3IQDB

Structure of octopine-dehydrogenase in complex with nadh and agmatine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
403
structure length
403
Chain Sequence
TVKVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFADEAERWTKALGADELTVIVNEKDGTQTEVKSRPKVITKDPEIAISGADVVILTVPAFAHEGYFQAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLGTKSVLAASLIKGTAKTVDPLSTLQMLHGAEPVFRLAKHFLEMLIMSYSFVHPAILFGRWGSWDGKPVPEAPLFYQGIDQATADMLTACSNECKDVANAIMAACPGNDLSDDKDIYQWYLEYYHEDIQDDHDLYHAITTNKSYKGLVHPVKAVDAGVAPDFGNRYLTEDIPMGMIVFKGVAIAAGVAIPSNDKLIMWAQEKIGKEYLVDGALTGKDVATTRCPQRYGFNTLDAILTGKKHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights into the mechanism of ligand binding to octopine dehydrogenase from Pecten maximus by NMR and crystallography
pubmed doi rcsb
source organism Pecten maximus
molecule tags Oxidoreductase
molecule keywords Octopine dehydrogenase
total genus 121
structure length 403
sequence length 403
ec nomenclature ec 1.5.1.11: D-octopine dehydrogenase.
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02317 Octopine_DH NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3iqdB02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3iqdB01
4XR9A 1QXSA 1V6AA 4KMSA 4A10A 4L76A 2I9PA 4H3VA 1J49A 2VNSA 3U49A 5L95A 5G4KA 1HE2A 1ZH8A 4MIOA 1A9YA 4Y6PA 4E5YA 4FJ2A 1U9JA 5AQ1A 2ZIZA 2HK9A 4MP8A 1KVQA 1XCBA 4RZHA 3TDKA 3DWFA 5ITVA 1LDEA 4IJVA 3SXPA 1B15A 4J7XA 3WGHA 4ND2A 3KBOA 4BMSA 4OIMA 2VHVA 3ICPA 3RBZA 3TFOA 2WWRA 1LQTA 1Q0QA 3OM9A 1U7HA 4EW6A 2I3GA 4ND3A 3B20A 1B2LA 2DC1A 4RLSA 3RBVA 1X7HA 2YHIA 3EHEA 3I1JA 3O03A 4L8VA 5A03A 3CE6A 3PYMA 3HQ4O 3FI9A 1RWBA 4L4RA 3HFGA 3ZH2A 1VSVA 1P1HA 1LRJA 1KIFA 2AA3A 1O9BA 1Y5RA 4ZQFA 1CRWG 3PJGA 1DLJA 4YA6A 3LLVA 3G1UA 3Q0EA 3VPSA 1ZKMA 3O8QB 1E1MA 5K0ZA 5CDTA 4Z9FA 1U5CA 1YXMA 3E9QA 5A1TA 1PS9A 2YV3A 3JYLA 3MJSA 4OL9A 5L7WA 4K1LA 1YDEA 5L3ZA 3UCFA 3MJCA 1M75A 5JW6A 5EN4A 1GZ4A 4CPDA 3UCXA 3HZZA 1ISGA 1N7GA 4Z3DA 2J5QA 4BNYA 1MA0A 4Q3NA 5T64A 4B4VA 1H94A 1HXHA 2ZQYA 4XR4A 2V65A 1WMBA 4Y67A 1PJLA 3V1UA 4BO6A 3LU1A 1E5LA 3ANLA 3TNLA 4CM3A 4IDCA 4E13A 4DYVA 4N54A 4R68A 3OIFA 4A2CA 1M2WA 1K2WA 3R1IA 3U3XA 5JE8A 1VM6A 2VNAA 2C0CA 3E03A 4M89A 3E8XA 4YXFA 1HL3A 2X8LA 3E5RA 3WMXA 2YJZA 3B1KA 1UXIA 4TRMA 2EV9A 4N5MA 5AXDA 1XG5A 2Q99A 3S1LA 2P5UA 3TL3A 3H9EO 3JQEA 1GPDG 4YT2A 2J6IA 4E5NA 1PGNA 4HNGA 4MJLA 2FR1A 3H2ZA 5KNLA 3UUWA 4B7XA 2J3JA 5T67A 1X14A 1YGYA 4EYEA 4FDAA 3INRA 3H9JA 1GFSA 3ANNA 1DRUA 4GBJA 4UEKA 1F8FA 2C5EA 1H9BA 2NWQA 3QQPA 2EKQA 4XYGA 1EVYA 1E3WB 4J0EA 5C7LO 1QLHA 4N5NA 3BAZA 3G17A 2BH9A 3WLEA 4MVJP 3HN7A 3V8BA 4CLXA 4E6PA 2OUIA 3B70A 1DIRA 4XA8A 4J6FA 2BD0A 1OOEA 5BNIA 2O7SA 5JS6A 1T2EA 3QA9A 3KYCB 4O63O 1GYQA 1R15A 5IZCA 4I08A 2NUAA 1BGVA 4BKOA 3H65A 3F4LA 1CF2O 1PJQA 4QEDA 4D44A 4O5OA 2EP5A 3MTGA 1GR0A 3PIIA 5JLAA 4DMMA 5K6AA 1VL8A 4BMVA 3F9IA 4WLUA 2O3UA 2B5VA 1I24A 3AU9A 3PI7A 1FDVA 4YVFA 2O3TA 1I3MA 2I99A 1ADBA 2HMUA 3AUAA 4WUVA 2IODA 2I66A 2GPTA 4D7AA 2VUTA 3BMNA 3DBRA 3R3JA 4U0JA 2NVUA 1CERA 4GKVA 2Y67A 1TT5B 4ZQBA 2VQ3A 1NBOA 2GZ3A 2OO5A 5TSDA 5B4UA 4IY1A 3RFVA 4AJJA 2CF6A 1LX6A 3EMKA 3DHYA 4GX0A 4IZHA 1UXHA 5ICSA 4RCVA 3JD1A 1NNUA 5F5NA 1HZZA 3LZ6A 4P4NA 1Q7BA 4UREA 3BYZA 4MIEA 4NIMA 2AMFA 1RM4A 3CSDA 3I5MA 4Q9NA 3LC7O 4JROA 4YJGB 1J5PA 5HWSA 5DOZA 4QTZA 2HJRA 1Z82A 1U2DA 4BKUA 4ID9A 2GF2A 5B1YA 2BKAA 1ISIA 3EVTA 4NJOA 2Q4BA 1XYGA 4CQMA 1LSSA 1ZXBA 3WBBA 4CQMB 1ZNQO 2YY7A 3I9MA 5CDYA 4JBIA 1VRWA 3DBHB 3ONDA 3IP3A 1RM0A 1ENZA 3T7EA 5IZCC 1EEHA 2Y05A 3VH1A 2W2LD 4GKBA 2HJSA 5JXWA 5DF1A 2ZCVA 3RJ9A 5F21A 2AE1A 5F1PA 1LLQA 2P5YA 4U6QA 4EI2A 1ZIDA 2VOJA 2YFQA 1GADO 4ONEA 1JN0A 1S7CA 1P3DA 4Q3CA 1EK5A 3QWFA 2HRBA 5DT9A 2Y1FA 2RHCA 3EK2A 1W8DA 5MGBA 2AG5A 5LCXA 1EFLA 1EK6A 4JJFA 5MDHA 1XR3A 2P68A 4D3FA 2ZJ0A 4BVAA 1ENPA 3D5TA 1LRLA 3K2BA 2H63A 5DBGA 3OJLA 4RVDA 4CM9A 1Q7GA 1XQ6A 4TRRA 1O94A 3KB6A 3ETEA 1BDBA 4XQEA 3GOHA 3RUIA 3K9QO 4HX5A 3IUPA 1DC6A 1B16A 2WD7B 1BG6A 3OEYA 1NPDA 4GX5A 2RH8A 2V6GA 5CPFA 1B26A 3S2IA 3GQVA 3LLSA 1HWYA 1LSJA 2BFMA 1T1RA 4AG3A 2PGJA 3WX0A 1QV6A 1ZK0A 3DQPA 4FSHA 1ZSYA 1GU7A 2W90A 3M1LA 3DXFA 1UR5A 2PKQP 4DLAA 1T26A 1KVUA 5EINA 4ZD6A 5K6AC 5U9CA 4OYRA 1P0CA 3UAGA 3ITDA 1H2BA 3I6QA 3KTDA 2VWPA 4BO9A 2XOXA 1HDRA 4KUEA 2PV7A 3D4NA 5JYDA 3RAJA 1MGOA 1H6CA 4MVJE 1DFHA 4JLWA 1B3RA 3KXDA 4P38A 3JQDA 3BIOA 2X9GA 4B8ZA 5ENVA 4D41A 4D3DA 1DAPA 3JD4A 5IDXA 3BMOB 3JQ9C 3PWZA 2YV2A 5ER6A 5DCUA 3TZ6A 3GEMA 2HQ1A 4R3WA 3C1TA 5KJ6A 4NR0A 1P0FA 3U4IA 3KV3O 3TN7A 1AXGA 2X9VA 4DQVA 3R6DA 1GEGA 1YOVA 4RVHA 5EERA 3VH4A 3HB5X 1NR7A 5JBIA 3G0OA 3WOHA 4EUHA 4B3JA 2WD8A 5A9SA 4CM1A 4XQCA 1QKIA 2RIRA 1GCOA 2B69A 5JCJA 2Q4EA 1P1JA 5LDHA 2VOEA 3MZ0A 4CUKA 3LC1O 1TXGA 3W8FA 5DCYA 4BKRA 5G0UA 1CQIA 5T8KC 4R3NA 4R01A 4BQPA 2WJPA 2OGUA 1FK8A 1T2AA 4WASA 4AJNA 4JXKA 3TRIA 5H83A 1HZJA 3UH1A 1GYPA 5JFOA 1HE3A 3GHHA 1KC1A 1DSSG 4CMAA 1VPDA 4BNUA 4QXMA 3QJ5A 3D4PA 1N8KA 3VZPA 3WGTA 1YQDA 1NAHA 3GMSA 1YBMA 3AI2A 4BOYA 2VRBA 1XWFA 4OMUA 3GRPA 1K3TA 5F1KA 2JCYA 4MVJI 4WJZA 3BMNB 1PGOA 4E21A 2QQ5A 3MEQA 1VL6A 4Z0TA 1HYGA 4AJIA 4ITUA 3QHAA 1IHXA 3ZNQA 