3IQDB

Structure of octopine-dehydrogenase in complex with nadh and agmatine
Total Genus 121
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
121
sequence length
403
structure length
403
Chain Sequence
TVKVCVCGGGNGAHTLSGLAASRDGVEVRVLTLFADEAERWTKALGADELTVIVNEKDGTQTEVKSRPKVITKDPEIAISGADVVILTVPAFAHEGYFQAMAPYVQDSALIVGLPSQAGFEFQCRDILGDKAAAVSMMSFETLPWACRIKEFGRKVEVLGTKSVLAASLIKGTAKTVDPLSTLQMLHGAEPVFRLAKHFLEMLIMSYSFVHPAILFGRWGSWDGKPVPEAPLFYQGIDQATADMLTACSNECKDVANAIMAACPGNDLSDDKDIYQWYLEYYHEDIQDDHDLYHAITTNKSYKGLVHPVKAVDAGVAPDFGNRYLTEDIPMGMIVFKGVAIAAGVAIPSNDKLIMWAQEKIGKEYLVDGALTGKDVATTRCPQRYGFNTLDAILTGKKHHHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Octopine dehydrogenase
publication title Insights into the mechanism of ligand binding to octopine dehydrogenase from Pecten maximus by NMR and crystallography
pubmed doi rcsb
source organism Pecten maximus
molecule tags Oxidoreductase
total genus 121
structure length 403
sequence length 403
ec nomenclature ec 1.5.1.11: D-octopine dehydrogenase.
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF02317 Octopine_DH NAD/NADP octopine/nopaline dehydrogenase, alpha-helical domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 3iqdB02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3iqdB01
3KSDO 4NI5A 5T8KC 4GPD1 4N5NA 1VKNA 1UH5A 3VTFA 1U3TA 1XEAA 3DZJA 2C7VA 3JD3A 3IJPA 1ML3A 3RKRA 3F6YA 3OA2A 5EIOA 4QO7A 3AU9A 1DPGA 3QRWA 5U4QA 2PGJA 1W73A 4INAA 2GYYA 2AQ8A 2NNLD 3B70A 3BYZA 3IMFA 2NQ8A 2Q1SA 3NJ8A 5KJEA 5A03A 2B5WA 3EUWA 4BMNA 4FC6A 1WP4A 4D41A 2VRCA 4NBWA 1T4DA 1Y81A 3SBOA 2UV8A 3AU8A 3PDJA 3M2TA 2WEKA 1ADBA 3AW9A 3GGGA 4FQ8A 4R1SA 3QSGA 1D1SA 2VHZA 1GYQA 2D2IA 3I9KA 3Q11A 1NPYA 2CVQA 2I6TA 5TQVA 3U3XA 5C3MA 4QFCA 3SLKA 1PQUA 2ZTMA 1NWCA 3LT0A 2YV1A 2NADA 2O23A 3RUHA 3TF5A 2RHCA 1CYDA 1HLDA 1ZMTA 1Y8RA 2Q49A 2RIRA 1Y1PA 3RUEA 5JMWA 1U3UA 3D5QA 5DCUA 1GYRA 4HKTA 4EDFA 1RM4A 1NPTO 3TOXA 4UUOA 3ZGYA 4XYMA 5CDSA 4U6SA 5TRTA 3DO5A 5IZCC 1EVJA 2J5RA 1C1DA 4CODB 1JTVA 1YL6A 1F12A 1TLTA 3GDOA 3L4BC 4YAGA 1JWBB 3TL2A 1LDBA 3O38A 3ETEA 1U5CA 5IF3A 1E3LA 4ND4A 1NBOA 1PS8A 3MCVA 3AI2A 4J3FA 4J91A 3ZWXA 1PJ4A 3P2OA 4BO7A 1XR3A 2HJRA 3LC2O 4J4BA 4DLAA 1K5HA 5EQFA 4DLBA 4X54A 1D1TA 3H4VA 4D43A 2Y05A 1DIRA 3QY9A 4CMCA 4I5FA 4K9DA 3WMXA 1GV1A 2CDBA 3PJDA 2GRAA 1LQTA 2A35A 2JCVA 4CPDA 4JROA 4I5EA 2VYNA 1LSSA 2DM6A 4BO1A 3ZHBA 3IKVA 3PJFA 3UCXA 3MOGA 1FJHA 2E4AA 5HRUA 2GF2A 3KEQA 4EI2A 2IZ0A 3ITKA 3VHRA 4QSMA 1NHGA 2BGKA 1D7OA 1I2ZA 1M67A 2CDAA 4J1SA 4XZ3A 3WGTA 4ALKA 3RUDA 1PS9A 4NJMA 2H5LA 5C7LO 2AE1A 3H2SA 3WIDA 1W6UA 2DPHA 2JL1A 3ZWWA 5JC1A 3GLQA 1E1KA 5ADHA 3QHAA 1KERA 3JV7A 3ZWYA 4ND3A 3KYDB 2PGDA 1DHRA 3GDFA 1K3TA 1X1EA 1IOLA 5L7YA 3WFIA 4MP6A 1T2FA 3Q1LA 5JAIA 1Z7EA 3KZVA 4E0BA 4BMVA 3HADA 3WYEA 3C7DB 1O6ZA 7MDHA 2C29D 2NU6A 2PD6A 3TDKA 3TZHA 1GCOA 4M8SA 3JQBA 4QTZA 2QZZA 3PWSA 1MP0A 2X86A 4BGVA 4WUVA 3FR7A 1QV7A 3ANMA 3ZHXA 3LT2A 3EK2A 4W9NC 1I3LA 5HTOA 1H6DA 3WGIA 2GN9A 2ET6A 1EFKA 2ZTUA 4CQLB 4GQAA 4ZHSA 5CP8A 1E7SA 3U0BA 1R4NB 3DOJA 1CEQA 2BFOA 2O4UX 1KY5A 4CM7A 2QW8A 4P38A 3TZQA 2Y0EA 3HNPA 1DDOA 2HKIA 3SJUA 3CKYA 3RFTA 5GZ6A 2FZEA 1I10A 4RPHA 3G3EA 1U2DA 2BRUA 4PLCA 4DIFA 3TQHA 1NVGA 4FOOA 1KC3A 1SZJG 4HFRA 2VWQA 4UEKA 1ISJA 4NQZA 4LW8A 2QYSA 4A5OA 1R6DA 4Z3KA 5BNTA 4GSLA 4J2HA 4CM1A 4TZKA 3QJ5A 3PFFA 2ZATA 1O89A 3DFUA 2XXBA 4AJPA 4ZICA 3WNVA 4R51A 2P9EA 3JCZA 3QLJA 4J7UA 1ZEMA 3K30A 2G76A 1ZW1A 1XYGA 3W4KA 4ZQHA 1PJCA 2XXJA 1E3SA 2WYUA 3GVCA 4Q9NA 2WYWA 1UXIA 4M55A 1WMAA 2EXXA 3FR8A 3GZ4A 3UW3A 3VPHA 1HZJA 3F4LA 4BB6A 1IPFA 3NTOA 5TNXA 1HETA 2VYND 4HY3A 1F14A 2NVBA 4BO2A 5A9TA 1MXFA 1XDWA 2Q2VA 1GQ2A 3MWDB 3TNLA 1V8BA 2I67A 1UAGA 2FR8A 3CEAA 1DLIA 4JGBA 1A9ZA 1BWSA 3PWKA 3GMSA 1X7HA 3MJVA 3PHGA 1VE9A 2P4QA 6LDHA 5L95A 3FHLA 3LDHA 4FFOA 2WWRA 3JYNA 3TZ6A 3WQQA 1DSSG 3A9WA 4FOSA 2DFDA 2WJPA 3DBVO 5TJHA 3RKUA 3ZU3A 4PG8A 4OXKA 3I1JA 5U1PA 5MGBA 1E6UA 2JHGA 4ZRMA 3U9LA 3GNQA 3H9GA 1RM5A 1JA9A 1WW8A 3RROA 3LLVA 3I52A 3QE3A 3S55A 1ENPA 2PZLA 4G81A 5KVSA 1HLPA 3DQPA 5IDYA 4IINA 1EVIA 3VZQA 2DBVO 3GGPA 3NAQA 5TLSA 1LRLA 2BFPA 1BGVA 2FY8A 4B3JA 4QEDA 3GHHA 1WDKA 1FK8A 3VH3A 1H6AA 3EMKA 1DJQA 3U4HA 1Z45A 3QWBA 1TT5B 5BNFA 4E21A 2V6GA 1BW9B 2DT5A 2YZ7A 3AJRA 3GUCA 1O8CA 3AM5A 4TSKA 1B2LA 1T26A 1TXGA 2O50A 4OYRA 3KM0A 1ISMA 2NVWA 1B3RA 2W98A 4K6FA 5ER6A 3U49A 2C5EA 3WIEA 3ADOA 3HB4X 3KYDA 4NPCA 1KETA 1I30A 2HK7A 2P9GA 2O3QA 3A14A 2OHXA 4WLEA 4CMBA 4BIIA 2EV9A 1OC2A 2D59A 4FGSA 4YT5A 2J3KA 3WLFA 1SC6A 5B4UA 2EEZA 3UXYA 3PFWO 2B37A 3DXFA 2B83A 3GVPA 4NMHA 4L4XA 3V2GA 1EBUA 2CF6A 1IE3A 2F00A 4OQZA 4H7PA 4WCFC 5EN4A 1DAOA 4BB5A 3JQ9C 4NU6A 3SJ7A 1QLHA 4A27A 1PWXA 4CV0A 1YDEA 4GSKA 4QO8A 2RHRA 3UH1A 2FPPA 1W4ZA 4IS2A 4PZEA 4U7WA 3V2HA 3WR5A 1T4BA 5AYVA 4D3FA 1JAXA 3I6QA 4YA6A 3PWZA 1F0YA 3CZRA 3L6OO 3I4FA 3WGOA 4D3DA 5IN5A 1T2AA 4JJIA 1HKUA 1VPDA 1T2DA 3SEFA 3F1LA 2O4CA 1P31A 1WAMA 2W2KB 4E2XA 3INRA 2VQ3A 5G4LA 3RBVA 3JQ6A 3LU1A 4ALLA 3IP1A 2IEBA 2Q1TA 2VZ0A 2AXQA 4XYLA 1LRKA 2JAHA 2LDBA 3DONA 4GKVA 4GX2A 3RD5A 3EAGA 3FNGA 1RYDA 4Y9DA 1I8TA 1FDTA 2PKQP 3K2EA 4MKZA 4PVDA 3SC6A 