3IQLA

Crystal structure of the rat endophilin-a1 sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
SVGSDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endophilin-A1
publication title SH3 domains from a subset of BAR proteins define a Ubl-binding domain and implicate parkin in synaptic ubiquitination.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 12
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3iqlA00
1AVZC 3VS2A 1AEYA 4JZ4A 5IXFA 2D1XA 2LX7A 2FG0A 2JM8A 1UECA 2J05A 1UGVA 2ROLA 2GQIA 1EFNA 2YUQA 2EVRA 2FRWA 2NUZA 4AFUC 3PVLA 2RNAA 1ABOA 1UDLA 2QDLA 4J9GA 2CSQA 2JTEA 2CUDA 4CC7A 1M3AA 2MOXA 3NPFA 3UATA 2EW3A 2BTTA 1M3CA 1U06A 2IIMA 2CSIA 2ED1A 2OAWA 3EHQA 2KNBB 2EYYA 1T0HA 1YWOA 4JJDA 1MV3A 1K76A 2FEIA 2MCNA 4OMQA 2JMCA 1ZUYA 2EPDA 3I35A 2DLPA 4RUGA 4J9DA 1QCFA 2CUBA 2EQIA 4LUEA 3TSZA 4AG1C 1WXTA 2KE9A 2O88A 4LUDA 1BK2A 1PKTA 2OI3A 2XMFA 2VVKA 5FW9A 3UF4A 5EC7A 4CC3A 1FMKA 2RN8A 2C0OA 1WX6A 2DL3A 3IQLA 1QWEA 1K0SA 2HBWA 1T3LA 1AZGB 1BB9A 2AK5A 1JO8A 1HJDA 2LZ6B 2AZVA 4IIOA 4ORZA 2GTJA 1WXUA 2AZSA 2CH4W 4JPBW 1AOJA 1TUDA 2CT3A 4OMOA 4F17A 1OPKA 2V1RA 2KT1A 1GFDA 1NYGA 2DL7A 2E5KA 1OEBA 1H92A 2FPFA 2V1QA 2EBPA 1YN8A 1ZUUA 3SHWA 1FYNA 1W6XA 1KFZA 1KIKA 1K1ZA 3H0FA 2HSPA 2BZ8A 2L0AA 2VWFA 2RQRA 1K0XA 3NMZC 4HVUA 1M27C 2RQWA 1M30A 2LJ0A 2PTKA 2K3BA 1YNZA 1JQQA 4E6RA 1SPKA 5IHNA 4A63B 1K4US 5FWCA 3PVQA 2A08A 2LJ1A 3KFVA 4D8KA 1X27A 1YP5A 1B07A 2HDAA 3H0HA 2ESWA 2F2VA 2W10A 2BZYA 1GCQC 2DL4A 3VRYA 2W0ZA 4ZNXA 1VYVA 1I1JA 1RUWA 1QLYA 3VS5A 3C0CA 3VS6A 1MUZA 3NHNA 4AG2C 4QT7A 1AWJA 1UUEA 1AD5A 1I07A 3CQTA 2O9SA 1UFFA 2LP5A 1X2KA 1HD3A 2DMOA 3QWYA 2CDTA 2I0NA 3VRZA 1SHFA 4M4ZA 2KR3A 4ESRA 2ED0A 1WFWA 1ZBJA 2DILA 1OPLA 2JS2A 3H41A 