1SC6A 4J2OA 1KVSA 5TF4A 2CSUA 2CVOA 5IJZA 3BHMA 3LT4A 4LRSB 3GY0A 2PKRA 1LA2A 4OJNA 4BHTA 4NDNE 2FPGA 4TSKA 2ZB7A 4YJGA 1NQAO 4J9UE 1Z74A 4B4WA 3ZHXA 4PZDA 2R00C 3S55A 1MXHA 2IE0A 4YJDA 3ZWPA 2BRUA 3H8VA 1KEWA 1NASA 2DBRA 2VTDA 5TNXA 5T57A 5C37A 2BFAA 3WGOA 1NAIA 4UVHA 5GZ1A 3Q1LA 4WK6A 4X54A 2FZEA 2W2KA 5F5LA 1DEHA 3W8DA 2B35A 4NK4A 2VT2A 2Y1CA 2ZCUA 1C1DA 1ISFA 1BW9A 3NT4A 4BNNA 4LGVA 3K73O 3PLRA 3N7UA 4HFMA 2ZYDA 3B1FA 3FR7A 1J4AA 1L7DA 3A1NA 8LDHA 3GNTA 1R4MA 1K89A 5DBFA 4XB1A 2PD4A 2JHFA 2H6EA 3CEAA 4WGGA 4F46A 4LN1A 1O95A 4AJKA 1PX0A 1O6ZA 3OP4A 4TVOA 1ULSA 4WOJA 3TF5A 5I7VA 1PZHA 1LI4A 5FI5A 4PVDA 4CL8A 4NH4A 3RKUA 3UCEA 3CUKA 3X2EA 3G3EA 5COBA 4W6ZA 2OL4A 3PJDA 4MOWA 2HO5A 3TZQA 1BRMA 3EC7A 1PZFA 2OZPA 5KJ1A 3SJUA 2GN4A 4CQMD 2ZB8A 2IXAA 1K6IA 4XGKA 2A4KA 3WGZA 2WYWA 4D3SA 1Y6JA 2DKNA 3KYBA 3HE3A 1GUFA 4B7CA 5HM8A 3LDHA 2BGMA 1MP0A 1K5HA 1VJ0A 2Q45A 4L73A 4R54A 3RUCA 3JQGA 3ZNOA 2PZMA 4WECA 5T5QA 4B8WA 1I33A 2CFCA 3GAFA 1ENOA 7ADHA 3I4CA 1YB5A 3PHIA 3PRJA 3ZWWA 3DL2A 1TVEA 5GZ6A 2YZ7A 4W99A 3HUDA 2UDPA 3WWZA 2G76A 2AG8A 5IDQA 3KSZO 3HHPA 1MFPA 3M6IA 4FFNA 3GMDA 2RAFA 1MLDA 4PCVA 3QV1A 4A5OA 4BO3A 2XF8A 3A06A 1NX6A 2EWMA 3I9NA 4AJ2A 4TMFA 4CLOB 4CLOA 3GHYA 3INGA 1DB3A 1JAYA 1U3VA 2PZKA 1A72A 1HKUA 2O23A 3HB4X 3JQ6A 1NFFA 4LRTB 3RUEA 3GFBA 1JKFA 1M6WA 3N58A 5DN9A 3TSCA 2X5KO 1PJ2A 4DYDA 2A94A 3LT1A 1EBFA 3AU8A 4A03A 1KBZA 1R12A 3WGQA 1VL0A 2RCYA 3KYCA 1CWUA 3HNPA 3M2TA 4PRLA 6ADHA 1RYDA 5THKA 3AUTA 3HDJA 1JAXA 2ZTUA 4WCFC 1H6BA 3O38A 2Y0DA 1ZMOA 5IXYA 5C5IA 3PPIA 5L40A 2GSDA 1PQWA 3DBLB 3WIDA 3O8QA 4WKGA 3IOYA 3ZGYA 4TKLA 4J7CA 2VWHA 3UFXA 3COSA 2ZB4A 5A06A 3U0BA 1E77A 4NHEA 3QWAA 3KETA 2O4UX 1AN9A 1EDZA 1A71A 3ZU5A 1B8UA 1E7WA 3RSHA 4FC6A 4PLTA 5A9SB 3ONEA 4C7JA 2NSDA 3CMCO 1R4NB 4HBGA 2Q2QA 4PLYA 3BA1A 5IN4A 4CR7A 2VUSA 3BZUA 1JDJA 2PGLA 3BHIA 1F0YA 5BT9A 3VDQA 2WTBA 4QT0A 3W6UA 2YHUA 1V3VA 3BHJA 3C85A 5JCJD 2HK7A 2NM0A 3AFNA 4XRRA 4EJ0A 3RKRA 2CNBA 3PZBA 4IUYA 1ADGA 1UXJA 3KYDA 2Y1DA 3NV9A 3PJFA 4NFSA 3L4BA 4WEQA 1Y7TA 4CM7A 1QLJA 1PJCA 4H15A 4KOAA 2UUOA 3QWBA 1P1FA 2Y1GA 4GH5A 4J2HA 5DULA 3JQBA 3WXBA 4R41A 3IKVA 2VYND 2H9IA 2O3RA 3FBTA 4IGEA 2IXBA 3M2PA 4CR8A 1KEUA 1ULUA 3G79A 4NPCA 1Y9EA 3OEWA 4IIUA 5ILOA 1V35A 2EW8A 4NFYA 2LDBA 2NVBA 3W1VA 1EE2A 3GDOA 3U9LA 2Y99A 4FC7A 1GCUA 1I3NA 3DO5A 4YBZA 2FHSA 4NG5A 3LQFA 1WPQA 1Q7CA 1E3JA 1OMOA 3ENKA 5F3RA 5LC1A 2E4AA 1E0DA 5G0SA 1MV8A 4S3MA 1CJCA 2JHGA 1NTOA 2WD7A 3NYWA 3ZWYA 3MOGA 3GZ4A 5CG2A 5KKCA 5TIIA 2IZ0A 2C29D 3DMYA 5JDCC 6LDHA 4JJGA 1DC4A 5G0VA 4UVGA 5GMOA 5C7IO 1Z73A 1ZJZA 2D8AA 2G5CA 2JD0A 4W7HA 1GQ2A 2DAPA 3RC7A 2V7PA 4PGFA 3ZNNA 5T8KA 1EMDA 2X4GA 1HSOA 1H0KA 1QV7A 3RI3A 5AOVA 4GPD1 1X0VA 3S2FA 4J7UA 4OXNA 1PJTA 1BXGB 1LDMA 1UZMA 4OSPA 3I83A 3IKTA 4II3A 3K5PA 4MPDA 4MVJG 1G0NA 1KY5A 5IDWA 2CMDA 1R66A 4YJFA 2EJWA 3ZW8A 1PR9A 4CQLB 1JA9A 1W6UA 4CQLA 2PGDA 4BNWA 1UXGA 4JX8A 1ENYA 1SPXA 2AXQA 1FJHA 4F6LA 1E6UA 3UF0A 3QLJA 1BVRA 1DRWA 4CM4A 3AM3A 4CMEC 4FFMA 1P44A 2YYYA 3JD3A 4ZHSA 2Y0CA 3GA0A 5DBIA 2PKQO 4IBOA 5ADHA 1IB6A 1PJSA 2IEBA 2YDYA 4MKXA 4WCFB 4FD3A 4DGSA 2UUPA 4Z0HO 3GUYA 2HMVA 1ZO8A 1PL7A 3EW7A 5CFZA 2G82A 5IFLA 3DHEA 3DHNA 3SEFA 2QHXA 2X6TA 1BMDA 3PFWO 5TLSA 4E4YA 1KETA 4IJKA 1JTVA 1G1AA 4DIFA 2EJVA 3I9OA 4H7PA 2Y1EA 2X0IA 3L6EA 1GAEO 4J3FA 2DUWA 3I3OA 2VHXA 3LT0A 1PGPA 2DTDA 5AXCA 2P9CA 2NU9A 4NBUA 3T7CA 3WB9A 3E18A 1I30A 3F4BA 4FS3A 3S2GA 1T25A 3ICCA 4NBWA 5JO9A 3ZWBA 3C7AA 1ZZEA 4AVYA 1N7HA 3ETDA 1E3LA 2V6FA 4EUFA 1U7TA 3H9GA 2GUGA 2X7HA 4S1VA 3PDJA 1NXQA 1X7GA 3EYWA 1WMAA 3I23A 1HRDA 5L4LA 5KOIA 3C1OA 4Y98A 3DMTA 3E82A 4ALMA 3VHRA 1EDOA 2Z1MA 4BGUA 4OXKA 5EPOA 4NJMA 1O0SA 3WGYA 4RVGA 4XQGA 5FFFA 1ONPA 3JQFC 4E2XA 1JLLA 3H9QA 4OQZA 2PLAA 1C0PA 4O0LA 2W4QA 2GZ2A 4GMGA 3U4DA 2DFDA 1LBEA 4FBGA 3VKVA 3IJPA 4Z9XA 1A27A 5K9ZA 4RDHA 2AW5A 1A5ZA 3IDSA 2GYYA 5I9LA 1HDZA 3KHUA 1NQOA 1XEAA 2EKLA 4OOEA 4PLVA 2HSDA 3JQCA 5L4SA 4NU5A 2F00A 1IE3A 1PEDA 1ZCJA 3OBBA 1H5QA 4CV3A 1E3IA 3OQ1A 4F45A 3HFSA 2VZ8A 4BNIA 2WM3A 4NNJA 5IDYA 2OOSA 1NFRA 2J5KA 4MVJF 5KJEA 3AI1A 1D4FA 2SCUA 3ZNPA 3R3SA 4YQYA 1SZJG 3MJ4A 2D59A 1FF9A 1I10A 1JQBA 3DBVO 1AUPA 1DBVO 1YBAA 3F5QA 3OECA 3WYCA 2Z95A 2C7GA 1P1IA 4GVXA 1KEPA 4XJTA 4ALLA 1BWSA 4B79A 2HLPA 4K6CA 2GDZA 2JAHA 2DFVA 3OJEA 5IZ4A 3I9JA 4D79A 3OA2A 3ONFA 1U4SA 3ENNA 1ZJYA 4XIYA 4FOOA 2IEDA 1YB4A 2EXXA 3PVZA 4YAIA 2GRAA 3D64A 4CLEA 3RASA 5IF3A 1I5RA 3P7MA 4E2WA 1U1IA 3JYPA 1GZ6A 4OGWA 1RPNA 3JQFA 3K2EA 4RVFA 2HU2A 3M1AA 3RC1A 2IYPA 1N1EA 1WLYA 4UUMA 5FF9A 3Q9UA 1QORA 4KDEA 5JMPA 3JQAB 4R1TA 2PZJA 4AICA 3FNHA 1XHLA 4RV9A 4MP6A 4JQCA 4I9UA 4TKMA 1Q2XA 1EVZA 3ZHBA 4OQYA 3JQAD 4DPKA 4IS2A 4BNJA 4MVJM 1ZW1A 2VYNA 4YRBA 1WW8A 1I8TA 4Z9YA 1JWAB 1C1DB 1RKXA 4UUOA 3FSRA 1LC3A 4HFNA 4JP3A 2IZZA 4AJOA 2C20A 4CV2A 4L75A 3FD8A 3ZV4A 4O6VA 4RQUA 4QQRA 1OAAA 3DZIA 3AY7A 3OIGA 3Q6IA 4WCDA 2VCYA 1NHWA 1BDMA 3KOUA 3ADPA 4HFJA 3WQSB 5CEJA 1SB8A 4DIBA 2CZCA 5L45A 1GZ3A 2HDHA 1IY8A 1VLLA 5AYVA 1ZVMA 2O2YA 3NX4A 4N7RA 4PLGA 3WTCA 4AJLA 1YONA 1OZAA 1VI2A 3JYQA 3P5SA 9LDBA 2JD1A 4L0QA 3W6ZA 2A9FA 3WYBA 3WQQA 1NQTA 1HTBA 2DBZA 5KWEA 1R0KA 