NDBB 3C8GB 4JZAA 2Y3BA 2IXNA 4OIQF 2AVKA 2YKZA 3KYJA 3SNHA 2R7RA 1M6TA 2OJQA 1JR8A 2Q9CA 4FESA 4PR9A 3U5SA 3U9MA 4E0HA 3GEHA 1NBBA 1KU2A 4CDYA 1H9TA 3LS0A 4AX2A 3IHUA 1ZZPA 1JOGA 2EIJC 3C62A 3LLKA 2B0JA 2GFHA 2YL7A 4EBKA 3QW0A 2BE5F 1ZU5A 4PJJA 3MYFA 4NY3A 2XLHA 4P9FA 3DZAA 5E3AA 1D1AA 4JJGA 1PD1A 2HKVA 3L8JA 4N06A 3EG9B 3L8IA 2ZXOA 5E2QA 4E7ZA 1SR2A 1D1CA 3O39A 4K1OA 4MVQA 3NRHA 3JTLO 4OD4A 2NSGA 4W8PA 2CYDA 4LLEA 4BG0A 3DJNB 5AGFA 3O10A 2WZGA 3U8PA 3U0CA 2QE9A 2XL8A 3JRTA 2HSQA 3JYHA 1G8XA 4N6HA 2QNLA 3AOUA 3W4YA 4OIOF 4XLPF 3KMIA 3FDQA 3NMIA 4MTGA 3ZVRA 1MMNA 4U5EE 3KKBA 3FOOA 2P0NA 3B29A 3Q6NA 1EQ1A 1VYKA 1MMAA 4DRHB 2IYLD 2PBEA 2AU5A 2XL6A 3S28A 5KYXA 4YN0B 1S05A 1ZU4A 5JSLA 5A6BD 4QI2A 3W8IA 3EQLF 4ONSA 1G4US 2M64A 2Q9BA 5EHHA 3T6JA 1NU9C 2UUIA 2XXAA 2XM0A 3ZQYA 3QW1A 4PFOA 3VF0A 4DBQA 1HMDA 1B68A 3TK0A 5KYNA 3B0UX 2OU6A 1V4AA 1T6IA 5COGA 3MLGA 3VAYA 4CS8A 5KYUB 5KYXB 3UGOA 4AL1A 1ZHXA 3QZCA 4JTAB 3DD7A 4YL0A 2NSFA 4CS7A 5F28E 4I1MA 2NPUA 3N0TA 2A0BA 1OKKD 1ZHZA 2L9JA 4CSAC 1LKXA 1QQ3A 4NTFA 4IB4A 2XLMA 3U8VA 4XTKA 5DS5A 1LS4A 2Y69C 2HV6A 2Q9AA 3EFOA 4Q7CA 2QTVA 3M1CB 3S90A 1XZPA 4OIPF 1RJ9B 1TKNA 3UMKA 4CSAA 2L6FA 3GANA 2HFIA 2MYSA 4I1OB 2OKUA 3CAXA 3WODF 1WN0A 2R7UA 2XM4A 3EPVA 2TMVP 2G3VA 4Z9HA 4IARA 3LJBA 4PK4A 2VB6A 4U5BE 1U0BB 1FNTc 5E3CA 4CJGA 2F22A 4U5FE 4E17A 3DAFA 1C17M 2WZLA 5GPGB 1XZQA 4JURI 3BEHA 4JIOA 1E86A 5F5HA 1MMDA 3DWWA 3NMJA 3OWTA 3V5XA 5IY5C 2QLAA 2FFHA 4XWJA 1BR4A 1UFBA 1Y4CA 4XPWA 1K05A 3U3BA 4J7TA 3ZQVA 4DVZA 5KYWA 3W8HA 4NTAA 2J9WA 2R05A 4JVSA 1C02A 4YK5A 3ITFA 3KPHA 1NFNA 3HLZA 5TJ5E 3K33A 4FWVA 4BJ1A 2XLVA 4IRUA 2JX0A 1OCZC 3S27A 1BBHA 2W4MA 1YARO 2NG1A 3LS1A 3RF3A 1J8YF 3W2VA 4D4XA 5L0FA 2JPUA 4U5HA 1M2VA 1EKYA 3JYYA 1FTSA 1RCPA 3B71A 3O6XA 2IXOA 3VRCA 4BJ5C 3CZ6A 1D1BA 3DAGA 4WGZA 1M2OA 3BRJA 4DVYP 3DJUB 2HZ8A 5CI8A 4YL3A 1SYQA 2YL3A 1R4TA 3H2UA 3K66A 1YJGA 2KW3C 4CDAA 3K1IA 3RKOF 3DKAA 5HSWA 2X51A 4E7SA 2ASRA 5L0HA 1Y6DA 3A9CA 2PP4A 5A6JA 5KYWB 2A69F 3NYMA 1G5ZA 4WABA 1RKEB 3SP1A 3C18A 4AE4A 4EUKB 5HV9A 2HMZA 1TWGA 2AWYA 3F47A 2R9RB 4ZLCA 1WOLA 4WGYA 2ZPAA 1JAFA 1YA7O 1ZW3A 1WASA 1PCXA 2Y39A 5DQZA 2QY9A 4RD9A 1YYXA 5EK0A 3S9OA 1GS9A 1MNDA 3ZC4A 1FMWA 3JT1A 4MS2A 5BQGA 3EG9A 4ANJA 1A7EA 2C03A 2DB4A 2ICWG 2PFDA 5B1AC 5T3WA 5DLJA 2ZXWC 3TOLA 2OEXA 4DJ9A 2KQ9A 4JCZA 4J7YA 5FZTA 1MNEA 2EPKX 1LPEA 5A6BA 2HUJA 2ZD9A 4AK9A 4BPMA 2J9VA 1BR2A 4K7BA 2L6HA 2J7PA 1VYIA 1H6GA 1ZYRF 2PX3A 3GWLA 4JC7A 4JW1A 1D0ZA 5B3SC 4YT4A 2W9YA 1D0YA 3C63A 4LERA 1T6UA 3JZ0A 4NQFA 4OINF 