4DEYA 1NEGA 1PKSA 2EYZA 4X1VA 1PHTA 1QWFA 1OV3A 1QKWA 2DBMA 4F14A 2SEMA 2DL8A 1TG0A 1NLPC 4CC4B 4AFSC 1YWPA 1VYUA 4Z89A 2D0NA 4IIMA 4HVWA 1GFCA 2H8HA 3VS1A 4J9EA 4EIKA 3TSWA 3ZL7C 4J9HA 4RTTA 2C0TA 5IH2A 1ZSGA 1S1NA 1IO6A 2JM9A 1V1CA 1BU1A 1PNJA 2EYXA 1AWWA 2LCSA 3VS4A 1VA7A 2KXDA 1WDXA 2PNIA 1Y0MA 2L3PA 5IXBA 3THKA 4RTWA 2O2OA 4Z8AA 1GCPA 4Z88A 4F16A 1GBRA 1ABQA 4J9CA 1W1FA 2JW4A 1VYTA 4LE9A 4OMNA 3EG2A 3O5ZA 4LNPA 2DX1A 1X6GA 2L3QA 2DNUA 1E7OA 3M0SA 1JXMA 1E6HA 5HCKA 2EYWA 2OJ2A 4HVVA 1T3SA 1RLPC 1XOVA 1K9AA 3PE0A 4WCIA 1SRLA 2A28A 4RTYA 2EGEA 1B3QA 1M8MA 2LQNA 2KROA 2CT4A 1MV0B 1WA7A 2DYBA 5FWBA 2JT4A 3M0QA 4JJBA 2FRYA 3UA6A 1PRMC 1G2BA 2RF0A 2B86A 2ENMA 1GBQA 3VS7A 2NWMA 2PZ1A 1ZX6A 4RTVA 1W70A 1ZUKA 2J6FA 2A36A 1WYXA 3QWXX 4DEXA 1UHCA 4Y92A 2RPNA 2VKNA 3RNJA 2RQVA 4JJCA 2G6FX 1NM7A 1H8KA 1G83A 1CSKA 2DVJA 1WLPB 2J6KA 2LMJA 2SRCA 1E6GA 1X2QA 2M51A 4HXJA 4RTZA 4KRTA 2L3SA 1N5ZA 2MIOA 3EHRA 5L23A 2KGTA 1KJWA 1UJYA 1X69A 2YUOA 1AZEA 1NG2A 3EGUA 1X6BA 2F2XA 4OMLA 3UA7A 2KBTA 2DA9A 4AFQC 2K9GA 4J9BA 1M3BA 2EGAA 1X43A 1T0JA 1UHFA 2GNCA 2LNHB 1ARKA 1LCKA 3ULRB 2ABLA 2K7AA 2JS0A 2BZXA 2FO0A 2D8JA 3NGPA 3EG1A 4LN2A 2HCKA 1PWTA 1SHGA 1AWOA 2GTOA 1UJ0A 2C0IA 1NLOC 1RLQC 2YDLA 2A37A 2DRKA 1JEGA 3A98A 1TUCA 2DE0X 2P4RA 2KRNA 2FPEA 1I0CA 1HSQA 3LH5A 1JU5C 2F2WA 3H0IA 3REBB 3U23A 2K6DA 4K11A 2GGRA 3R6NA 2DF6A 2DL5A 1J3TA 2O9VA 2KYBA 2X3XD 1SSHA 2EGCA 2JXBA 2DJQA 5IHKA 2X3WD 1SEMA 5IHIA 1Z9QA 5I22A 2KRMA 2YUPA 2D8HA 3JV3A 4HCKA 4R0KA 3TVTA 2FPDA 2J06A 1Y57A 1YCSB 1JXOA 3M0PA 2L2PA 1NYFA 2J7IA 1ZLMA 1NEBA 2YSQA 2K2MA 1SRMA 3EG0A 1WIEA 1CKAA 3M0RA 5GJWB 4RTXA 4OMMA 3SEMA 4GBQA 2CH4A 3I5SA 4JZ3A 2HEQA 3M0UA 2JMAA 2LQWA 1OOTA 3EG3A 3REAB 2DRMA 3M0TA 2DM1A 1UG1A 