3L6OO 3RWBA 3EZYA 5HTOA 4MINA 1EVJA 3LF1A 1PZGA 1AHIA 2BGLA 2O7QA 1Z7EA 2H1SA 3KM0A 2YV1A 4TRJA 2DUUA 4R5HA 2X22A 1UAGA 2CDAA 2CDBA 1E1KA 4HKTA 3RIHA 3VKUA 1LXCA 3ZV3A 3DMTC 3NUGA 3ZDFA 1HDXA 2J8ZA 4G65A 3LYLA 3OIDA 2HUNA 1LJ8A 2DTEA 3RJ5A 3ROQA 5ILGA 4CMBA 4CLHA 4YCAA 4DL9A 2VRCD 2O48X 4RLHA 1BXKA 3DZKA 1IPFA 4BNMA 4BS9A 4PIVA 3ZHZA 1FDTA 2O50A 4CMIB 1P1KA 3W4JA 1DIGA 1IZ9A 2J3HA 3GVHA 5CP8A 3CTMA 3L9WA 1KS9A 1E92A 1ISHA 3WMWA 4CODB 2C7VA 3GT0A 1MC4A 1HDOA 4QFDA 1ADCA 2GLXA 2Z1NA 4DPLA 1WDMA 1ZSNA 4MKRA 4K9DA 1HSZA 5A04A 4BKPA 3AOEC 3JTMA 5G0TA 4EJMA 1WDLA 2V6BA 4UVEA 1N1GA 1DFGA 1SEPA 4FGSA 5JDCA 4DVJA 4EEZA 3WYEA 4E2ZA 3Q9NA 3G49A 1E1LA 2VT3A 4WLEA 3RUFA 4ZRNA 3PFFA 4XYBA 4IDGA 3BTOA 3EUWA 4J1QA 1O89A 1PZEA 3DAPA 4PG7A 5L53A 2FP4A 1HYHA 2WEKA 4Y6RA 5DOVA 3AOEA 1ZXLA 2YFHA 4II2A 2OBNA 4LSMA 1MG0A 3B1JA 1PU2A 3SLGA 5CEEA 3GG9A 3WGIA 1U28A 3RC9A 1NR1A 2GNAA 2O2SA 2QZZA 4Q3DA 3OJ0A 1TB4A 4ZA2A 4IJWA 1L1FA 4DIOA 4FFOA 4BNLA 4MP3A 3Q2IA 4A7PA 4OSOA 3PIDA 2HKIA 4PG8A 3JYOA 2QZ9A 1OBFO 1H2HA 1SB9A 3DZFA 1TLTA 1XGKA 2I6TA 4GLLA 2R2GA 4LCEA 4BNZA 1LLUA 4XB2A 1QG6A 3GC6A 3I9LA 4KUGA 2EERA 4FIZA 4FJ1A 1XA0A 4JK3A 3JD2A 3E5MA 1ZEMA 1ZK2A 1XDWA 2FY8A 3AUUA 4AL4A 3FNGA 1YO6A 1UZNA 1UDAA 2D3TA 3OJFA 4B7UA 4QFCA 2ZK7A 4NBTA 1X1EA 4FOSA 4GLOA 2C2XA 3F1KA 4QECA 5FYDA 2RH4A 4GMFA 3FR8A 4M86A 4R1UA 4WLNA 4JIGA 1HLDA 4PRKA 1V9LA 4I5EA 3RD5A 2VZ0A 1NVTA 1YE3A 4RPHA 3KSDO 1XKQA 3GZNA 2PD6A 5JC8A 1DIBA 4QO7A 1CIVA 4EDFA 4MO2A 2FPIA 3NTQA 3AFMA 4URFA 4IIVA 5U4QA 4IM7A 1LRKA 2GO1A 3ABIA 3VVBA 2NTNA 1RM3A 3FPCA 1R0LA 2AQHA 1LLDA 3BTSA 3FCOA 2EG9A 3DDNA 4BO5A 3IQDB 1MX3A 2C82A 3NAQA 4Z6KA 4LMRA 2IZ1A 2JCXA 1H6AA 3UVEA 5IXSA 4OH1A 2JAPA 5JO0A 1WVGA 2VN8A 1V3UA 4YAEA 2NQ8A 4ESOA 4ILKA 1M76A 4KUHA 2R00A 5BQFA 3AM4A 4CV1A 5I8ZA 4FPXA 1Y9AA 2DPHA 3KYDB 1NYTA 3RU7A 5IN5A 4W7IA 1XQ1A 3F46A 3UOGA 4CMKA 1HLPA 2C59A 3EZLA 4CUZA 3NJ4A 2NNLD 3GVXA 4M87A 1U5AA 3VPHA 2Q50A 4BO4A 4XCVA 1R16A 4K6FA 1AHHA 1BHSA 3V2UA 1UH5A 4UVDA 4CLDA 1PWXA 4BNGA 3STHA 4M54A 1T24A 4C4OA 1EUCA 2NVWA 4XWYA 4E0BA 4FJ0A 3VVCA 1YQXA 3GF4A 4J4HA 1PJ3A 2CDCA 3K92A 1DXYA 2FN7A 2I5PO 1P74A 3ORFA 2W98A 4KTTE 3BTUA 4GSKA 1YQGA 4E3ZA 3QP9A 2F1KA 3ITKA 4DQUA 1Y8RA 1H9AA 1PQUA 2JKVA 4MKZA 5L7TA 4G2NA 4A26A 3JQ7B 4IQ0A 3RCBA 1U8FO 4XZ3A 1T4DA 1M6HA 3CMMA 3PHGA 4IXTA 4YDRA 5G0WA 4HP8A 4YR9A 4I1IA 1P33A 4FFRA 1ZBQA 3OQ6A 2PR2A 2ZTVA 2ZB3A 4CM9D 5DP2A 1K6JA 2B5WA 1NVMB 3TPCA 3JQBC 4QSMA 1A7AA 2BLLA 3C8MA 1EFKA 1GY8A 2EHDA 3LC2O 4J1NA 4B4OA 3TZCA 4J90A 2TMGA 3E48A 4XGIA 2UAGA 4HFRA 4YACA 2OORA 1DC3A 3QW2A 2X5JO 4IQ8A 4LVUA 4WPGA 3CH6A 3SBOA 2GN6A 3PYLA 1V8BA 3UXYA 3DZBA 3IJRA 3FN4A 4BO2A 1JKJA 2VRCA 3EVNA 4BB6A 1UDBA 2R6JA 3LVFO 5BSFA 4OM8A 1H93A 1XU7A 1YS4A 3KO8A 3ST7A 1ZUD1 4YAGA 4R5MA 1RM5A 3OETA 4FGWA 2Q2VA 2PTGA 2B0JA 3DEYX 1T4BA 4L74A 4Z0PA 4D0RA 1SO8A 4JNKA 3G1TA 4Q3EA 4UVIA 2BHLA 2NU6A 3HG7A 4YRDA 3BXXA 1YKFA 4FW8A 4N5LA 1DHTA 1LSOA 4E2YA 5U1PA 2VTEA 5EL0A 4BV8A 3L6DA 5TS3A 1I32A 2CF5A 2OXIA 4ND4A 1YL7A 3PP8A 1NP3A 4TRNA 1LEHA 5JC1A 3A9WA 1OC4A 4E31A 4GL4A 4R1NA 1OFGA 3UN1A 4FFPA 2J3IA 1E7MA 3F5SA 1X13A 4GWKA 4CMJA 2PH5A 1T2CA 2E49A 2UV8A 1ZK1A 2Y68A 4XIJA 1A9ZA 1HYEA 2B37A 4DC1A 2HCTA 1SOVA 3ZWOA 4KWHA 4PG6A 3ZI0A 5CPBA 4IXWA 3VH3A 1YWGO 4XGNA 3ZV5A 4IDAA 3KLMX 4NZ9A 5A5FA 2G1UA 4GX2A 3D3WA 4GWGA 3KEOA 4D46A 1KVTA 4WNCA 5GZ3A 4UULA 3TZHA 2ZJ1A 3D5QA 3CZRA 3IIEA 3JQGB 1E7SA 2B4TO 4BIIA 3HDYA 5JYEA 1P31A 2VZ9A 1UJMA 5A5EA 4WE3A 1EUZA 3AI3A 3DZJA 5EJ2A 3WBFA 2Y1OA 4BNTA 4ZQGA 1VKNA 2AEFA 3MWDB 2P91A 3NGLA 4HUJA 2Z5LA 4FCCA 1DRVA 2DM6A 4ZJUA 3GFGA 3QE3A 4W9NC 1OI7A 3FPLA 3W4IA 3ZN2A 5ENDA 2NTVA 3OHSX 3PWKA 2D2IA 3PJEA 4NBVA 1K0UA 1A4IA 2GCGA 2P9EA 5KVQA 1DJQA 3VAZA 2NADA 2X86A 1ID1A 3QVTA 4XYMA 2HMWA 1CQJA 4D45A 1MB4A 1QYVA 3AY6A 3GLQA 4OO3A 3GDFA 1PR3A 1PWZA 2P4HX 2OFPA 4J49A 1DO8A 3ZWAA 1UAYA 3PZRA 1W73A 5G4LA 3UGKA 2JFHA 5I9MA 5C3MA 2E82A 2J3KA 1HE4A 4RPJA 4KQWA 3GVPA 3JQ9A 1YRLA 1G6KA 3L07A 3HN2A 3ZWMA 1Y8QA 1TT5A 2Y66A 1BW9B 3KUXA 5I7EA 2E48A 4IMPA 3AY3A 3PHLA 4DC0A 2FOIA 2OP1A 3I52A 2AEJA 4JP2A 4BO0A 4YJFB 1I2CA 2VYVD 1I3LA 3GN2A 4RJTA 5L4NA 2D5AA 2OP0A 4BNVA 4ZN6A 5I7FA 5IG2A 4N18A 2QG4A 4R9RA 2WE7A 4TWRA 3ZU2A 2VUUA 3K8ZA 5DCWA 2DQ4A 4BMNA 1LDGA 1QRRA 2BI8A 2G17A 3H9UA 4E12A 3JQ7A 1DFIA 3O26A 5F1OA 3WQRA 4CM8B 3VZSA 3VC7A 3WFJA 3AWDA 3AJRA 2V6MA 4J1SA 4U0KA 3ZW9A 3NT2A 1TI7A 1Y5MA 7MDHA 5CEFA 5BSHA 3OH8A 2O3QA 4KTVE 3ZV6A 4O1MA 2Q1TA 2QYTA 3GVIA 4XKJA 3SX2A 3TWOA 3GNSA 4D42A 1M67A 2IYOA 1QYXA 4ZVVA 4PLHA 4P22A 1UXKA 3E9NA 4L4SA 3WSVA 4YTEA 5G2OA 1E7RA 3HWRA 1A4UA 1Z7BA 4XEHA 5LDGA 3KSUA 5A02A 4BV9A 4YT8A 1B8VA 1C0KA 3WICA 3WIEA 2FSVA 3W8EA 4E5PA 1YOVB 4DQXA 3OICA 1BXZA 2C07A 3VTZA 1W4ZA 4ALNA 4CJXA 2PFGA 4PLWA 1PGJA 4DTIA 4RL6A 4Y9DA 3WGGA 5EMHA 2OMEA 2JFFA 3IMFA 1GV0A 2C54A 1GTMA 1LLCA 5EIOA 2G0TA 4DXHA 2ZTLA 4EEXA 1QP8A 1ZEJA 4J4BA 4YQZA 1VE9A 4FN4A 4IDDA 1YH3A 1YDWA 4XJSA 1X1TA 3MWEB 5BNFA 2I65A 3JQ8B 3AK4A 5HRUA 5ER9A 4YAJA 4ZRMA 2GGSA 1PTJA 4NFHA 3RFTA 4UAGA 1PS0A 2O4CA 1S6YA 1D1SA 3NJ8A 3RROA 3PK0A 4FR5A 2EW2A 4G5HA 4R51A 5CDSA 1Y81A 3IUSA 2VWQA 1U4OA 2W2LA 1YJ8A 