3IQDB

Structure of octopine-dehydrogenase in complex with nadh and agmatine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
403
structure length
403
Chain Sequence
b'TVKVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFADEAERWTKALGADELTVIVNEKDGTQTEVKSRPKVITKDPEIAISGADVVILTVPAFAHEGYFQAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLGTKSVLAASLIKGTAKTVDPLSTLQMLHGAEPVFRLAKHFLEMLIMSYSFVHPAILFGRWGSWDGKPVPEAPLFYQGIDQATADMLTACSNECKDVANAIMAACPGNDLSDDKDIYQWYLEYYHEDIQDDHDLYHAITTNKSYKGLVHPVKAVDAGVAPDFGNRYLTEDIPMGMIVFKGVAIAAGVAIPSNDKLIMWAQEKIGKEYLVDGALTGKDVATTRCPQRYGFNTLDAILTGKKHHHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Octopine dehydrogenase
publication title Insights into the mechanism of ligand binding to octopine dehydrogenase from Pecten maximus by NMR and crystallography
pubmed doi rcsb
source organism Pecten maximus
molecule tags Oxidoreductase
total genus 121
structure length 403
sequence length 403
ec nomenclature ec 1.5.1.11: D-octopine dehydrogenase.
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02317 Octopine_DH NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3iqdB02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3iqdB01
4KZPA 4BNLA 3RUFA 3NDJA 1PWXA 1NX6A 5JAIA 2VHXA 3AUTA 2I76A 4MP8A 2NVUA 2VYVA 3FBTA 3F3SA 3V5NA 1U8FO 4AG3A 5GZ1A 1XELA 2NU8A 3GT0A 3GN2A 5KCZA 3L6EA 4QSMA 4UULA 1E1NA 3D5TA 1F06A 6LDHA 2B4TO 3IP1A 5IN4A 1DC3A 1B8VA 1RPNA 1M6WA 2A9FA 1N7HA 2OP0A 3UUWA 3DZGA 4OSOA 3UF0A 4WASA 3QVTA 1DFGA 5TSDA 3Q9UA 1WP4A 1KC1A 4DUPA 3IAHA 3VZSA 1YQDA 4D41A 3EZYA 3RCBA 5BQFA 5FI3A 3KSDO 4J7UA 3AI3A 4BV8A 2W98A 5TF4A 3WG9A 1CETA 1H0KA 2FWMX 3JQAD 1E6EA 1LEHA 4R54A 1NYTA 1PSDA 5F3RA 2IYOA 1X0VA 3I6QA 4ND2A 4CR6A 5B4TA 1U2DA 3FNGA 4BO1A 2AEJA 3MEQA 1GUYA 4PVCA 2CVQA 2NADA 5G4KA 4FDAA 1BVUA 4EJ0A 3KYDA 4OSPA 1MG0A 1TVEA 3PDUA 1Y7TA 4PRLA 2PKQO 3GOHA 4DA9A 3A4VA 2QRJA 2BHLA 1OBFO 1Q7CA 1DRUA 3FTPA 5DN9A 1ZK1A 4YAIA 4YAEA 1E3EA 3IQDB 1QORA 1DFIA 4NH4A 1E3WA 3RC7A 3VVCA 3M6IA 3FNEA 4CMEC 1WLYA 3R0IA 4ZRMA 2CMDA 1K89A 4ITUA 1NASA 3DAFA 4BL5A 2Y1DA 4MKZA 1NHGA 4YJHA 3IOYA 1FF9A 1PGQA 4FOOA 4D3SA 1C0PA 5JDIC 4W9NC 3VZQA 3G17A 2Q2WA 1BW9A 1ZK2A 3KEOA 4XGNA 4YACA 3ZWVA 5KVSA 4HBGA 4UVDA 3G79A 2EKLA 1T1RA 2B5WA 3AY3A 4M55A 4RVGA 3MTJA 3Q6IA 3GVHA 4DBVO 3JQGA 1PJ2A 2IDZA 2DPGA 3BMQB 2GASA 2P9EA 2VYND 4BO6A 4J43A 3BAZA 3JQ7B 4JK3A 3CZRA 3K9QO 3HDYA 4JROA 1YVEI 5DCUA 3N58A 3L4BC 1QRRA 4L76A 4PZEA 4B79A 1OAAA 5I7VA 4GWKA 4PLTA 4OO3A 2ZK7A 3CMCO 3E8XA 1TT7A 4B8ZA 3DFUA 3ETEA 3NEPX 5JYEA 1Y8RB 2FZWA 2DBRA 1P31A 2ZCUA 3OJLA 1HXHA 5I9MA 3CINA 4HFRA 5TT0A 4ND5A 4YDRA 5DCYA 3WYBA 3S2FA 1LRKA 4CQMD 4KP7A 4HY3A 1XLTA 3DAGA 1RYDA 4HP8A 5ES3A 3WJAA 2HRBA 1CQIA 1P3DA 4INAA 3TN7A 3COSA 1TLTA 4GVLA 3NTRA 3K5PA 5I7EA 5CDYA 1LSUA 1T24A 1DHTA 4DQXA 1LJ8A 2CY0A 3PHIA 4NBRA 5EMHA 3QQPA 3WOHA 3D3WA 1Z7BA 1FDUA 4NFYA 4W7HA 3U0BA 4PG5A 3Q9NA 2HMSA 2EEZA 3L4SO 4I1IA 1JU9A 3FTNA 1UH5A 2FZEA 1WZEA 2HQ1A 3GZ4A 4AJKA 1I33A 4YJDA 3TL2A 1F0YA 4NFSA 1B7GO 4CM4A 1GZ3A 2F00A 4BNXA 2H63A 4GMGA 4Q39A 3P7MA 4P22A 3Q3CA 4DBZA 1PGNA 1KEPA 3H6KA 3L9WA 4I5EA 4BNWA 4CLRA 4BQRA 4J1SA 3HDHA 3K92A 4ALKA 5EQFA 5F5LA 3WWYA 2F1KA 4AVYA 1P1FA 1Y6JA 2NQTA 3S2IA 2G17A 5FFFA 1WPQA 4YJGB 4M87A 1TEHA 3I5MA 1V3TA 4N5NA 1LDBA 4IXWA 1J6UA 5L7YA 3V8BA 3JV7A 3PIIA 5EESA 3L6DA 1CJCA 2CF6A 3PPIA 5ER6A 5HTOA 1DJNA 1ADBA 3NTOA 2R6JA 1OZAA 2VHZA 1ZIDA 3I3OA 4J2HA 1IOLA 4O1MA 4U6QA 4NBTA 3KOUA 4R1NA 1DC6A 1EQUA 3A28A 2ZCVA 5JMWA 3DTTA 1YONA 4GKVA 3H8VA 4NBUA 1HEUA 3CZMA 4IBOA 4BV9A 3QE3A 3EVTA 4QFCA 4CUKA 2BMAA 2G82A 2JFFA 1JLLA 2VWHA 2RBEA 5C7LO 1WZIA 1PGPA 1O9BA 3T4EA 4E31A 5ICMA 2WWRA 2QRKA 3ZV6A 1PTJA 4BKQA 2P4HX 3C85A 4II2A 2GRAA 2X9VA 3EUWA 3VTZA 3WB9A 2NACA 4TRNA 4HNHA 2NUAA 3ZHZA 2WSBA 4PFJA 4IJKA 3U4DA 3X2EA 3PHLA 1Q0HA 3ZW9A 4Q3DA 4BO9A 4YAGA 3ANMA 1MGOA 4LMPA 4MIYA 1C0KA 1NFFA 4NJMA 3RFVA 2J3HA 3KYCB 1C0IA 4E12A 4G65A 4D44A 3M1AA 4QX6A 4WNIA 1BSVA 2ZQZA 3RU7A 1EDZA 5L4LA 3JQCA 2BGMA 1GQQA 2DU8A 4LRTB 3HDJA 5DDIP 2WD8A 1CYDA 2PZMA 4JJGA 1YOVA 4IUYA 4YYZA 3E9MA 1T2AA 4KUHA 3NJ4A 5A4DA 2J3JA 4JP3A 1P1KA 3SLGA 1CDOA 4P38A 4CUZA 1ML3A 1AHHA 1M75A 1GCUA 4E13A 4YT5A 3ZU3A 5KNLA 4NK5A 2RAFA 3T4XA 5JBIA 5HWSA 4TKMA 2J8ZA 3H5RA 3F1KA 1KEWA 2X23A 3OJOA 4JJIA 3RBXA 1YS4A 1AXEA 2NNLD 3O26A 4J4TA 4RQUA 4XQEA 2Y68A 5JAMA 1KETA 1XQ1A 1QG6A 3DONA 2BH9A 3CXRA 1JDJA 3I23A 3DHNA 4BGIA 4PRKA 4YBZA 4WE3A 2Y1GA 3H9QA 4UAGA 4W6ZA 3P2OA 3FNFA 1E3WB 4LVCA 1K2WA 4W82A 2IODA 3NUGA 1IYZA 2I66A 3ETDA 3FN4A 4CLOA 3TZKA 2ZATA 4IS3A 4YJHB 5JDCA 2B36A 2WE7A 2NSDA 4L8VA 4BB5A 3GPDG 4E3ZA 5EN4A 1XKQA 1GQYA 3WQQA 1NXQA 4XZ3A 4GKBA 3TRIA 2Q1UA 4AJIA 4W7IA 3OM9A 5JDCC 3ASVA 3ZW8A 3L6OO 5L9AA 1NWCA 3QVXA 3D4NA 1I24A 4MVJG 1IHYA 1Y8QA 3NT5A 3GY0A 4H15A 1CIVA 3JQBA 3ZWOA 4CLEA 8ADHA 4RPLA 5L53A 3TZQA 5JS6A 2VN8A 3GNTA 4WNCA 1E7QA 3GZNA 5JO0A 3O8QB 1B8UA 1EFLA 1P1HA 4MVJI 2HMWA 1LRJA 2PGJA 4R1SA 3NDRA 3DOCA 3NJ8A 2HJRA 1XR3A 4YQZA 2AEMA 3RFTA 3PYXA 1PS0A 3DOJA 3MWDB 3E5MA 1N9GB 4IY1A 5DT9A 2Y99A 2X0JA 3BXXA 4XGKA 3U4IA 4DRYA 1KVSA 1R0SA 4J4HA 2V7PA 1C1DB 4FJ2A 2ZTLA 