4IGGA 2PF4E 1ST6A 3F46A 2DGJA 1TFOB 2LQGA 1Q0FA 1ZVZA 3JRMO 3Q6MA 1V74B 2UUHA 2EIKC 3ECSA 3OEOA 1HMOA 4W8KA 4BEMJ 1GGQA 1K40A 4EHPA 3FOPA 1JMWA 1M2VB 1HY5A 3MYIA 4CIHA 3US6A 2R7XA 4Z9JA 1CGNA 2L7AA 3QTHA 3E9VA 1BZ4A 2M4EA 3ASNC 4CX9A 3RVYA 1FMVA 3G4ZA 3L0IA 1FAPB 1OXKA 2LD6A 1QZXA 3A11A 4PACA 3T4RA 2V3CC 3M15A 4JTCB 2P7VA 3AGTA 3TOMA 3C7JA 1LIHA 2FAPB 4J32B 4DBRA 1KNYA 3JCUQ 2OQMA 2ZXRA 4C3EA 3EGXA 3T9OA 5JT4A 1OW6A 3C8ZA 3M4CA 3IQ6A 4M63A 1E2XA 1UG7A 3TJ6A 3ZTMA 1N1CA 3DXJF 2A6EF 1A0BA 1G4WR 2GA0A 4GQHA 1ORJA 1XWJA 4P9TA 3WG7C 4UDVA 2BL2A 3K6BA 1ZHWA 4IJJA 4O6NA 1YZAA 4K0DA 1WATA 1Q0DA 4U5GA 2R02A 4O79A 1CPRA 4KI2A 3AG1C 5COMA 4IWBA 1ZW2A 4O7GA 3IEEA 5DS4A 1H9GA 4MTOA 5DVWA 2ETSA 1RMVA 2OOCA 4JJFA 2J46A 1YLMA 2NUPB 2VC9A 4CS9A 3GEIA 2CDQA 2VASA 1ORSC 2YL0A 4JE9A 3U9JA 3DMDA 2AWCA 4CS9C 1IW7F 1TQGA 2CCYA 3C8GA 1F1MA 3C8GD 3NMKA 2G62A 4YJWA 1VTMP 4O6YA 4GEHA 1W2WA 1JPJA 2JD3A 4BJTA 3DE8A 3GODA 5JUAA 2D5RB 2MHRA 3HKKA 3ABKC 1OKKA 2E87A 2Y3DA 3SYNA 3AGUA 1TR2A 3HTKC 4C3DA 5L0JA 1FFHA 2O9XA 1E84A 4PJLA 1LE4A 3JSEO 3ZWIA 4BJ6A 1WGWA 3CQZA 2YL1A 3KH2A 5KYYB 3CSKA 1VMAA 2XLEA 3LUTB 3E70C 2HJMA 3ASOC 4YT8A 2XXAB 1YA9A 4U5CE 3RW0A 1DOWA 1HW1A 3S29A 3U2MA 4CDVA 4LDRA 1AVOB 1Q0MA 3GM1A 3O55A 2GDCA 2VCAA 4JTDB 1E85A 2Y3GA 2Q7RA 2XLDA 4YWQA 3UNGC 2DYRC 1HW2A 4YL1A 1NFOA 1O87A 1QVXA 3GM2A 3R7CA 2YLIA 4G7OF 4MTFA 4MQ9F 1YVIA 3FAJA 5A6AA 5L0GA 5JP7A 5L0CA 3PMRA 1OR3A 1Q0GA 2XLWA 2A68F 1H7IA 1SZIA 5B3IA 3LAYA 3W2WA 2Z15A 4Q5SF 3DE9A 5AC4A 2FGYA 1MMGA 5L3QA 1D0XA 2LSEA 1BR1A 2BC5A 2GAQA 3WHNA 4C3BA 2HS5A 4MVMA 3MX3A 3FAPB 4MVRA 5JS5A 1A7VA 2LCHA 3UR3C 3EGXB 4QI0A 3U3FA 2R7WA 3AQCA 4KNVA 3DI5A 3CEXA 2PNOA 4AL0A 5A6KA 3RIPA 1OCCC 1MQVA 3GM3A 1L7CA 1OCRC 1WTYA 1M56C 2LP4A 3I5PA 2WB7A 3RYLA 4CJOA 1LI5A 1LI7A 3FMSA 2CNWD 3GEEA 5JRAA 3EFOB 5JVEA 2X0CA 5DS6A 1TWHA 2YWAA 3B0VC 1NSGB 1RXQA 3RQFA 1Z3IX 2R03A 4PJNA 1OR2A 5KYUA 3TQOA 4H4KC 3AG2C 1C03A 1DOVA 4LDQA 4YT5A 4CS8C 3I5QA 3TULA 1OW8A 3X2QC 3DM5A 5JLIA 2J8WA 1U6HA 1YAUO 2L6GA 2D4UA 3KL4A 3SXMA 4N4WA 4IAQA 4LDKA 1OW7A 2LIGA 4OIRF 4E0IA 2OEVA 2YEVA 2R7VA 1GM5A 2VCCA 3K1HA 4NTBA 4MVZA 2HV7A 5D92A 4YT2A 4WJ0A 5T3TA 3PHF2 3AJMA 4GYTA 3ZG1A 4EKWA 2B0HA 3J06A 3RH3A 4BEJA 2NUPA 3SEOA 2VCBA 3V5YA 3S0XA 1HE1A 1YZCA 5DQTA 4I3MA 4FAPB 3LEOA 4XQ1A 2R7OA 3NKEA 3JSZA 1QPUA 1U89A 2P61A 4MVUA 3G4XA 2NUTA 2MWQA 3ZSUA 2DI3A 3ATPA 4G7HF 2IM8A 1T9KA 1OQCA 1HE9A 3H2VA 3PCVA 1QSPA 4FX5A 4ULWA 3HNLA 5BUOA 2P6VA 1J8MF 2H7VC 4HFFB 2IXMA 1SMYF 2AP3A 1A7DA 2IXPA 4HEAJ 2NUTB 4O6MA 4QDLA 1VK5A 4A2NB 