2ZATA 1ZMTA 1PIWA 4EBFA 5KJFA 2H5LA 3CTVA 4YJHB 3MJEA 5KTKA 5TT1A 3OF2A 5ICMA 3ON5A 4DBZA 3D0OA 5KIAA 1NFQA 5IAAA 4WLVA 3NRCA 3QIVA 5FI3A 1HEUA 1NVGA 1Z45A 5JPIA 4K28A 3GDGA 1GUZA 1SBYA 3T4XA 4KZPA 1NM5A 4KP7A 3DR3A 1PGQA 3PTZA 3PEFA 1DHRA 4I5DA 3QWHA 1B7GO 4NJMB 5JY6A 1YJQA 2HMSA 2GR9A 4HY3A 4TZTA 4CM8A 1LSUA 1GD1O 4YWJA 4PVCA 2X0NA 1ZSVA 2RHRA 3WTBA 4B3HA 4CLRA 3RU9A 4D43A 2ZKLA 2CVQA 5ITWA 5TQVA 3E6AA 2WMDA 3LK7A 2BELA 4J0FA 1GEEA 5JCXA 3CKYA 1I2BA 2AQKA 3KEQA 1DOHA 3PQEA 3EDMA 4IZIA 1F06A 1XSEA 3L4BC 1GV1A 4INAA 3TJRA 4XRGA 2FPPA 1VC2A 3GNQA 1U3UA 1AGNA 3RUAA 2Q3EA 5L9AA 4NBRA 3IL2A 1FDSA 1P9LA 2D0IA 1C1XA 3C3XA 3UICA 3L4SO 3U09A 1N9GB 5FEUA 4BNKA 4LVCA 2VHYA 1ONOA 5DP1A 2ET6A 4GSLA 3AM5A 3HDQA 3GGOA 4OAQA 5B4TA 1NPYA 1SOWA 2PY6A 3AUSA 3FHLA 4RF4A 3DZGA 2EIHA 3ETGA 2YDXA 5JY1A 2WYVA 1R37A 3ZHYA 4BGVA 4HXYA 1ORRA 4IINA 2EKPA 3A14A 1VJTA 4DRYA 5JDIA 1KYQA 5KVVA 4XQ9A 4A27A 3K30A 3BTVA 2B36A 3P2OA 1IL0A 3HDHA 2CY0A 3KLPX 2JD2A 4TZKA 4E30A 1F12A 3H5RA 1WZIA 2P4QA 3L0DA 4E5KA 1JKIA 4RZIA 4D0SA 1DLIA 1ML3A 1R4NA 2FRDA 2W2KB 3F1LA 3NT5A 3ULKA 3X2FA 4B4UA 2YUTA 2NQTA 4IS3A 4CMGA 2UVDA 3F6YA 1EBUA 1HE5A 3L9XA 1EZ4A 3IP1A 4RGBA 1X7DA 4ZQHA 3ZWNA 1YVEI 1QYWA 1V3TA 3VPGA 4WOKA 1EE9A 1X0XA 3GK3A 1T2FA 1LUAA 3AOGA 2VYVA 4LCJA 3B6ZA 1JVBA 3CZMA 4GGPA 3TZKA 3OMLA 3GGGA 4P4GA 1E3WA 1KOLA 4I5GA 3VTFA 4FB5A 4RVSA 5I9NA 2DTXA 5B12A 2OBYA 2XXBA 3UKOA 3UW3A 4CMIA 2CD9A 4E32A 1D7OA 5THQA 3QY9A 2Q46A 4GAEA 1E5QA 2BGKA 3RC2A 2ZQZA 1W0CA 2HK8A 1XU9A 4I8XA 5EQFA 4YEDA 1F17A 4QUKA 4AFNA 5JAZA 3TL2A 1UZLA 1UDCA 1NPTO 2AE2A 3KZVA 4CR6A 5HA5A 3VPXA 2I76A 3O4RA 1PSDA 3JQ8A 4IGFA 5A05A 4CMCA 3GEGA 3QVWA 5DZSA 1DC5A 1R6DA 4DLBA 4YT5A 3WFIA 4BGEA 4DREA 1DIHA 1E6EA 1DIAA 3WNVA 1T2DA 3QVSA 3C7DB 3JD0A 9LDTA 1Y8RB 3A4VA 2B4RO 3OA0A 1QYDA 4B3IA 3INTA 4J91A 4AJ1A 3NEPX 1KC3A 3S8MA 3WG9A 1SMKA 5FWNA 1MXFA 1CEQA 4PZCA 1VKOA 2PWZA 3V5NA 2GERA 3ASVA 4FFLA 3H3JA 4W9NA 2AEMA 1GUYA 1U8XX 4DMLA 1WXDA 2DLDA 1O5IA 2O3SA 1R4MB 2DBVO 2ILTA 1KEVA 4OXYA 5AXBA 3F47A 4BO8A 2FZWA 3BMCA 3BMCB 4XYLA 2XPCA 5L7YA 3LSYA 1LNQA 1MFZA 2EP7A 3DB2A 3OFSA 4RPLA 4M49A 3HSKA 2Y93A 4TROA 1X15A 4UUPA 3WDSA 4Y8VA 1B3BA 1F8GA 5H81A 3P2YA 4M1QA 3VPFA 1FDUA 1CYDA 2E37A 5EESA 1N9GA 2DPGA 4E33A 5CAEA 3MTJA 1SCUA 4ZICA 4W82A 5ES3A 3H3FA 4A73A 1NHGA 3ZWVA 4BGIA 1DPGA 1FXSA 1KERA 1PJ4A 3NDJA 4CM5A 1C0IA 1DJNA 4HNHA 4BKQA 3QVOA 1C14A 1N92A 1I0ZA 1UP7A 5I8WA 1B14A 1GQYA 4MIYA 3PXXA 4KQXA 4R1SA 3RVDA 1E1NA 3SVTA 1UP4A 4J1TA 4RO0A 4R16A 5G4KB 4IDEA 4NQZA 3H5NA 1PS8A 3ROPA 1Q0LA 1T1SA 4IDFA 3NKLA 3N74A 5CDUA 1NQ5A 3WLFA 3K96A 3FTNA 5JMWA 4XDZA 2NACA 2VHWA 2NU8A 4AJHA 3QRWA 5DDIP 4ND5A 3FRJA 5BSGA 5J23A 1ZFNA 3DC2A 3RFXA 5BR7A 3DOJA 4JGBA 1P77A 1IHYA 3ROMA 1EQ2A 3I4FA 1RYEA 3PGXA 5KCZA 4KDFA 4MVJD 3U62A 5I7SA 3IAHA 2YHIB 4PLZA 4PLPA 5DNAA 2QX7A 1GDHA 4G81A 4NI5A 2YW9A 3NGXA 4XD2A 5JDIC 2QRJA 4U8GA 4PFJA 2BF7A 4GVLA 4WNIA 2VHZA 1JWBB 4M8SA 5COQA 3V1TC 2GZ1A 5COAA 2Q49A 5B4VA 4TVBA 3GUCA 4K26A 2WE8A 4R4JA 3V2HA 1UP6A 3D7LA 4JJIA 3GAZA 1PJBA 4CM4B 5A4DA 5KVCA 2TMDA 4ND1A 1ZK3A 1QMGA 1LQUA 1YL6A 1BSVA 2PK3A 2OHXA 3OJOA 1YL5A 1IUKA 2HRZA 4P8RA 5BSEA 4NMHA 5EQDA 2BFOA 2QW8A 3V1YA 5A3JA 4C7KA 4EZBA 5JAMA 3NDRA 3EAGA 4OHUA 4TQGA 4IDBA 4YB8A 1MUUA 3DAGA 4ROSA 4RPGA 3BMOA 3SC6A 3PQDA 5AVOA 3D3WB 1N5DA 3O9ZA 3LT2A 1WP4A 1WZEA 2EGGA 5C7OO 3PQFA 2QYSA 4A0SA 4BNXA 3PGJA 3RBXA 2D5CA 1VSUA 3DOOA 2HMTA 4ZU3A 5A9RA 4JBGA 3F3SA 2QRKA 2PH3A 4I9HA 3ZU4A 2BI7A 2NVUB 4BUCA 2EGHA 1LTHR 3TOZA 2ZYAA 4WEOA 3D3EA 1KVRA 2QRLA 3K6JA 3JV7A 1IYZA 3EGOA 4GGOA 3GN1A 5H82A 5CHEA 4I9NA 1L7EA 3ZU3A 4H16A 1AE1A 4BNFA 1SEVA 1BXGA 2B4QA 1D8AA 1ADFA 3JCZA 4RQTA 4R69A 5KKAA 2Q2WA 4LW8A 3FWZA 4RF3A 1QSGA 4EITA 3U5TA 4RF2A 4OKIA 1PL8A 4PLFA 3RUHA 3K31A 2A35A 3VZQA 1LU9A 4F3YA 1HT0A 4NK5A 4UUNA 2P9GA 1LDYA 1XELA 3WS7A 1BVUA 3L77A 4YPOA 3NDIA 4IQGA 3ADOA 4XX0A 3QWIA 4BNHA 5L51A 1ZK4A 3DZHA 1JU9A 4Q3AA 3DBHA 3PHJA 4YT4A 4XYEA 4EGFA 3SLKA 2FSSA 4J16A 4OKNA 5TC4A 3KRTA 1I2ZA 3BMQB 4LSWA 3JSAA 2BFPA 4FQ8A 4O59O 4ALJA 2HAEA 1IZ0A 5TJHA 1EUDA 3MOIA 1N2SA 3U4CA 5HBRA 4R9SA 3DTYA 5B37A 5A3VA 1HDGO 1K6XA 1WWKA 4J43A 4PN3A 3CXRA 4L4XA 4GQAA 1R0SA 2WSBA 4IJUA 2X5OA 3FTPA 3V2GA 3W4KA 1I36A 4IMRA 2DT5A 2FR0A 5HS4A 1DAOA 1PQPA 3GEDA 2Q1UA 4UEOA 5TT0A 1D1TA 3DFZA 3GZNB 4M55A 1H6DA 1O8CA 4LK3A 3RUDA 1FMCA 2YQ4A 3I9KA 2CVZA 1P45A 4J4TA 3VDRA 1V0JA 1KY4A 2DBQA 5KVSA 2D1YA 1VJ1A 4BO1A 3IC5A 2UYYA 4HADA 4KWIA 5A9TA 5BNTA 4GX1A 4IPTA 2QIOA 1AXEA 2A92A 1J6UA 3U4HA 5KJCA 3FF4A 2NU7A 2BMAA 1I01A 3DFUA 2JJYA 3P19A 1Z75A 3CIFA 2X1HA 2POQX 1NWHA 4W4TA 3WJAA 3NTRA 4UEJA 3SC4A 3TFQA 3Q11A 3TQHA 3WSWA 4E5MA 5JAIA 3SJ7A 1WAMA 1E3SA 2X9NA 3I6IA 1OC2A 2Q1SA 2X58A 5TRTA 4DLLA 1HDCA 3DAFA 1NWCA 4DWVA 3QVXA 3WR5A 1B0AA 3GPDG 3H6KA 4WCFA 2WDZA 1E3EA 1E7QA 3PHHA 3C1AA 1E7YA 3DONA 4OOFA 4CLRB 3GR6A 2NTJA 3H5AA 4JBHA 4PLCA 4AJ4A 1YB1A 2PD3A 3ZCXA 1IOLA 1GYRA 1PL6A 4YJHA 4CMHA 1D3AA 3GVCA 1EQUA 4YAKA 3ANMA 2I67A 1LDBA 4EJ6A 5JNLA 1TT7A 3GG2A 4HWKA 3CPSA 3PLNA 1M66A 5JSFA 4QO8A 4U6SA 4YYZA 2EEZA 4DA9A 4PZEA 3C24A 3FNEA 1QYCA 4ZQEA 2WYUA 2XAAA 4QX6A 3ASUA 3TOXA 1HDYA 