2B83A 1ONPA 1IL0A 2ZTMA 3TWOA 2O2SA 1QLJA 4YWJA 4KTTE 3VPFA 3TDKA 4XB2A 3QWBA 4MINA 1F14A 2XXJA 2X4GA 3I52A 3IMFA 1A71A 4AJ4A 2O48X 4LMRA 4H16A 4IPTA 1UXIA 2Q1SA 2VRCD 2NU6A 5DP1A 5T8KA 4DYDA 2OOSA 3H2SA 1R0KA 3NDIA 2I5PO 2YHIB 3UICA 4RQTA 5DP2A 4WEOA 4Y9DA 3PYMA 1Z73A 4IQ0A 3RKRA 5TQVA 5BSEA 4DTIA 1ZSYA 1SBYA 1WDMA 5COQA 3UOGA 3V2GA 1EK6A 3F9IA 4CLHA 1PJBA 4YAKA 2B37A 2BGLA 1B15A 1LX6A 1R37A 3KZVA 5EIOA 2X86A 1T2FA 3UGKA 4CM4B 2J3IA 1PZFA 3Q2KA 1B8PA 2X5OA 4IDFA 1VL0A 5U9CA 1HZZA 3H3FA 2VHVA 5JYDA 5A9TA 1DIBA 4CLRB 2ZTUA 1T25A 2EW2A 3GFGA 5U1PA 4WCFB 1GADO 3A9WA 1KEVA 3ROPA 3JQ9A 3D4OA 4EITA 2V65A 5BNTA 2A94A 4IZHA 5HS6A 3RROA 4A03A 2YV3A 1O6ZA 1E0DA 2NU9A 4A0SA 1DB3A 4GVXA 1XG5A 5A9RA 3SBOA 4E2ZA 3JQ9C 3K30A 5CPFA 4HKTA 5G2OA 2ILTA 3DBVO 3NTQA 3S55A 4ALNA 2HO5A 4UVHA 4KDFA 1KERA 4RZHA 4OKIA 3V2HA 2DT5A 4CODB 4XQCA 4KUEA 4MP3A 2PKRA 1BXZA 3HNPA 3I1JA 2VZ8A 3PJFA 4LGVA 5KVVA 5ENDA 3W1VA 3WR5A 1JKJA 1GV1A 1TB4A 4TRMA 3TF5A 4KUGA 1V3VA 1V9LA 2HKIA 2QX7A 3HE3A 4HX5A 4UVEA 2POQX 8LDHA 5I9NA 2BLLA 4EJMA 3QW2A 2FPGA 1UUFA 1L7EA 1T2CA 1V6AA 4OH1A 3E1KA 2J5RA 1I10A 4OGWA 1LLQA 4R9SA 2G0TA 2XF8A 3O9ZA 4R41A 3DZFA 3TSCA 3PHGA 1HDYA 2RHCA 4N18A 4UVIA 3WYEA 2W2LA 5EL0A 3DBRB 4CL3A 1ZK4A 1UP7A 3RVDA 3WFIA 2B35A 1YL5A 3BTOA 5KJ1A 4J0EA 3EYWA 5L45A 1Y81A 3VPXA 1C1XB 2UAGA 1NVTA 2R00A 4YJFA 4CMIA 2JCVA 3DMYA 1L1FA 1TA4A 4B3JA 5MDHA 3CMMA 3FWNA 3OH8A 1A4UA 1KY4A 1LC3A 3ONFA 1K6IA 2B69A 1FJHA 3GVXA 1EUCA 3HQ4O 2OP1A 4MKRA 7ADHA 1EVJA 1VC2A 4EEZA 2ZJ0A 4FFLA 4DYVA 2O7SA 2C0CA 5DOZA 3VH4A 3AOGA 4RVHA 1HT0A 4FBGA 2IZ1A 2RH8A 2DTDA 1P44A 1WAMA 3Q2IA 4LN1A 4M54A 4PCVA 4DC0A 3JQAA 4MVJP 3LC1O 5KWEA 4IDBA 2VT2A 2P9GA 1V8BA 1VJTA 3EY4A 3JQEA 4RVDA 1PJQA 1OOEA 4DQUA 2PY6A 4RZIA 1HE4A 3VTFA 3H65A 3E03A 3E18A 1LRLA 4RDIA 1AN9A 4BMNA 3H4VA 3TL3A 5CG2A 1IPEA 4YR9A 2QYTA 4PLPA 4CPDA 5CG1A 2H9IA 1NPDA 5A5EA 1P74A 4FFOA 3B20A 4ND1A 2O2YA 5CEFA 3F6YA 3VDQA 3ZWPA 1JQBA 4P4GA 1PZHA 1QR6A 4QT0A 4NQZA 2FOIA 4BNHA 4JGBA 1CRWG 1IPFA 3ONDA 2Q1WA 5A9SB 2D0IA 1KY5A 3H5AA 5F21A 3E6AA 4XYGA 2BRUA 2OUIA 3GMDA 1XIVA 2Z5LA 2FR8A 4R1UA 1ZBQA 3CPSA 4FGWA 2WJPA 1P45A 3HFGA 3WXBA 4B3IA 4D43A 1M66A 1K6JA 3BHJA 1YGYA 1RKXA 1SZJG 1Y8QB 2CFCA 1A5ZA 3DBLA 3DTYA 1NNUA 1B14A 2UDPA 3HZZA 3H9GA 4K6CA 2YW9A 2W8ZA 3KSZO 1BXGA 3MTGA 4LK3A 1GEEA 3D0OA 3WGIA 3RSHA 4BNYA 2PH3A 3U3XA 4FQ8A 4ZHSA 2VYNA 2BFMA 1YJ8A 3DMTA 3ULKA 1P1JA 5DULA 1DRVA 1LDMA 4BNTA 4E5NA 2GO1A 1R15A 2YDXA 1U7HA 2YV2A 4TMFA 4OHUA 5T5QA 1LSSA 1E92A 3QVSA 4UREA 2EKQA 4XRRA 3MJCA 1LI4A 1YJQA 3EAGA 2JKVA 2IEBA 3Q1LA 2Y93A 3OHSX 1EVIA 4CUJA 3C7CB 3LT2A 2YJZA 3E48A 3LT4A 1HLDA 2VTDA 4CMAA 1ZH8A 2JJYA 2X0RA 3QP9A 2B5VA 3FPCA 3GAZA 3UCFA 1N1EA 1SB8A 3JYPA 3MJSA 2Y66A 3PQDA 3TZHA 2VZ0A 1ZFNA 1I36A 3G49A 3NYWA 3OIGA 2H5LA 4D7AA 4BQPA 3INTA 2FMUA 2YZ7A 4I9NA 1T2DA 1PQWA 1E1MA 2BI8A 2O23A 3PK0A 4MP6A 3BMOA 4RPHA 2DM6A 5KIAA 4WLUA 1ADCA 5HRUA 2QG4A 3PGXA 4E21A 2AEFA 4K26A 4MVJA 2W2KA 5A06A 2C5AA 2ZB4A 1KEUA 1ID1A 4L4SA 1QYVA 1K6XA 2NTNA 5JCJA 2AE2A 4NBWA 1U4SA 3WIEA 1HYGA 1X1EA 4XIJA 5A05A 2AQIA 2W90A 3PHHA 2UVDA 2QZZA 3C3XA 4WPGA 4YB8A 4YEDA 1NQTA 1PR9A 4D46A 2IYPA 4ZVVA 4J6FA 3LYLA 2Q2QA 4M86A 3CTVA 1HE3A 1KC3A 1SO8A 1HRDA 3GVPA 3F4LA 2Y0DA 5JSFA 1W6UA 5EERA 3VAZA 3QHAA 3KUXA 3LK7A 3KO8A 3F5SA 1NHWA 2P5YA 1Y9AA 3GFBA 1TT5A 4E5PA 4ZGWA 5TGDA 4PZDA 2QW8A 5JAZA 3OA0A 4TRRA 4Z0HO 1F8FA 5CP8A 1KVUA 5JY1A 4C7KA 4D0SA 4PG7A 1A72A 2J6IA 3IUPA 3LC7O 3WWZA 1QYCA 4DVJA 4MDHA 3JCZA 4ZICA 1T1SA 5FF9A 3FCOA 4CR8A 3D4PA 3AM3A 3HG7A 4U6SA 1R6DA 4YTEA 3H9UA 3C24A 1P77A 3BA1A 1BG6A 1AE1A 3K8ZA 1HSZA 1HSOA 5JXWA 4ND3A 1MC4A 2A35A 3BMNA 4BB6A 1PS8A 1D7OA 2GF2A 4TSKA 3ZWAA 1H6AA 1K3TA 1N92A 1V35A 3BZUA 3ZU2A 4ESOA 1XA0A 2I9PA 1MP0A 3OFSA 1JAXA 2J5KA 3FNHA 2VZ9A 2YV1A 4TRJA 4JQCA 2GN9A 1ZMTA 1VI2A 1VSUA 4XQ9A 1VL8A 4CMIB 3HN7A 3Q11A 1NP3A 1I2CA 2NQ8A 5KJCA 4XB1A 3ANLA 4QTZA 1XU9A 3ENNA 4ALLA 6ADHA 5DZSA 1SEPA 1S7CA 1PJ4A 4YA6A 4OOFA 5JW6A 5B37A 4Z0TA 5B12A 1YXMA 1Z74A 4IJWA 1YB1A 1PX0A 3LQFA 2PZLA 4K28A 4R3WA 5GZ6A 3TFOA 1ORRA 2EWMA 2PD4A 4QO7A 3RU9A 1EK5A 1KOLA 3OBBA 2C5EA 1D4FA 1UP4A 5ENVA 3PJDA 3RI3A 3W8DA 3WYCA 4IQ8A 1CWUA 5IG2A 1HETA 5G0TA 1HE5A 4R9RA 3DQPA 1ISJA 1E77A 4E5KA 5IXYA 3F5QA 4LSWA 3OP4A 1B3RA 4KWIA 2P9CA 4O0LA 1I30A 5LCXA 1CEQA 3FBGA 3P2YA 1IB6A 2X1HA 2Y1CA 4IJVA 1HDRA 4I5GA 4PLYA 2BD0A 3HFSA 4HUJA 3AY6A 4WEQA 4EI2A 4E4YA 3PJEA 3CTMA 1QXSA 4HXYA 3ADPA 5IF3A 3QWAA 1LU9A 2IXAA 4BKRA 4I9HA 5J23A 5L4NA 5LDGA 4WLOA 1QYXA 4MJLA 3VDRA 1R4MB 5ER9A 3PWSA 3KV3O 3PRJA 4BMVA 1I3KA 1DLIA 4YCAA 4ALIA 3R1IA 3JTMA 1UAGA 3QWIA 4XRGA 3PQEA 1GU7A 3EHEA 3QLJA 1DDOA 2DFDA 1BGVA 3VPHA 2VWGA 1Q0LA 2V6BA 1XYGA 5T6BA 5IAAA 1BXGB 2Q99A 1UDCA 4WLVA 3PJGA 5DBIA 3MJ4A 3EDMA 3KBOA 1LTHR 1ZKMA 3P5SA 4EZBA 2VQ3A 5AXCA 2CNBA 1LXCA 1F12A 3GUYA 4Q3CA 3WGYA 3D3EA 3GA0A 3LVFO 3PFWO 2WD7A 3ZHYA 2UUPA 2WEKA 5IZCA 4CQMB 1HDGO 3UN1A 4EUHA 3SC6A 4CMJA 3JYLA 4J1NA 1FDVA 4RF5A 1EUDA 4OM8A 3PVZA 2DUUA 1ENPA 4PGFA 3KVOA 2WYVA 4CM6A 2AXQA 2CD9A 2X7HA 2I99A 1KVTA 5IDQA 5BSGA 2JHGA 4YXFA 3C1AA 4JBIA 3RD5A 1QKIA 3PLRA 3WBFA 2C82A 2FHSA 4JBHA 4NR0A 3WQRA 2YUTA 3EC7A 