1SNYA 4W7IA 2DTEA 4FPXA 1ZXBA 5A3JA 5L4LA 1E3IA 3H9UA 3FWZA 3RIHA 4ALIA 3QIVA 1P0FA 2DPGA 4CL8A 1HE2A 3JQFA 3EZYA 3WGGA 1ZJZA 2GR9A 5JW6A 1EUZA 1A7AA 4CLOB 1SBYA 3BHJA 3NEPX 3ROQA 2IRWA 2JKVA 3TRIA 5F1KA 1Z75A 4GMGA 1D4FA 3OECA 4J2OA 2WD7B 5FF9A 3P19A 1AUPA 4BNHA 1NVTA 3JYQA 4ZQBA 5BNIA 3Q6IA 5EPOA 5DT9A 2O2SA 5CDUA 5C7OO 2DAPA 5I8ZA 4JXKA 1O0SA 1YE3A 2IXAA 4DVJA 3GQVA 1YRLA 4YYZA 1WWKA 4XX0A 1B14A 4L4SA 4PRLA 4RF3A 1OBFO 3WGHA 2J6IA 2YQ4A 4PLZA 4XYEA 5I7FA 2ZB3A 5CDGA 1SPXA 1FDUA 1X1TA 3WMWA 5T64A 1OZAA 3L77A 5I7EA 2AQHA 2Y1FA 4YWJA 5A9RA 2QRLA 2C2YA 3ZW8A 5G0UA 4B7CA 5G0SA 5JAQA 1TI7A 4YACA 1HTBA 4UVDA 1ZIDA 1I24A 1CWUA 5THQA 1TT5A 4JK3A 1BW9A 1LSOA 1P45A 4IS3A 4DRYA 5JDCC 3HDQA 1EBFA 4P8RA 4YRDA 3WB9A 3E9NA 3FPLA 5BSHA 4HX5A 4KZPA 2C2XA 4K26A 4B8ZA 4JBHA 1MFPA 2Z1NA 3UUWA 1WXDA 4DC0A 4E33A 4YAIA 3I5MA 3INGA 1PJQA 3GF4A 3C1TA 4KDEA 2UUOA 4J1TA 4CLEA 3OHSX 5DOZA 2WSBA 1LLUA 1U7TA 2FR1A 4K6CA 3LYLA 1X0XA 1EVYA 2AQKA 2JD0A 2PD4A 1TT7A 3RQSA 4BQRA 4CMEC 5CEFA 3PGXA 2Q45A 1X0VA 1DRVA 3PYMA 1HRDA 4RPLA 1SEVA 1X15A 4HWKA 1JQBA 2P5YA 1DIAA 5A3VA 5LCXA 2NSDA 3NYWA 2BGLA 4IZHA 2PKRA 3B1KA 2VT3A 5B1YA 5TF4A 3PZRA 3WTCA 3GN1A 4GLOA 4PIVA 3BMQB 3HJAA 5KKCA 1V3TA 3L07A 2NTVA 1EE9A 4ITUA 4QX6A 2DTDA 3I9NA 2F1KA 4A7PA 2W2KA 3R3JA 1BDBA 4KQWA 1Y7TA 5BQFA 5I9NA 4Y6PA 2X8LA 4BGIA 3GK3A 2DKNA 2HMSA 1LEHA 1ONOA 2BHLA 3NT2A 1P1HA 1I2BA 1LDGA 4OSOA 1LDMA 3AFNA 1CF2O 4FJ1A 2G0TA 2QZ9A 3RFXA 1GEEA 4D3SA 1Z7BA 1EDOA 3KRTA 2JHFA 4GVXA 4WK6A 1SOWA 1E3JA 4BO8A 3TFQA 4XQEA 3D4PA 3P2YA 1GL3A 3A1NA 3DDNA 1E7QA 3FN4A 1PJTA 2ZB4A 3MJCA 4E5MA 2H9IA 2JFGA 4N18A 3OJLA 5A05A 3UAGA 5FYDA 3IUPA 2B4TO 1C0KA 1I2CA 2BI8A 4R16A 1UDAA 2VHVA 5DOVA 5A5FA 2XOXA 3KYCB 1B8PA 1YQDA 4RVGA 2WD7A 2ZIZA 2X0NA 5HWSA 1EE2A 1YL7A 1UR5A 3VDQA 4QT0A 1PGNA 5JFOA 2O3SA 2H63A 1HSZA 1Q0HA 2UVDA 4ZQGA 4BNMA 1DEHA 1E3EA 2EJVA 3RUCA 1MFZA 3QQPA 4R9RA 4EUHA 3PJEA 4I08A 2E37A 1EMDA 3IL2A 4DQXA 4TZTA 1BXKA 1NHWA 1KOLA 2OXIA 1QYDA 2OFPA 3H9JA 5TJ9A 3QV1A 1UUFA 4RZIA 5A5EA 1PJBA 2D8AA 4WEQA 2RBEA 1LNQA 3WWZA 4NFYA 1E92A 4Z0TA 2GN6A 3OETA 2WDZA 3GG2A 2H1SA 2HJSA 3DHNA 3AOGA 1AXGA 4XR4A 4L9RA 1H2BA 3BMCB 2AG8A 1MC5A 4DIOA 1LTHR 4ZA2A 3JQAB 1L7EA 4BV9A 5KVVA 2Q1UA 5GZ3A 1CIVA 2FMUA 1R12A 1T2CA 3ZNQA 3K96A 4M89A 5JO0A 2XAAA 4KQXA 4NU5A 1FMCA 2X5KO 3VPGA 3A06A 3NKLA 3VPFA 5IDWA 3DAGA 3QVXA 1RKXA 5KNLA 3AUSA 3WYCA 5JBIA 4O59O 2D1YA 1ISHA 4WLUA 4AJIA 2PA3A 5U9CA 1GU7A 1IB6A 1U2GA 4UEOA 1SAYA 3L4SO 4YAKA 4BO3A 1YJQA 5CAEA 3CIFA 5ENVA 3Q9UA 3WSVA 4QQRA 1UP6A 1Z73A 1ZVMA 1X7GA 3DFZA 1HSOA 2Z1MA 4CUKA 1HDYA 4DQVA 1I01A 1PGQA 4DYVA 2W2LA 3AK4A 3U4IA 2QIOA 2NVUB 1UDCA 2OZPA 2WTBA 2CMDA 2NM0A 4OSPA 4IDAA 1N7HA 3JQ7B 4IY1A 3V5NA 2CFCA 2VUUA 3NJ4A 5A04A 4XRRA 3C3XA 5JPIA 1HDGO 1DJNA 3GNSA 4EJMA 1I0ZA 2Y68A 4MOWA 4YJHB 3ZWCA 1ULSA 4R5HA 1ADGA 1P1IA 1PJ3A 3OSUA 4CLRB 1PEDA 4MVJE 3L9WA 3NT5A 4R1UA 2DBRA 1IZ0A 1O5IA 2GZ3A 1UXHA 1ZKMA 1P1FA 3Q3CA 3NX4A 4XCVA 3DBHB 5BT9A 3ZHYA 3QVOA 5KVCA 4R5MA 5KVQA 1S6YA 4LSWA 4RVDA 3IS3A 4MO2A 1AN9A 1EUDA 3K6JA 4O63O 3F5SA 3BMOB 3ENKA 1IUKA 5K6AA 2Y99A 3BTOA 3K73O 5LDGA 4YPOA 1AXEA 1KEVA 1TB4A 5JCXA 3CMCO 3E8XA 1J6UA 2O3RA 1XA0A 3PK0A 4ZQEA 3JQBC 3WXBA 3S8MA 2AEFA 2O7QA 1Y9AA 2VUSA 4KMSA 3WBBA 1M75A 1EUCA 3H9EO 3DR3A 4XQGA 2HK9A 3JD2A 4GKBA 4A73A 3NDIA 1HZZA 2PR2A 4Q3DA 2GN8A 4WLFA 1C0PA 4GL4A 4ND2A 1MG0A 1ZK4A 3DOCA 3IAHA 4YVFA 5ILOA 1P77A 3M1LA 4OAQA 4XGKA 4PLHA 4XRGA 4HFMA 1PZGA 2Y1CA 4XQ9A 3H5RA 4FCCA 4A0SA 3IIEA 1KVSA 4EZBA 5CPFA 1OOEA 1T25A 2X0IA 1HWYA 1PU2A 4FFLA 3ZW9A 4A03A 3LT4A 2QYTA 2CVZA 1C0IA 3BMCA 2B35A 1GZ4A 4J0FA 4J49A 3EVTA 3WS7A 4Y67A 1XG5A 4QECA 2ZK7A 4GX0A 1LDYA 2D5CA 1J4AA 3DOOA 1HF3A 1LC3A 2G17A 3KSZO 4A10A 1K2WA 3ONEA 3UCFA 3UHAA 4E6PA 3SLGA 3OEWA 1ZO8A 2XF8A 1MLDA 5JYEA 3AWDA 3UOGA 4Q3AA 2W2LD 2VHXA 4IM7A 3ORFA 3ZWNA 4F6LA 3R3SA 4BNNA 2P5UA 2VNSA 3T4XA 1FXSA 2C59A 2EW8A 3DHEA 2GCGA 1O9BA 2I99A 1DOHA 4XDYA 5EESA 1KBZA 3COSA 3K92A 4UUPA 1LC0A 1NR1A 3BA1A 1LA2A 3WNQA 4E3ZA 1G0NA 3PIDA 3HQ4O 4AICA 1GFSA 2VNAA 4UVHA 3PYLA 3VKVA 2DBQA 1K6XA 5F21A 1DIBA 4CQMB 4BO0A 2PFGA 4BNZA 3OJFA 2I3GA 1N9GB 3VZRA 5ITVA 3LK7A 4CMJA 3BZUA 4XKJA 5JAMA 1P9LA 2X6TA 4Y6SA 4LGVA 5IFLA 2UYYA 4G2NA 3PI7A 1G0OA 4FDAA 4BNGA 4PN3A 2HU2A 4ALJA 2Q4BA 1NAIA 5C7IO 2VZ8A 4YJFA 3JQ7A 1Y6JA 3AOEC 4U0KA 4IQGA 2FSSA 1HE4A 1H9AA 4UVIA 1LLCA 2PH3A 3ONDA 4U0JA 5JE8A 4CLRA 1B8UA 1AHHA 4HP8A 4XR9A 4E30A 4FFNA 4JX8A 3DBHA 1QYCA 3DBLB 3RU7A 2FP4A 1GPJA 2V7PA 1ZJYA 3T7CA 4AJ2A 3JQGA 1NNUA 2EKPA 4TQGA 1BXGB 4NIMA 3LF1A 4PG6A 3BMOA 2VTEA 2EKLA 5C37A 1GADO 3H8VA 2RAFA 4MPDA 1PZEA 5BSGA 4E12A 3NTRA 1IY8A 2BKAA 3RU9A 4C7KA 3HDHA 1P1RA 3FI9A 3ZNPA 1TA4A 1ZCJA 3JD1A 4UEJA 1ZFNA 3UF0A 4AJ4A 1EK5A 5MDHA 4L74A 2GZ1A 4TRMA 3DL2A 3GN2A 1PL8A 3Q2KA 4RF2A 2QRKA 1LU9A 4PG4A 4YJGB 3VDRA 4DREA 2J5QA 1IULA 1BVUA 4W4TA 4CR7A 3CTMA 1ONPA 1BVRA 4IMPA 3TFOA 2Y1EA 1Z82A 1ENOA 4KTVE 5FWNA 2B5VA 3CE6A 1V6AA 3PRJA 3ICCA 4BOYA 4CR8A 2CF5A 3HSKA 2BH9A 3K5PA 3KBOA 3I9LA 3FTPA 4JJGA 4XYGA 4YR9A 4N5MA 4U8GA 4I5GA 3DWFA 2IE0A 4EGFA 3GY0A 4OKNA 1EDZA 1ZK2A 2Y1OA 1PSDA 1ZH8A 3D7LA 3PYXA 4ESOA 2GGSA 1YB4A 4H15A 5B4TA 4DYDA 