1CGOA 1S7ZA 1Z5ZA 4DRIB 4MVSA 5BQHA 5F5FA 3MBGA 1VOMA 2YZSA 2GWWA 4D4NA 1NLXA 4XPYA 4KC9A 1A41A 2J9UA 3FXHA 4CBEA 2H7OA 2W4BA 3H65A 5BQIA 4DRJB 1ZHYA 4OD5A 1YYJA 4KBLA 4XEVA 1NG1A 1BDJB 2YRFA 1IZMA 4RBNA 3ZIBA 1VLSA 3G50A 2YVKA 1VLTA 2HMQA 2Y3HA 1VB5A 2IBFA 3LLIA 3K1IC 4X0RA 1V54C 3U2LA 3NKDA 1EI7A 1AEPA 2EPOA 3EZIA 3GORA 3NYLA 4XEKA 4XLNF 2DYSC 2KK1A 1NZEA 1I4ZA 1LVKA 3EGDB 5B1BC 2CW0F 4E18A 2R7TA 2H7BA 4HFKB 2RD9A 3EHNA 1V55C 2I15A 1PD0A 2EPMX 2YHSA 1O5HA 1TWCA 3SXYA 3AQBA 4EBBA 4ULVA 1FFTC 3ZDLA 3LNMB 3MFNA 4G78A 4ZLDA 3IPMO 4KNWA 1NU7D 3EZHA 2XRHA 2EINC 3KYIA 5CIVA 5L0DA 4JKVA 3POVA 2VH3A 3TJ5A 2Q3TA 1JRAA 2Q4FA 2WZFA 4MW3A 5CI9A 1CGME 1OCOC 4MVOA 2A0UA 3UMIA 4BJ5A 3I4UA 2OCCC 2LK4A 2EPLX 5K0IA 1OXBA 4I44A 2KC3A 3M4BA 4P6IC 2J9BA 4U9DA 2I8BA 5AC5A 5A69A 4L6RA 4JEAA 3L1MA 5D91A 1M57C 3T6BA 1T01A 3Q7GA 4LACB 3UMHA 4JCHA 2HSBA 2PX0A 2ZXPA 3LESA 4IAOA 3R2PA 4DOZA 3SXZA 4EIYA 2A1DD 4MNDA 4R32A 4U5DE 1LM3B 3EJNA 1AUEA 3LEVA 3LNRA 2A6HF 1Z7Qc 2CNWA 3M79A 1SF8A 3HNJA 3UGPA 1T5OA 2Q00A 3HNKA 2G3KA 3IQ5A 1PV3A 4C7OA 1R5ID 2C04A 4MW8A 1ORYA 5COFA 3V7OA 4NC3A 4F4BA 1EA8A 2L81A 2LFFA 2R7QA 3L34A 4CIPA 2XSEA 1GQAA 1L3PA 5KYYA 2W45A 2XS1A 2HJ3A 3FVYA
chains in the Genus database with same CATH topology
4N4WA 1CGNA 4IAQA 4CX9A 3M15A 3TOMA 1QQ3A 4IB4A 2XLMA 1YZCA 2XLOA 5JT4A 3HNIA 3M4CA 3IQ6A 3ZTMA 1QPUA 256BA 2XM4A 2YLDA 3QVZA 4JEBA 4IARA 1YZAA 4ER9A 1CPRA 4CJGA 3HNLA 1E86A 3QVYA 3NMJA 1CGOA 2QLAA 3ZQVA 4U9EA 3ZTZA 2YL0A 4D4NA 4JE9A 3NMKA 2XLVA 2CCYA 1E83A 1BBHA 1YYJA 1CPQA 4D4XA 3DE8A 1EKYA 5JUAA 1RCPA 3VRCA 1E84A 4WGZA 2YLGA 3ZWIA 2YL1A 2XLEA 2YL3A 1APCA 4CDAA 4CDVA 2YKZA 1M6TA 1E85A 1NBBA 4CDYA 2XLDA 4ULVA 3C62A 2YL7A 2YLIA 3QW0A 2XLHA 4WGYA 5JP7A 1JAFA 2XLWA 4JKVA 5B3IA 3DE9A 1YYXA 2BC5A 3M4BA 4U9DA 2J9BA 5JS5A 1A7VA 3TOLA 4L6RA 4JEAA 3L1MA 5AGFA 3U8PA 4EIYA 2XL8A 1MQVA 1LM3B 4N6HA 4CJOA 3C63A 5JRAA 3NMIA 3M79A 3HNJA 3FOOA 5JVEA 3HNKA 2XL6A 3IQ5A 1S05A 5JSLA 4NC3A 4CIPA 3FOPA 5JLIA 2J8WA 1GQAA 2XM0A 3ZQYA 3QW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N4W A;  1CGN A;  4IAQ A;  4CX9 A;  3M15 A;  3TOM A;  1QQ3 A;  4IB4 A;  2XLM A;  1YZC A;  2XLO A;  5JT4 A;  3HNI A;  3M4C A;  3IQ6 A;  3ZTM A;  1QPU A;  256B A;  2XM4 A;  2YLD A;  3QVZ A;  4JEB A;  4IAR A;  1YZA A;  4ER9 A;  1CPR A;  4CJG A;  3HNL A;  1E86 A;  3QVY A;  3NMJ A;  1CGO A;  2QLA A;  3ZQV A;  4U9E A;  3ZTZ A;  2YL0 A;  4D4N A;  4JE9 A;  3NMK A;  2XLV A;  2CCY A;  1E83 A;  1BBH A;  1YYJ A;  1CPQ A;  4D4X A;  3DE8 A;  1EKY A;  5JUA A;  