2OHXA 2Z95A 3HB5X 2G5CA 3GHHA 4M8SA 1P9LA 4UVGA 4XIYA 3VPGA 4YQYA 3W8FA 3QWHA 4E2XA 1N7GA 1FDWA 2VRCA 4ROSA 2ZJ1A 2CVOA 2EW8A 4KMSA 1DFHA 3OSUA 4M1QA 1I5RA 3FHLA 3ZNNA 3TNLA 4D45A 5THKA 1LC0A 5I7FA 4DPLA 4XWYA 1HYEA 4GSLA 2Y1OA 3C1OA 2NVUB 2X9NA 3DOOA 4WLFA 2WMDA 2E48A 2GZ2A 3GK3A 4HNGA 4MPDA 4NU5A 3GC6A 1HDCA 4BMSA 1GAEO 1FXSA 1DAPA 1PQUA 2GGSA 1AHIA 1GD1O 1ZMOA 2WYWA 5AXAA 3HADA 3RQSA 1TT5B 1U28A 4JXKA 4A26A 3GNSA 4U8GA 3U62A 4DLAA 1RM3A 4QUKA 2HK8A 4EJ6A 2OFPA 1ZEMA 1R0LA 4Y98A 1UXGA 3NKLA 2O3UA 2PZJA 3AOEA 5TS3A 3GQVA 2PV7A 3JQ6A 4D79A 4QEDA 2E82A 1GFSA 1ZXBA 4URFA 3U49A 4ALJA 3NRCA 5AXDA 2VNAA 5L95A 1DIGA 4JIGA 1T26A 4G81A 5IZ4A 4OKNA 4I5DA 4LCEA 4D0RA 1ISHA 1QYDA 2J3KA 4NBVA 5G4KB 3JD2A 4BNZA 3KYDB 4KOAA 4E30A 3OJ0A 1SPXA 4J1QA 5DOVA 4YT2A 5JMPA 2PWZA 3OICA 1DEHA 3N7UA 4R5HA 1NM5A 3QVWA 4QFDA 4R69A 5F1PA 2NLOA 5C7OO 1SCUA 1VKOA 1HDZA 4KWHA 4A27A 3FF4A 3HJAA 1UXJA 2DFVA 1LNQA 1E6UA 1SC6A 2O7QA 3Q0EA 2D8AA 1DO8A 1HDOA 4J7CA 2C54A 1T4DA 1DJQA 2Y05A 1J4AA 3DBHA 1KVQA 4I9UA 4Z9XA 4CMBA 5L4SA 3K6JA 1RYEA 1NPTO 2PK3A 3A06A 3IS3A 5FYDA 4IXTA 2CZCA 2PLAA 2D4AA 1ONOA 1JWAB 4BOYA 3GEMA 1DC4A 4BGUA 5T67A 2X9GA 4Y6RA 3ZNOA 5C7IO 1X1TA 4ZQEA 5A3JA 4YPOA 1VSVA 3GUCA 3FSRA 3I6IA 4Q3BA 1BW9B 1H93A 2IE0A 2YHUA 2EG9A 4OQYA 3R3SA 2BFOA 4CV3A 1FDSA 3KHUA 4P4NA 4RLSA 4ZRNA 3EW7A 1IZ0A 1PZEA 3JQGB 3AU8A 4W4TA 4J0FA 4CM9D 2UYYA 3D7LA 4TVOA 1R66A 4BO7A 1Z75A 4YT8A 1ZCJA 4LSMA 4QO8A 3JQBC 4GAEA 5COAA 4AFNA 1ENOA 1SNYA 4JBGA 1PJTA 4U5QA 2QHXA 3DAPA 2A4KA 1MC5A 4BIIA 5CDTA 3VZPA 1ZJZA 3DZIA 5KTKA 3DXFA 3ZNPA 1B2LA 2J5QA 1K0UA 2C7VA 5FEUA 4RPKA 2AMFA 2EJVA 3VKUA 1D1SA 3DZKA 2X22A 4EGFA 3G3EA 3LSYA 4K1LA 3EVNA 4A10A 1CERA 4BS9A 1LLUA 3TOZA 1V3UA 3DZHA 5KJEA 3SC4A 5KOIA 3JD1A 1H2HA 3WTBA 5FWNA 1XCBA 2PTGA 2NM0A 4ALMA 1D1TA 1E5QA 4XQGA 3JD4A 4OIMA 5CEEA 4Q3AA 3ZH2A 3IDSA 4IQGA 3AJRA 4G5HA 4EDFA 2JL1A 2JFHA 1EE9A 3K2EA 1YE3A 3DO5A 3R6DA 2Y1EA 2V6GA 2R2GA 3E5RA 5CHEA 4OQZA 3D3WB 3ST7A 3BTSA 3GRPA 3L07A 3OQBA 5T8KC 4BGVA 2GZ3A 4BKPA 1E6WA 2CDAA 5HS4A 2AG5A 1XHLA 4XJSA 4YAJA 3E82A 3ZWWA 1VM6A 1BDBA 4CMCA 4DXHA 4CMGA 4OMUA 3TZCA 1NWHA 3L77A 3CUKA 4AJEA 3GVIA 4RL6A 3AFNA 1AUPA 3LU1A 1P33A 1ISFA 1IY8A 3GDFA 3DDNA 1QLHA 1RJWA 1R4NA 4BKUA 5JCJD 5ICSA 1YDWA 5TX7A 2Z1MA 1NTOA 3CH6A 3GGPA 4L4XA 4I8XA 3OIFA 4OXYA 1S6YA 2DUWA 2GDZA 2IZZA 1O5IA 3F46A 1J5PA 5K0ZA 1XQ6A 4I5FA 4ND4A 3GEDA 4A73A 1HZJA 3CSDA 4UEKA 1OC2A 3I9KA 2VOEA 1GR0A 2XPCA 3RC1A 3ROMA 4GBJA 3WICA 2I65A 3DZBA 4CLDA 1E3IA 1LDGA 1LDYA 3GN1A 4U7WA 3U9LA 4II3A 3SLKA 2ZB7A 5T64A 3EZLA 1DXYA 1GDHA 4NFHA 2P2SA 1PJLA 3K73O 3OJFA 1A27A 3JYNA 5EPOA 4A5OA 2JAHA 4BO4A 3AUUA 3MOIA 5EQDA 4FS3A 3T7EA 5DCWA 4B3HA 2VTEA 4Y8VA 1YO6A 2HRZA 4O63O 3WTCA 2JCYA 4TROA 1LLCA 4E2WA 3KETA 1FMCA 2VUTA 1ZUD1 3I9OA 4AJHA 2YQ4A 2AE1A 3I9NA 4WGGA 4QQRA 1Q1NA 2DBZA 3VH1A 2ZTVA 1B0AA 1JWBB 3ZHXA 1ZO8A 2GCGA 3PHJA 5K6AA 2B4QA 2FSSA 1MUUA 4NJMB 3WNQA 4TZTA 2PGLA 4GX1A 3H3JA 1A4IA 3H7AA 3AI2A 4OYRA 1NAIA 4XEHA 5F1OA 4J4BA 4LCJA 2PD6A 5K6AC 4N5MA 1IUKA 2R00C 4PLGA 4DL9A 5KJFA 1J49A 1HWYA 1XSEA 2RCYA 4QECA 5I7SA 3INRA 3QJ5A 1YOVB 2O3SA 1YH3A 3WIDA 1Q0QA 1VRWA 1NVGA 1PEDA 3S2GA 2CF5A 3C1TA 3UHAA 4AJ1A 1UP6A 2OGUA 2RHRA 3GG9A 1LQUA 4XYBA 5GMOA 4ZQHA 2O3RA 3OEWA 2X8LA 5AXBA 1NQAO 3PDJA 5JFOA 4AJJA 5CEJA 2BF7A 5CDGA 1VLLA 1JVBA 4L4RA 1GYQA 4MVJF 1ZEJA 4AJOA 4BNJA 4ILKA 3BTVA 5F1KA 1TI7A 1YBMA 3VPSA 3ZNQA 4BUCA 3S1LA 2YY7A 1DOHA 1I2ZA 4Z6KA 1XU7A 4KQWA 5KVCA 1ISGA 4MVJE 4O5OA 3RC2A 1DIRA 3V1TC 4CLOB 4E5YA 2HMTA 2NV6A 3HN2A 1H6BA 2ZB8A 1KIFA 1KYQA 3ASUA 3FD8A 4ZQFA 2YYYA 4NU6A 2XOXA 3PQFA 3JD0A 1SEVA 1UDBA 3BMQA 3TFQA 5L51A 3WGTA 1SOVA 3WGQA 1O89A 3WQSB 1BDMA 2X0IA 3ENKA 1U1IA 2C20A 3WLEA 5A03A 5CDSA 3JQ7A 1D3AA 2AQ8A 1M2WA 1V0JA 4OXKA 4BKOA 1MXHA 2GSDA 1X13A 3ICCA 3WGZA 2GN8A 4EYEA 4H7PA 5IDYA 2Y67A 3IP3A 2AA3A 2WDZA 2O4UX 5A02A 4DLLA 3GZNB 3SXPA 3NGLA 4FFNA 2PA3A 3I9LA 4DPMA 1Y8RA 4X54A 3ETGA 4HWKA 4E0BA 3NGXA 1QV7A 4RO0A 1LQTA 4TKLA 1QSGA 3CKYA 1M6HA 3I4FA 3MZ0A 1VPDA 3ZWCA 4CJXA 1VE9A 2Q1TA 5L40A 4ZA2A 4BO5A 2PR2A 2YFHA 3DMTC 4FB5A 4GSKA 3IJRA 4B4VA 2NVWA 4FPXA 4ZU3A 4Z3DA 4BNUA 1PIWA 4UUMA 4Y6PA 1PL8A 3BMCA 5KJ6A 5C37A 1JAYA 4XR4A 3MJEA 4CM3A 2EHDA 2OBNA 3RUHA 4ONEA 3ZWBA 1YKFA 4CQMA 4NJOA 4GH5A 5TJ9A 2Q50A 4RVSA 3LLSA 1T2EA 4A7PA 3WGHA 4RDHA 4GL4A 2D1YA 4KQXA 4AJNA 2W4QA 2AQHA 1G0OA 2FN7A 2QQ5A 4YVFA 3PXXA 4GI2A 2ZIZA 3WGOA 2GLXA 2UUOA 3ABIA 4FC7A 1W73A 4B7UA 4XYLA 1P0CA 1I32A 4WKGA 3LC2O 4L75A 5COBA 5BSFA 1DPGA 2BELA 4FW8A 1YQGA 2PD3A 2QRLA 2ZQYA 4R5MA 1Z82A 2Y1FA 4YJGA 1G0NA 4J2OA 4GMFA 4L73A 1O0SA 1EUZA 1GPDG 4DREA 5MGBA 4PLZA 3HUDA 4TZKA 2QZ9A 3GR6A 7MDHA 2NVBA 2PKQP 4Z9YA 3JQFA 4JP2A 3TPCA 4IGFA 1BVRA 1LA2A 1NAHA 3V2UA 3KTDA 4D42A 1EFKA 2V6MA 5HBRA 2D3TA 3AM4A 3QA9A 1Y5MA 5BNIA 1QMGA 1UXHA 3ANNA 3JQFC 4IMPA 4XX0A 5G4LA 3GH3A 1B3BA 4YRDA 3JQ8A 3L0DA 4B7XA 3AI1A 3FI9A 1M76A 2W2LD 4BNVA 4RGBA 1ULSA 3STHA 3K31A 1TXGA 2ZYGA 1A7KA 5EJ2A 4Y67A 1PU2A 3MWEB 3IKVA 3IC5A 3T7CA 4EBFA 5B4UA 1W0CA 4S3MA 3GG2A 2TMGA 1GYRA 2P91A 1VKNA 4I08A 4OL9A 4CV1A 1CF2O 3VH3A 4TVBA 1PR3A 2FR1A 3RUIA 1GUZA 4LISA 5THQA 4P4LA 1PL6A 2EGGA 1U4OA 