1P1JA 3VTZA 3PXXA 3DZIA 1KVUA 4K1LA 1XKQA 4YXFA 4Z6KA 4FC7A 4IQ8A 4RZHA 4AJKA 4RORA 4PLTA 1GQQA 1R0KA 1W8DA 3M6IA 2EW2A 5JNLA 4ZJUA 4IDFA 3FRJA 4CJXA 4FW8A 2E82A 4ZU3A 2DQ4A 2J5KA 3JQFC 3QWAA 2W8ZA 1WDMA 4O5OA 4TKLA 3C1AA 1RM3A 4MVJH 4LMRA 5EINA 3ZWBA 2HAEA 5J23A 5CDTA 4BNWA 4NH4A 1O95A 3MTJA 3PIIA 5DP2A 3GUYA 3MWEB 5JC8A 4UAGA 4Z3DA 2GDZA 3H7AA 2WYVA 5I7SA 3HWRA 3KSUA 3VZSA 4GGOA 2ZJ0A 4BKQA 4FJ0A 1PR9A 4CM5A 1GQYA 2CUKA 1VL0A 4FFPA 3ZWVA 4B4WA 3QWIA 1KY4A 3CZMA 2EF1A 1GUZA 1DBVO 1E1NA 4E13A 2O3UA 4RL6A 3S2FA 1QMGA 3HB5X 3TJRA 2QRJA 2NUAA 2FR0A 1GPDG 3D5TA 3AOEA 2VN8A 4R69A 2UAGA 3V2UA 2Z5LA 2YYYA 3GG9A 1UXKA 4BGUA 2A4KA 4DPMA 1LSJA 4TMFA 5L53A 4RV9A 1L1FA 2JD1A 4BNVA 2NTNA 3TN7A 3LF2A 2EGGA 3LZ6A 5F1OA 2FZWA 1U5AA 1PJ2A 1NQOA 2FPGA 5I7VA 1E5LA 2NV6A 2XPCA 4YCAA 3E9QA 2GASA 1EQUA 4FJ2A 1FDWA 2O3JA 4BUCA 4YBZA 3OICA 2PY6A 1BXGA 4YTEA 3C7AA 2Q3EA 3H5NA 4UVGA 4NBVA 1HT0A 3V1TC 2HDHA 1QORA 1T2EA 2DTXA 4WLVA 4BQPA 4GX5A 2PLAA 2Z95A 1RJWA 4YJDA 3JYOA 3EC7A 4CMHA 4XD2A 4D46A 3WYBA 4C4OA 5KJCA 4D45A 3O03A 1OFGA 5FEUA 3H3JA 2G5CA 4WOJA 4CQLA 5TS3A 4DC1A 1X13A 1N1EA 5T57A 4CMGA 3WFJA 1R4NA 3H6KA 1N5DA 1Y5MA 3P5SA 1GZ6A 4YJGA 4EBFA 1M76A 1E0DA 3JQEA 2ZTVA 4RVFA 4XGIA 3JQDA 1I3NA 5CPBA 2VHYA 1M6WA 2D4AA 1E77A 4TRJA 3O4RA 3IUSA 3VOSA 1KEPA 5ENDA 5KIAA 4BMSA 3H2ZA 4RQUA 3JQ8B 5DZSA 2W4QA 3ZWOA 3WBFA 1DHTA 1JW9B 4OQYA 4QFDA 3OH8A 3QWFA 2Y0CA 3M1AA 3RI3A 1FF9A 3G0OA 2NU8A 2IYPA 3JYLA 3ZCXA 3FCOA 5LDHA 1ZBQA 4IDEA 2OGUA 5IDXA 4FFRA 4PG7A 1TEHA 1LDEA 4CQMD 1NFFA 1SOVA 1U28A 1KS9A 1Z6ZA 4GMFA 5JO9A 4BS9A 1MB4A 1QYVA 3E82A 2D3TA 1NWHA 1E7MA 4MINA 1B3BA 5KJ1A 1QYWA 3F1KA 3VH1A 2P68A 2DFVA 4NZ9A 1T1RA 3OIFA 3PHHA 3BTVA 4FBGA 3PQEA 3W1VA 5K9ZA 5IJZA 4E5NA 1D3AA 2FRDA 2JAPA 4RLSA 3IKTA 1L7DA 2I76A 4CV3A 1UZNA 4BO4A 5ITWA 4GH5A 3HN7A 2VHWA 4KTTE 1E7WA 4DLLA 2HMVA 4WJZA 5L3ZA 2V65A 4JLWA 4GWKA 4N7RA 1K6IA 2BI7A 5G4KB 4BNIA 1G6KA 2X9NA 3EZLA 3SVTA 4J16A 4ALMA 1CJCA 4BGEA 4R4JA 4P4LA 3LQFA 5JY1A 3OEYA 3ITDA 5T67A 3ZDFA 4II3A 4XB1A 3WG9A 2CY0A 1ZK3A 3QVSA 4OXYA 5DBFA 4M87A 2TMGA 2PTGA 1E1LA 1HDXA 3C85A 3LLSA 3RSHA 3GH3A 1JU9A 4WNCA 4XJTA 1ISFA 1K0UA 1W0CA 5GY7A 4R41A 3BXXA 3GA0A 5JY6A 5L9AA 1BRMA 4YRAA 1JWAB 1R4MB 4CM8B 4H3VA 3ZNOA 1P3DA 1SCUA 4G65A 1C1XB 1YXMA 1U9JA 1NYTA 5AXCA 3RUAA 4MJLA 4LVCA 4XIYA 3A28A 4Q39A 4E5KA 4ONEA 1ID1A 4RPJA 2WD8A 2PZKA 4J1QA 3GEMA 1DB3A 3HHPA 2VOJA 2D5AA 1HDOA 5EMHA 5LC1A 5DCWA 1WVGA 3E5RA 3HFGA 2JJYA 1BDMA 1PS0A 3T7EA 3VKUA 1HYEA 4B4VA 1P1KA 2BFAA 4OM8A 1A9YA 4NJOA 1AHIA 4XQCA 4Y98A 4J4HA 3KYBA 4DPKA 1K6JA 4XA8A 1H94A 3D0OA 3OIDA 4EEXA 4N5LA 1MV8A 4FB5A 2ZYAA 1QR6A 4ZGWA 1BXZA 4YQZA 1V3VA 5G2OA 4R01A 5DCYA 4CV1A 3DMYA 5KTKA 1XU7A 1OI7A 5TX7A 4KUHA 2WE7A 4IPTA 1ENYA 3ANNA 3X2EA 4MP8A 4RPKA 3DEYX 1LLDA 3CXRA 1XQ1A 2C0CA 1VL6A 3M2PA 1BTOA 1ISGA 1Q1NA 2E49A 2LDXA 4F45A 4RLHA 3O8QB 4WPGA 3CTVA 5F5NA 1BSVA 1FDVA 4ZQFA 3V1UA 4MKXA 3DTTA 3OJ0A 1PL7A 1IL0A 1UXGA 4PLGA 1E7YA 3WWYA 1YWGO 4IUYA 4DA9A 4EJ0A 1DC6A 3GT0A 1HYHA 3DZFA 3QA9A 4NG5A 4DIBA 5JDIC 2YQ5A 4AJNA 4BNLA 1UDBA 3I23A 4PZCA 4FSHA 1LRJA 1NPDA 1KVTA 2GN4A 1NXQA 1I3KA 1ZSVA 3JYPA 2PD3A 1EZ4A 2D0IA 3GDGA 4OOFA 1GD1O 2BLLA 4CLOA 2O2YA 5K6AC 2EKQA 4BO6A 3E6AA 2PZMA 1VM6A 2V6FA 4R1TA 2AQIA 4J7CA 3LC1O 2CVOA 3VVBA 3K8ZA 4AJ1A 5EJ2A 5ICMA 3ENNA 1F17A 3C7CB 1C3VA 3JD4A 3DAFA 3RBXA 4E2WA 3KTDA 4YAJA 1RPNA 4AVYA 2X7HA 3D3EA 5IXYA 3L6DA 4I8XA 4IGEA 4MIEA 2PNFA 1NQAO 4ID9A 1IZ9A 4HFJA 3BMNB 2QG4A 4F6CA 2QHXA 4ROSA 3I4CA 1GDHA 2P9CA 2DUWA 4EEZA 4OL9A 4DMLA 2IODA 3BTUA 4EUEA 3U4DA 3UVEA 3D64A 3DTYA 1NR7A 3MJSA 1JDJA 4NFSA 3RC7A 4B7XA 5ES3A 1NFQA 4CMIB 1A72A 3SC4A 1SO8A 5T6BA 3HG7A 4B79A 3H65A 4I9HA 4CM8A 4MIYA 3N74A 1A5ZA 4IZIA 4ALNA 3EDMA 3AUAA 4BKOA 4ZD6A 1C1XA 3UN1A 4I5DA 4Q3CA 1VSUA 3PP8A 1I32A 1I33A 5KWEA 3GC6A 3MZ0A 4IDGA 4CUZA 5JSFA 4JQCA 4PLPA 4B3IA 4N54A 8ADHA 4TVOA 1KYQA 2BELA 3ASUA 3ZV6A 3QVWA 1JKIA 1P33A 3GGOA 1HE5A 2PH5A 2X0JA 1A7KA 1C14A 4B7UA 1DXYA 4MDHA 1JN0A 3K31A 4S1VA 3IOYA 4HFNA 4AJEA 1XU9A 1Y8RB 3PVZA 1AGNA 2J3JA 3KLMX 1Q7BA 5I9MA 2HMWA 1I5RA 3I9JA 3GFBA 3FNEA 3R1IA 5ILGA 2V6MA 4KDFA 2DU8A 4E4YA 1DAPA 2JFHA 2C20A 3BMQA 1N7GA 5BR7A 2GUGA 1CERA 2R00A 3VZPA 4EJ6A 2EIHA 2O3TA 4J43A 6ADHA 4WE3A 1VSVA 3WGYA 5COQA 4CMAA 2I66A 4Q3EA 2Q2WA 3L9XA 3F3SA 4JP3A 4LCJA 2ZCVA 3KXDA 4RGBA 2VTDA 3AY6A 5DULA 3O8QA 5T5QA 1NQTA 2R6JA 4NBTA 3BTSA 2YV3A 4J7XA 4URFA 1P74A 2OBYA 2NU9A 4I9UA 1F8GA 1VC2A 4JNKA 3GEDA 5JDIA 4CMKA 2ZB7A 3G17A 4UVEA 3RJ9A 3STHA 2P91A 5CFZA 3PPIA 2YHUA 3EHEA 4RPGA 3GHYA 4AJOA 2NTJA 3I9MA 4AFNA 1B26A 1QG6A 5F1PA 3B1FA 3NDRA 4LSMA 1LX6A 4WASA 5JLAA 2NLOA 3T4EA 2C07A 1DC4A 2VCYA 2NU7A 4Z9XA 4RJTA 3GAZA 4BKRA 4EYEA 4NFHA 2X5OA 2JCYA 4IBOA 4WEOA 3DZKA 1Q0LA 1UP7A 3KYCA 4LMPA 4MVJP 4NJMB 2EHDA 5BSFA 1GV0A 3PJGA 3K9QO 1UP4A 1SEPA 3OMLA 1DRUA 1A4IA 1JVBA 1LQUA 1YQGA 3B20A 3ZV4A 2POQX 4CLHA 4TROA 1HYGA 4OMUA 4I9NA 1C0LA 3BMNA 1RWBA 5KOIA 4DBVO 1ZZEA 1R15A 2G1UA 5G0VA 1U3VA 2EJWA 1VLLA 3RASA 1J5PA 5ER9A 1PX0A 3B6ZA 1QXSA 4ZRNA 3B1JA 3FNFA 5TC4A 4RQTA 3ASVA 4LCEA 3S2EA 1LUAA 4CMIA 3QW2A 3EYWA 5FFFA 4GBJA 4PLWA 1B7GO 4HADA 1E3WB 3FD8A 3CUKA 3O26A 1AE1A 1MC4A 2Y66A 