1RCP A;  3VRC A;  1E84 A;  4WGZ A;  2YLG A;  3ZWI A;  2YL1 A;  2XLE A;  2YL3 A;  1APC A;  4CDA A;  4CDV A;  2YKZ A;  1M6T A;  1E85 A;  1NBB A;  4CDY A;  2XLD A;  4ULV A;  3C62 A;  2YL7 A;  2YLI A;  3QW0 A;  2XLH A;  4WGY A;  5JP7 A;  1JAF A;  2XLW A;  4JKV A;  5B3I A;  3DE9 A;  1YYX A;  2BC5 A;  3M4B A;  4U9D A;  2J9B A;  5JS5 A;  1A7V A;  3TOL A;  4L6R A;  4JEA A;  3L1M A;  5AGF A;  3U8P A;  4EIY A;  2XL8 A;  1MQV A;  1LM3 B;  4N6H A;  4CJO A;  3C63 A;  5JRA A;  3NMI A;  3M79 A;  3HNJ A;  3FOO A;  5JVE A;  3HNK A;  2XL6 A;  3IQ5 A;  1S05 A;  5JSL A;  4NC3 A;  4CIP A;  3FOP A;  5JLI A;  2J8W A;  1GQA A;  2XM0 A;  3ZQY A;  3QW1 A; 
#chains in the Genus database with same CATH topology
 1LE2 A;  4Z9I A;  2J7P D;  2QUP A;  2WVQ A;  3GWN A;  3QMK A;  4RDA A;  3Q7L A;  3SXK A;  3AG4 C;  3S84 A;  4C7O B;  2KGO A;  4EBJ A;  4PFP A;  1Z6A A;  4B6I A;  1I5N A;  1Q0K A;  2XL4 A;  2KJG A;  2YQY A;  3VYW A;  2XLO A;  3PDM P;  2P1A A;  3NG1 A;  1JPN A;  1KTM A;  3VM6 A;  3HNI A;  2XS8 A;  3EH1 A;  2EIL C;  3IQC A;  256B A;  3HJC A;  2YLD A;  4N6C A;  3QVZ A;  5L0I A;  2EPN A;  2J0W A;  2LFD A;  3N2Z B;  4JEB A;  3IQT A;  5EGY A;  4ER9 A;  2V26 A;  4XPX A;  2KNH A;  3RFY A;  3FHD A;  1TWA A;  1T6Q A;  2CGE A;  4NCQ A;  2KYH A;  1TFK B;  5FCL A;  4PJM A;  2WVO A;  5T1D B;  2OG2 A;  2OJE D;  3QVY A;  3T6G B;  3N24 A;  3ABL C;  4G7Z F;  3V5Z A;  1I4Y A;  3TD7 A;  1FR0 A;  4H54 A;  4U9E A;  3RQG A;  3SZR A;  4XEF A;  4J30 B;  3RQE A;  3ZTZ A;  3AG3 C;  4A4A A;  4G0H A;  1QLE C;  3NYJ A;  1LS1 A;  1O3U A;  1RKE A;  2WL8 A;  4AE4 B;  4JRZ A;  1RJ9 A;  4LLC A;  4HE8 D;  1ZHT A;  3EH2 A;  1E83 A;  3X1O A;  2EIM C;  1CPQ A;  5L3V A;  1QKR A;  1Z23 A;  1Z63 A;  1K04 A;  2RSE B;  2J0X A;  2R25 A;  4BJ6 C;  4DXW A;  1WWP A;  5E33 A;  1YDI A;  2R7S A;  2J45 A;  3B0P A;  2KSF A;  3EGD A;  1RKC A;  4EWC A;  3DM9 B;  2YLG A;  3OA1 A;  3WAQ A;  4Q4Z F;  3EHM A;  2IOQ A;  3B9Q A;  3RVZ A;  3ABM C;  2H8A A;  1APC A;  2WVN A;  3K7D A;  3NDB B;  3C8G B;  4JZA A;  2Y3B A;  2IXN A;  4OIQ F;  2AVK A;  2YKZ A;  3KYJ A;  3SNH A;  2R7R A;  1M6T A;  2OJQ A;  1JR8 A;  2Q9C A;  4FES A;  4PR9 A;  3U5S A;  3U9M A;  4E0H A;  3GEH A;  1NBB A;  1KU2 A;  4CDY A;  1H9T A;  3LS0 A;  4AX2 A;  3IHU A;  1ZZP A;  1JOG A;  2EIJ C;  3C62 A;  3LLK A;  2B0J A;  2GFH A;  2YL7 A;  4EBK A;  3QW0 A;  2BE5 F;  1ZU5 A;  4PJJ A;  3MYF A;  4NY3 A;  2XLH A;  4P9F A;  3DZA A;  5E3A A;  1D1A A;  4JJG A;  1PD1 A;  2HKV A;  3L8J A;  4N06 A;  3EG9 B;  3L8I A;  2ZXO