3OIDA 5C5IA 3PIDA 1GUFA 4FGSA 3KYCA 1U3UA 2FPIA 3QIVA 4NG5A 3VKVA 5I9LA 4XYEA 1C0LA 1PGOA 1E3LA 3ITKA 1Y1PA 4E6PA 3SJ7A 4PLVA 1YRLA 3ZHBA 4K6FA 2HAEA 3DL2A 1EEHA 4YJFB 2RIRA 2HCTA 2LDXA 5JAQA 3O03A 4B7CA 2I67A 2VT3A 3AM5A 3GRKA 2I3AA 2X5JO 3WS7A 1GPJA 1YQXA 3I4CA 5H83A 3A14A 1NQOA 3GLQA 4Z9FA 5BSHA 1I0ZA 4FR5A 1P0FA 3AK4A 3VC7A 1L7DA 4XDYA 2X6TA 1AXGA 3JQAB 4L74A 4MOWA 1E7RA 1MFPA 1OI7A 2YFQA 3BHIA 4CMEA 2I3GA 5B1YA 4XKJA 1H6DA 1HYHA 3DWFA 3LF1A 1Z6ZA 2FY8A 1U2GA 2E4AA 4PG8A 1I8TA 5IFLA 3F47A 1ISIA 4RLHA 2E6UX 2GZ1A 5JDIA 5I8ZA 3QWFA 1YB4A 2D2IA 4W9NA 4WECA 4CM8A 4JN6B 2P4QA 2VRBA 4WK6A 1U3TA 1HKUA 4XJTA 2BKAA 5JC1A 1QP8A 1W8DA 2C7GA 3W6UA 2VWPA 4WLNA 3B1KA 4FFRA 3NAQA 3GNQA 1ZXLA 4K9DA 4DLBA 1NBOA 1OC4A 1U7TA 2C59A 4BNNA 1EE2A 1PQPA 1AGNA 1IE3A 2DTEA 2XXBA 2Z1NA 3JYOA 3EGOA 3E9NA 5AVOA 1QV6A 1U8XX 3DEYX 4MVJH 1DC5A 1DIAA 5I8WA 9LDTA 4RCVA 1N2SA 3KM0A 3O8QA 1KBZA 3JQDA 3L4BA 1ONNA 4DMLA 4YRBA 3AUSA 1LDNA 3VZRA 1UDAA 2GERA 3KYBA 3DBLB 5LC1A 4M89A 4NHEA 2DQ4A 1N9GA 3DC2A 3WSWA 4E2YA 4CMKA 2VOJA 3BYZA 3ZN2A 1WWKA 3PTZA 5TIIA 1XEAA 1ENZA 4NZ9A 4CM9A 1C1DA 1BRMA 4NDNE 1BXKA 5G0SA 1P1RA 3G0OA 2Q46A 4PVDA 1U9JA 1WDKA 3G1TA 1E7WA 4CM7A 5IXSA 4EUFA 1XDWA 3O38A 4J9UE 4DGSA 4QXMA 1EBUA 1LBEA 4UUOA 5JY6A 4ZN6A 3GGOA 1N8KA 1NQ5A 3QVOA 3UFXA 2CUKA 3MCVA 3OJEA 4PIVA 4PLHA 3IJPA 4RV9A 3ZZNA 1SB9A 3MOGA 3ONEA 4GQAA 1NFRA 3B70A 4GX2A 3SX2A 5IZCC 2YHIA 4MVJD 3BMCB 4U0JA 1RM5A 3ICPA 3RUDA 4ID9A 3SJUA 3WFJA 2ZYDA 2ZKLA 4AL4A 3W4KA 4Q9NA 4BO8A 4PZCA 4XCVA 3IKTA 1H2BA 3B1JA 4N5LA 4XR9A 1PL7A 1E1KA 2CDCA 2EV9A 2QIOA 3WMXA 4B4UA 1P1IA 3UW3A 4J49A 2VYVD 4XGIA 3V1UA 2OXIA 3ZV3A 4FJ0A 2EF1A 4AJLA 2O50A 2VHWA 2VCYA 3BMOB 1CQJA 2PZKA 3IIEA 4KTVE 5H82A 3EK2A 1GV0A 4XYMA 3MJVA 3P19A 3UCXA 2W2KB 3RWBA 2PFGA 1EVZA 3NT2A 2HUNA 4WCFA 5ILOA 1J0XO 5L7TA 1YBVA 4N7RA 3GPIA 2C29D 1U3WA 1MB4A 1A9YA 4WCFC 3K2BA 5BR7A 4EW6A 4CMHA 3AWDA 4GGPA 3UAGA 4BNGA 3G1UA 2XAAA 1YL7A 3PYLA 1XWFA 2OO5A 3BTUA 5LDHA 2GYYA 1I01A 4F3YA 3FWZA 1O94A 5L3ZA 4DQVA 2NTJA 4MVJM 4B8WA 2AHRA 3JQ8B 2ET6A 4J1TA 4MO2A 2JHFA 4O59O 5JPIA 3S8MA 3X2FA 3RJ9A 5KKCA 1UZLA 2JD1A 1Z7EA 3FPLA 3ZWNA 1EQ2A 1IZ9A 1JW9B 4RF2A 4LRSB 3D5QA 4BNIA 3WGGA 1O8CA 4RF4A 4RORA 4BNFA 1R12A 3RBVA 1HLPA 1PJCA 1E7MA 2FRDA 3AOEC 3GMSA 3DBRA 5H81A 1Q2XA 4HV4A 1MA0A 4CQLA 4AJPA 2Q45A 1UXKA 3GDOA 2BFAA 1YB5A 3PWZA 1C1XA 1NVMB 3BMNB 2GNAA 1O95A 4FFMA 2Q4BA 4F6LA 2RH4A 4OAQA 3MJTA 3DB2A 1YL6A 2O3JA 2UV8A 3ITDA 4RPGA 1K5HA 3OEYA 3DZJA 2HMVA 2B4RO 2JCXA 2G1UA 4FFPA 4IDEA 2BI7A 3DHEA 3WDSA 1RM0A 3LF2A 2H1SA 4CV2A 2DPHA 4OXNA 3RAJA 3AU9A 2JAPA 4XDZA 3CEAA 4IGEA 4CV0A 2AW5A 3A1NA 5ILGA 3OF2A 3I9MA 5T57A 2NWQA 2DBVO 5AOVA 2DKNA 1ZJYA 1ISMA 2E37A 4R68A 2JD0A 3ZGYA 4HFMA 4IZIA 1PGJA 2AG8A 2B0JA 2ZB3A 3RC9A 1U3VA 1I2BA 3CIFA 3U09A 4MIOA 2PGDA 1ZNQO 3W4IA 1UAYA 1NPYA 1HF3A 2VUUA 4UEOA 1PS9A 4UUPA 5CAEA 4JCOA 1A7AA 4GX0A 3EMKA 3N74A 4GWGA 2DBQA 2IEDA 3GHYA 5TT1A 5L7WA 1C3VA 1JKIA 1DIHA 1R16A 1ZVMA 5JCXA 4BO2A 3JD3A 4IDGA 3K96A 2D5CA 4UUNA 5IN5A 3D64A 4EUEA 2FPPA 5JNLA 2CSUA 3OECA 4FN4A 2Y0EA 3U4CA 1D8AA 3WLFA 5A5FA 5GZ3A 3PEFA 2VUSA 2Q4EA 4CM8B 3JSAA 5TNXA 1X7GA 4DWVA 1NFQA 2HLPA 1ADFA 2JFGA 3PLNA 1WMAA 4DIBA 4W99A 4RJTA 5A9SA 1GZ4A 1QYWA 2LDBA 2WM3A 4WJZA 2HJSA 4J9VA 5AYVA 4G2NA 2Q2VA 2BGKA 4L0QA 2HU2A 1PWZA 3TJRA 2OL4A 1G6KA 3F4BA 4OJNA 3C7AA 2GPTA 5A1TA 2DTXA 2NU7A 3HB4X 3M1LA 4JLWA 2HSDA 4HFJA 5A3VA 1VL6A 3H9JA 1MFZA 4GLLA 5JC8A 1EDOA 1UZNA 1X15A 3PP8A 3IL2A 4R01A 5IJZA 3R3JA 4BNMA 3VH2A 4DIOA 2GN6A 2O4CA 3TOXA 3AFMA 1G1AA 2O3QA 3LLVA 3M2PA 4BGEA 1PJ3A 1ENYA 5CPBA 4Z0PA 1U5AA 4NK4A 4J3FA 3H2ZA 4R3NA 4YRAA 1ZW1A 3OETA 2PNFA 4B4OA 3QV1A 4E33A 2P5UA 2V6FA 1RM4A 4FJ1A 3FR8A 2ZYAA 1F17A 1ZSVA 1HL3A 2D59A 3KLMX 2E49A 3ROKA 2WE8A 4PG4A 5DNAA 1LLDA 1ZZEA 3WSVA 1GEGA 3ADOA 3WJ7A 1RWBA 1DBVO 4NIMA 3IUSA 2HDHA 5TLSA 4O6VA 1WW8A 3FR7A 1FDTA 2WD7B 1FK8A 1XGKA 4A2CA 4BVAA 2EP7A 3UH1A 1WVGA 1E3JA 3NV9A 1BHSA 2IZ0A 1WMBA 1N5DA 1X7DA 3RUAA 1ZSNA 4R4JA 5CDUA 1UJMA 2DVMA 4ZQBA 3GDGA 1H9AA 2EGHA 4R1TA 2I6TA 3PI7A 5KKAA 3LZ6A 4IJUA 1WNTA 3TQHA 4B4WA 4C4OA 2EKPA 3L9XA 1MG5A 3ON5A 4DMMA 3ZCXA 3W4JA 2EJWA 5HM8A 2TMDA 4JX8A 2X58A 4IDAA 3E9QA 1MXFA 1DSSG 2VWQA 1EZ4A 3ROQA 1F8GA 4Y6SA 1SOWA 4RVFA 3CE6A 4FCCA 3UXYA 4P8RA 1JKFA 1NR1A 1JN0A 3H5NA 1MV8A 3BIOA 4WCDA 4H3VA 3UVEA 4OOEA 3C7DB 3RBZA 1BTOA 4CM5A 1BWSA 2FSVA 4J91A 3ZWXA 4CM1A 2DAPA 4GLOA 4RPJA 3RJ5A 3ZWMA 2X5KO 1E1LA 4YT4A 3NT4A 9LDBA 5K9ZA 3H9EO 5JO9A 2QYSA 1E7SA 5KVQA 1YBAA 2C2XA 5B4VA 3ZV4A 4LW8A 1I3NA 4IINA 3WNVA 4N54A 3ZV5A 2VHYA 4AJ2A 2BFPA 2SCUA 2EP5A 2D5AA 5BNFA 3PZBA 4DC1A 3WBBA 4S1VA 4HFNA 3O4RA 3F1LA 1H6CA 1M67A 4PG6A 1ZK0A 1LUAA 1VJ0A 3V1YA 3W8EA 3RUEA 1GY8A 1DRWA 4ZQGA 3UKOA 4RVUA 4CR7A 1E5LA 5CFZA 2A92A 3DFZA 1HE2A 5G0VA 1Y5RA 1OFGA 1DLJA 3SVTA 1KS9A 1WDLA 5HA5A 4TQGA 2CDBA 4LVUA 3W6ZA 1YWGO 3SEFA 1Z45A 2Y0CA 4GX5A 1A9ZA 1JVSA 4XA8A 5JE8A 2G76A 1LDEA 2IXBA 3HWRA 5G0UA 4CQLB 3OMLA 3NX4A 3ZU4A 3ZWYA 4WUVA 4R16A 3BHMA 1LSJA 3FRJA 3D1LA 3QY9A 4BNKA 1N1GA 3PFFA 4IIVA 3KB6A 4U0KA 2X0NA 3KLPX 4NPCA 2NTVA 3LT0A 1ADGA 4WOKA 4IS2A 4C7JA 4E32A 2EXXA 1T4BA 2OMEA 4CLXA 4IDCA 1ZK3A 