3ULKA 3PQDA 2IYOA 3JQAA 4A2CA 4M1QA 1YO6A 4B4OA 1Q7GA 4HUJA 1KEWA 5AXAA 1GCUA 3N7UA 3FBTA 4IMRA 4I1IA 2DC1A 3W8EA 4BNKA 1XCBA 4OO3A 4O0LA 4E32A 1M2WA 3VPSA 5FI5A 3ZU4A 3KV3O 4HBGA 1HDCA 3L0DA 1DFHA 1JAYA 4RF4A 4L73A 2AMFA 3OFSA 2ZYGA 2OUIA 4QXMA 1KIFA 1VI2A 2DBZA 1WDLA 1ZXLA 3PTZA 4TWRA 3FBGA 4RF5A 4D42A 1R16A 2A92A 4JP2A 1ARZA 2ZCUA 4Z0PA 4HXYA 3W4JA 3WQSB 2Q46A 1MX3A 1X7DA 3DAPA 3KHUA 4ND1A 3KUXA 3AM4A 3F4BA 2OL4A 2A9FA 1V35A 2E6UX 2HMTA 5CG1A 5L45A 1YBAA 4YB8A 3PDUA 2VYVA 2NVUA 3CINA 4LRTB 4CUJA 4IDDA 1NAHA 2EG9A 1U8FO 2C7GA 3KB6A 4RVHA 3ICPA 5TT0A 1CRWG 1T24A 3RBZA 1XELA 1XLTA 2B69A 2PK3A 2UDPA 1NM5A 4QUKA 3W4IA 3ZNNA 1D8AA 4MVJM 4FIZA 4BL5A 5I8WA 4YJHA 4JN6B 3ZN2A 1EVZA 2OMEA 3CMMA 3G49A 3I3OA 5KJ6A 1HDZA 3AI1A 2ZQYA 2X5JO 5TGDA 5CDYA 3FNHA 5JCJA 3G1UA 3NGXA 3NDJA 2AEMA 2VOEA 4BNFA 2I65A 2DUUA 3C8MA 3G79A 3GVHA 3NV9A 2FOIA 3AM3A 4BNXA 3I6IA 5L4SA 4CLDA 3V1YA 2JFFA 4NR0A 1VRWA 5CG2A 4JCOA 3P7MA 2QQ5A 1E6WA 2ZQZA 5CEJA 1ZMOA 3H3FA 1GAEO 3E48A 2ZKLA 3GOHA 4W7HA 2YDYA 4II2A 3V8BA 1B0AA 2VRCD 4NK4A 3MJ4A 4NHEA 1NX6A 4E31A 3JQAD 1I36A 3RAJA 4H16A 3AUUA 3GPDG 2JCXA 5T8KA 2SCUA 1OC4A 4KOAA 3ETGA 1YBVA 3GAFA 5A1TA 1E7RA 1M66A 2AA3A 4U6QA 4IIUA 1YKFA 5EQDA 2VRBA 3MOIA 1S7CA 4G5HA 4WNIA 3UKOA 1ENZA 3D4OA 4OJNA 1MXHA 1Z74A 3KLPX 3ON5A 5L4NA 4R54A 2V6BA 1PGJA 3GR6A 3ROKA 1IHYA 3VH2A 3DZHA 1WPQA 3ZH2A 4CV2A 4ZVVA 4DPLA 4NDNE 3KEOA 3N58A 4XWYA 1E3WA 2YDXA 5KKAA 4R3NA 4J0EA 2PWZA 2Q2QA 2A94A 3DMTC 4WGGA 2NACA 3UCEA 4AG3A 1A4UA 4PZDA 1MGOA 3NT4A 4OHUA 4Z9FA 1ADCA 4YT2A 2O48X 1HXHA 1BHSA 3WOHA 3PGJA 3TL3A 3PHJA 4P4GA 2BD0A 1N8KA 1N92A 1T1SA 3OBBA 1DC3A 4HNHA 3W8FA 4C7JA 1UAYA 2I5PO 2YHIB 5JYDA 3AUTA 4NBUA 5B12A 4W99A 4KP7A 2VYVD 1IYZA 3DC2A 5A9SB 1HEUA 1JKJA 2BGMA 3Q2IA 3GEGA 1ZK0A 1Q7CA 3E9MA 1XWFA 3ZV3A 2B4QA 3OP4A 5FI3A 4CL3A 2I3AA 1ISIA 5A4DA 4J6FA 4YT8A 3ST7A 4DQUA 4UUMA 3RCBA 2W90A 4AJHA 1ZEJA 2C5AA 5IZCA 2OO5A 4TVBA 1MA0A 4PRKA 1O94A 2WE8A 3GVXA 1IHXA 5B4VA 4CQMA 3IDSA 3L4BA 2GNAA 5JCJD 2Y67A 4YRBA 1PGPA 5AVOA 1N9GA 3PEFA 1Y5RA 2ZTLA 3VPXA 4GLLA 1UJMA 1TVEA 1GY8A 2HO5A 1QYXA 4MVJI 5THKA 4D79A 4P22A 4B4UA 3PLRA 3UGKA 4XGNA 3E1KA 4U5QA 1H9BA 3QP9A 4OXNA 4BV8A 2HK8A 3EGOA 3TZKA 1E5QA 3H9QA 2IZ1A 4D0RA 4BNTA 1YDWA 1X14A 2GLXA 4B8WA 3HDJA 2OORA 1WZIA 1M6HA 4CM6A 3HN2A 5A02A 1CQIA 4IDCA 3FSRA 2B0JA 2Q50A 1K89A 1QRRA 2Y1DA 2YUTA 4E5YA 2WMDA 4FR5A 4XB2A 3RC2A 2HSDA 3DBLA 3UICA 1ZK1A 2BFMA 3ETDA 2IZZA 3GRKA 4L8VA 3D4NA 4XIJA 3WJAA 1PJSA 1QKIA 3JD0A 2VWGA 4PFJA 1NFRA 1N1GA 4J90A 1YB5A 3LSYA 1YS4A 3MEQA 1DFGA 4JBGA 4KUGA 3TWOA 4S3MA 1H6CA 2X9VA 3E03A 3HZZA 4IGFA 3WSWA 3W8DA 5IXSA 3Q9NA 1ZUD1 3GZNB 3ZV5A 3W6ZA 1GTMA 2PZJA 4IJUA 3ZWMA 3IP3A 1V3UA 5EL0A 5IDQA 3QVTA 1LSUA 5KCZA 5HA5A 5COAA 4LK3A 4BHTA 5KJFA 2GPTA 2OBNA 4XEHA 2IDZA 1PQPA 2BF7A 2HLPA 2P4HX 3CH6A 4E2YA 2YFHA 3KO8A 3QWHA 1Q2XA 2DLDA 3LT1A 5JMPA 4WCFB 4PLFA 4BNUA 1I3MA 2RH8A 4W9NA 4FS3A 4J4TA 5H81A 3RC9A 1R0SA 3DHYA 1QV6A 2R2GA 3VVCA 1RM0A 3PHLA 2B36A 3DMTA 5DF1A 4FGWA 4BO9A 4JJFA 4PLVA 4DL9A 5K0ZA 3GVIA 3Q0EA 1NP3A 2ZYDA 1P44A 3OIGA 4GVLA 4JBIA 1NVMB 4BKPA 2Y93A 5C5IA 3GPIA 4KWIA 2X4GA 4OGWA 3F47A 3VH4A 2AW5A 2B4RO 2EERA 1YJ8A 4HV4A 1B16A 1KVRA 2YHIA 5ICSA 3MJEA 1YOVB 1U7HA 2WM3A 3GNTA 2CZCA 3U62A 5A9SA 1A27A 1PIWA 2CSUA 4D7AA 5L51A 4NBRA 5DDIP 2VWHA 3W6UA 4ILKA 3SXPA 1OAAA 4AJLA 5F5LA 4BO5A 3K2BA 4IJKA 3ZU2A 1LLQA 3C1OA 4WECA 1GUFA 1SMKA 4E2ZA 4LISA 3IJRA 4Q3NA 3BHMA 2J3IA 3D3WB 3RUIA 4E5PA 3PQFA 3BHIA 3I83A 4Z0HO 3DB2A 1PZFA 4R68A 1YONA 3TOZA 2Q4EA 2Y1GA 2ZB8A 3RJ5A 1V0JA 2VUTA 2PGLA 3AY3A 1CDOA 1R0LA 1IPEA 1LBEA 1VKOA 4KWHA 1RYEA 1U3WA 1GZ3A 3FTNA 4HNGA 4XDZA 3EVNA 4YAEA 2EP5A 2GERA 4EUFA 1CETA 3MJTA 1HL3A 3F5QA 3ANLA 4RDIA 3CSDA 1MG5A 3OQ1A 2CD9A 5AXBA 3X2FA 3ROMA 4GWGA 1WLYA 1WMBA 4CR6A 3LC7O 3NUGA 4TRRA 1U4SA 4F46A 1LDNA 4NNJA 5AXDA 2BMAA 1OMOA 4YEDA 2C82A 4TKMA 4WLOA 2PKQO 3C24A 1XHLA 1XIVA 4WOKA 3AY7A 3WX0A 4RVSA 4GX1A 3RUFA 4WLNA 4A26A 4Y8VA 3JSAA 5L7TA 4MVJA 7ADHA 2HRZA 1WNTA 4L0QA 3GZNA 3TPCA 1KVQA 3D1LA 4IIVA 3RWBA 5JAZA 3INTA 2DVMA 3WICA 1XQ6A 4DGSA 2X0RA 3OJEA 1SB8A 1Y8QB 3PZBA 1KC1A 3HUDA 3VC7A 5JXWA 1PTJA 5GMOA 4PGFA 4OKIA 3WLEA 3OF2A 5BSEA 3HDYA 1XGKA 3DZBA 4BNJA 5B37A 2R00C 1YL5A 2Y0DA 1EFLA 3I9OA 4IXWA 2O7SA 4WCFA 3WDSA 3E18A 3JQ9A 3F46A 1EK6A 3JQ8A 2HUNA 3KVOA 4ND5A 2RH4A 2CDCA 1YH3A 2PV7A 4PLYA 5HS6A 4BKUA 3PLNA 1QSGA 1DFIA 1R37A 3PHIA 2GO1A 4IXTA 3MTGA 3ABIA 4BVAA 1DLJA 1PL6A 1H5QA 3SX2A 1Q0QA 2H6EA 4OH1A 3NGLA 2FSVA 4TRNA 3A4VA 2QX7A 5DN9A 5EERA 3FWNA 4R1NA 3GFGA 2X1HA 1E6EA 3JQCA 4R3WA 1DRWA 1YGYA 1GEGA 5TT1A 4M54A 2VT2A 4B3HA 3L6EA 3R6DA 1YOVA 1QLJA 4IDBA 4CM4B 3DBRB 2FPIA 5DBGA 2J3HA 5HM8A 1VL8A 3ADPA 1ZNQO 1ADFA 1HE3A 2ZJ1A 9LDTA 1JVSA 4FN4A 2TMDA 2FHSA 4IJWA 4CLXA 3HFSA 4W6ZA 1MUUA 3U5TA 3G1TA 1H6BA 2YY7A 1DIGA 2EGHA 3FF4A 2FWMX 4LN1A 1EEHA 5A06A 2GZ2A 3D3WA 4O1MA 4XJSA 4YQYA 5G4KA 3ZI0A 3OQBA 4J1NA 3AFMA 3WGQA 2YV2A 3ROPA 2GD1O 4WKGA 5L7WA 1CQJA 2OOSA 3VAZA 1DO8A 1V9LA 3TZCA 5G0TA 2CNBA 4CM9A 1NQ5A 5I9LA 3ZWAA 1R66A 1QP8A 1ZSNA 2P2SA 3O9ZA 3UFXA 3CPSA 1UZLA 1F8FA 1PJLA 4GAEA 4IQ0A 3ZWPA 1DC5A 1WZEA 1U8XX 4YT4A 1LI4A 2EP7A 1BMDA 4MVJG 4RO0A 