2X0RA 3MJTA 5T6BA 4Q3BA 4P4LA 4CV0A 3GPIA 1FDWA 3IS3A 1Y1PA 1U3TA 1SNYA 1E6WA 2P2SA 5HS6A 1HF3A 3DBRB 4LMPA 4PG5A 3PYXA 1LC0A 1F14A 1C0LA 3BMQA 4LISA 4ALIA 3LF2A 3UHAA 4AJPA 3OQBA 2Y0EA 4DBVO 1P1RA 4JN6B 2VWGA 4MVJH 4RDIA 1HETA 1Z6ZA 3AW9A 1A7KA 3GH3A 5JAQA 4MVJA 1TEHA 2CUKA 3GGPA 4NU6A 1RJWA 1MC5A 4I5FA 1IPEA 2AQ8A 2XXJA 1LDNA 4EUEA 2GN8A 2ZTMA 4J9VA 2W8ZA 4Q39A 2E6UX 1CETA 1Q1NA 2JCVA 1EVIA 4AJEA 3GRKA 4DPMA 4CUJA 1Y8QB 4GI2A 3PWSA 2EF1A 4MDHA 3MJVA 5TGDA 1MG5A 3NTOA 1XLTA 3RQSA 1WNTA 3VZRA 1WDKA 3OSUA 3HJAA 4HV4A 2GASA 1YBVA 2FWMX 2GN9A 3FBGA 1CDOA 1ONNA 3JYNA 4RORA 3DOCA 2AHRA 3DTTA 2PA3A 4RPKA 3E9MA 3KVOA 4Z3KA 5GY7A 2NLOA 3ZZNA 3VOSA 4CM6A 1C3VA 3H2SA 5AXAA 1QR6A 3QSGA 4RF5A 1XIVA 1GPJA 2JL1A 3D1LA 3T4EA 1B8PA 1IULA 2D4AA 4XDYA 1DDOA 2GD1O 4L9RA 4U5QA 1TA4A 3CINA 4PG4A 3HADA 4F6CA 4ZGWA 1GQQA 3WWYA 4YRAA 5CDGA 3EY4A 2C2YA 1ISJA 3ZWCA 3S2EA 1BTOA 2B83A 2X0JA 3MCVA 4BQRA 4U7WA 2RBEA 4CL3A 1Q0HA 2X23A 3E1KA 3ZWXA 3D4OA 3FWNA 2PZLA 2FMUA 4RVUA 3WJ7A 3VH2A 4BL5A 1SAYA 2DVMA 3ROKA 4CMEA 2YQ5A 2PNFA 4DUPA 1I3KA 2AQIA 4Y6SA 3A28A 3R0IA 3JQAA 5TX7A 8ADHA 4BB5A 3C7CB 3Q2KA 1ISMA 1C1XB 2LDXA 2FR8A 2I3AA 4BO7A 3PDUA 3H4VA 1GL3A 3WNQA 1U2GA 2C5AA 4WLOA 2NV6A 4ALKA 2J5RA 3Q3CA 2IDZA 1J0XO 1JW9B 1JVSA 2IRWA 2Q1WA 2O3JA 4WLFA 3H7AA 3FNFA 2DU8A 1G0OA 1UUFA 4JCOA 2ZYGA 2JFGA 5TJ9A 5CG1A 1ARZA 1U3WA 3DBLA
chains in the Genus database with same CATH superfamily
3TD2A 3UB3A 5EWLB 5TE9A 1GGKA 1DELA 1PLJA 4H3VA 1J49A 3S1AA 5G4KA 1E2GA 5SICE 1ZH8A 3NHFA 3OZVA 3TTVA 5HIMA 3PWTA 3OCWA 1J5EB 1OLOA 1EA7A 2WOOA 2QVBA 3GJTA 4Y6PA 5AQ1A 2P67A 2HK9A 4TMYA 3TDKA 3UJ8A 5BUCA 2ZBFA 4KO3S 2IKSA 3I8XA 3Q40A 4RVCA 3PQ3A 2C31A 5CVVA 4JI1B 3MYYA 1CUEA 4NZPA 2VHVA 1RADA 1TCBA 2WWRA 3OM9A 3DE5X 2HBYA 3OTIA 4MMXB 3D02A 4MA4A 1N75A 1SY7A 4UHKA 5J40A 2AG0A 1C9MA 2Q7OE 1W44A 4RLSA 1SA0B 4MQFB 4AZ0A 4F4UA 5KNCH 1F1JA 5A03A 1XZCA 3NUZA 2JLBA 3KEGA 1RWBA 4Y7CA 2GJSA 4L4RA 4YQEA 1ZXXA 1IN7A 1GNSA 4TL7A 3PNLA 4YECA 3I9FA 4ZREA 2FI1A 4B7AA 1EB9A 1KIFA 1ZRMA 4QOFA 5E7QA 4ZQFA 4AY5A 2VPQA 1RBZA 1DLJA 4Q16A 1C7FA 3VPSA 3N7TA 1EDDA 3EVAA 1U11A 3RIYA 4YMVA 2JIRA 1AV7A 4YIHA 1E5VA 1YXMA 3E9QA 1AK1A 1FTGA 3I53A 3MINA 4GZLA 4W5QA 1E4VA 4UQPA 3HY3A 5DTEA 1U2GC 4U9IS 2WM2A 3MJSA 3RYIB 1L4NA 2DHRA 1YASA 3ETNA 4K1LA 1GA4A 5AK4A 2RJ3A 2ZKIA 3BD6A 3MJCA 5LLDA 4RTRA 2RHWA 5MN5A 4EFMA 2GRUA 4UM9B 2OR3A 4F3CA 3CH4B 2OLKA 1CC1S 3JRXA 3ZXXA 3F5DA 2I7TA 1V7PC 4MR8A 4MUJA 4Q93A 1A9XA 1BH6A 2J5QA 4BNYA 1MA0A 4Q3NA 4ZJZA 3DHWC 1X6VA 4B8YA 1FS5A 1KPIA 2QUZA 4N1AA 2V65A 3A27A 5HQ3A 5SZIA 4HAOA 2QR3A 4HDCA 3LU1A 1CUDA 3LFUA 4ARBA 3TNLA 3UEOA 5IVHA 4E13A 3MUEA 4I50F 1NMYA 4IFBA 2W6CX 1RC1A 3R1IA 2G1JA 5JE8A 1GSIA 4NECA 4AYWA 2HFJA 2ZW9A 2VSXA 4HUQA 1XTRA 1H65A 2C0CA 3HO6A 3E03A 2QXTA 4M89A 3OPNA 2GETA 1ZCAA 2Z6AA 1CVLA 2YJZA 1E3QA 1PCXA 2Z4TA 3B1KA 4D4IA 2AC4A 4TRMA 3IQEA 4N5MA 3VU9A 5AXDA 1SK9A 2DH6A 1Y7HA 2OPHA 2P5UA 5IASA 3H9EO 2QGNA 5DYIA 4IOMA 4YUVA 3K0SA 3ZD7A 4FHCA 2FNAA 3EOBI 2ZITA 5T41A 4JKIA 3UUWA 4B7XA 1IZYA 2REQA 5LWHA 2VH1A 5T67A 4RC9A 1YGYA 4WK4B 4A82A 3EEQA 3QTLA 4RKQA 1WRBA 2XB2A 4KWEA 5DW3A 1MGPA 1C29B 1CPYA 4IRUB 2DFNA 4DSAA 4UPEA 3H84A 1CEYA 3DAYA 1DTSA 1XXHA 4OYYA 5K3DA 4I1PA 1HMPA 1JFVA 2JH3A 1F8FA 1O03A 1S1CA 3A3OA 3KTOA 1EP2B 4JVOA 2NWQA 1Q0PA 1NI4B 2O7VA 4HDMA 4JLPA 3R5FA 3KR2A 1UEJA 2BP7A 3MVEA 1E3WB 2PAFA 4J0EA 3WK8A 1QLHA 3WMFA 2HA6A 2R8BA 5C7LO 1JBEA 3C8ZA 4D25A 4CI9A 4CLXA 4E6PA 1T8PA 1NYQA 3PVCA 3MB5A 1VIDA 4FKMA 1CRPA 4YMUA 5F7ZA 4BDSA 1P6XA 2OTCA 2OUIA 4P5DA 4AF6A 3ZVMA 5ALSA 4ZEWA 1OYVA 2AK3A 1U0SY 4CKBA 2O7SA 3KHSA 5JS6A 5KEIA 1CB7A 3U2QA 4GZ3A 4YLGA 1J8QA 2A1IA 1DP4A 3NM6B 1JZQA 2LGJA 3AJ9A 5JIBA 1JBQA 5DSZA 5DBHX 5K45A 2GEDA 4GYJA 5BMVA 3CKKA 1R0RE 4GUAA 4YAOA 4OMCA 1E4OA 3HXPA 4HATA 3GFVA 4EA9A 2JVKA 4F2HA 1JPUA 1I7LA 2EP5A 1PFGA 2O7RA 3N2EA 2RE8A 1K98A 5EZYA 3K9WA 3PIIA 1VL8A 3T34A 4WLUA 2VPPA 1SCJA 1I24A 2HBZA 2N0SA 1JB1A 2WF9A 4H7JA 2PSDA 2C83A 2DOKA 4W8HA 4X0EA 1I3MA 5CT8A 1ADBA 2HT6A 4C0WA 3DVAB 3VQTA 2ACWA 4ZI7B 4ZYYA 4QXQA 3U56A 2BI4A 3BMNA 2FWIA 4HAWA 4CF5A 3MT9A 4PQEA 4O4JA 1F4PA 1KJ8A 1NBOA 4TN5A 2XRMA 1QFSA 4HEHA 4IY1A 3ABZA 4EYSA 2CF6A 4X1OA 1H2AS 3EMKA 4KIJA 3GJSA 3R44A 4Q4AB 3VJRA 3WNZA 2WWVD 1FTQA 2UUAB 4KXYA 2V5VA 5JD3A 3LZ6A 2GXQA 3LQYA 2RBKA 4P3NA 4WBNF 4CFYA 3L7OA 4TT8A 3BYZA 3STYA 1C9EA 5SYNA 2AMFA 3A6HA 3CSDA 3DHVA 3UHJA 3I5MA 2Q5EA 2HB6A 1JG3A 1USVA 4D02A 4RH3A 4FMBB 4X85A 5TDHA 1MRZA 1ZDMA 5H0IA 4XM0A 1CUYA 2JIMA 2FG5A 4G5YA 2GF2A 1RKBA 5GONF 4BKUA 2R5FA 4BP1A 2OCXA 1II8A 5AW3A 1LSSA 2IF2A 3NVDA 1M2VB 3R6WA 3HYTA 4FXPA 4U7FA 5JWHA 1CUJA 2OE2A 2YY7A 2Q3HA 5CDYA 5FULA 4JBIA 1EDBA 3A1WA 3ONDA 1RM0A 3KJGA 2VXYA 4O2BF 4GOOD 1ZGAA 4L6AA 5IZCC 1UQUA 4B6PA 1KMMA 5TQ2B 1OX4B 3R9IA 5EJFA 3FJ1A 2JH9A 2OHFA 5JXWA 4XI9A 4P3KA 5DF1A 4MICA 2ZCVA 3RJ9A 2IUYA 2ONYA 1LLQA 3NP7A 2AEEA 2VOJA 4ONEA 3E7PA 2VH2A 4KO1S 5TGTA 4FMCF 3FPBA 1HT3A 4NNPA 3ORQA 1KI9A 4NY1A 4WXRA 5SZHB 1ACLA 4BPRA 4F06A 1EU1A 3HLTA 1QC5A 4JJ8A 1CQWA 1FRFS 5E1BA 1NQXA 2Z3WA 2A0YA 3B9PA 3B52X 3AJDA 3QWFA 2DR2A 1VG9B 2W2VA 4LFBB 2RHCA 1Q12A 5DM4A 1VSTA 1W8DA 5LCXA 1YMVA 