4JJFA 3ZDFA 4ZJUA 1EBFA 3OQ6A 2C07A 3LDHA 4EEXA 5IDWA 4GPD1 1YDEA 3ZU5A 1ULUA 1KVRA 3AUAA 5EINA 1JA9A 2Q3EA 4PN3A 3DBHB 4BHTA 2GUGA 1GL3A 3VVBA 3RIHA 1IHXA 3TZ6A 4E5MA 4J16A 3LT1A 1GQ2A 2YQ5A 5JLAA 5BT9A 4UEJA 2HK7A 5DBFA 1HDXA 3HHPA 4AICA 4FOSA 5AQ1A 1MLDA 1H9BA 4Q3NA 2DC1A 4F45A 1Q7GA 1EMDA 5U4QA 3I83A 1Q7BA 2H6EA 4NI5A 1E3SA 3GGGA 3INGA 4FD3A 1B26A 5DBGA 2OBYA 1I3LA 2WYUA 2C2YA 2OORA 1MX3A 1DHRA 1UZMA 5A04A 3GAFA 3ORFA 3DR3A 4D3FA 4IIUA 4IM7A 1H94A 5IDXA 1HTBA 1B16A 3AW9A 3M2TA 5TC4A 5F5NA 4DIFA 4IMRA 1R4MA 3RASA 5ADHA 1GCOA 3I9JA 3DHYA 5G0WA 4CL8A 1X14A 5ITWA 1WXDA 4BO3A 5GY7A 2AQKA 1PZGA 2DLDA 4GGOA 1ARZA 4XD2A 3HDQA 4PLWA 3ZI0A 3RKUA 1U5CA 4F46A 3U5TA 1GTMA 1I3MA 4JNKA 3VOSA 4FIZA 3KSUA 2O3TA 3KEQA 1NR7A 3KRTA 3UCEA 4J90A 1X7HA 3GVCA 4FC6A 1H5QA 1SAYA 1JTVA 2Q49A 4Q3EA 3OQ1A 1W4ZA 4FSHA 1PJSA 2GR9A 4J7XA 2YDYA 4NMHA 3QSGA 4HADA 1BMDA 2P68A 3WMWA 2HMUA 1SMKA 2GN4A 4PLFA 5C3MA 3OA2A 2FP4A 3B1FA 1LSOA 3JYQA 3WX0A 1OMOA 4PLCA 4M49A 1GYPA 3PZRA 4F6CA 3GF4A 2EERA 2OZPA 3B6ZA 4TWRA 4WLEA 2PH5A 3GEGA 5ITVA 1Y9EA 2WTBA 4IDDA 4ZD6A 4BO0A 4KDEA 3PWKA 4RF3A 1C14A 3PGJA 1VJ1A 1DAOA 4D3DA 1X0XA 2IRWA 4L9RA 3C8MA 5DF1A 4R51A 1GZ6A 3KXDA 2FR0A 2CVZA 3RUCA 5FI5A 4MKXA 1R4NB 1UR5A 1IULA 1E7YA 2EIHA 4WOJA 3U4HA 4DPKA 4Z3KA 3AY7A 1EVYA 2HK9A 3HSKA 4MIEA 3VHRA 3QRWA 3RFXA 5TJHA 2VNSA 2GD1O 2JD2A 4NNJA 5TRTA 3S2EA
chains in the Genus database with same CATH superfamily
4OBWA 1OJLA 1S01A 2OV1A 4PU0A 3JPWA 4BNLA 4J0KA 4BQFA 4MWTA 4ARZA 5JAIA 3UK6A 3B5JA 2VHXA 5HCUA 3AUTA 1QE5A 1PSWA 3KJEA 3PD1A 4CF5A 1WTCA 2XUJA 3TX6A 3OZFA 4IICA 4TSFA 4B6PA 3VZCA 2M98A 2VYVA 2QTMA 3JARA 1JV2B 4M1WA 2J3EA 4UQOA 3M5PA 3RWOA 4B6RA 1Q83A 2QTGA 3CX8A 3UKJA 2WTEA 4AG3A 2ZSDA 1MJGM 4QQ8A 4RIGA 3GT0A 3TW4A 1L5MA 1M0TA 2P75A 4RTJA 3MJDA 1E0SA 3RVSA 1DKOA 1VDZA 4UTPA 3D7MA 4JYAB 4RACA 5TMDA 3X1KA 1ES9A 1VSBA 2QX9A 2UKDA 1CRZA 1M6WA 2A9FA 3EGDA 3TOSA 1T0JB 3IDAA 4WRRA 1ZX1A 3DZGA 3FWKA 3HKEA 5DYGA 3STWA 3ICWA 3MJHA 1AO0A 2ENWA 2HU5A 2UYQA 4N7BA 3CLUC 1W36C 5TSDA 5AO9A 2P0EA 1WP4A 3Q9UA 1Y1RA 4V24A 4DUPA 1WZUA 2O0LA 4NARA 3KG2A 3RCBA 2FZLA 3NHJA 3F6BX 5JBQA 4UJ3A 3KWJA 4WT7A 3WG9A 1H0KA 3KQYA 3CLTC 3JQAD 2QN8A 1C1YA 5F3RA 1IVYA 5C3UA 5SZKB 5B4TA 3NC0C 4ZPJA 2G63A 3G2KA 1A96A 4PVCA 1N5JA 1FP4B 1MIOA 1E9DA 1MDFA 2NADA 3LDGA 4UDOA 1ACMA 1HLGA 1M2VB 2A5YB 1U65A 4PONA 5DW0A 2ZDQA 4OSPA 5EE3A 4Z1MD 5J1TB 4DY4A 2Q5CA 2ONJA 5JH7F 1E8NA 4OLFA 1YCGA 4LJAA 4EMSA 1Y7TA 4F5DA 5D85A 1C7JA 1WXWA 3GOHA 4HEHA 4X6LA 2VTVA 3WGJA 4JI7B 3A3PA 3NRBA 2R79A 1CUIA 3HL0A 4GPBA 2RH5A 3CW9A 3H0EA 1Y1TA 1ZK1A 4PYNA 1ELOA 3EUEA 4O33A 3N8DA 3GFPA 5EFOA 5HEKA 5K0TA 2YRWA 3QYFA 3HA2A 4JLMA 4NH4A 4EFDA 3PUJA 1E3WA 2I2XB 4WBNF 1YJ5A 5EZSA 3R0IA 1XN1A 2VLBA 1U2QA 2A2ZA 3N75A 4D9BA 4DZRA 2CV2A 1K9SA 2ZXEA 2JPDA 3DEKA 3AJEA 3OO0A 1YS2X 2P4UA 3HY3A 4H3HB 4RK4A 4KV7A 1CDZA 3NBKA 1ZRMA 3G85A 4AWXA 1PGQA 5LQUA 1QR2A 2RHHA 3V3TA 2OM2A 1Z37A 3G17A 1D2EA 1U2TA 4BPBA 1NXOA 1XMSA 3EN0A 4YACA 3CT4A 3S29A 3ZWVA 4MV7A 1E66A 2QMEA 4TVSA 1DC7A 1E5VA 2EKLA 4M55A 3HJNA 1UKBA 1XCGB 2GSWA 3GVHA 4NEHB 3RYTC 4IDQA 4MV0A 4AS3A 4D8XA 4DBVO 5EQJB 4LXUA 2BAGA 2YWJA 2QEQA 3Q7SA 4H7DA 4HK4A 4M7PA 2JI6A 3IXQA 1MN6A 3USZA 1GNRA 2FOXA 4R81A 3X1DA 4BO6A 4MW5A 4RJIA 2OE2A 4J43A 5K2MA 3S7ZA 1TIBA 1XRSB 2GS9A 3BAZA 4B8YA 3JQ7B 4JK3A 4EECA 3CZRA 4NAHA 5LP6C 1FP7A 1X3LA 4PCLA 5DCUA 1KI9A 1MABA 2YJTD 4HMOA 5J4LA 2R8PA 3K70B 3MWDA 4GWKA 2ZK7A 2BONA 5K45A 1N57A 2AR9A 4RCZA 4US1R 5K3CA 1JDBB 3CGWA 3DFUA 3ETEA 3TGPA 2JJ1D 3PG5A 5FHRA 3IDQA 3WHKA 1IUPA 4C3OB 5I8PA 1R7RA 4H27A 3SDBA 1EUQA 1HXHA 5LIRA 1IZ8A 1WO8A 2QLFA 3IHKA 1S3IA 1EP2B 1TK2A 2AWNA 2Q0SA 4Y6OA 4AS2A 1OREA 1GKIA 1IWOA 3A7DA 2B1RA 3LTNC 2CFIA 3NIGB 2YVAA 3EG9B 4KP7A 4CQMD 4D25A 2CLSA 1AC5A 4XVHA 2O7VA 2RJOA 5FWAA 1U2EA 2A5LA 4HP8A 4TQAA 4L6AA 5ES3A 5TDHA 1EI9A 3WLSA 3DMRA 4M22A 4CL0A 2WJYA 3RREA 5DLDA 2AC2A 2QXUA 3ETNA 3VOAA 1TLTA 3ZE8A 1UJ6A 4LDQA 3KR0A 2P67A 2FPUA 3DO8A 1NG9A 2ZANA 3B2NA 1T24A 2XY4A 3ZEAA 1DHTA 3GEBA 3O1LA 4ZPXA 1LJ8A 2CY0A 4EM6A 2X4DA 3QQPA 2C8VA 2DY0A 1P4GA 4IIJA 4W7HA 3RRNA 3WGUA 3ORRA 5IAKA 3DWEX 3NHMA 2P7IA 4AQYB 2AX4A 3HDTA 4M9XA 1HK7A 1XMVA 2HMSA 3L4SO 5KWIA 3WKCA 1JU9A 4JC8A 1UH5A 4X8LA 1WZEA 1ZP6A 2WV7A 4HCJA 1T8WA 2H4WA 1I33A 3CLHA 4ICIA 4OBBA 5M04A 2C9BA 3BICA 3H8JA 3NVMB 4HVAA 2ZUTA 4CM4A 4YIHA 2F00A 2H5IA 1E4VA 3LY9A 2E18A 4OI0A 3ZJVA 3BEDA 1NT4A 1J09A 1JEDA 5HZHA 3L9WA 3GAAA 1F2VA 4J1SA 2BGTA 1JG2A 1YZ3A 1WX1A 3AFGA 4U2CA 3MWYW 1Q21A 4Y7DA 4ALKA 5EQFA 4G4GA 3NZEA 4OL0A 3SQXA 1KJYA 2AWOA 2NG1A 1ZH4A 3QX9A 3L0ZA 1QMPA 3S2IA 2QMYA 5FNZA 1IEVA 2VRWA 3AV3A 2UXDB 5KYWB 4REQB 4AUMA 4YJGB 3BREA 3OOYA 3U3OA 1LDBA 2HJVA 2R1VA 1H3NA 4TMWA 1RHUA 1K3FA 1V8DA 3LFTA 2C7QA 3K0BA 5LYJA 1GUBA 1T6NA 5HTOA 3PF8A 1OZAA 1VBKA 2EDAA 2D1SA 1MQ8B 2G25A 5A7GA 2FZCA 3DZ8A 3USCS 4C4TA 1N2OA 3W7VA 3PEYA 2B7BA 3BL8A 3M6MD 1XF9A 4RANA 1QPGA 5FD8A 4EA9A 1I4TD 4YRIA 3BWVA 2BFDA 4B3DA 4OQQA 4ZGBA 1TPZA 4Z7QB 4GKVA 5TMBA 2R65A 3LVRE 4QLOA 4HVTA 2ZWMA 1GU1A 3MYYA 3OLYA 1JLRA 4V2IA 4W5JA 3UHFA 3ZDZB 4RTSA 1FLAA 4L0MA 1ZOPA 2ZWAA 3AR9A 3CONA 3EVTA 3QE3A 3VR1A 4BV9A 4ED9A 