5TIIA 1DIHA 2FN7A 3S1LA 1GR0A 4MVJF 4RCVA 1PWZA 3R0IA 3ZHZA 4MVJD 1B8VA 4RVUA 4PCVA 1SB9A 1R4MA 1ULUA 3IC5A 1XSEA 4UULA 4UREA 4FFMA 4O6VA 5TSDA 1YVEI 2IEDA 2OP0A 5AQ1A 1HDRA 2AHRA 3FPCA 1H0KA 4M49A 2G82A 4P4NA 5DP1A 4Z9YA 1YBMA 1U4OA 1FDSA 1VJTA 2JD2A 4PVCA 5H82A 4DMMA 5IZ4A 5JS6A 3NTQA 2HCTA 8LDHA 2Q1WA 4M86A 4ZN6A 3OQ6A 4DWVA 3KOUA 5HS4A 3WJ7A 4L76A 2GSDA 1G1AA 3RVDA 2VWPA 2OP1A 3ONFA 3EY4A 3JTMA 1J49A 2IXBA 1ORRA 4K28A 5L40A 3WQRA 5JDCA 3DZGA 1EQ2A 1VJ0A 2HRBA 3H5AA 4L4RA 2AEJA 1A71A 2AE2A 1UZMA 3OM9A 1ZSYA 4DUPA 4GI2A 1LJ8A 1ONNA 2I9PA 2NWQA 4R9SA 4UUNA 5COBA 1PGOA 2X9GA 1Y8QA 4F3YA 1B15A 4AJJA 1UXJA 4BNYA 4KUEA 4OOEA 1C1DB 1J0XO 1KEUA 1PZHA 3LVFO 4L75A 4MKRA 4RDHA 3WTBA 4W82A 1NASA 1GYPA 4CMEA 2EWMA 2HMUA 3F9IA 3TSCA 3NRCA 3IQDB 1GUYA 4MP3A 3ZU5A 5GZ1A 4Y6RA 1NTOA 5DNAA 5HBRA 3RFVA 4AL4A 4J9UE 2UUPA 3RC1A 4DXHA 1LXCA 2RCYA 2YJZA 4WCDA 2ILTA 4GGPA 1PR3A 2AG5A 4DTIA 2X23A 4FD3A 4J9VA 5G0WA 4EITA 5CEEA 2J8ZA 3E5MA 1H2HA 4NK5A 1P0CA 2NQTA 4DBZA 2Q99A 2YW9A 3OJOA 1H93A 1F06A 3EW7A 5AOVA 1VJ1A 2X22A 4EW6A 3BIOA 3U4CA 2C54A 3WGZA 4JIGA 4CM4A 1JLLA 3DBRA 1PQWA 2YFQA 1Y9EA 4CM9D 1BG6A 5IAAA 4YJFB 5DBIA 1YB1A 4PG5A 5IG2A 3HE3A 4LRSB 1N2SA 4IJVA 3KETA 9LDBA 1E1MA 4XYBA 3ZZNA 3S2GA 3BAZA 1U1IA 3GMDA 3U09A 3OA0A 2HQ1A 3AI3A 2X58A 4CM3A 1YQXA 4D44A 1JKFA 5IN4A 5H83A 4Q3BA 3S2IA 4D0SA 2E48A 3GRPA 3JQGB 4MIOA 5CHEA 4OIMA 4YDRA 2VZ9A 5F3RA 4LVUA
chains in the Genus database with same CATH superfamily
1YR6A 2PG3A 1WHSB 2ZUWA 5LZ5A 3LBYA 2JLCA 4GPD1 4MVYA 4QOSA 4N5NA 5DNDA 1ZL2A 3VTFA 5FR2A 1U3TA 1ZINA 2C7VA 1G8YA 4FXPA 1FYFA 4TT8A 3S2ZA 3ZGNA 1XNQB 4PZYA 3F6YA 1SC9A 3IP6A 1T5DX 1JIUA 4UNNA 1IRIA 2G6TA 3G89A 4RIIA 1NBMD 2R6GA 3RV4A 1W73A 3RFFA 3EEYA 1N78A 2AQ8A 3PXEA 5BRJA 5JH7F 1DDGA 3OFND 4WD3A 2GPJA 5FPQA 5KJEA 2NQ8A 1EG2A 2Q1SA 1VMAA 4G0NA 4GPBA 3QLUC 2WSMA 3GFVA 1WP4A 1Z8DA 2WJVA 2PA0A 1XTKA 3K0EA 4IWYA 3ZHSA 2FA9A 3H99A 1Y81A 2YWEA 1QONA 3NP7A 5FQNA 4HB2A 4P84A 2GH1A 4G25A 2M6LA 4BFWA 2NO5A 1KBOA 3M2TA 1YRHA 3FETA 5JISA 3GGGA 4MGHA 1NVDA 1X7YB 3PUKA 3QSGA 1O3YA 2BJVA 3ANTA 5D01A 1D9XA 4CKEB 2GN2A 2OB1A 4F8EA 2D2IA 4MLPA 4YDHB 5CU7A 2RGYA 4QXQA 4G9BA 5K0JA 4QFCA 3SLKA 4U7FA 5DI3A 1F38A 2FW9A 2G1PA 4H7EA 2GARA 2I7VA 2ZTMA 4Q1BA 5IC6A 4DE5A 1NWCA 4M1TA 2AZDA 3R7AA 3H2JA 3MCUA 3PRKE 4U9UA 1WKBA 2D62A 2GBPA 3SBEA 1RQXA 3TF5A 1L4KA 1JSXA 2FDRA 1Y8RA 2AIRA 2X40A 3F5FA 3RUEA 1BXRA 4XLLA 5LZ4A 2BFNA 3EG9B 3GPBA 2XTZA 2R3SA 3RHTA 2ZE8A 3EVDA 1K88A 1ZBDA 1KJNA 3D5QA 4IXNA 5LKAA 1CS0B 1N6OA 3KL4A 4UUOA 4U6SA 1TO1E 2IY9A 2OVBA 3C8UA 2L19A 3CIOA 3HCWA 3IQEA 1OW3B 1QFZA 2GM9A 3QPWA 3NBUA 2Z56A 1U2ZA 2QG9A 4UBIA 4CODB 3RK4A 1JTVA 3RVPA 1YL6A 1JEOA 3GDOA 4CDMA 3WLLA 1AN0A 4BBJA 1JWBB 5KOYA 3VJRA 1JDZA 1LDBA 3MF4A 4V1CA 4MA5A 4DCSA 3W05A 1E3LA 1AU9A 1W59A 4KK3A 3TJZA 3ZIUA 5J5AA 1PS8A 1IATA 3MCVA 10MHA 2P6NA 1QK5A 4J3FA 2DJIA 1YJAA 4K40A 5I48A 1HYQA 3H0CA 5D3ZA 3LBFA 1DIOB 1ZOSA 2IOYA 1SPBS 3CE9A 1XR3A 4TUYB 4H6XA 3GT3A 1EFUA 1K5HA 4BX9A 1WW2A 5DHRA 3JS5A 5J2UF 5CUQA 3DP7A 1NNI1 2WOJA 3GJ6A 4X54A 1DUVG 3SZOA 1RFLA 3ACBA 4UHBA 1W87A 2Y05A 4D43A 4CMCA 4LUCA 4BLRA 4L8YA 1GV1A 3K9WA 4N6OA 3BWDD 1LQTA 2P6PA 3CGGA 4DNQA 1J0EA 4JROA 3T38A 2W48A 1NIPA 2B98A 2B1IA 4FVTA 3C3JA 4BO1A 3W6NA 4NV3A 3RREA 1MAHA 4KDCA 3FOZA 4XFKA 1JTFA 4HVTA 4X5OA 2J3LA 5BQ5A 3MJRA 2BKEA 2RG1A 4O4LB 2A3RA 2IZ0A 1BEUB 4EI2A 3ITKA 4RKWA 1WG8A 3L7AA 4QSMA 3DE7X 3TQRA 1I2ZA 2CDAA 2HU8A 3LM8A 1ZWLA 4R71A 4ALKA 4AX4A 4BJ6A 1CF9A 4Q9AA 2J9XB 3LQRA 3LUFA 3EVCA 3NIWA 2OZLB 3N8GA 2B4YA 2JL1A 1KO7A 4MGEA 5K2OA 3F97A 4KIWA 3GLQA 4RKRA 3OZWA 1P91A 2E5LB 1IZYA 2FB9A 2YJ4A 5HDQA 3KDSE 4R2JA 5FL7A 1IOLA 1BE1A 1PBNA 5EE5B 1NYRA 2PPLA 1FUIA 1OTYA 3DEHA 5JAIA 3A2MA 4BMVA 2A9JA 4DDHA 2VP5A 3ER6A 4LNUB 2C29D 3L1HA 1PFWA 3FDJA 3TZHA 2EJCA 2YVUA 1GCOA 1FEZA 5JWHA 3HK2A 1F6DA 1PZXA 2E9SA 4N3AA 4RETA 5AO9A 4MV1A 3PWSA 3TOSA 4L16A 2X86A 4BGVA 5AVRA 2QUHA 4IIFA 2A1UB 3SZGA 1QV7A 3ANMA 3ZHXA 4CG2A 1I3LA 1JPNA 2LIPA 3A7DA 4Y7CA 5KNCD 4B6QA 2XTMA 1EFKA 1YS1X 3IVRA 3FOEC 3QLUA 4MQFA 1HX7A 3U0BA 3IMCA 4DSZA 3DOJA 4QATA 3V7YA 2QW8A 4WZBA 4EB0A 1M2EA 2QD1A 3HNPA 1ZJ4A 3CKYA 4M1OA 1F1JA 2GXAA 5TARA 1R74A 4KRFA 3KG2A 3USZA 1EFPB 2XVAA 4HAIA 4JLNA 4PLCA 3R5FA 4ZXFA 4DTCA 4KMOA 3AF4A 2C1EA 1DO2A 3GJ5A 4JH0A 1N36B 5IM4F 2W2MA 2MINB 3FKQA 4OP3A 4HFRA 2VWQA 4ZAXA 4NQZA 3AHJA 5EP3A 4PO1A 2QYSA 1R6DA 2XW6A 3H2GA 4QUHA 4Z3KA 5BNTA 3DPIA 2COKA 3SKVA 4GSLA 2E5WA 4PX3A 5AFSA 2EZUA 1U9YA 1JV2B 2HCBA 4O4JB 4TZKA 1Y9ZA 2PGOA 1J06A 3C6BA 2B8NA 3PFFA 2RAPA 3IKLA 1CB7A 1ZH6A 4AJPA 2RHBA 1S9DA 2GXQA 3KQWA 5HHTA 5G3YA 1MB3A 1U0NA 1WZNA 1ZEMA 3NAMA 4RTLA 1ZW1A 4LJ7A 1PJCA 4Q9NA 2A3NA 5JZOA 3D6FA 3OE4A 2JLXA 1WMAA 2EXXA 1Z0JA 4GU5A 1EZZA 1T3LA 2FFQA 3TCXB 3TR0A 4BB6A 2AOTA 2NUTB 1V16A 3CXUA 1Q44A 1V41E 1JLSA 1TM2A 4GR4A 3V4FA 1KOFA 1KYZA 1VBMA 1WQ3A 3UJNA 4F4IA 4RKQA 3TNLA 3MWDB 1V8BA 4BPRA 1JG4A 3BCHA 2C98A 5H70A 3TMAA 1FX0A 2I7TA 3B1ZA 1JPUA 4QVKA 3N8DA 2FNAA 3AUKA 5GONB 2P3SA 1SVNA 3GXBA 3HH8A 4JOSA 4W1PA 3W1WA 4AP5A 1A9ZA 1BWSA 2QRVB 1X7HA 3MJVA 4WRRA 5ALFA 4JXZA 2BEWB 1QH9A 2JH8A 1USIA 3WV5A 4EGQA 5AVSA 3PI6A 5HQ3B 1UXOA 