2CREA 2YT6A 1H3HA 1GL5A 2GBQA 2O31A 4J9FA 2K79A 4CC2A 1BBZA 2M0YA 1RI9A 2KXCA 2KYMA 2ROTA 3RBBB 4J9IA 3I9QA 2J6OA 1U3OA 1GRIA 3FJ5A 5ECAA 1UE9A 1WI7A 2DBKA 2LJ3A 2RMOA 1KSWA 4OMPA 1A0NB 1WXBA 5GJVB 2AKLA 2EKHA 1GCQA 2KRSA 2RQTA 3I5RA 4GLMA 2ECZA 1QKXA 3VS3A 1U5SA 2KT8A 3GBQA 1PRLC 1Z9ZA 4D8DA 4FSSA 3VS0A 2YUNA 1AWXA 2AKKA 4AFZC 1CKBA 4RTUA 2KEAA 2RQUA 5I11A 1UTIA
chains in the Genus database with same CATH superfamily
1OX9A 1AVZC 2X9HA 3GF5A 3JB9D 1QVFA 1AEYA 4PJOD 2LX7A 2FG0A 3OW2P 1I5OB 2OX7A 1UGVA 2YUQA 2EVRA 4XQ3A 4AFUC 1UDLA 4J9GA 4BD3A 2COWA 3BDLA 1KQSS 4CC7A 5GAMg 2X4JA 3NPFA 1LVKA 4BACA 4C8QE 1M3CA 1U06A 1RADB 1IRXA 3EHQA 3EFOB 3M59A 3OB9A 1T0HA 3L2QA 1MV3A 1K76A 5D6XA 2MCNA 1YHQT 4C8QF 1BIAA 1ZUYA 1H3ZA 3I35A 2DLPA 2MAMA 3NTKA 2CP7A 3S6WA 1D0ZA 1PKTA 2CP3A 2XMFA 4FYVB 2JTMA 4J6WA 4C92E 1QVFS 4IUTA 3RMSA 1FMKA 2OAUA 2RN8A 1WX6A 4M7DB 1VQ9A 3IQLA 1YI2A 4ZN3A 3MHXA 1WHHA 3L2UA 1Q95G 1VQPT 1ZHIA 2O01E 2HBWA 2XD0A 2AK5A 2V26A 1JO8A 1LPLA 4C92F 3OA6A 2LZ6B 4A4EA 1QVGP 3G71A 1WNLA 5GAOm 2VC8A 4M7AF 1OX8A 1WXUA 2P4TA 4E7SA 5GAMh 2CT3A 4OMOA 4XTUA 3CXCP 4F17A 4E7LA 3EH2A 1GFDA 1UGRB 2DL7A 4RCCA 3DB3A 1H92A 3JCMf 1PG5B 2FPFA 3EGDA 2QK0A 2EBPA 3L2VA 3C94A 1D1BA 4OGEA 3CCJT 4PFPA 2CP2A 2PVOB 1KIKA 1Q82R 3GPLA 4MDXA 3J80E 1K0XA 3CCEA 4HVUA 2EAYA 1M27C 5M9OA 2D0QB 2JOYA 2LJ0A 3BFMA 1EZZB 1YNZA 1LJOA 3H9NA 4E6RA 5CKEA 4FYXB 3CCQT 2V8KA 3PVQA 3KFVA 3TQ7P 1QP2A 2ESWA 4XU2A 2DD5A 3L2ZA 1IZ6A 1JB0E 3GNFB 2DL4A 2MPXC 4ZNXA 3BW1A 3PTAA 3QBYA 4KH1B 1R77A 3VS6A 1PD1A 2QQRA 4C0ZA 2MK5A 3OBYA 2JN0A 1X75C 3FDRA 2IPOB 1D0YA 5A0LA 4OB2B 2LP5A 2VGMA 4XTXA 5GMKl 2CS7A 1BI0A 3RERA 4JLIA 1VQ6T 2PVDB 4ESRA 4M4ZA 1JJ2P 5DLOA 3QXEB 2DILA 3M56A 2JS2A 4DEYA 3M53A 1ZBXA 2DTOA 