2IWHA 4RLQA 1DX9A 1AGYA 5FL7D 2JFFA 3P4XA 2W42A 1B00A 2PSHA 2VWHA 2YX1A 1QGYA 1ZUNA 2HCBA 2R7KA 3FDFA 5B1DA 5LB2A 4AZ0A 3QUAA 3EEOA 1FU8A 5CFLA 2P4HX 5BMVB 2RK4A 1XVTA 2X9VA 3RYFB 3VTZA 1RMTA 1U5BB 1VLHA 1ZGBA 2R1ZA 3W1WA 2RAUA 2ARKA 3GLTA 3DE0X 1S0UA 4IIGA 5CBPA 1GM5A 3LC0A 1W36B 3R74A 1CJSA 1TEVA 3QMWA 3GLGA 3R3YA 3UOWA 1OFVA 3ANYB 3TJZA 3DV9A 1MGOA 1IRIA 3HKEB 2WHYA 4YLGA 3SF8A 1T8YA 2PT9A 1NFFA 3VR2D 2CWWA 2A30A 1X3SA 1J22A 2FPIB 2FSIA 3HSSA 1X9IA 4E12A 3DOHA 4G65A 4D44A 2VP6A 2LE0A 4DSTA 4DSNA 5FAKA 4ZO8A 4BJ6A 5J2TF 1EDZA 3O82A 3ESQA 2K7ZA 3W5DA 1GQQA 1Y3IA 3R7NA 4LRTB 3SOZA 3IXMA 1ZI8A 4DJDC 3MJRA 3SQLA 4N9QA 3EZ6A 3O95A 4OU4A 1YOVA 4YYZA 2BGNA 3BA6A 1VMAA 4FHEA 3EZGA 4B48A 5A4DA 5DHRA 5JALA 1U8TA 5C46F 4TL6A 3VU9B 2HXYA 4B6JA 3SLGA 3QHPA 2XGOA 1P9OA 1ML3A 1AHHA 1ZJJA 3E2IA 3OT1A 5EGNA 1CR1A 1GCUA 4YT5A 2IEZA 3NVDA 3ZXSA 3HTXA 4F4IA 2JGNA 3F9RA 1E5DA 2RAFA 2D1QA 4NK5A 3T4XA 3WIVA 2OGSA 1WXIA 1OBOA 4TKMA 2GLUA 3ZLVA 2ECKA 1LFAA 4S2EA 1QPZA 4RQUA 4LQLA 1ZM9A 4BUJA 1C81A 1NOJA 2AZ4A 3P27A 2FN4A 2CXTA 4YCNA 1XQ1A 3H1EA 3DKKA 5CJPA 4W8HA 1Z15A 2J09A 3DHNA 3F49S 2ESRA 2OUKA 2JGLA 3JAKB 3KAPA 3KDAA 3OURA 4KJZA 3BDAA 3VR5A 1IWPB 1G2IA 1E3WB 3T1YB 4CCAA 4OHBA 5IPFA 621PA 3WOVA 3VKFA 2PBRA 1JEAA 1IYZA 2I66A 2FI1A 1O8BA 3FN4A 4AKGA 3TL6A 2Q9AA 2ZATA 3PIRA 2XJ4A 1QO0D 4IS3A 1H8HA 1XMXA 3HLYA 1JBQA 3E53A 2WE7A 5IUJC 1Z25A 3GPDG 3NBMA 2FSUA 2QUJA 4FBLA 1GQYA 4N40A 3WDKA 2P1ZA 4D6YA 1XMIA 3W2HA 3U61B 1KXZA 1KK2A 1OH5A 3ASVA 3FMFA 2ZUSA 1OYYA 5L9AA 2Q6LA 4P3NA 4MVJG 2B9VA 3EVZA 4KAJA 5EKTA 3FPAA 1Y8QA 3NT5A 3PF9A 5DNVA 3ZWOA 1KEEA 1USGA 3R6WA 4CLEA 4RPLA 3OLVA 3VV3A 4RHUA 1WBDA 4BJ1A 5LP6B 1FS6A 1E7QA 1QZUA 1W2HA 5AOCA 1NMZA 3SXUB 1Y5IA 1UKCA 1BH6A 3GEEA 4OA5A 1B8UA 5MN4A 2QAGC 1P1HA 4MVJI 5DSZA 5A4KA 1I1HA 1P5RA 5B3JA 2WZBA 4EHKA 3DOCA 3L8CA 3NJ8A 1XR3A 1C41A 1Z5UA 2AEMA 3RFTA 5CDHA 3SDSA 5BR8B 3OPYB 1YZNA 1DKMA 3MWDB 3N8HA 4KPGA 4IY1A 4M6WA 2JKZA 4RKQA 5DT9A 5K4AA 4BVBA 1W4RA 4DRYA 1RBZA 2Q3LA 4X95A 3B78A 4PZPA 5CA1A 1UAAA 4J4HA 4NZYA 2OCIA 2E6KA 3IBTA 2WAMA 2NVOA 1OYWA 5J4YA 4OYHA 2G06A 3EIFA 1XTJA 3BZBA 2ZTMA 1KMQA 2IUTA 3ZIAD 4JB2A 3TWOA 3F9CA 4LXIA 4AY6A 4KO8A 4RELA 4Q01A 4EA6A 2GBCA 3FZNA 4KTTE 3F8WA 1L9XA 1Y63A 4UMDA 3TDKA 3V00A 3A1SA 3UMRA 3W5SA 2ZIAA 3E3AA 2EX0A 5JISA 1QNFA 3F67A 2ZJYA 1K86A 4IW3B 4RKEA 1Z2CA 3LG2A 3AR2A 3GMTA 1TYCA 4DBLE 1GL6A 1XZEA 2OD2A 1A71A 2P9JA 4OATA 4A8PA 3L7YA 5BPFA 1HNXB 1K5DA 4LMRA 2G6BA 4H16A 2Q1SA 2VRCD 3L7MA 4IPTA 1KMMA 5T8KA 2OOSA 3LKVA 1R0KA 5DHFA 3UICA 7ABPA 2IK8A 3QUTA 4PYQA 5D2CA 3KQWA 5DLPA 3ISVA 4IIJB 1DG3A 2ANCA 6REQB 1Z73A 3Q9SA 4FYWA 4RVNA 4AJKA 5BSEA 1OX6A 1SBYA 1WDMA 1EPUA 1MX5A 4X85A 1EK6A 3LYUA 3KZVA 5EIOA 2ZYSA 4DV6B 2YVLA 4XE5A 4YMIA 4CM4B 1J2JA 3ZHRA 5FP0A 2RGNC 2X9QA 4KPUA 2ODEA 1LPSA 2AL7A 2IVFA 4XX1A 1SVUA 2UZIR 4OI1A 1L5OA 3H3FA 2K2WA 1U0OC 5D86A 5DGCA 1MJGA 4UU8A 3OT4A 1NVUQ 1RABA 4MWOA 1T25A 2NV0A 3PL1A 3PX7A 4L4YA 2RJNA 2H4ZA 4F4DA 5C2JB 3B1WA 1F6BA 1T1GA 4HWGA 3JQ9A 3D4OA 3HBNA 5BNTA 2GOYA 3INNA 1E0DA 2AC4A 2NU9A 2H2DA 1HV8A 4GVXA 4RTPA 3KSRA 5BVGA 3AGQA 4E2ZA 3JQ9C 3G2HA 1TGYA 4HKTA 2ILTA 3K2IA 3J80A 2ONYA 2FEXA 2Q29A 2RG1A 6Q21A 2JGEA 4RY0A 3S55A 2QBYB 1AKUA 1JP7A 2CWDA 1ZICA 4HNVA 3IQXA 5L3VA 3ROFA 5TMPA 4HEA6 3NPAA 3HKBB 5D3MA 2PRSA 4KUEA 4FS8A 3K9HA 5FPQA 1OFTA 3HNPA 5I9IA 5KVVA 3BXHA 4TM7A 2BDTA 3VI4B 3W1VA 3WR5A 1EWVA 2ZEJA 1GV1A 2R85A 4TRMA 1RQRA 2BFDB 4RK5A 5EHNA 2GILA 4X93A 1V9LA 2VHQA 1CD5A 2X2FA 4O4IB 3K71B 1Y1KE 3ET4A 1V1MB 4JJ4A 4QPJC 5FA5A 3TTUA 1QCCA 3QW2A 5DE3A 2YHSA 1JKXA 1QVVA 2AJCA 1M34B 2QJFA 1R2QA 4OHRA 4ZEWA 1X8KA 1XDGA 4OGWA 1LLQA 4R9SA 1UKVY 1N8NA 3FYTA 1ZUNB 2JKYA 3CX3A 3FY4A 4HWOA 2E2WA 4KIWA 3S2ZA 1PK8A 3MQFA 2QZ4A 2ZVDA 2H2WA 4G37A 3ZH9B 3LL4A 1P61B 1SIWA 5FPKA 4UVIA 3LCRA 2W2LA 4KKXB 4RENA 3LQRA 3H16A 4KXMA 1ZK4A 1M2EA 2AOUA 2I62A 3RVDA 5JFGA 2HXSA 1H4TA 3GLGB 2R8BA 1E79D 2WAOA 4U9UA 3OZIA 3WGVA 1TIKA 5AW5A 5L45A 1Y81A 3IVAA 5A71A 2UAGA 5C52B 1KFEB 3OY2A 1JA1A 1YK0A 2R00A 4MMYB 4KJXA 4CMIA 3DTVA 4I55A 1TYEB 1TA4A 1XZCA 5I7OA 2EW1A 4MR9A 1VYVA 5MDHA 4ER6A 1A4UA 3M70A 3VPBA 2V7QA 4O5AA 2QSUA 4PF1A 3EBLA 3RLIA 1C4OA 4QLAA 4ERNA 4DIUA 4ZHQA 2FWNA 1EVJA 2GZAA 1S2OA 3CR3C 5EKSA 4FFLA 4AZTA 5JYCA 4NYMR 1E9AA 1Q1BA 1ZM7A 1MQSA 3REQA 3B85A 1SVOA 3AOGA 3CLVA 2IW3A 3KJGA 3ZXXA 2RH8A 1P44A 4DC0A 4QKQA 4LN1A 3WJ2A 4HZGA 1U7OA 3K09A 4FMCB 1U9YA 2QLBA 1N2GA 2Q3FA 4MVJP 5IRCD 3MXOA 1KOJA 3LOUA 3N0RA 2H59A 4M9RA 4UE6A 2QW0X 3RSQA 5LZ4A 3L02A 3JQEA 3WQHA 3MT7A 4RVDA 1LZLA 1PJQA 1OOEA 1TZMA 4KXVA 5JJKA 1SPBS 4MW1A 1URPA 3N8KA 4O4LF 1Q6ZA 5D1HA 3MS7A 1LRLA 4RTLA 2MOKA 2KI5A 1DKUA 4QEKA 4F04A 3H4VA 3TL3A 3BGSA 4P54A 2F48A 4YR9A 1JBKA 1MO4A 1ONSA 2DSTA 3OOWA 4CPDA 2AJLI 4LG1A 5CG1A 4XWTA 1OTXA 2J4DA 4QBGB 4MROA 2PYIA 4D4JA 1XTIA 2VL7A 2ZI7A 1HY3A 2PL9A 1SU8A 3RS9A 1MTOA 2C2WA 3A9VA 3JPYA 3OX2A 5DO9A 4CEHA 5AW0A 1U0FA 3TLBA 5ICCA 2EFGA 5ED0A 4N0QA 3CU5A 4PXSA 5K03A 1YZFA 1TAHA 1IPFA 4G67A 2GWHA 1CF9A 3V34A 2D62A 3V55A 3ID6C 4DE5A 2CE2X 2HYIC 3I8SA 1D4OA 1XIVA 2ZSAA 3GT4A 3EPHA 2YICA 3CPSA 2WJPA 2G07A 4FN5A 4B3IA 5GV7A 3WXBA 1LPAB 1M66A 