1UCFA 3FHCB 1WD5A 1A9OA 1BU8A 3FHLA 4FFOA 2WAMA 3FI0A 3ND8A 1DSSG 2Y3IA 3L7IA 4RFVA 1ZMXA 2DFDA 2PKXA 2YHAA 4V3BA 4KQFA 2Q4TA 4PG8A 2O52A 4Q1AA 4MV7A 1P2SA 3I1JA 3OCYA 1UJ5A 1E6UA 4YREA 1YZKA 2V5AA 5CLQA 4G1MB 4BE9A 2R1VA 1HURA 1RM5A 1JA9A 1WW8A 3LLVA 4ZYYA 1NSTA 1SXJA 4G81A 4XCXA 1MJNA 5JEEA 5KVSA 1XQYA 5BW5A 1EVIA 3BRWA 1T0JB 1W88A 2FY8A 4UXHA 1BGVA 3BD7A 1SKAA 4BWYA 4YMGA 4QEDA 3PEYA 4F9FA 1VPWA 5L95A 1WDKA 2PMDA 3RQIA 1H6AA 3VH3A 1DJQA 2J3DA 2YZ7A 4YP9A 2DR0A 4GF5A 4QUBA 4ND7A 1GO2A 4E4TA 3ZVNA 3PXUA 3MS2A 1T5IA 2CB0A 2PTHA 2A9KA 3P0HA 1TXGA 2O50A 3CURA 5M04A 2W98A 5ECGC 5ER6A 5J5VA 2C5EA 4KKVA 2JLYA 5EZYA 3FWYA 2AV6A 4NPCA 3UJAA 2P9GA 3DD1A 1GGKA 3A14A 4U2KA 5LXTF 4BIIA 3T54A 1CZLA 3CONA 3MLAA 1TU0A 1TZ2A 4FGSA 3Q87B 2F9LA 4YT5A 4ENUA 3W04A 2J9FB 3IUQA 4W5RA 3GX1A 2QL6A 4MLCA 3O8OB 3WLFA 1O0CA 4XWWA 2B83A 3GVPA 3ZHRA 3KALA 3L5OA 4JVNA 1GM5A 1AKRA 4B34A 5DM70 3RF6A 1TTPB 1Z5OA 2A84A 4HB3A 4MS3B 2BE9A 2CF6A 1IE3A 2XCQA 4H7PA 2B7CA 2CXPA 4GYJA 3C4JA 1RD4A 1QLHA 2PXXA 3Q5DA 3QXGA 2BHNA 2LWIA 3CH5A 2VDKB 2LVBA 3UH1A 4BPBA 4JBYA 2FPPA 4NZZA 5GV7A 3PD1A 2PUWA 1VHLA 4KQKA 3V2HA 3ADKA 1W36B 4LYAA 1T4BA 1U8ZA 5AYVA 1F0YA 3QE4A 1HE8B 2AL7A 2EQ5A 2GPAA 2O1XA 2PUHA 4D3DA 3AFOA 3I4FA 5EEGA 1FNCA 3WGOA 5J43A 5KC9A 1UDWA 3W5JA 1HKUA 1UT8A 1T5OA 1V8PA 1RXEA 1U04A 3F1LA 4TOIA 4FGLA 5C4IA 2QQFA 3WMFA 1U1CA 1P31A 1WAMA 3LP5A 3INRA 5LL6P 3D6HA 4DR2B 1Z22A 4ZVMA 5IAEA 2G06A 2WNSA 3KXIA 4J0DA 1Z5GA 2IEBA 3W5CA 4OB8A 2QB5A 2H1WA 2Q1TA 3AEYA 3B5EA 2AXQA 3MOSA 4MVCA 5FIUA 1LRKA 2O8NA 4RMNA 1Y82A 2LDBA 3T7KA 3ZZTA 3EPRA 3IV6A 4BN5A 4DKJA 1NDQA 3MK31 3RD5A 1RQNA 1T9KA 4DLNA 3NEAA 4AKSA 4R8LA 3T3OA 1RYDA 4DA7A 1N4DA 2PKQP 3AHCA 4ERNA 4PVDA 5MFZA 1ODCA 4FMCF 5E95A 2O2ZA 1C5KA 2QUZA 2XMSA 3OZBA 5FP0A 4YHHB 1NF8A 1ZXBA 4LF6B 4HH3C 1XYVA 2E1PA 3PKZA 5MN6A 4QL3A 4A8PA 3N6XA 3VR5H 3QIVA 2DPGA 1RYMA 3DBOB 1XOIA 3SYNA 3AUYA 1QZ3A 1XUOA 2PU7A 1QTNA 4MQ5A 1RZ3A 2WF7A 4QBIA 1W7AA 2J7KA 5EWJA 2GVNA 2E4WA 2JAWA 3C3KA 5AKJA 3HRHA 1SBYA 3NEPX 4Z99A 3VI4B 4JYCA 1FRFS 5C8ZA 4P58A 1TGYA 3UMFA 4QSHA 3C3WA 4PYIA 5IJAA 4GMGA 5FLXA 4L22A 5AHRA 3RRYA 2WTNA 4JSRA 1Z38A 2O1SA 5FF9A 3WLQA 1KYXA 5IBPA 3DW3X 4F1JA 3JYQA 5BNIA 4ZO9A 5EPOA 3THRA 4D99A 3MWFA 4OSEA 2O2SA 5ALGA 2Z08A 3VU9A 1P0QA 2JIQA 2YUIA 3VSEA 1O0SA 1EWKA 5AHXA 3K35A 2XNSA 4NQRA 3ZUGA 3A9TA 1PVDA 1YE3A 2IXAA 1I4WA 4WZBE 1B14A 1GG2A 4UXJA 4FIDA 5E6SB 4RF3A 4TKUB 1OBFO 3GLSA 4EW2A 1V1RA 2G1JA 2RGNC 2BMJA 1KU6A 2RCNA 3D59A 4JKOA 3S99A 1WA5A 2XB6A 4F3NA 5DISB 1NN5A 7REQB 4JYAB 1NA5A 5HILA 5CDGA 3ZLVA 1MJGM 1FDUA 3MLBA 1HNNA 2OVFA 1OZAA 1Y48E 3L77A 5FR1A 5IW8A 1R9GA 2AQHA 2RHHA 1RC1A 2XE8A 4IHKA 5FPYA 2YIMA 3KPUA 2X3FA 3X44A 1JF8A 3ZW8A 2O2XA 3H11B 3U3DA 1MKYA 3L79A 1T4GA 1TI7A 1X9GA 3B1VA 4TTRA 3UJ3X 1HTBA 3WLMA 4N8DA 4UVDA 4D9CA 1ULAA 1QIKA 2B1JA 4JK3A 2XE7A 4G1CA 5KTYA 2ZBEA 2JFBA 4EUSA 5I9BA 1IBMB 3A9CA 1PR6A 4X60A 3FCCA 1KE2A 1SQ5A 5JDCC 3WYDA 4P8RA 3EWIA 4V3CA 2P6MA 3E9NA 5BSHA 5HZHA 2E4YA 4HX5A 1Q7TA 1SKUA 1Y4DE 2B6HA 2X8JA 4K26A 4M7WA 1XN4A 1MFPA 2Z1NA 3CPEA 4HB4A 4JNCA 4RVCA 5P8WA 2CNLA 4PIPA 4E33A 2Y9ZA 3H97A 4NCIA 3GBVA 3KB2A 1DUIA 2XTJA 5KTRA 3GJYA 3EQ6A 3HCRA 2W8BB 4KDEA 4A6EA 3S0JA 5E3JA 4PZZA 4MXDA 5FOWA 2BTQA 4CN9A 5LFAA 1BE8A 1Q0RA 1N6LA 4OEHA 3WWDA 1LLUA 2FR1A 3T06B 4U39A 4FDLA 4DJDC 5IMBA 3SS8A 1MW9X 2JHCA 2FUNB 2JD0A 2B34A 1RADA 1FTSA 5CEFA 1NN3A 3HGMA 1QQ7A 1E9FA 2Q45A 2R1TB 3JVEA 3PGXA 2F43B 2O05A 1DRVA 2PRSA 1GGNA 1HRDA 1JT2A 3KKEA 4HDMA 3CR7A 1OD6A 1TF7A 1L5SA 3O7MA 4RPLA 3IQHX 4BP8A 2C57A 4R8VA 2QE7D 2SKEA 5CAEB 2Z2KA 2NSDA 4C4YA 4IZHA 4CNBA 2WJGA 3R0VA 2FMHA 5I7AA 2OHFA 3S2UA 3MA0A 1XFAA 1XALA 4GLOA 4B44A 1J2JA 3B38A 3BMQB 4L9AA 4RMHA 1EJ6A 5AI5A 3HJAA 4D98A 1EE9A 3JWPA 4IIHA 4PPYA 5JTTA 1KSFX 5BV7A 4ZCRA 1WUYA 1Z39A 2YIVX 5ALEA 4RTNA 1Y7TA 2RDMA 3IA2A 1G7RA 2ZBUA 4MQ6A 1L7PA 1NJ5A 1PFGA 1QGED 2DKNA 2C2ZA 2IHYA 2C5GA 2BHLA 2P0YA 3ONNA 3R5XA 4FONA 3WK8A 3BSFA 4P3XA 1O97D 1V6CA 5FTLA 2BI4A 3BB3A 4B3CA 1OX4A 1Y98A 1FFGA 3IBTA 1BKDR 2OXFA 3THYB 3HPRA 1J2RA 2W11A 4EI8A 4MWEA 2NU9B 4FEEA 4KE8A 2VDRB 4O2BA 2QZ9A 1JJIA 3HR7A 1OIWA 1GEEA 3TECE 2ZANA 4EFKA 4AO6A 2VQFB 2JEYA 4LV5B 4Y9UA 5DLDA 1MPXA 3WB1A 1WCWA 4GVXA 1D0IA 2OGZA 1SOWA 3FZNA 3GEIA 4I2NA 4BO8A 1V1JA 13PKA 1KSJA 4HG2A 1RU3A 3T95A 2YWJA 3WQHA 5AVWA 1LBSA 3QELA 3VISA 4MQEB 1YASA 1L4YA 2H9IA 2JFGA 2OSVA 3OJLA 4N18A 5ELMA 2ZYWX 5KNCH 4EGJA 2C95A 2I62A 1ZM7A 5HG0A 1JDSA 2X4DA 4BMDA 3E8MA 4PY2A 3MCZA 5DOVA 4HHEA 5A5FA 3O3OB 3ZCTA 4QPCA 3ZIAA 4AURA 4YAUA 1G21B 2OXEA 1HDIA 1KO1A 2J0SA 1B8PA 1YQDA 2F1JA 2FSHA 3KKLA 4ZO8A 5IH3A 2VQ6A 4TQUS 3P8ZA 1S2NA 4GYYA 3KCNA 3VR6D 5JASA 1T9CA 4EVRA 5JWOA 1NG1A 1KQ3A 4P7JA 1NRXA 4GL2A 2OBLA 1PGNA 1CR2A 5B7PA 4GQIA 4LKOA 5GQSA 1IONA 2FPMA 1PNTA 3RSFA 3CLTC 1DEHA 1QPZA 3T5DA 2B99A 1TAQA 3QQPA 4QTTB 4D9MA 2RGNA 3DNMA 5DE3A 4WMLA 3J7AC 2QLTA 4E7PA 4Z8YA 2REBA 1RWXA 5AJHA 1ND5A 3KQVA 3SMVA 5EMNA 4ZKDA 3O2JA 2P77A 3H9JA 1UOPA 1FUUA 2R8OA 3QV1A 3LLUA 4LRQA 4EPXA 2D8AA 4FCTA 5A4MS 3O3MB 5KTMA 2G4LA 2G1KA 3V4RA 1LNQA 2YZNA 1DWQA 4Z0TA 2GN6A 4DV3B 5CITA 2ZDGA 2OV8A 5U4XA 5GADl 2QT1A 3K0HA 3AOGA 1MC1A 2PZFA 