A;  5E2Q A;  4E7Z A;  1SR2 A;  1D1C A;  3O39 A;  4K1O A;  4MVQ A;  3NRH A;  3JTL O;  4OD4 A;  2NSG A;  4W8P A;  2CYD A;  4LLE A;  4BG0 A;  3DJN B;  5AGF A;  3O10 A;  2WZG A;  3U8P A;  3U0C A;  2QE9 A;  2XL8 A;  3JRT A;  2HSQ A;  3JYH A;  1G8X A;  4N6H A;  2QNL A;  3AOU A;  3W4Y A;  4OIO F;  4XLP F;  3KMI A;  3FDQ A;  3NMI A;  4MTG A;  3ZVR A;  1MMN A;  4U5E E;  3KKB A;  3FOO A;  2P0N A;  3B29 A;  3Q6N A;  1EQ1 A;  1VYK A;  1MMA A;  4DRH B;  2IYL D;  2PBE A;  2AU5 A;  2XL6 A;  3S28 A;  5KYX A;  4YN0 B;  1S05 A;  1ZU4 A;  5JSL A;  5A6B D;  4QI2 A;  3W8I A;  3EQL F;  4ONS A;  1G4U S;  2M64 A;  2Q9B A;  5EHH A;  3T6J A;  1NU9 C;  2UUI A;  2XXA A;  2XM0 A;  3ZQY A;  3QW1 A;  4PFO A;  3VF0 A;  4DBQ A;  1HMD A;  1B68 A;  3TK0 A;  5KYN A;  3B0U X;  2OU6 A;  1V4A A;  1T6I A;  5COG A;  3MLG A;  3VAY A;  4CS8 A;  5KYU B;  5KYX B;  3UGO A;  4AL1 A;  1ZHX A;  3QZC A;  4JTA B;  3DD7 A;  4YL0 A;  2NSF A;  4CS7 A;  5F28 E;  4I1M A;  2NPU A;  3N0T A;  2A0B A;  1OKK D;  1ZHZ A;  2L9J A;  4CSA C;  1LKX A;  1QQ3 A;  4NTF A;  4IB4 A;  2XLM A;  3U8V A;  4XTK A;  5DS5 A;  1LS4 A;  2Y69 C;  2HV6 A;  2Q9A A;  3EFO A;  4Q7C A;  2QTV A;  3M1C B;  3S90 A;  1XZP A;  4OIP F;  1RJ9 B;  1TKN A;  3UMK A;  4CSA A;  2L6F A;  3GAN A;  2HFI A;  2MYS A;  4I1O B;  2OKU A;  3CAX A;  3WOD F;  1WN0 A;  2R7U A;  2XM4 A;  3EPV A;  2TMV P;  2G3V A;  4Z9H A;  4IAR A;  3LJB A;  4PK4 A;  2VB6 A;  4U5B E;  1U0B B;  1FNT c;  5E3C A;  4CJG A;  2F22 A;  4U5F E;  4E17 A;  3DAF A;  1C17 M;  2WZL A;  5GPG B;  1XZQ A;  4JUR I;  3BEH A;  4JIO A;  1E86 A;  5F5H A;  1MMD A;  3DWW A;  3NMJ A;  3OWT A;  3V5X A;  5IY5 C;  2QLA A;  2FFH A;  4XWJ A;  1BR4 A;  1UFB A;  1Y4C A;  4XPW A;  1K05 A;  3U3B A;  4J7T A;  3ZQV A;  4DVZ A;  5KYW A;  3W8H A;  4NTA A;  2J9W A;  2R05 A;  4JVS A;  1C02 A;  4YK5 A;  3ITF A;  3KPH A;  1NFN A;  3HLZ A;  5TJ5 E;  3K33 A;  4FWV A;  4BJ1 A;  2XLV A;  4IRU A;  2JX0 A;  1OCZ C;  3S27 A;  1BBH A;  2W4M A;  1YAR O;  2NG1 A;  3LS1 A;  3RF3 A;  1J8Y F;  3W2V A;  4D4X A;  5L0F A;  2JPU A;  4U5H A;  1M2V A;  1EKY A;  3JYY A;  1FTS A;  1RCP A;  3B71 A;  3O6X A;  2IXO A;  3VRC A;  4BJ5 C;  3CZ6 A;  1D1B A;  3DAG A;  4WGZ A;  1M2O A;  3BRJ A;  4DVY P;  3DJU B;  2HZ8 A;  5CI8 A;  4YL3 A;  1SYQ A;  2YL3 A;  1R4T A;  3H2U A;  3K66 A;  1YJG A;  2KW3 C;  4CDA A;  3K1I A;  3RKO F;  3DKA A;  5HSW A;  2X51 A;  4E7S A;  2ASR A;  5L0H A;  1Y6D A;  3A9C A;  2PP4 A;  5A6J A;  5KYW B;  2A69 F;  3NYM A;  1G5Z A;  4WAB A;  1RKE B;  3SP1 A;  3C18 A;  4AE4 