3HFRA 4D43A 3BHJA 1YGYA 3D4IA 4D9HA 2QGFA 1Y8QB 2DB3A 2HA2A 2QAGB 1B14A 2PCLA 3RK1A 4ZYUA 2UDPA 5EXEA 4BFTA 3PQ5A 4C30A 3U80A 2V59A 3MTGA 1CY0A 2X5NA 3DM9B 3D0OA 1A4XA 5H5JA 3OCVA 3RSHA 1HOXA 4ZQIA 3TR0A 3U40A 1ULZA 4BNYA 5A5DA 1O77A 5K0NA 4ZHSA 5ABPA 3EGCA 4MQUA 3D6VA 2VYNA 2ZJ2A 3I1IA 4B3MB 1CY1A 1QDLB 5FNVB 3LX5A 4D3XA 1IN8A 5M2QA 5DULA 1P1JA 4JEHA 5JLJA 5H1YA 1LDMA 4BNTA 4E5NA 2GO1A 3AP1A 5EWMB 2ODNA 1II0A 4ACAA 1A8PA 1CIJA 1FVHA 1R15A 3GPBA 4YP1A 4TMFA 5AJZA 4K81B 4OHUA 3WP1B 1IUOA 2WDPA 3WL8A 1UT5A 3I9V1 1V26A 5FQNA 2JKVA 4HN4B 4UM8B 3K35A 1N0UA 3L7JA 5JSQA 2QDXA 5EZ5A 2A9QA 2C5LA 4RFSB 1QQBA 3LT2A 2YJZA 3E48A 3LT4A 1HLDA 3A1CA 1ZH8A 3FRHA 5K0CA 3OLQA 4QEZA 3OKCA 1MB0A 1DKQA 1JU4A 3A9SA 3QVJA 3DCIA 2IH2A 3AVWA 3TZHA 3I92A 1FP6A 3IEIA 1I36A 1WLSA 4L5IA 2EJBA 2B0CA 3SZOA 3OIGA 2VT6A 4R1LA 2H5LA 2WSSD 3SYLA 3ILSA 4NNPA 3INTA 3SZGA 2FMUA 2YZ7A 4FHZA 1GCIA 1YQTA 3Q7IA 2D0DA 2W8BA 2BI8A 2PFSA 4K2HA 4R31A 5TQ2A 3T35A 4AMZA 4YUWA 1ZL0A 4IWYA 1CZHA 2P79A 1ADCA 3P2KA 4KV9A 3R0ZA 4KSBA 1UJ5A 4WLUA 4R2MA 4DLRA 1DX4A 4MVJA 2W6PA 2BZSA 3ITEA 2EYQA 1AUVA 4HAZA 1VKRA 1S1MA 2AN3A 2NTNA 1RAAA 4AO8A 4NBWA 1M5RA 2AMYA 2QD3A 2XKJE 4W9MC 3A2KA 3IALA 2H06A 4C7BA 2AXNA 4OHYA 4QREA 5EIHA 4TKVB 2FZ4A 4M9SA 4YB8A 4YEDA 1BOFA 3ZE1B 4D9GA 2GPYA 3NAMA 5AVSA 1NQTA 1Y7PA 2RC5A 2Y8EA 4H0NA 5BV0A 4LTDA 4J6FA 1UKYA 3M49A 3CTVA 2WG0A 3CY6A 1XAHA 4IIFA 1NQWA 4LYDA 4M4SA 4Q1BA 1W6UA 1V4NA 3OI7A 5EERA 3KUXA 1H1LB 2W7TA 3EH1A 3KUUA 3L04A 4WXRA 3G5UA 3X1WA 3DDZX 3TTXA 5BVGB 1Y9AA 3ZI7A 3D6HA 4E5PA 5IT9A 3LAWA 2PIDA 1SBNE 4BC0A 1ZCAA 1DT5A 3O4IA 4GECA 3O8CA 2VVTA 4KITB 2H7VA 4BU0A 3H2JA 4TKZA 2JK1A 4G4SP 3LLMA 1HDIA 1Y0BA 1EXVA 4PG7A 3R7DA 1U9ZA 3IUPA 3LC7O 3WWZA 4RHCA 4DVJA 3JCZA 1UKEA 1ZN7A 2H4FA 4MGYR 2F9LA 4LX0A 4RKFA 5FF9A 4QBTA 2XF2A 3SQWA 9ATCA 4ZYWA 2VP2A 2EATA 1K8XB 4IV5A 3CLSD 1S5PA 1NXTA 5AR1A 1YI1A 2HJHA 3OTWA 5AVUA 1W4CA 4U6SA 2XDQA 4EA8A 3AUJB 4P83A 2AW3A 3H9UA 3R5FA 4IV8A 4G0OA 2FPRA 1P77A 4PNEA 3K8ZA 1AE1A 1HSZA 1HSOA 2NZ2A 2PAFA 4ND3A 1Q95A 4AZ3A 2A35A 2ISCA 2GF2A 1U2DC 1GFIA 3G13A 2HEGA 2WKSA 3E8MA 4IQFA 3MGBA 4JOSA 1XA0A 2PZGA 1MP0A 3QKSA 5AVRA 4EZIA 2ERYA 2NP6A 4KE9A 2R6DA 4JQCA 2NXWA 1JNXX 3HO6A 1JIXA 4OB7A 5AK0A 3V2IA 3FVTA 4XQ9A 2PU5A 1KO7A 3N0WA 4CMIB 1CFJA 3HN7A 3Q11A 1NP3A 3WMRA 1RXVA 4QTZA 2PLFA 1M1XB 3ENNA 1S02A 3HJHA 4KLNA 1Z88A 2MINB 2WA1A 3T7AA 5CCEA 4H9GA 4L5AA 3KXPA 4P7KA 2VP3A 1S7CA 1PJ4A 1PO7A 2A8YA 2P3SA 3ETHA 4JYBA 5ECGC 1IXYA 3I09A 2UVPB 2V9PA 3I0ZA 4QUHA 2I34A 4GGMX 2ZAOA 4IL5A 2OA0A 3T7KA 1YXMA 3IMCA 4IJWA 1YB1A 3CTPA 1QX4A 1AKMA 3W9BA 3RRXA 3TRHA 2HX1A 1ORRA 2PD4A 3PCTA 4F38A 1KU6A 4X00A 2ZYVX 1D4FA 3IUYA 1BWRA 1PEKE 1RRVA 3JR3A 3PJDA 4HSEA 2XT9A 3D3NA 4IQ8A 4X6YA 5IG2A 3G8BA 4TLMB 3LQYA 1GPH1 3KELA 4K7JA 3NTXA 1ETUA 4WXPA 5LSAA 3PFNA 1EGQA 4AD8A 2C4MA 2WIAA 3CISA 1HNWB 1B3RA 1V95A 3DPIA 3A3OA 5EMNA 4Q18A 3STYA 4ITRC 2P3OA 1CEQA 4CKBB 2H57A 2D2EA 3K0EA 4I2NA 2X1HA 3UH0A 5C80A 1PT8A 1J9EA 1XTRA 3NW9A 4OGKA 2HL6A 4I5GA 2BD0A 5ILQA 3ROGA 3G2PA 4EI2A 4PN7A 2F17A 2G3YA 1TZ2A 3EARA 1DQRA 5BW5A 3O4GA 3CTMA 4HXYA 5BW6B 4UUQA 3QWAA 1PHRA 2GAAA 3P97A 1JE0A 3FPBA 4MZDA 4BKRA 2Y4NA 2BJWA 2ZJ5A 4EABA 2B94A 2BR3A 4AI6A 3AGPA 2O2IA 1AQLA 3N0VA 3PX2A 3TRJA 1N2HA 2C5SA 4LEIA 4WLOA 3RE1A 1QYXA 1Y80A 1YIDA 3FYUA 1Q3HA 3N2ZB 5IUKC 1Z7WA 2ZIFA 4RIFA 4UM5A 4E3WA 1KY3A 1D2RA 4AMVA 1VPLA 4YJKA 1KWGA 2ISSD 1A5BB 2Q3MA 5IHPA 4XIIA 4YCAA 4ALIA 4P34A 2ZRLA 4RSGA 1Y3BE 1UPBA 2FMFA 1AGRA 1TQHA 4L2IB 1XTSA 5EAIA 1NI4A 2DFDA 2HGSA 3VPHA 2ODWA 1Q0LA 2ZI4A 5EA2A 5BSUA 5IAAA 1Z36A 4F3RA 4HH4A 1UDCA 2Q3BA 5A5GA 4H0CA 3MJ4A 2P4EA 2CSXA 2J33A 3C3CA 3KBOA 1RQGA 3Q3VA 5E1MA 4K46A 3NWEA 4DLVA 3W5HA 2VQ3A 5DYYA 2LP4Y 1Z5OA 1B0UA 3ER6A 3ZE9A 1A77A 2CNBA 5JPCA 2RHDA 4Q3CA 3COPA 3WGYA 2BTEA 3D3EA 4C76A 1VMKA 1VKZA 3PCRB 2WD7A 3ZHYA 3D2LA 4CW7A 1LF0A 1HDGO 4P31A 3IUBA 3QLTA 1IQPA 4TTVA 5JVDF 2DULA 4HAOA 3WMGA 5BOSB 3TCXB 4I8DA 3LUGA 3E7XA 3PRYA 4L7QA 2CD9A 4PGFA 3RAPR 2I99A 1U4NA 2XCOA 5BSGA 1SCJA 1L4BA 1NGSA 3FETA 3UBTA 3QLUA 1I6MA 4YRQA 3R41A 1XJWA 5AKEA 2Q9BA 3K6SA 2V7XA 3QZUA 1JLHA 1CNMA 1O5OA 4X20A 4Z51A 2C82A 1KMIY 4JBHA 3M1YA 4NR0A 2YUTA 3C3AA 1CS0A 3WQRA 2ZIVB 3HB5X 4XM2A 3QLUC 4FHGA 3U7EB 3BD9A 3NIDB 4XPIB 2IELA 1XVAA 3HV0A 3G5MA 3NH6A 3O73A 4P92A 5FOXA 5IHXA 1M6YA 4AIIA 3QFFA 1GZUA 3W8FA 2HWUA 1V5FA 3MHPA 3HWSA 5EIBD 4HRAA 3DR5A 2ZJ1A 4GI1A 3AYXB 2IUYA 3S0JA 3IKJA 4ACBA 4NYIQ 1TD1A 4QNMA 1XT6A 1YB2A 2PGIA 3M5CA 2OB1A 5JUWA 3W2TA 1GT6A 2J45A 2WZQA 3KQKA 3TJMA 1I5RA 1NRWA 1DINA 4KIGA 4ZXFA 1JILA 2WVGA 4X1KA 5KSOA 2BHSA 1JQ5A 2VP0A 4EQ6B 5I7FA 5K3OA 4DPLA 4HRXA 4MVYA 1Z47A 2PXCA 4KN9S 2N42A 2ZT7A 4GSLA 3G8CA 4XWYA 3AQ4A 4B2PA 1FEZA 2VIIA 3C1OA 1A5TA 3OOJA 5DMHA 4WLFA 2C96A 2I54A 5GVRA 2R8EA 3GK3A 3MN1A 3O4HA 1QS0A 4OY3A 2NU8B 2AD1A 4N3NA 4NOLA 1PQUA 2J7KA 2GEDA 2GGSA 2HLDD 3IO3A 3K53A 3BE6A 3NHAA 4L08A 1ZMOA 4IF6A 3LQ1A 4TMZA 3VUEA 4LYHA 1MX9A 1Z5GA 2Y9YA 1QIEA 1U28A 1G3MA 3IVXA 3NRJA 1JPVA 4LQCA 4A8TA 3M1IA 3U62A 1YHZA 4TX1A 3OCZA 4HI0E 2HK8A 3UANA 4DQLA 2FZ5A 2OFPA 1P73A 4HC4A 4DCNA 1SUFA 3WLQA 4Q1AA 2JFVA 4JDPA 1GTJ1 5FBKA 4EFLA 2GJ8A 