2PUKB 2XG8D 1QWFA 3WVEB 1QKWA 4F14A 2DL8A 4ATOA 3OYDA 2LNVA 3NTIA 4CC4B 1Q81U 4PJOC 2QYZA 3EFOA 4QQGA 4Z89A 4IIMA 1Y71A 4XTVA 4PLLA 2H8HA 1ZA1B 4EIKA 4RTTA 5IH2A 1DJ7B 1LNXA 1V1CA 1V29B 5CR2A 2DXCA 4FL6A 4PNOA 3CC7A 2EYXA 1VA7A 2KXDA 1N9SA 2DTIA 3FJPA 1Y0MA 5IXBA 1BKBA 4Z8AA 5CVIA 1RL2A 1VOMA 3RKXA 4L59A 4M7DG 2JW4A 1VYTA 4M7DA 1KQ2A 3EG2A 4N4IA 1JBMA 4KBMB 2B8AA 4FT2A 2Z0WA 2OJ2A 2BKDN 3CD6T 1V76A 1H641 4ANJA 4E7HA 2RK2A 2FL7A 4LDUA 1W2BP 1SRLA 1XNIA 1BIBA 3G4ST 4KUIA 3QG1A 3ME9A 1MV0B 5FWBA 2FRYA 3UA6A 4JRQA 2B86A 3A8HB 2PVGB 2Y4YA 3I55A 2NWMA 3OW2A 3QUIA 2P0PA 2DVEA 3RR6A 3CMAQ 1I4K1 4RTVA 1ZUKA 4JRKA 2DD4A 1KHCA 1QP3A 4OP0A 2J6FA 3OQ5A 2CZ1B 3CC2T 4DEXA 1MGQA 3OMGA 5EG2A 3C95A 5IAYA 2RQVA 2XDPA 1VQLT 3PNWC 1NM7A 2DVJA 2SRCA 1WLPB 1VQ8Q 1E6GA 4JRPA 4RTZA 3VYHB 4KRTA 3CCLA 2L3SA 5FU6C 4A54A 5HK0A 1UJYA 1I5LA 1X69A 2RJEA 1NG2A 4UC4A 3HRUA 5GAMe 2XDDA 2QEXQ 2EIFA 4OMLA 1VQMA 2KBTA 2WACA 2LTOA 1TU0B 2EGAA 1T0JA 4A4GA 2JS0A 2BZXA 2DIQA 3OW2S 1KC8U 4PJOB 4BE0A 4LN2A 2HCKA 1SHGA 3CBOA 2RB6A 5GAMj 1QVGA 1RLQC 3X20B 5GAN8 3SD4A 2FPEA 3ASKA 1HSQA 3CCUT 5KH6A 1NJIU 2FB7A 3U23A 4Q5WA 4K11A 2CP0A 5C0MA 3R6NA 2PU9B 3QIIA 2HKQB 3FRNA 2O9VA 4RG2A 2DETA 2K57A 1GXIE 2EGCA 1KG1A 5GAN7 2HZYA 1VQOQ 2P0QA 5IHIA 2LQKA 5LL6S 3LLRA 2D8HA 5GAN5 1K8AU 1FXXA 4N0AC 3E9GA 2E65A 3M0PA 2L2PA 5GANg 1NYFA 4PFZA 2J7IA 1SRMA 6AT1B 1N6AA 4JZ3A 2K2VA 1IGUA 1OOTA 3CC2Q 4BI3A 1RAHB 5CKBA 1S72T 2DM1A 1VQKT 1JRIA 4EMHA 4CC2A 5LJ5g 3EGXB 2H3JA 3RBBB 4J9IA 2J6OA 1N8RC 4QVDA 1UE9A 1K73U 2DBKA 2ZPEB 1JJ2A 1A0NB 4FW2A 3A8MB 2EQJA 3CCMT 1R8OB 2KRSA 1RAFB 5FU6B 3I5RA 4FW1A 4KT0E 2KT8A 4E7JA 2ATCB 3GBQA 4FSSA 5KYUB 3M4YA 4RTUA 4M7DE 5LJ3f 5GANf 2JUFA 5I11A 3F70A 4PJNA 2A0FB 3GNGA 4C0FA 1C1AA 