1PR2A 4Z2AA 1UBJS 3CLSC 4WESB 1SU7A 1RWQA 1B6TA 3M5DA 1QFJA 4QQ8A 3UB4A 4MTLA 1W36D 5ESDA 3P1JA 1FTGA 4G2TA 4AROA 1L7EA 4AKIA 2Q3CA 2HF8A 2JI6A 3RIMA 1W9MA 1F2UB 1O57A 1XL1A 1N5KA 3ESQA 5FWXB 3BILA 1T2CA 3I1FA 4KQGA 4K6KA 4JX9A 2I9KA 4H35A 4L3VA 4AG5A 1MRSA 1CULC 4R1PA 4G1BA 2YNMC 1I7DA 5I9SA 3A06A 2IQ5A 4DCUA 2CDRA 4KMMA 1KMCA 4GZ6A 4N0EA 1DEOA 5KNDD 3O0DA 2G4CA 4HYTA 1T36A 3DAGA 2ZEJA 2P9TA 4WKPA 5D5HA 1DQPA 1SQ0A 5KNLA 2OZEA 1EIZA 4CDRA 4J0CA 4KPUB 3AUSA 1Y8ZA 2IHZA 3CNOA 2XUKA 4GWLA 3UMBA 4R2WA 1U0RA 4WLUA 4OJYA 4BQQA 3TG2A 2P30A 2PEZA 5U9CA 1RYZA 4L4YA 3AR3A 3L4SO 3NWEA 3EW9A 1COWA 1QRDA 1YJQA 1JG7A 4PXAA 3R6TA 3UTCA 1Q5PA 1YA4A 4AO7A 4DLPA 1T4MA 4WKCA 1EX7A 4KX5A 2Q1XA 4P5DA 1UP6A 2DX7A 4MS1A 1RRKA 1ZVMA 3ND6A 2BDTA 3DFZA 4XUGB 5J4VA 1Y8AA 2YTZA 3SNHA 3QG5A 1KFCB 2H85A 2FV8A 5EIFA 4I81A 5FPPA 3F3KA 3AK4A 3U4IA 1RAIA 2QIOA 4GO1A 2FUEA 5EGSA 1UDCA 3RRFA 2WTBA 1JP7A 1STOA 1M7BA 4OSPA 4IDAA 4ZI7A 3SZMA 5IJ0B 1CJKC 2VNKA 3H1TA 1OXXK 1KA9H 3AJ9A 3NJ4A 1CZNA 1Y37A 4JJEA 4I4LA 4XRRA 1TK2A 1MQ8B 1KKLA 2PQ2A 4EJMA 5JPIA 3WGLA 3A6LA 4GBED 2Y4NA 3BAFA 4M46A 3GQBA 3ZXXA 5EKUA 4MVJE 3WP1B 2JH3A 2P6OA 3VR1A 5FX2A 3ESDA 2DBRA 1O5IA 1VHTA 4NPAA 4H3HB 4XCVA 4W5QA 3DBHB 3AEKB 4FT4A 4WCVA 4AG6A 1ECJA 1KYWA 3N05A 4R5MA 5L3QA 4LSWA 2FP4B 3AM1A 2FPXA 1G41A 1K8RA 3IS3A 2B94A 1MT0A 1AN9A 4MO2A 5CH3A 5D2CA 5HEKA 2XNKA 5C4GB 3BMOB 5TS2A 1IUKA 5K6AA 3BTOA 3WL7A 3I61A 2EJBA 1Z6PA 4CETA 1KPHA 2GNOA 4HSEA 1UBHS 1GGVA 4R40A 1KEVA 5KMGA 1TB4A 2QVZX 3U48A 5BW8A 1J6UA 5ERGB 2JLSA 3JQBC 4OAPA 3DAYA 4B43A 4BVKA 1WETA 1Y9AA 5KX5F 4PHFA 2EHJA 2ZPUA 1QIHA 2EJUA 3BXEA 2FPLA 3HV0A 4TSRA 3BN3A 5L3SA 1P7PA 2UYOA 2W2NA 2YXNA 3PG5A 1QVWA 3KE8A 1CUXA 2PR2A 3RS7A 4RAOA 3DDUA 1LZKA 1IN6A 4ZAVA 1R4ZA 1Q50A 3ESZA 4Z51A 3DCJA 2WA1A 3PDWA 2J0UB 4AYWA 3BJEA 2WHRA 1J0BA 1E79A 1P77A 2VDJA 5LA6A 2Q5QA 4P92A 4C3UA 4YDSA 5BWOA 4PLHA 2YBEA 1H22A 2BRUC 1PZGA 2Y1CA 2VSYA 4BE7B 1NNLA 4FZJA 4QFMA 4CTNA 3IIEA 4BFYA 1OGJA 4QOEA 5D00A 2ERCA 3HJGA 2C9OA 2SKCA 3Q85A 1OOEA 4NONA 2DECA 3TDMA 3EG5A 1Z4QA 3B51X 2EX1A 3IQXA 1NIJA 4F4UA 1YDMA 4LJRA 4X1OA 1L5YA 1JSZA 2ZGVA 1LZLA 2CVZA 1YD7A 5FOQA 3QYFA 4IRMA 2VF4X 4G0PA 3OOJA 2JGMA 2Z5VA 3ZGZA 4C0SA 1XG5A 4UPVA 4C2AA 4QECA 2PRIA 3L0YA 2KPOA 4DSAA 2G83A 2D5CA 2DP4E 4TN1A 1J4AA 1LC3A 1C9NA 2ZQ5A 1Y6FA 4MUYA 3KHKA 4WK0B 4X6YA 3UHAA 4JT2A 4A2WA 4DQKA 1XQ9A 3F74A 1NBWB 1JR6A 4ZVSA 1FTYA 5A4AA 5CA1A 2H11A 1MLDA 2XEXA 3V80A 5JYEA 1GKKA 5CTJA 2W2LD 3V8EA 2VHXA 3VZBA 4YXWA 1MJGA 1O5TA 5C1IA 4IRUB 4LZPA 4X24A 4F6LA 1IG3A 1QIFA 3PC4A 2C4VA 3EZNA 5EKTA 3J80A 2VNSA 2FKAA 4GZ5A 3T4XA 4UBKA 1FXSA 4PZ9A 3DHEA 3EMVA 4PPQA 2AFRA 4A7PA 4EBFA 3F90A 3COSA 3CS3A 3K2IA 4UUPA 1NR1A 4V0SA 3KQYA 4UTZA 4X44A 3EODA 2X9LA 5G3ZA 521PA 5H9WA 1TC2A 3P0EA 4RD3A 3TTVA 3RYIB 4E3ZA 1MIOA 3V6MA 4HQLA 4C0AC 3PPVA 2FWJA 2P27A 4YV2A 1Z56C 5KTOA 2PL1A 1QAMA 1GFSA 1Z17A 4NAVA 4UVHA 3ZWDA 3PYLA 4LV6A 4BMCA 3RLIA 2IEYA 2DBQA 4MRPA 3WGNA 4MUNA 3ZGOA 2YR0A 2W6CX 5EGNA 2Q2NA 2MU1A 3WNBA 3DV9A 4TL8A 1WHTA 3RHSA 2N1MA 3BZUA 3SC2A 3V1NA 5ITVA 3LPLA 1JH8A 1TQ2A 4LTDA 2H4XA 2X6TA 5JAMA 1DCTA 3ISTA 2PDAA 5IFLA 4EA6A 1OQAA 4FDAA 1NVEA 4PN3A 2Q4DA 3GGCA 3QFSA 4JI7B 4YJFA 2F4NA 2LW7A 3JYHA 2WUVA 4FP9A 1UJCA 4U0KA 1CEXA 4E5VA 3RLFA 1RMYA 3NHZA 3CA8A 3S81A 3NEJA 5IYZA 1IK6A 3ZKWA 2L17A 3EXFB 2XCLA 3KT0A 4ISCA 3QSYA 2VJNA 3L0BA 2HA2A 2TSYB 4JODA 4CLRA 5D3MB 1KI1A 4FE3A 1CSEE 5EXXA 2F8TA 1F0PA 2JCBA 3UAVA 4E30A 5HGXA 1FVXA 1J2UA 5C1DA 1QYCA 4KI0A 5CTAA 1FFXA 2XT6A 1O03A 2PGIA 4JJ6A 4HJRA 4MHSA 1UMCB 5I47A 4TQGA 4NIMA 2C31A 1XDSA 3LF1A 3RDPA 4KLZA 1U2QA 2VTEA 1EVQA 4KN6A 3A6GA 4F5YA 2UYQA 2V9ZA 2OE2A 5GVSA 3H8VA 2H7YA 1R0BA 4E12A 4RQAA 2C7RA 5D5PA 3KU1A 3FI9A 4LXGA 2VA8A 3DZ8A 1ZCJA 5CLHA 3QKIA 1ZFNA 3OOHA 4M1WA 4JBLA 3UF0A 4AJ4A 3OX4A 1GTRA 1E69A 3LAWA 1K7SN 2NXWA 2DWQA 4D02A 1N57A 3OTIA 4LQ4A 5DYIA 1PL8A 3TLMA 5C5CA 3AG6A 5HE8A 4WT7A 2C7OA 4PG4A 1G8MA 3REGA 3VDRA 4DREA 1LS1A 2RH5A 3CTMA 1WOMA 3WLHA 3BGOS 2PYIA 4BAUA 1PHRA 3KAJA 3OZCA 1N5JA 4ER0A 3CE6A 4ZOLF 2P8JA 3W7AA 2QBYA 3ICCA 2KM1A 4RLQA 1G8JA 2CF5A 3BE6A 3SG0A 1MEEA 2BH9A 1PK7A 3K5PA 5JR3A 5IEJA 3G0IA 3EXIB 2O1EA 3T9FA 1IQ0A 3O4HA 2GF0A 3H2HA 2XGMA 3HN6A 3N5CA 3DVLA 4W9RA 4V02A 3T4PA 5CB4B 2YJ5A 1SVWA 1EDZA 4INPA 2WT4A 3KQSA 1VHDA 3GJQA 2AI3A 1EUQA 4IF4A 5DGDA 2Q5HA 4CQNA 4N48A 1KDYA 4BZZA 5B4TA 4DYDA 1P1JA 4A0GA 3T4UA 3OIUA 1JEEA 1OE0A 4N7BA 1XKQA 1P73A 3PXBA 3V4PB 4AJKA 5IVHA 1AV7A 1N2OA 1ZW6A 5IC5A 4N6NA 2ZJ5A 1LPPA 1KH2A 2F48A 6CHYA 1JL3A 1E2UA 3OMWA 3NOQA 3GJTA 2XCTB 2PGNA 1OWLA 4MR8B 4Y30A 1KR2A 1WQ4A 4ND8B 4FW8A 1YKSA 2DQ4A 1WOYA 4UUBA 4B84A 1P19A 1V26A 2W8ZA 2WUDA 4ZT5A 2XUHA 1RACA 2N9UA 2A0XA 2J85A 4M0UA 1FVFA 3C1AA 4MV5A 4UAJA 5BVGA 5ITZB 5GIOE 3KT8A 2DFLA 3NTLA 3FH0A 2YINC 1CUVA 4NH4A 4NYMR 4XPIA 2X0EA 5DP2A 3VXKA 3TG8A 2YWBA 3I58A 3VOTA 3CT6A 4BVBA 2G0NA 3JQQA 1VLZA 1Z07A 4EJ2A 5KQLA 5BURA 3G0BA 3HWRA 2PH1A 1POWA 3AESA 3RS0A 1JILA 2EFJA 3B1XA 3KTOA 2WF8A 2ZJ0A 4GGOA 3T8YA 4RHTA 4BKQA 1PR9A 2CHUA 4IOJA 2QR3A 2A78A 3WKBA 4A2QA 4BUJA 4CM5A 5C5EA 3ZVKA 1UKEA 2HU7A 4IWNA 4B4WA 4M0EA 3U40A 2JLZA 2IH4A 3G6KA 4DV5B 3CZMA 1GUZA 2O06A 