1WU7A 2E9SA 2PV7A 3AF2A 4LV5B 3VC1A 2E82A 3HYCA 4MMZB 1GRCA 1OCEA 1NXWA 3UV7A 5F64A 4MA4A 4F85A 3M4YA 3PXAA 4ZAWA 5IBPA 1CVIA 4F4FA 2ZOSA 4NS4A 4H6XA 4AO6A 5KQLA 4INPA 4I5DA 1CUFA 4JBNA 2ZREA 2W70A 4B2LA 2JGMA 3PSAA 2R66A 4CIVA 5EHQA 4WUTA 3I30X 5ANRB 2QMZA 4BNZA 4HMPA 5KAPA 3PTAA 3GX1A 2TMYA 5AJXA 2GNOA 3TQTA 3ZVLA 1NKSA 1UDRA 2PGNA 4ABYA 1DGQA 5LBTA 1QGUA 1NM5A 4QFDA 2JFOA 4R69A 2NLOA 1R6BX 4HNAB 4IGIA 4IJMA 1I3CA 3E22A 1YZTA 1BU8A 1AKYA 2VSNA 3OZEA 4A27A 4D8WA 1RI3A 4L07A 3I2FA 4QRDA 1E6UA 2QI9C 3M83A 3RS3A 2OKCA 4DCCA 5C9ZA 1NM5C 2QTFA 3CNNA 3U1BA 1DBQA 1ODLA 3FGOA 1W0JD 1J4AA 2DQKA 3NHPA 3DBHA 3QF4B 2D0OB 4F12A 4Z9XA 2CXHA 1CX9B 1XXLA 2WIGA 3U4QA 4GKJB 3A06A 3P20A 3OY7A 3D1VA 2PLAA 2D4AA 1J7KA 3E7FA 1HC7A 4H1UA 2PVSA 5KX5F 4FKBA 4I50F 3DT8A 3HWX1 3SEQA 1I7LA 1IMJA 1XFAA 5T67A 3KQOA 2X9GA 4UNIA 3L5KA 1UXOA 4JJEA 4QWMA 4XSVA 1N2CB 1EGAA 3LYAA 1X1TA 3UXEA 5B57C 1W4AA 3AIKA 1ZGJA 4B32A 3HCPA 4DCTA 2F4NA 3AM1A 3DC7A 1THTA 5JZOA 4NE2A 2H3HA 2YHUA 3D8RA 4PPQA 4OQYA 4M1YA 1NZDA 3R3SA 1ZU4A 3F0TA 1FDSA 3KHUA 3QQ5A 3A11A 3CLRD 3G8AA 4ZXPA 1M2OB 2V0CA 3R0XA 4J0FA 1Z5NA 2EKZA 2MSDB 1U8YA 2G72A 2IQIA 1RJ9B 2NO7A 3CNHA 1R66A 2QVGA 4FFVA 3T7IA 4BO7A 2B1IA 3UFBA 2G88A 1F1BA 4LJKA 4Y2QA 2EARA 3LLCA 3DW1X 1ENOA 3DE4X 1N5MA 3QFTA 4KZKA 1EFVA 2OBMA 3GU3A 4KW7A 4YCCA 2C4UA 4G26A 2XUAA 4BIIA 3OIWA 3RG8A 3MCZA 1WSWA 1ZJZA 1YZGA 4LY3A 3THRA 3VR0A 4D4KA 1CKEA 1K0UA 3NAGA 4MUHA 4Y0AA 4F4CA 1JHDA 5FEUA 1TUEA 1W1IA 1WCYA 3R7LA 2SKEA 2PX0A 5K2OA 3S1SA 1D1SA 1XP8A 1YR7A 3LWDA 3P9XA 1C9DB 4ENUA 2X22A 5HUHA 1SCQA 1U1GA 3EVNA 4K1LA 3BCSA 3RRJA 3HKCA 3TSWA 3TOZA 3D4LA 1S2LA 4A15A 2X13A 4ALMA 1SG9A 1OXBB 2I4IA 2IHVA 4XQGA 5CX4A 3JD4A 2HC9A 3ZHSA 2ISQA 1CQIB 1PDOA 2D2VA 1GHTA 2HF9A 2XSZA 4G5HA 4EDFA 3N07A 2IBTA 4P33A 1CUDA 5AHXA 1EE9A 1YNOA 2H1VA 2Y1EA 4C0SA 2V6GA 3E5RA 5HKKD 2INGX 5CHEA 2AK3A 3BTSA 4UQPA 2IHKA 2I0FA 3L07A 1X2EA 5K05A 3OE4A 1RKQA 4IHAA 4OHXA 4KGDA 1AQIA 5FBHA 2CDAA 2CJYA 3FROA 2CNWD 2JEZA 1RZUA 2PAAA 3NP9A 2IEIA 2Z2YA 3DWIA 4ZZ1A 3IB3A 1W47A 2YW2A 3DSRA 2BI4A 4CMCA 2AUMA 1RVDA 1UL1X 3DV2A 4U2GA 1NWHA 3TZCA 5JWRA 2H8GA 3S6JA 1PVDA 3AERB 4AYXA 4UMVA 3W5JA 3GZJA 1Y5NA 3AFNA 1PI3A 3KB2A 2AZMA 5JSZA 1IY8A 3PVCA 3GDFA 1WY7A 4FXPA 3C6QA 1RJWA 2J46A 3ZWKA 1FX1A 4BKUA 2W4IA 3OQIB 3DMHA 3RF7A 5C8YA 4BY9E 2Z9BA 4JASB 1JT2A 3LQ2A 3ZCPA 4EG5A 1YS9A 3GGPA 3IVCA 1ESNA 2ZTSA 4KXFB 3G7UA 1C3JA 2CDRA 1S6YA 1N5IA 5ESWA 3F46A 4L3WA 1YIOA 4QBIA 1Q44A 1M8GA 5BY2A 5K0ZA 3IEVA 4MJ3A 3RS0A 3PUXA 1RI4A 2TS1A 3GEDA 4PICA 3SU8A 2D2XA 4A73A 1TJPB 3IUMA 1GR0A 2XPCA 5CT6A 2QQ0A 3HL4A 5K3AA 1C8VB 4QUGA 3BVPA 3CZCA 4B2YA 3WICA 3C8DA 2YINC 1KHTA 3RLFA 2HFJA 1L2TA 1UPFA 1VMEA 1FNMA 3N2GA 1CZOA 3QE4A 4INOA 3BE5A 4LZNA 2WV9A 3Q98A 4II3A 3E1SA 2HPZA 2QRGA 3EZLA 1YCHA 4W5HA 3STVA 1GDHA 1KQNA 4NFHA 4Z4EA 1AQUA 1BCRA 4OVKA 4D9KA 3GRVA 1PJLA 4L22A 3K73O 3JYNA 1ZC4A 4TZ0A 3H0CA 2XEDA 1T0BA 3AUUA 3Q6NA 4V39A 1J8MF 2Q07A 2P3LA 3C74A 3EAQA 5DCWA 1F1JA 2VTEA 3A9TA 2OV2A 4KRXA 4Y8VA 3GRYA 4ZYVA 4DZTA 3F3YA 5EJ7A 5MN6A 3S81A 2BM1A 4EPRA 5CA0B 3C3EA 3GT7A 1YJAA 4YJ2F 1FMCA 3HGTA 5DBEX 2VUTA 1RPZA 2XXAB 4TZ6A 1QIKA 2NP7A 3A0UA 1Q1NA 421PA 2IHZA 4UTVA 3VH1A 1TU3A 3P71T 3M0EA 1O9HA 2GCGA 2NZVG 2FWJA 4M0KA 3PHJA 4E88A 5K6AA 5FEMA 2B4QA 4E15A 4AY2A 3O47A 3B9RA 1GT91 5HR5A 1NLUA 1ORVA 4JUBA 3H7AA 1G6Q1 1C30A 3OF3A 5F1OA 1Z2EA 4J4BA 1R9NA 3B1ZA 4KQEA 2XODA 1V11A 1E99A 4O2BA 2FLVA 3ZDQA 3TW8A 5K6AC 3ROXA 1U9IA 1XSEA 2G6TA 3KYJB 4LWQA 3FLEA 1IXSB 1Z6TA 1YQEA 5ITZB 4WQMA 2YWXA 1KI7A 1VRWA 1NVGA 4P1ZA 3G2OA 3S2GA 3IKMB 3GLKA 2EBHX 2EZ8A 3O7MA 4L28A 4C20A 1RMYA 3KTAB 5JSZB 3TLYA 2O1XA 3GLSA 1MB3A 5DXAA 1Z62A 3DUFA 4U7GA 3T1VA 3GG9A 3VYTB 2WG1A 5GMOA 1HG1A 1MC8A 4HRYA 4EB8A 3PFCA 4Y6QA 4UE2A 5AXBA 2E87A 1L5HB 1J56A 4MLPA 4DNFA 3Q1KA 3ESCA 1S2IA 4QIHA 5ADWA 4AJJA 3KL2A 4TTIA 4D99A 3EFOA 3GRUA 1I5OA 1I4LD 4EJ2A 3PXUA 3GPCA 1R6TA 1AXRA 1F8XA 1JVBA 1GYQA 1I1QB 3KAQA 4LDNA 1ZVVA 2IH5A 3EDRA 4M1EA 1N0WA 1ZEJA 3WHLA 2AV6A 2GAJA 4ILKA 4BNJA 1P75A 3BTVA 1TI7A 4WDQA 4C6SA 1ORDA 5EP4A 1W88B 4R7GA 1SXHA 3MSXA 1YBMA 5DWVA 3S8YA 4DMGA 3FGZA 3VPSA 4PWZA 2YY7A 1DOHA 4BVKA 1XU7A 2XQJA 2KMLA 3GGDA 3AKDA 4Q1DA 2Z43A 2H7XA 5T4HA 2UUAB 3U1VA 1XZKA 2C42A 3GUZA 1H6BA 4KQ6A 8ATCA 2D8MA 4ZQFA 1MAWA 2BT4A 5F12A 3SR0A 2GT1A 2ZAIA 1MRNA 2EFHB 3NVAA 4WKPA 1VCIA 1UDBA 2W6JD 3AR7A 4RSHA 4Q7MB 4Z2YA 3VHQA 4B3FX 4E1AA 3FFTA 4EAQA 2RCNA 2QT0A 1O89A 3FNRA 3WGQA 4OJTA 4RD1A 3SZRA 2XW6A 1TC1A 1XLVA 2C20A 3BJZA 2W6CX 3Q72A 1D3AA 2C99A 4MVXA 1M2WA 4OXKA 1ND6A 5ERXA 4G0NA 3UKDA 1X13A 3Q3IA 3GFRA 1T0UA 1WXXA 5C81A 4AMUA 2HI0A 2G36A 4EYEA 2VDRB 4TQ9A 3TIFA 1GN8A 5A02A 1YVUA 4WOCA 2UZ4A 5DK4A 1IN6A 2G04A 3NGLA 4LDRA 4LYAA 3BH6A 3GJ0A 4PIPA 5AUNB 5CVEA 3D3KA 2ZR0A 3OEHD 1JTEA 2FKNA 2IHTA 1RCTE 5EE9A 4LDPA 1EP9A 1RHKA 2HWWA 1GCAA 4E0BA 3NYQA 3PKZA 4OU5A 4RO0A 1T43A 2VDPB 3EVDA 1YR6A 3EXFB 1TQ8A 4KI7A 1Z5ZA 1GPYA 1RLUA 4FMPA 4QPZA 4V1CA 3OEED 3R77A 1XNJA 4AUEA 2NX2A 3RYHA 1FB5A 2C8KA 5EVCA 3DMTC 4YI3A 2FU5C 2FPSA 3ORSA 1MB2A 4LBYA 1XJCA 4B4VA 1L5NA 3PUYA 4ZU3A 4Z3DA 1U7UA 2JJ1A 1D09A 3DL7A 1IVSA 1RYFA 2O1EA 4CHGA 4IF4A 2O8CB