1EK6A 1JU4A 1E59A 1Z3IX 3C6MA 1SXHA 1QANA 2X14A 4YO7A 4YJHA 3D5TA 4H9GA 4X84A 1DEKA 4WOCA 1WE2A 5KTSA 1TC1A 3Q6MA 1IZ8A 4CM9A 2O06A 5A5GA 5I7OA 3OWXA 3PR1A 3RSQA 1XQ6A 1XQ9A 3EVDA 1CJKC 4PYOA 4TRRA 1OX5A 3KB6A 3VC3A 2A57A 1BDBA 3BH0A 4Y0NA 2AFHE 2PQMA 4WK6A 5BSTA 4OHRA 3K9QO 1QIKA 4LYHA 3STWA 2H5JA 2QU7A 3K53A 1DC6A 4HX5A 3MTAA 4KN9S 1BG6A 1R0ZA 3OEYA 5CPFA 3IEPA 2HRQA 3V4FA 1G7RA 5JASA 4PX5A 5CCBA 4Z7OB 4H59A 1RPTA 3CN7A 1LSJA 4GICA 3FYUB 4JQOA 2YYAA 4AG3A 1NL3A 1QOQB 2NZUG 2ZAGA 10MHA 4EKYA 1XPOA 4B9AA 4TSFD 2JGRA 4YMHA 1OWMA 2W6OA 4AZVA 1GPAA 3T7JA 5BOSA 5JSHA 4B1FA 4ZVMA 1KVUA 1UBUS 2O19A 3USZA 4OYRA 3UAGA 1H2BA 2VWPA 2Y4OA 1A5AB 1GILA 4CWAA 1YIAA 3A37A 4KHZA 3CVXA 4OI4A 1K2VN 521PA 4INJA 3SVLA 4B8ZA 5ENVA 1OA0A 2ZJAA 4N40A 1CUUA 3UW1A 4PYLA 2YV2A 3I2HA 4XFKA 5DCUA 1HNZB 1XRRA 3TPFA 1HNNA 2DCUA 1GAQA 3UWKA 2XRYA 1MO2A 2QLJA 1NI4A 1AKEA 1RHJA 1YOVA 1EBBA 3ABSB 4RVHA 3VH4A 1Y1LA 1YDGA 3PNOA 1NR7A 3TQIA 1JIVA 3HFRA 1D4OA 3P2IA 4IFTA 3DLTA 4D4LA 3AY0A 3ELBA 1KEKA 3ZIAA 5B58T 3O4GA 3DZCA 3JRNA 1B74A 2GZRA 4E5SA 2VSOA 3KLBA 1NVVR 5E9AA 3V8VA 3D2LA 1M2VA 3N0WA 4NX2A 3GJQA 5AK3A 5JCJA 3W05A 3I2YX 3AUXA 4FGUA 1JFSA 1A82A 3AB3A 3LC1O 4F8JA 1QH9A 2XMPA 3CO0S 5J5CA 2EFCB 4BKRA 1W5AA 4QOGA 3WAKA 3SLRA 3N53A 1FTSA 4R01A 4N9QA 4Q1CA 2Z4RA 5FPSA 1FK8A 2FJ0A 2UXBB 4JIMA 3TRIA 4KE8A 5CM2Z 3UAWA 3K05A 3OX1A 1DKMA 1HZJA 2ZWPA 1GYPA 1DUVG 1FPQA 3ME5A 4LY9A 1HE3A 3GHHA 1DSSG 4BNUA 1NC3A 2QAJA 1FNSA 1M1YE 3H42B 3Q8LA 3FHOA 4RIIA 4PTYA 2DHCA 5JZSA 3WNCA 1NAHA 3C8UA 3GMSA 1U0HC 2Z08A 4Y1RB 1YBMA 3AI2A 1TKCA 2XITA 3QX7A 4X20B 1AF7A 1XP5A 2VCHA 4OMUA 4BNDB 3KK0A 3TGPA 5LL6P 2PEZA 1QIGA 2PSEA 3BMNB 4E21A 5BSKA 4Z0TA 1RVDA 3HWWA 3MHPA 5KWIA 2JKYA 4KQJA 5DJ5A 5E7MA 3ZNQA 2R4QA 2FDXA 4J2OA 2R68A 2GM3A 2CVOA 4X6XA 4LYGA 5B55A 4FGKA 2OVBA 2ZDQA 2OXEA 1K68A 1G3UA 2ORVA 1LA2A 4PC1A 4YAFA 4D0NA 2ZBVA 2RK3A 3UT5A 4JLUA 5JZVA 4TLDA 3E9DA 4CBVA 4ZWNA 4C7BA 3ZJVA 2QX9A 4TSKA 2G71A 5GVSA 1U8UA 1NQAO 2YINC 3LUDA 2YWFA 1AUVA 3NRBA 3Q0TA 4J9UE 2G67A 4MV7A 5LBUA 3SJAA 3ZHXA 4F4HA 5BNWA 3AVPA 4YJDA 2C2GA 4QOIA 2BRUA 3GW8A 4FX5A 4NS1A 1FRVA 1GKKA 5A4FS 3H8VA 1PD1A 3GA5A 1OGJA 3MHTA 4YRMA 2VTDA 1EM8B 3HUEA 4UHBA 1ATIA 4UHEA 5T57A 3T5TA 2FUCA 2HJHA 1A96A 1Q6ZA 1TECE 1XV5A 2FPIB 1UZUA 2VZLA 2FZEA 1X74A 1S01A 2X42A 2ATXA 2VP3A 1DEHA 3ICOA 4M88A 1Y6QA 5KTMA 1OHHA 2AOUB 1GP2A 1LZKA 3QPBA 1CJUC 1C1DA 3NHZA 4UMFA 2O8FB 4LGVA 1WB4A 4YR7A 2FU5C 4B76A 5AW0A 4OFBA 3N7UA 2VDWB 1K8ZB 2ZYDA 2W2QA 4HFMA 1J4AA 2X2OA 2NPFA 1NF3A 4M83A 4G56A 2NOGA 1KAEA 4L0DA 5DKFA 4EYKA 1MNAA 4JJ4A 4U2FA 4CKEB 1EVLA 1R4MA 1RRPA 2QDXA 2HMAA 2AZMA 2QVZX 3IKLA 4LOHA 1B0UA 3KG2A 4GRDA 3VI3B 1T13A 4F46A 1NVDA 1D9ZA 2C5SA 4AJKA 2FQ1A 1OV4A 2D5IA 2QLNA 4FYVA 3OP4A 2PUCA 1VIMA 5ECDA 5B7GA 3TF5A 4I3FA 4J1TC 5I7VA 4MK4A 1DE0A 4RENA 1E9SA 4AO8A 3RSGA 5AO9A 2V7GA 2W8BB 4HB4A 1MENA 2ST1A 3G3EA 3ZBTA 2PN1A 3ZE8A 4W6ZA 4JXXA 3PJDA 2Y1WA 2HO5A 1H1TA 3W5CA 1CD5A 2CL7X 4S1OA 5I6DA 2HC9A 4KX3A 2P65A 5AJVB 2ZRLA 3SJUA 2GN4A 2ODPA 3LS2A 4HGNA 4LE2A 4ZIRA 1D9XA 3ET4A 3GCGA 4QTYA 1LX7A 1K6IA 1A5BB 4XGKA 5I5GA 3ZGXA 4XGRA 4YNBA 3WO1A 1ZIOA 1QKKA 3WGZA 4RKRA 3RS9A 2G4CA 2WYWA 1Y6JA 2V45A 2C3UA 3IT1A 4RCZA 4B7CA 2OM6A 1RLMA 3LDHA 3AERB 5HUHA 1R1DA 4EPYA 2G88A 4L73A 3QFFA 3RUCA 3FTEA 1ND6A 4BDTA 4GZ5A 1M1UA 4LDRA 3OY2A 1P61B 1ZLYA 4LF6B 1E8NA 4JGGA 4RA9B 3LVBA 1WXXA 2CFCA 1HI9A 2Y27A 4ZVTA 7ADHA 4DUZB 5KC8A 2UKDA 3LXXA 1Z0KA 1CHNA 3U61B 3DL2A 1RBMA 3OWHA 2XDQA 1TVEA 4OMDA 2ORYA 2QI9C 4A0QA 1MB3A 1I0IA 2UDPA 3Q85A 5H4GA 2PEYA 3TLMA 3KT8A 1OV6A 5IDQA 3SSOA 3PQ2A 2N1MA 1PKEA 2AN3A 3M6IA 1UK8A 2G83A 1MLDA 2GX6A 2RAFA 1E66A 3CH7A 3DMDA 4HQOA 3K3PA 1K8XB 2FA9A 5KOYA 2EWMA 2RGWA 3LPCA 5CB6A 4TMFA 3RRYA 4CLOB 1YS9A 3N2NA 2HU8A 5DLQC 5J47A 4UTRA 1FUKA 2F3RA 3CFYA 4X3CA 1THZA 1ULZA 4YJ3B 1AVTA 5AOCA 5IKOA 4A23A 2O23A 1V1MB 3HB4X 5GGYA 1OD6A 3WL6A 5DN9A 1BEUB 2X5KO 3PDIA 1W36D 2CV0A 2WMYA 4MWZA 3DT6A 3ID6C 5D5HA 5HHTA 3LT1A 3IQXA 4J75A 1LK0A 1TEZA 1PNRA 2OM2A 3E9YA 2OSVA 1DBSA 4TSFA 1KO1A 3B2QA 2YL2A 2RCYA 3D6JA 3OOHA 4XSVA 1CWUA 1XAJA 1XZPA 1SQ0A 2OV8A 3A4YA 1EFTA 3BRQA 5F9HA 3ZZTA 2VJBA 2R60A 2PT6A 3DV0B 2E4WA 3Q87B 5KYUA 4WCFC 5DN6A 5F5XA 1RQPA 2VNIA 1ZMOA 3UT6A 3GLHE 2Z6QA 4XIFA 5IXYA 4ZT7A 3ICEA 1HL7A 1I1OA 4OXRA 5L40A 2ISSD 2JIQA 3DBLB 3MWKA 5D3QA 3O8QA 5D85A 3KKMA 2Z3VA 4MAFA 3IOYA 3OP1A 4WKGA 5K0NA 2VWHA 3V42A 1VYVA 4E5VA 2Q6VA 2BCEA 1A76A 3AZOA 4X64B 4B3XA 5KWVA 3Q0IA 3O90A 4FGZA 1SUSA 1OLUA 3MJHA 3QWAA 4D5EA 1AN9A 1IEQA 4MV4A 3RVNA 3ANTA 3ZU5A 2KLHA 4N8DA 2VDMB 3GLIB 2O2ZA 1CVRA 4FC6A 3Q7RA 1W0KD 3MIZA 1E2BA 2QRUA 5A9SB 4QT4A 1MQ8B 3ONEA 3O8LA 1DC8A 2NSDA 4RIGA 5ANRB 5J2UA 2XKKA 3C3YA 1OXMA 4HBGA 3H7IA 1IY1A 3DUFB 1ZOSA 2GEBA 1QQ6A 2VNKA 1MORA 3BA1A 3IODA 5DEOA 2VUSA 3BZUA 1DX6A 5CXXA 2CNWA 5AW5A 2WTBA 4PQYA 3R7SA 3V7FA 3VDQA 3DZDA 1V3VA 3C85A 4RHEA 3DZ8A 2HK7A 1U3GA 1Z7GA 2NM0A 3HDGA 1WMFA 2YICA 4OV6B 4Q4HB 3SXUB 4EJ0A 1ESCA 3VDMA 4IUYA 1UXJA 3KYDA 4KYTA 3NV9A 3UJCA 3PDHA 3PX2A 5LWQA 4NFSA 2XADA 4F04A 3LV8A 4B2YA 2VBGA 4NCIA 1R8YA 4UBIA 4O4HB 1T5OA 4H15A 2Y1LA 2UUOA 5CVDA 4J2HA 1NBMA 5DULA 4ND6A 3WXBA 1N6IA 