1PNRA 3WAGA 3OD5A 2KHZA 3EFBA 4DANA 2BKLA 2WTUA 2UYHA 5ELXA 1QZZA 2AK3A 4RL6A 5CVTA 4E5DA 3N8HA 1GPDG 1QB7A 4S35A 2WWYA 1D6NA 2C8JA 4R69A 1ZJWA 3UHOA 1UXKA 1LSJA 2BZ0A 2OYSA 2HHCA 2WIGA 5HF9A 1B1CA 1M1YE 2A6PA 3I2GA 4GC5A 3W78A 2EGGA 3LZ6A 1U5AA 2FZWA 1PJ2A 2FPGA 2ZJZA 1KNQA 2XVZA 2R25B 2AJCA 3GAMA 5KWIA 1EESA 3OIYA 4TMYA 4A0HA 5KNDH 4UMFA 3E1SA 5HGJA 1QH8B 4CU2A 4FJ2A 3I37X 1FOEB 2RFLA 3PEVA 2VP4A 5B1DA 4BIMA 3OICA 3ZQKA 5IF9A 2IBSA 3AF6A 3RYHA 3O82A 1BXGA 2PT5A 1E8DA 1I1NA 3JPYA 3C7AA 1PK9A 2GS9A 2M32A 3LQKA 2FZGA 5CW2A 1EXDA 2VAPA 4I4TB 4NBVA 1HT0A 1XZMA 1JLHA 4U9HS 2RJ3A 2HDHA 3L6CA 4Q7MB 4WLVA 1U0BB 4C78A 1FNBA 5KVAA 1DXOA 5FORA 4TXMA 4ZOAA 2H8KA 3DEAA 1O87A 3R7SA 4WVFA 4CMHA 1WUKS 5ED4A 1MCZA 4WADA 1USWA 2ZT7A 4B3DA 1OTHA 4D45A 4UKDA 2GHQA 3NYRA 1CHNA 4HJXA 1OAOC 4KPYA 1KQPA 4REQA 3KUKA 4WOJA 2E89A 1VE3A 2RGXA 1H2YA 4O4HF 3NHMA 3E23A 4OQXA 4X92A 5T57A 4CMGA 2X6QA 1TFUA 2AG6A 3R9WA 1TM5E 1RTTA 3ANXA 3DDCA 2KE5A 2JPDA 3G8BA 1P9WA 3I8OA 1UANA 4FFBA 1VMIA 1XKTA 4JC0A 4LDRA 1M76A 1E0DA 3MD0A 2ZTVA 4RVFA 1HI9A 2OV2A 5CPBA 4YFYA 1ULZA 1XZAA 2GESA 2H7XA 2J6HA 1E77A 3FTFA 3ILSA 3O4RA 3VOSA 1KEPA 4CIBA 4J0GA 1NRJB 2R11A 3ZNOA 5KIAA 2HB6A 4M7RA 4BMSA 5FTKA 3RYCB 1ZESA 2ZT5A 2AUTA 3GZTB 3PC8A 5E1OA 2CXRA 3WBFA 1T3TA 2IY7A 3SVLA 4QFDA 2PE5A 3U7GA 1Q11A 4FFWA 1QO0A 3EPHA 1QQ6A 3TKAA 3FUWA 1CUDA 1JX6A 1KBQA 2MSEB 3I01M 3SYMA 2WV7A 2J7PA 5EUCA 2W71A 2ZRKA 3VNQA 4KVFA 1IJEA 1BE6A 2YHSA 2ZYRA 3LUBA 3H13A 2C5FA 3GT4A 4HXFB 1UINA 4TV9B 2XA1A 3ZTYA 3HCPA 1N1DA 1SCIA 5EXPA 1U28A 1GPYA 1NZDA 1XU4A 2NSYA 3UMMA 5JO9A 4MWDA 2BEUA 4OHYA 3K53A 3ET5A 4D8YA 1B3BA 1NXOA 5KJ1A 2H52A 2WAOA 2D1SA 3FYUB 3HBJA 3IPLA 4U3JA 4V03A 5EZSA 3OIFA 3PHHA 2QSYA 4UE6A 4QRHA 3PQEA 3OCJA 2XIQA 3R6WA 4ITRC 5IJZA 4E5NA 1UT6A 3Q5GA 3UOWA 2O8EA 4GH5A 2M6SA 2NIPA 3B9RA 3TTWA 4RPCA 1E7WA 3CUUA 5HPYB 4DLLA 4QYSA 5L3ZA 2V65A 3IXLA 3NIDB 5DGXA 4JLWA 3DKVA 3ZYZA 4NOKA 3LJKA 2DBYA 2WIAA 2B3TA 4BNIA 1T9AA 3UEOA 4F92B 4C2UA 2XBLA 3W79A 1CJCA 1QCDA 4BGEA 4P4LA 5FUXA 2OCYC 1N33B 3LQFA 4RY9A 1YZGA 5JY1A 2XTNA 3I12A 4H4CA 5DSXA 2HEIA 2G4VA 3W3AD 3LBAA 3ITDA 5AKIA 3EPKA 2R68A 4RIEA 1Q91A 2QN2A 3PDIB 3GFTA 4JLAA 5TMPA 1K27A 2GHIA 2WUWE 4KWCA 4NENB 5LR6A 1UC4B 3C85A 4PC2A 3KIPA 5FOTA 3RSHA 2L42A 4WNCA 1QFMA 3OQOA 6REQA 1W0CA 2CNNA 2DHRA 4OREX 3HKBA 1US8B 4JR0A 1CVLA 4YRKA 2MHCA 2I0FA 2P40A 2PMFA 4MAAA 4DM3A 3C8ZA 2IBTA 1KGDA 2I4OA 3C6YA 4H3VA 4B75A 1BHQ1 3CNNA 3FPGA 1P3DA 2VP0A 3CNQS 5HCNA 1Z13A 3CW2A 4QYIB 4DVGA 1U9JA 1JG6A 2R44A 4I6GA 4MZXA 4ACBA 4AZWA 5HKOA 4MJLA 2BP7A 2WPDA 2IE8A 3A28A 2R6AA 4QM7A 2HBZA 4B5LA 2A30A 4WY2A 5KINB 2X2OA 3LQ4A 3S28A 5EE1A 3B2QA 4FZRA 4A1FA 1L7NA 2ZUBA 3BK2A 1S4MA 2PZKA 3LP6A 4TTIA 3GEMA 5IJXA 2HJVA 1P2GA 4PC7A 4QOFA 1XD2A 4BEJA 2O5EA 2VOJA 4ZDIA 4IOKA 4MPPA 3GLIA 1Z4OA 2R7AA 5LC1A 5DT2A 5GOZA 2WP0A 3HFGA 4Y2JA 1T3GA 1F20A 4OB6A 2NYAA 3VKUA 4ZZ0A 1GG9A 3EA0A 5M3BA 1OAOA 1I94B 1A9YA 1AHIA 1JBKA 1QDUA 3TXAA 1H94A 1ICIA 2PR7A 1WX1A 2X14A 4XGQA 1MV8A 1MJ5A 5CK4A 3GWGA 3N0WA 1BX1A 3TM5A 3D5EA 5I7OA 4YQZA 3R20A 2DR3A 3OOYA 1P6QA 1QAQA 3L2OB 1V3VA 4COKA 2BTEA 4HVLA 5J4YA 3L6BA 4MUHA 3DMYA 4O33A 1IY0A 4CV1A 3OUZA 1VMDA 4DLKA 3ELUA 5TX7A 2O8FA 4KUHA 1E2EA 4XUCA 2QX9A 5F7XA 4M22A 1IBSA 3AERA 4GLBA 4X3OA 2IS1A 1BMQA 2MWMA 4PFSA 4KFCA 3CXRA 1NV8A 1XQ1A 1Y1QA 5EYPA 4IIXA 1T9GS 3EVAA 3M2PA 1BTOA 1YQQA 1ISGA 1USUA 2LDXA 2XJ9A 3GCXA 4M9UA 1PYDA 5KQPA 2EDAA 2FUG1 4WA7A 1SRRA 5F5NA 5JYBA 3BIFA 3GPCA 4BCDA 3O8NA 1FDVA 2RKOA 3K05A 1PV4A 3CF4G 3IBGA 3IQFA 3UJ9A 5JXHA 1FX1A 3H42B 4DYHA 1UXGA 2XYVA 3FX2A 3IEMA 2A57A 1HH4A 3EXHC 2F3TA 1DC6A 1XCPA 1M6YA 3DZFA 3QA9A 4KAXA 5JDIC 1EVEA 1Y33E 4BQFA 4AJNA 3E7WA 4Z4QA 3I23A 4PZCA 4FSHA 4TM8A 3SPXA 1RS0A 3FZEA 1V3QE 2YXLA 4HAUA 4HQOA 5JARA 1Y5NA 1ZSVA 4KQHA 1EIWA 2JLWA 1EZ4A 3M4JA 4Z2YA 1SBTA 2HYDA 4KE9A 2H5JA 2BLLA 2JJMA 2UZIR 3G5TA 2IP1A 4CLOA 1T1GA 3QMWA 3DE2X 1S8FA 4DZRA 4KW7A 3E6AA 2B30A 2PZMA 4HWOA 4OFXA 2AQIA 1JR3E 4J7CA 2D2FA 2VPYA 1ZUNA 2WA2A 1W4BA 1AD2A 4GZ3A 3HBLA 1EZ1A 3NO4A 3U7FB 3GRYA 2O5VA 1GPLA 1T6ZA 4U4AA 5DLPA 4D4LA 1XQVA 3ADBA 3IMGA 1CY4A 5IT9A 1FSZA 3V6LA 3RVOA 4C04A 1C3VA 2VKTA 4K88A 4RM2A 1DJMA 2V5UA 4HZGA 1RPNA 3EGDB 2B82A 3EZ7A 3G8YA 3QX8A 3OCVA 4AVYA 4C0HA 3L6DA 4I8XA 3PNMA 4BV3A 1Q83A 5JVDF 1RI2A 3OTWA 4ID9A 4OVKA 1J8YF 1HZZC 2QG4A 2QHXA 1PJ8A 1Y4AE 5DV9A 1C80A 4HEA6 4DCJA 4EO9A 3HNRA 2P9CA 2HUPA 4D8VA 2Q7XA 3WB0A 1T8YA 2IODA 2GTIA 2V0NA 1GITA 5DEOA 3U4DA 3I62A 1TECE 2ZKIA 2WJ4A 3D64A 3WISA 3LHIA 1QGUA 4N49A 3RG8A 4BBPA 3TNJA 1IVYA 2B3DA 2F64A 3CCFA 4UUAA 4B7XA 5JS7A 1NFQA 2C9YA 5AW5A 3R74A 1A72A 4D57A 1JQEA 2Z4RA 4EL5A 2C5BA 3AHIA 3LCVB 1F8YA 1UFQA 2FEMA 1GSHA 1JQJC 2PMBA 3VRHA 3F6RA 4G0YA 5DTMA 3B7WA 4HAVA 4MIYA 3JRWA 3UMSA 4V1CI 2ADMA 1S8OA 2V59A 4TV8A 3EDMA 3AUAA 2XSZD 3KPVA 4QULA 2G40A 3QKRA 3ZOKA 2I03A 4I5DA 1VSUA 2BHRA 1HQKA 4WXHA 4BX2A 5LNK1 1YIAA 2HOQA 4X3CA 1QIMA 1U0GA 1E4VA 4EPTA 4YJ2A 3WWPA 4K03A 5ABPA 4CUZA 1NYLA 3V8PA 4EAAA 4KU4A 4B3IA 1NI4B 3QJGA 1DRKA 4PLPA 2PUAA 2O7VA 1KYQA 2BELA 5HYVA 5IJ9A 2IYYA 1INLA 4X91A 3HCFA 4O2AF 5LZ7A 1YF3A 3NANA 2X0JA 3L92A 2ZBQA 2XUAA 1E62A 2QVGA 1A7KA