A;  4EUK B;  5HV9 A;  2HMZ A;  1TWG A;  2AWY A;  3F47 A;  2R9R B;  4ZLC A;  1WOL A;  4WGY A;  2ZPA A;  1JAF A;  1YA7 O;  1ZW3 A;  1WAS A;  1PCX A;  2Y39 A;  5DQZ A;  2QY9 A;  4RD9 A;  1YYX A;  5EK0 A;  3S9O A;  1GS9 A;  1MND A;  3ZC4 A;  1FMW A;  3JT1 A;  4MS2 A;  5BQG A;  3EG9 A;  4ANJ A;  1A7E A;  2C03 A;  2DB4 A;  2ICW G;  2PFD A;  5B1A C;  5T3W A;  5DLJ A;  2ZXW C;  3TOL A;  2OEX A;  4DJ9 A;  2KQ9 A;  4JCZ A;  4J7Y A;  5FZT A;  1MNE A;  2EPK X;  1LPE A;  5A6B A;  2HUJ A;  2ZD9 A;  4AK9 A;  4BPM A;  2J9V A;  1BR2 A;  4K7B A;  2L6H A;  2J7P A;  1VYI A;  1H6G A;  1ZYR F;  2PX3 A;  3GWL A;  4JC7 A;  4JW1 A;  1D0Z A;  5B3S C;  4YT4 A;  2W9Y A;  1D0Y A;  3C63 A;  4LER A;  1T6U A;  3JZ0 A;  4NQF A;  4OIN F;  4IGG A;  2PF4 E;  1ST6 A;  3F46 A;  2DGJ A;  1TFO B;  2LQG A;  1Q0F A;  1ZVZ A;  3JRM O;  3Q6M A;  1V74 B;  2UUH A;  2EIK C;  3ECS A;  3OEO A;  1HMO A;  4W8K A;  4BEM J;  1GGQ A;  1K40 A;  4EHP A;  3FOP A;  1JMW A;  1M2V B;  1HY5 A;  3MYI A;  4CIH A;  3US6 A;  2R7X A;  4Z9J A;  1CGN A;  2L7A A;  3QTH A;  3E9V A;  1BZ4 A;  2M4E A;  3ASN C;  4CX9 A;  3RVY A;  1FMV A;  3G4Z A;  3L0I A;  1FAP B;  1OXK A;  2LD6 A;  1QZX A;  3A11 A;  4PAC A;  3T4R A;  2V3C C;  3M15 A;  4JTC B;  2P7V A;  3AGT A;  3TOM A;  3C7J A;  1LIH A;  2FAP B;  4J32 B;  4DBR A;  1KNY A;  3JCU Q;  2OQM A;  2ZXR A;  4C3E A;  3EGX A;  3T9O A;  5JT4 A;  1OW6 A;  3C8Z A;  3M4C A;  3IQ6 A;  4M63 A;  1E2X A;  1UG7 A;  3TJ6 A;  3ZTM A;  1N1C A;  3DXJ F;  2A6E F;  1A0B A;  1G4W R;  2GA0 A;  4GQH A;  1ORJ A;  1XWJ A;  4P9T A;  3WG7 C;  4UDV A;  2BL2 A;  3K6B A;  1ZHW A;  4IJJ A;  4O6N A;  1YZA A;  4K0D A;  1WAT A;  1Q0D A;  4U5G A;  2R02 A;  4O79 A;  1CPR A;  4KI2 A;  3AG1 C;  5COM A;  4IWB A;  1ZW2 A;  4O7G A;  3IEE A;  5DS4 A;  1H9G A;  4MTO A;  5DVW A;  2ETS A;  1RMV A;  2OOC A;  4JJF A;  2J46 A;  1YLM A;  2NUP B;  2VC9 A;  4CS9 A;  3GEI A;  2CDQ A;  2VAS A;  1ORS C;  2YL0 A;  4JE9 A;  3U9J A;  3DMD A;  2AWC A;  4CS9 C;  1IW7 F;  1TQG A;  2CCY A;  3C8G A;  1F1M A;  3C8G D;  3NMK A;  2G62 A;  4YJW A;  1VTM P;  4O6Y A;  4GEH A;  1W2W A;  1JPJ A;  2JD3 A;  4BJT A;  3DE8 A;  3GOD A;  5JUA A;  2D5R B;  2MHR A;  3HKK A;  3ABK C;  1OKK A;  2E87 A;  2Y3D A;  3SYN A;  3AGU A;  1TR2 A;  3HTK C;  4C3D A;  5L0J A;  1FFH A;  2O9X A;  1E84 A;  4PJL A;  1LE4 A;  3JSE O;  3ZWI A;  4BJ6 A;  1WGW A;  3CQZ A;  2YL1 A;  3KH2 A;  5KYY B;  3CSK A;  1VMA A;  2XLE A;  3LUT B;  3E70 C;  2HJM A;  3ASO C;  4YT8 A;  2XXA B;  1YA9 A;  4U5C E;  3RW0 A;  1DOW A;  