4FFWA 4R41A 3Q88A 1ID8A 3OMWA 2ZSKA 3JZMA 2H9IA 3PXDA 5TV2A 3ZGZA 1DIOB 2ZVJA 2PU5A 4CKZA 1ULUA 2E21A 3G79A 5I8PA 1Y6FA 3QVJA 5ILOA 2GCIA 2TYSB 1MW9X 1OZHA 1Z25A 2LDBA 3M3DA 1BMTA 4HLQB 4P86A 1QWSA 2J5BA 2BPOA 3AFGA 3IULA 3OCYA 3HRIA 2Y99A 4KSBA 5CA1B 4O4IF 1D2GA 4FC7A 2H1OA 1QS0A 4YBZA 4GBGA 4K9QA 2DHEA 3LQRA 1GZHB 2JZNA 3IEKA 5FBQB 5K2MA 1W85B 1UODA 2DKFA 2P1DA 2VL7A 1Q7CA 8GPBA 1CBUA 1UM8A 1QAQA 3CH5A 3ENKA 4FYPA 2EG5A 1ORTA 2XOKA 4UM8B 3ZWKA 4KIUA 4G0WA 2IP4A 4S3MA 1CJCA 2JHGA 4GOJA 3M5PA 2WHXA 3MOGA 2LIPA 4MR8B 4B09A 1E79D 2JLCA 2C88A 1J9GA 5CG2A 1TYDE 2RGRA 3R5XA 2IZ0A 5JDCC 5TIIA 1RQNA 4U2BA 3E84A 1CUFA 4JJGA 5FLKA 3OU6A 2IS2A 5C34B 3O47A 3DKPA 4F93B 3OUTA 4Q03A 3E8MA 2D8AA 5FHRA 2K2WA 5CM8B 5F7JA 3AHEA 3P9SA 4OU5A 3M9XA 4UPVA 1BYIA 4LVNA 2XYHA 3WGKA 1KA9H 1RWNA 5TF0A 4M21A 1TLFA 2Q4DA 3LWDA 3L46A 1UF9A 3WOVA 3H4TA 1H0KA 2C1ZA 4NU8X 4ZIRB 4GPD1 3I5XA 2H31A 4J7UA 2KM1A 1UIRA 3M5DA 5ESRA 3V9AA 3VVMA 1UZMA 2ZI5A 1RIFA 3MG9A 2A9PA 4JASB 1UBOS 3W5DA 1G0NA 2AYYA 2QL6A 5IDWA 2O1SA 4YJFA 1ZD8A 3ZW8A 4EENA 1MJGM 1SQFA 3WFZA 4EM6A 4BFLA 2B8JA 3BQ9A 4R40A 1V25A 4L0CA 4CIDA 3FDZB 4LWZA 1G4AE 1G5IA 3O82A 1TGYA 5LU8A 3B7WA 3QLJA 4D9BA 4RA9A 3PQ7A 4RJ2A 1SBQA 4YJ2B 3GCZA 1EK2A 3AM3A 4CMEC 3H13A 1P44A 2YYYA 2VSFA 4F5ZA 1TKRA 2Y0CA 1R4ZA 1WD5A 2PKQO 4JQYA 4IBOA 1HQKA 4KACA 5TMDA 5ADHA 3ILVA 5LXTA 2KB0A 2Z83A 1IB6A 5EZSA 1KEZA 4I6JA 2Z04A 4O2BB 4QICA 5GADl 5FNVF 5B5SA 1YR9A 1DKOA 1EQAA 2G8NA 3BERA 4HDQB 1MJNA 4UNPA 1L7VC 1YCGA 2J9FA 5CFZA 1RLJA 5IFLA 2J0EA 4XE5A 4D9KA 5DBOA 3SEFA 5K8JB 1JT2A 3O7MA 4QYMA 2ATCA 4I3HA 2GB4A 4BB0A 4B31A 1BMDA 2BEVA 3SZGA 5TLSA 1WY7A 4U2KA 5JZ9A 4BIMA 3BWDD 4ZU1X 4WV3A 1AMOA 2FWPA 2NW6A 3I9OA 2EBHX 3RT7A 1MHPA 4D9HA 1JR3E 1Z0UA 2X0IA 3L6EA 4XUDA 2H1RA 3U7QB 3WRYC 3L0OA 1GAEO 1Z29A 2CNKA 4B2IA 4LJKA 3KR9A 1AM4D 4ZI7A 2RAPA 3VR1A 2QTNA 3NHYA 4MQMA 4NBUA 2WJYA 1OTHA 3B8EA 3ORSA 5J5AA 4AIRA 2VTBB 2M6SA 4HYEA 3DLPX 2IIVA 3H1GA 1EFAA 3C7AA 2Q3CA 4LWPA 4EW3A 1E3LA 4M4SA 4Q7MB 3AF4A 4MKGA 4DR2B 4EUFA 5FFNA 2W70A 2W6MA 1PTKA 4PTLA 3SAJA 4FIDA 4Q18A 5FWDA 3HKDB 4M7RA 3KQLA 3IMEA 2HUPA 4H4DA 4UOEA 5KOIA 4ALMA 2QGFA 4J0IA 3KAJA 3DBOB 3I2FA 5FTWA 1NQWA 5EPOA 1A2BA 3KDSE 4B3MB 2VA9A 4RVGA 2YVQA 2C9MA 3NTVA 1YC5A 4Z3OA 5P8WA 1SVWA 3QU5A 4KRGA 1FP4B 1L5KA 2ZZMA 3BKXA 4WRRA 3U7RA 3SHVA 3EC1A 2MIIA 2GZ2A 4GMGA 2BCJQ 5CHYA 4H3SA 3IVGA 1KDTA 1MHTA 2RCNA 3IDSA 4RA6B 4PGHA 3BREA 2EP8A 3GLKA 5DHUA 3KHUA 1NQOA 3TEFA 3GBVA 4OOEA 4X8LA 4XVCA 4HS9A 1OWOA 2IK8A 4L9AA 5ECWA 2Q3MA 3ZCPA 4RTQA 3EVZA 1LBHA 1ZCJA 2HX1A 3QOWA 5F5LA 1KGSA 2EBWA 3P5BA 3EIEA 2BEWB 1CUHA 3ROGA 4PYQA 2I33A 1MAHA 1KEEA 2XW6A 3GGJA 3LJKA 2GLTA 2AJ8A 3DE7X 2LPMA 1WX1A 1P4GA 4XCXA 4S1NA 1N3IA 3LPLA 3WISA 1EFCA 1NFRA 4MVJF 4BRUA 3DDOA 4ZCPA 4MQ6A 5KJEA 4EFLA 3DE4X 3THYA 2SCUA 3R6TA 4BQEA 4DR3B 1NJ5A 4MROA 2H9YA 3FYHA 3EJ6A 1D5WA 2VK8A 3R0VA 3QSYA 1I10A 1XDZA 1CQPA 1ZU4A 4G41A 1JQBA 3RYCB 2UZ1A 1DBVO 1T8WA 1YBAA 3OECA 3IBYA 4HH0A 4JOSA 4B6FA 3C5EA 1P1IA 1J8YF 4GVXA 2ISQA 3FCXA 4IOLA 4ALLA 5BPFA 2I3ZA 3DPIA 2NAFA 4B79A 2HLPA 4K6CA 5D3MB 3PC8C 4WZ6A 2GDZA 1ZIYA 3BZWA 3A4NA 3ADCA 4DUYB 3OJEA 4QXRA 2EAUA 1V41E 2OHIA 3OA2A 1U4SA 3ONFA 4B87A 4D79A 1ZJYA 4AZ3A 2BDTA 2IEDA 2R25B 2EXXA 2JATA 3PVZA 1M8FA 1FUUA 1ZM9A 3D64A 4G86A 4UW9A 3KOWA 2F3PA 3HCCA 3I09A 3MCWA 1R8SA 2CXSA 4XX1A 1IEXA 5HP4A 3JYPA 1QRSA 3FTDA 4XD7A 2VHQA 4JYCA 4ER5A 1YUBA 5ELMA 3WIBA 2EDCA 1M2OA 3IGFA 3UMJA 5JMOA 3TOSA 2RG7A 1VCHA 3RC1A 1BH2A 2D1SA 1WLYA 1RQXA 1DMRA 3JQPA 3SBEA 2P2ZA 3IUNA 1NXWA 4X7BA 1KSHA 4ZV7A 2FF5A 5IWCA 4GMDA 2PZJA 3LQKA 1T5HX 2VLBA 3TK1A 4AICA 1XHLA 2J0UB 2HSEA 4MP6A 4JQCA 4WINA 1K7SN 4OUDA 4QAQA 3IT0A 4I9UA 4W63A 1BO6A 4F3RA 4F5YA 3ZHBA 4MHTA 1VLZA 4S0XA 4IS2A 4BNJA 5J4KA 1L7MA 2ASVA 2QTGA 2AG6A 2M6LA 1LPSA 3VR0A 3TG8A 3H6GA 5EA2A 3GEHA 1JHOA 1Q7RA 3GUVA 4KPGA 4GMXA 1Z8NA 1IXSB 4A6PA 1JWAB 3GRUA 2WYHA 4EHKA 3D9QX 1BJRE 1T43A 1Z37A 3RB8A 2VS1A 3ROEA 1XB2A 3RS5A 3CVUA 4H08A 2E5LB 3P0FA 4GIBA 2R96A 2WV7A 5FLXA 4O6VA 3T1VA 4Q7QA 4FNGA 1R10A 1K7EB 1J7KA 4NJEA 3EQ7A 3KOUA 4KBFA 1OLSB 1SB8A 3C7KA 3N39C 4HI0E 2NN3C 1L4FA 2CZCA 1WMSA 3FDZA 4MAMA 5L45A 4PLGA 1ZVMA 4AJLA 1PJAA 1ZG3A 5BV2P 2JLUA 3BAFA 3P5SA 4EJSC 2ESRA 4MR9A 2MOKA 4ZQIA 2ZJ6A 3SIWA 3PKZA 3WYBA 1NQTA 2AJTA 1HTBA 2DBZA 3C74A 1R0KA 4M1MA 2XQFA 2OCLA 2CHVA 2E9SA 3H1AA 4PBSA 5FYQA 3FE2A 2IQ5A 1PZGA 5JSZB 2QDKA 4UJ5A 3SQXA 2YYZA 4C5CA 2Q5IA 4R98A 4TL9A 1VG0B 2YV1A 3B5IA 4JUDX 4BJHB 4JNCA 3FGPA 3GJ6A 1QX4A 1GRQA 2E5WA 2HZBA 2XLCA 3OFJA 2IUUA 1Y63A 3DMTC 3NUGA 3ZDFA 4RIFA 1HDXA 3LYLA 2HUNA 2WJJA 2QN2A 2HSZA 3FMOB 1I5OA 5EYPB 2TRSB 3ROQA 5TXGA 4BN4A 4CMBA 4YCAA 3BSFA 2IH5A 2VIIA 2O48X 1FX0B 1H05A 4HQLA 2NT3A 1SVLA 2IYRA 3PXAA 5IVPA 2IFTA 4YCJA 3JVVA 4BS9A 3N8NA 2BFFA 2HI0A 2MCFA 1VYUA 5E6UA 2W8BA 2ZYUX 3RS2A 4GXTA 4WBNB 4RTLA 2AJLI 1DUSA 3M6UA 5AFSA 1RCTE 1KE2A 1KS9A 2GFIA 3QU7A 4CODB 2V7WA 4B3SB 1MC4A 1M7HA 4QFDA 2JAQA 3EX7C 1T1JA 3IBTA 3UWPA 2GRJA 1NI5A 2ZFUA 3G9UA 4TQ9A 3VO8A 1WDMA 2AOTA 4XWAA 4YIKA 5A04A 3P27A 1XYYA 2YJ3A 5EKDA 2WM8A 5KPDA 3WL4A 1OGIA 5FA5A 4CL2A 2XE7A 1NN3A 1E1QA 1TCVA 1JHVA 3TMKA 2WF7A 1N1GA 1DFGA 1YMQA 3HKEB 3HA7A 4KLRA 4RZUA 3WYEA 4E2ZA 2P9YA 2PZGA 1FLDA 1U6JA 2BTEA 2AFIA 1H23A 1XMVA 2FYTA 2I87A 3CJQA 3E70C 1FP4A 3AEKA 4IDGA 5HG0A 3TL6A 3BTOA 3EUWA 3P0JA 3HC7A 1WZ2A 1OJ7A 3TQCA 3IE1A 3R5TA 3DEKA 2WEKA 4WNAA 3GELA 4Y6RA 5HM6A 3L8HA 1ZXLA 1NIPA 4HAIA 4PRZA 4II2A 1I5EA 1XD2B 2CLMB 4GR4A 5C81A 4DLKA 5CK4A 4J0QA 5K99A 1JH9A 1DI0A 4KR9A 3H97A 4Q3DA 3BWBA 1SQSA 1TB4A 2XA1A 3WA6A 1L5RA 3UMCA 2WTXA 1GL9B 1IN5A 1TU3A 1L5YA 2X4LA 5KTTA 1L0BA 4Y6OA 4Q05A 3LL7A 4OSOA 1PZMA 1KZ7B 1Z2DA 3QG5A 1DAIA 2GXSA 2QZ9A 3ETLA 1S3IA 2C77A 4G0VA 1PWEA 1US8B 3RLFA 1FUYB 4EUNA 4JYPA 4PAWA 1B8NA 3FHJA 1Z56C 2BIFA 1Y8AA 1H66A 3M82A 4MV1A 4X20A 1SXJE 2ZUDA 3C70A 1LLUA 1Z5WA 4AG5A 1NLZA 2EERA 1M1XB 4FJ1A 5CX1A 3BMXA 5JS1A 5J4VA 3JD2A 1ZEMA 2VK1A 5CYOA 4D0GA 1NKTA 3O31A 3D1JA 5HZHA 4MYTA 4TTVA 4YCDA 3KSRA 4B7UA 4QFCA 3PT9A 5ADWA 1ABBA 1KSFX 1P0MA 2C2XA 2PVCA 3OOYA 3INNA 2CXTA 2RH4A 5HE9A 1YK0A 2Q5OA 3OJCA 4PAGA 4D2IA 3OZSA 4UTVA 2D13A 4XFJA 5HIJA 3RRNA 1D04A 2H18A 3IMKA 1GT91 2AH5A 3UT0A 1V9LA 5JNVA 3A1TA 1JFFA 2OEPA 4Z1MD 1NVTA 2XTAA 4E11A 2FMKA 3DOEA 3GZNA 2PD6A 3PEVA 3Q12A 5CYFA 4CT4B 5JC8A 4W6QA 1EESA 1GUDA 2UXCB 3AF2A 4HYYA 4EDFA 4MO2A 5E0KB 2FPIA 1D2NA 3PPVA 4I8IA 3RRZA 3UUFA 2F59A 4IM7A 1LRKA 1PT8A 4I19A 2OKGA 3VVBA 3KU4A 1JXAA 4FZJA 1BOOA 4HNRA 4OLAA 1QK4A 5BO5A 1GCAA 1GTZA 3KVRA 4KBYA 3G5AA 4PR3A 4EP1A 4R71A 5AICA 3W2IA 3H18A 1YBFA 4GI7A 1H6AA 4ROTA 3K0HA 3IB3A 2X0FA 1CUZA 1HFWA 4YAEA 2BHRA 3LGSA 1SC4A 2WIAA 5KNDH 3TW8A 5DXJA 1KBQA 4MW0A 3RNOA 4E94A 4FPXA 2R6FA 1NYTA 3KYDB 4EQZA 2FDCA 3IP9A 4OG2A 1MAAA 4BO4A 1MO3A 1NXTA 5CW2A 4DJ5X 2XV1A 4XD7D 5B1SA 3MAJA 5JH7A 3RFFA 5ICFA 1AHHA 1BHSA 1Q1AA 1QVVA 2EKBA 4OYHA 1G2OA 1W52X 4BJ6A 4CLDA 3BGVA 4BNGA 5LU9A 1X2EA 1QVZA 4LJAA 4C4ZA 4ZVQA 5FBRB 4B3CA 3EN0A 1T24A 5K3EA 1ZC3A 4REOA 2NVWA 3PE3A 2W2MA 4LPSA 4FJ0A 2BFBB 2QL7A 1NSYA 2DHDA 1IAQA 3MTEA 3ORHA 3H0CA 4C7OA 3DOUA 2JFWA 3H04A 1DXYA 4HLNA 4Y7DA 3RTAA 4CTNA 5HKKA 3BTUA 2FSPA 3FBWA 4E3ZA 4WK2B 3LW7A 2UYQA 3GMIA 3GUZA 3H6HA 3KLOA 4JX9A 5DHPA 1HBJA 5IVKA 1PR6A 2UVPA 2FPPB 1Y8RA 3I92A 1H9AA 2XGJA 4NVRA 2HWYA 1C3XA 1OXVA 2AR0A 4GBMA 3BKWA 3L8FA 3CZCA 4OKSA 3SF8B 2ALJA 4IQ0A 1JSCA 1DPFA 1NX9A 1X87A 2HA4A 3GJXC 4TOIA 1C8LA 4W9MC 1IM8A 3GEPA 4KLCA 3CVWA 3UKJA 1ABFA 4KSYA 1O96A 4YDRA 4ASUA 3OG9A 1IOVA 4HP8A 4RHYA 3TXYA 1NNEA 2GT1A 4MW7A 1VYTA 2JI7A 3EUAA 3HU2A 5IC6A 1VZ2A 1ZBQA 4P0TA 1SZDA 3ISTA 1EUQA 1XMIA 2JLSA 2ZTVA 3AJ8A 5DP2A 2B5WA 1W94A 1C9KA 3EASA 4LNUB 3JQBC 4Z4CA 3W5SA 3ZIUA 4Q4HA 3OHPA 1A7AA 2BLLA 4HH4A 4LGMA 1ISSA 1TL7C 3R23A 3TIGA 5AW4A 5KQLA 1EFKA 1GY8A 1X1AA 4J1NA 3E22A 3PKIA 2QRQA 2ZREA 3WRVA 3IALA 4J90A 4DJJA 4O2AB 2TMGA 5IJ9A 2NSLA 1BU5A 1IG3A 4P54A 2AIRA 3KWJA 4KC0A 1UFQA 1UANA 1XFDA 3AKDA 3OPYA 1RXYA 4IQ8A 4LVUA 4WPGA 1QPGA 2GN6A 4KAJA 4KAXA 3HU3A 4LTNA 1RIIA 3FN4A 3M6MD 4BAGA 4YMGA 1JKJA 1Z28A 2PKWA 3EVNA 4LZWA 1KI4A 2IS6A 3ST7A 1ZD9A 1FFHA 2REQB 1L8OA 3KO8A 1GGFA 4WK0B 3RSFA 4HBZA 3T9CA 2YXEA 1W4BA 3IVCA 2J46A 4X1KA 3Q8MA 2FFHA 3MT8A 3RYTC 2H85A 1BHO1 2B4KA 2WSLA 2XJ9A 2IEAA 5BUQA 5TMPA 1VL5A 2F9LA 3WWEA 4Q3EA 3OTWA 4YRDA 2NU6A 2GKOA 1W85A 1Q57A 3TX6A 1T2UA 4FB5A 1CR6A 2XZTA 3VC2A 1L5HB 1NBIA 4P5EA 1G21B 2J07A 2QSZA 3BFXA 4BV8A 2VJDA 1YNOA 3BD7A 1I32A 2CZGA 2C4UA 2CYAA 2BM0A 1JEQB 3DEZA 2CBXA 4WBXC 1BFDA 4IHJF 3IT2A 5FPYA 1YR8A 3FYCA 3ND6A 4JEMA 2JFZA 1VE6A 5CLIA 1XA3A 5JC1A 3A9WA 2X19A 3A6LA 4AYTA 2YHBA 3UN1A 4FFPA 3VX4A 2I1QA 3DFMA 5A5FA 1ORDA 2H92A 3BF8A 4FWTA 3KZCA 4QQFA 3EXFB 3FZQA 1J2EA 1T2CA 3L6BA 2UV8A 2E7ZA 4UZEA 5HIKA 5FBLB 5HFAA 2DQSA 4L57A 1OH7A 1SOVA 2YNMC 3NIFB 4FEGA 4PG6A 2V7UA 3ZI0A 1SCUB 2CCKA 2QK4A 1CHDA 4I6EA 5BR8B 1FB5A 4IDAA 5ALKA 3KLMX 1Z0JA 3R7WB 1XQWA 3UPUA 2G1UA 2JRLA 1W5SA 1H9CA 1YR7A 4OCZA 4IUBS 4D46A 5J2UF 3TZHA 2A0FA 1TQ8A 4XM1A 4X1YA 5EFOA 1LZLA 2B2NA 4FUQA 2HRCA 5K03A 5FV7A 3BULA 3LHIA 1IDOA 2GKSA 4AT1A 2BMWA 2I4OA 2QQEA 5C7YA 1UBHS 4B9EA 3Q1KA 4N0EA 3WHLA 5F51A 2EATA 3B7PA 4HGZA 4MV0A 2Y1OA 4B84A 5CFMA 4ZQGA 1VKNA 2G36A 1SXQA 3QVGA 2X2PA 2GVZC 3A2LA 2WMNB 1XMOB 3NU1A 4UE3S 5HUQA 2VAWA 3NGLA 4HUJA 1DZ3A 1I4OA 2XQVA 2Z5LA 3ED1A 4QTXA 3ZH9B 4E2FA 3CRVA 3HCOA 3ZY2A 3GFGA 3QE3A 4ZHQF 1ST2A 4KR2A 2HLNA 1L7NA 4J0KA 2WHEA 1IMOA 1W75A 2W6ID 4LNUA 3ZDYB 1Q7TA 5KQMA 3ZDCA 3GCDA 2UYOA 4NWIA 1YQQA 3SE7A 3NHSA 1UPBA 2NIPA 1KOGA 4X7MA 3N86A 3VAZA 1ZH6A 4PGAA 2X86A 1BU8A 4XYMA 2JJMA 3C97A 3HUUA 4B3RB 2ZIAA 4D45A 4GG1A 3RGWS 1RRGA 4G37A 3CO5A 4I1OA 5E9WA 1SN7A 5C1BA 3ND8A 3TVYA 1PQYA 1QFYA 3QOFA 4J49A 3UGKA 4ENPA 5JFGA 1QLWA 5I9MA 5A7GA 3WBJA 5C3MA 1GNQA 1L6IA 1K7XB 3GGDA 5F73A 5K0BA 4PC3A 4P9NA 4Q5IA 4B82A 1N2HA 2Z8XA 1T9KA 3G0DA 1I4EB 3L07A 4B46A 3R7BA 7MHTA 3GT7A 4IH4A 2Y66A 4X1IB 3KUXA 1MVNA 3SR3A 2NO1A 1GPBA 3E1SA 4IMPA 4MWEA 5EWMA 3AY3A 3PHLA 4DC0A 5H80A 3U81A 3OZTA 2GO7A 2NUBA 2WU8A 5CNMA 2WSIA 3OAAA 4Y9TA 4YJFB 4B34A 4BMDA 3GN2A 4KXMA 5L4NA 4RJTA 1L4YA 4EKIA 8AT1A 1VCNA 1X7YB 2RG1A 3CQ9A 4YPVA 3B2NA 2B0CA 5IT0A 1MPXA 1N7JA 5DYNA 3FUVA 4YUAA 2BC9A 4BMNA 5DCWA 2OHVA 3K9GA 1OW3B 1LNSA 3UMSA 2MYPA 4C30A 3DKVA 3ZGNA 2ZDGA 1TQ6A 1Y4ZA 4MVCA 1DFIA 1JS1X 1LPAB 3FPFA 4NZOA 5F1OA 3ZBQA 2ZROA 2RC6A<