1HW1 A;  3S29 A;  3U2M A;  4CDV A;  4LDR A;  1AVO B;  1Q0M A;  3GM1 A;  3O55 A;  2GDC A;  2VCA A;  4JTD B;  1E85 A;  2Y3G A;  2Q7R A;  2XLD A;  4YWQ A;  3UNG C;  2DYR C;  1HW2 A;  4YL1 A;  1NFO A;  1O87 A;  1QVX A;  3GM2 A;  3R7C A;  2YLI A;  4G7O F;  4MTF A;  4MQ9 F;  1YVI A;  3FAJ A;  5A6A A;  5L0G A;  5JP7 A;  5L0C A;  3PMR A;  1OR3 A;  1Q0G A;  2XLW A;  2A68 F;  1H7I A;  1SZI A;  5B3I A;  3LAY A;  3W2W A;  2Z15 A;  4Q5S F;  3DE9 A;  5AC4 A;  2FGY A;  1MMG A;  5L3Q A;  1D0X A;  2LSE A;  1BR1 A;  2BC5 A;  2GAQ A;  3WHN A;  4C3B A;  2HS5 A;  4MVM A;  3MX3 A;  3FAP B;  4MVR A;  5JS5 A;  1A7V A;  2LCH A;  3UR3 C;  3EGX B;  4QI0 A;  3U3F A;  2R7W A;  3AQC A;  4KNV A;  3DI5 A;  3CEX A;  2PNO A;  4AL0 A;  5A6K A;  3RIP A;  1OCC C;  1MQV A;  3GM3 A;  1L7C A;  1OCR C;  1WTY A;  1M56 C;  2LP4 A;  3I5P A;  2WB7 A;  3RYL A;  4CJO A;  1LI5 A;  1LI7 A;  3FMS A;  2CNW D;  3GEE A;  5JRA A;  3EFO B;  5JVE A;  2X0C A;  5DS6 A;  1TWH A;  2YWA A;  3B0V C;  1NSG B;  1RXQ A;  3RQF A;  1Z3I X;  2R03 A;  4PJN A;  1OR2 A;  5KYU A;  3TQO A;  4H4K C;  3AG2 C;  1C03 A;  1DOV A;  4LDQ A;  4YT5 A;  4CS8 C;  3I5Q A;  3TUL A;  1OW8 A;  3X2Q C;  3DM5 A;  5JLI A;  2J8W A;  1U6H A;  1YAU O;  2L6G A;  2D4U A;  3KL4 A;  3SXM A;  4N4W A;  4IAQ A;  4LDK A;  1OW7 A;  2LIG A;  4OIR F;  4E0I A;  2OEV A;  2YEV A;  2R7V A;  1GM5 A;  2VCC A;  3K1H A;  4NTB A;  4MVZ A;  2HV7 A;  5D92 A;  4YT2 A;  4WJ0 A;  5T3T A;  3PHF 2;  3AJM A;  4GYT A;  3ZG1 A;  4EKW A;  2B0H A;  3J06 A;  3RH3 A;  4BEJ A;  2NUP A;  3SEO A;  2VCB A;  3V5Y A;  3S0X A;  1HE1 A;  1YZC A;  5DQT A;  4I3M A;  4FAP B;  3LEO A;  4XQ1 A;  2R7O A;  3NKE A;  3JSZ A;  1QPU A;  1U89 A;  2P61 A;  4MVU A;  3G4X A;  2NUT A;  2MWQ A;  3ZSU A;  2DI3 A;  3ATP A;  4G7H F;  2IM8 A;  1T9K A;  1OQC A;  1HE9 A;  3H2V A;  3PCV A;  1QSP A;  4FX5 A;  4ULW A;  3HNL A;  5BUO A;  2P6V A;  1J8M F;  2H7V C;  4HFF B;  2IXM A;  1SMY F;  2AP3 A;  1A7D A;  2IXP A;  4HEA J;  2NUT B;  4O6M A;  4QDL A;  1VK5 A;  4A2N B;  1CGO A;  1S7Z A;  1Z5Z A;  4DRI B;  4MVS A;  5BQH A;  5F5F A;  3MBG A;  1VOM A;  2YZS A;  2GWW A;  4D4N A;  1NLX A;  4XPY A;  4KC9 A;  1A41 A;  2J9U A;  3FXH A;  4CBE A;  2H7O A;  2W4B A;  3H65 A;  5BQI A;  4DRJ B;  1ZHY A;  4OD5 A;  1YYJ A;  4KBL A;  4XEV A;  1NG1 A;  1BDJ B;  2YRF A;  1IZM A;  4RBN A;  3ZIB A;  1VLS A;  3G50 A;  2YVK A;  1VLT A;  2HMQ A;  2Y3H A;  1VB5 A;  2IBF A;  3LLI A;  3K1I C;  4X0R A;  1V54 C;  3U2L A;  3NKD A;  1EI7 A;  1AEP A;  2EPO A;  3EZI A;  3GOR A;  3NYL A;  4XEK A;  4XLN F;  2DYS C;  2KK1 A;  1NZE A;  1I4Z A;  1LVK A;  3EGD B;  5B1B C;  2CW0 F;  4E18 A;  2R7T A;  2H7B A;  4HFK B;  2RD9 A;  3EHN A;  1V55 C;  2I15 A;  1PD0 A;  2EPM X;  2YHS A;  1O5H A;  1TWC A;  3SXY A;  3AQB A;  4EBB A;  4ULV A;  1FFT C;  3ZDL A;  3LNM B;  3MFN A;  4G78 A;  4ZLD A;  3IPM O;  4KNW A;  1NU7 D;  3EZH A;  2XRH A;  2EIN C;  3KYI A;  5CIV A;  5L0D A;  4JKV A;  3POV A;  2VH3 A;  3TJ5 A;  2Q3T A;  1JRA A;  2Q4F A;  2WZF A;  4MW3 A;  5CI9 A;  1CGM E;  1OCO C;  4MVO A;  2A0U A;  3UMI A;  4BJ5 A;  3I4U A;  2OCC C;  2LK4 A;  2EPL X;  5K0I A;  1OXB A;  4I44 A;  2KC3 A;  3M4B A;  4P6I C;  2J9B A;  4U9D A;  2I8B A;  5AC5 A;  5A69 A;  4L6R A;  4JEA A;  3L1M A;  5D91 A;  1M57 C;  3T6B A;  1T01 A;  3Q7G A;  4LAC B;  3UMH A;  4JCH A;  2HSB A;  2PX0 A;  2ZXP A;  3LES A;  4IAO A;  3R2P A;  4DOZ A;  3SXZ A;  4EIY A;  2A1D D;  4MND A;  4R32 A;  4U5D E;  1LM3 B;  3EJN A;  1AUE A;  3LEV A;  3LNR A;  2A6H F;  1Z7Q c;  2CNW A;  3M79 A;  1SF8 A;  3HNJ A;  3UGP A;  1T5O A;  2Q00 A;  3HNK A;  2G3K A;  3IQ5 A;  1PV3 A;  4C7O A;  1R5I D;  2C04 A;  4MW8 A;  1ORY A;  5COF A;  3V7O A;  4NC3 A;  4F4B A;  1EA8 A;  2L81 A;  2LFF A;  2R7Q A;  3L34 A;  4CIP A;  2XSE A;  1GQA A;  1L3P A;  5KYY A;  2W45 A;  2XS1 A;  2HJ3 A;  3FVY A; 
#chains in the Genus database with same CATH homology
 4N4W A;  1CGN A;  4IAQ A;  4CX9 A;  3M15 A;  3TOM A;  1QQ3 A;  4IB4 A;  2XLM A;  1YZC A;  2XLO A;  5JT4 A;  3HNI A;  3M4C A;  3IQ6 A;  3ZTM A;  1QPU A;  256B A;  2XM4 A;  2YLD A;  3QVZ A;  4JEB A;  4IAR A;  1YZA A;  4ER9 A;  1CPR A;  4CJG A;  3HNL A;  1E86 A;  3QVY A;  3NMJ A;  1CGO A;  2QLA A;  3ZQV A;  4U9E A;  3ZTZ A;  2YL0 A;  4D4N A;  4JE9 A;  3NMK A;  2XLV A;  2CCY A;  1E83 A;  1BBH A;  1YYJ A;  1CPQ A;  4D4X A;  3DE8 A;  1EKY A;  5JUA A;  1RCP A;  3VRC A;  1E84 A;  4WGZ A;  2YLG A;  3ZWI A;  2YL1 A;  2XLE A;  2YL3 A;  1APC A;  4CDA A;  4CDV A;  2YKZ A;  1M6T A;  1E85 A;  1NBB A;  4CDY A;  2XLD A;  4ULV A;  3C62 A;  2YL7 A;  2YLI A;  3QW0 A;  2XLH A;  4WGY A;  5JP7 A;  1JAF A;  2XLW A;  4JKV A;  5B3I A;  3DE9 A;  1YYX A;  2BC5 A;  3M4B A;  4U9D A;  2J9B A;  5JS5 A;  1A7V A;  3TOL A;  4L6R A;  4JEA A;  3L1M A;  5AGF A;  3U8P A;  4EIY A;  2XL8 A;  1MQV A;  1LM3 B;  4N6H A;  4CJO A;  3C63 A;  5JRA A;  3NMI A;  3M79 A;  3HNJ A;  3FOO A;  5JVE A;  3HNK A;  2XL6 A;  3IQ5 A;  1S05 A;  5JSL A;  4NC3 A;  4CIP A;  3FOP A;  5JLI A;  2J8W A;  1GQA A;  2XM0 A;  3ZQY A;  3QW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...