1N9RA 3VS2A 2FZKB 5IXFA 4LXCA 2MMPA 3KUFA 3N5BB 3CCSQ 2ZPFB 2X51A 2JM8A 1WHGA 4M7DF 3D7SB 3I56T 3CEYA 1MMDA 3CCVT 1ABOA 2QDLA 2JTEA 2QTVA 1M3AA 1YIJA 2MOXA 4M75D 5KYYA 3JB9G 2C06A 2E6ZA 4E47A 5LJ5f 4PJOG 2CSIA 3G7ZA 4PJOA 5GAOn 4CRIA 2FEIA 3QKJA 1YJWT 4FIBA 3M4GA 2EPDA 2LT4A 3UPUA 4J9DA 2CUBA 2EQIA 4LUEA 5GAN6 2KE9A 4J8OA 4LUDA 1BK2A 1KHIA 2LRQA 1W2BA 2QGFB 3S3MA 5GAN3 4ELYC 5EC7A 1TUGB 3A8LB 1VQNQ 2DL3A 3OSVA 3L1AA 1T3LA 1BB9A 1S72Q 1VQKQ 1G3WA 2EWNA 4BDYA 3GIBA 2AZSA 3EFRA 3HHTB 2CH4W 1AOJA 3LGLA 1OPKA 2L5QA 2E5KA 2LDMA 2NYSA 3CC4A 1OEBA 2DK3A 3ZBDA 2V1QA 1YJ9A 4MMLA 4IUUA 2DERA 1W4SA 3P8DA 2HSPA 4OB3B 2L0AA 3BDUA 4R55A 2QA4T 5GAOr 1BCMA 4KUDK 2VWFA 2RQRA 3PMIA 4XU0A 1HK9A 3CMET 5IN1A 1WZOA 1M30A 4BY6C 2PTKA 1EX4A 2E4HA 3EGXA 2CZ0B 1BI2A 3A8OB 4FYWB 3OYJA 3MJXA 3VV0A 1VQ5Q 4JJNK 3VU3C 2LQ8A 2VYTA 3H0HA 1Y07A 3VJPA 1M1FA 1BI1A 2W10A 3HRTA 3MCAB 1VYVA 4FT4A 3Q1JA 4ELZC 4IURA 1QLYA 3WVDB 3FLGA 5KYUA 4WF2A 4QKUA 3X24B 1WPYA 1FMWA 5I2MA 2K5FA 3CQTA 4C5HA 1X2KA 3HPWA 4OGCA 4Z02A 2DMOA 3VKIA 4RKUE 2I0NA 1YJ9T 3VRZA 1SHFA 2OTLT 2ED0A 3QZ5B 1WFWA 3JCMg 1SKUB 4M78G 4E2FB 1NEGA 1PKSA 3TREA 4FCYA 4X1VA 1PHTA 1Q86U 2BUDA 3HP9A 1VQ7T 1NPRA 1TG0A 1OU8A 1NLPC 2JVVA 1YJNT 2HBPA 1VYUA 2D0NA 2RJCA 1YFNA 2YRDA 4J9EA 2XK0A 3TSWA 1IHVA 4PLIA 1HXDA 2JM9A 2RHUA 2FYKA 1BU1A 1AWWA 2XKOC 1FX7A 2LCSA 4M7AE 3VS4A 4M75C 2L3PA 2O2OA 1GCPA 1MMGA 2GFAA 4F16A 4N0AA 3EFSA 1Q81C 4OMNA 2DZ9A 4E7IA 4X9DA 4LNPA 2DX1A 4C0GA 3JB9J 2G3RA 1X6GA 2MYSA 3L2WA 1JXMA 3ZFJA 1E6HA 5HCKA 3OYFA 1T3SA 3J81E 1WJRA 2DAQA 4MZMA 5HY6A 3PIOA 5HK3A 4EMGA 2EGEA 3CMAA 1OULA 2K3YA 2E70A 4OVAA 2CT4A 4LD9K 5GMKm 1WJSA 1VUBA 3P8HA 4BY6B 1PRMC 4PJOE 2HQEA 2A3LA 2ENMA 4XU1A 2DKGA 4KULA 1U1SA 2P0KA 3H6ZA 3V7CA 2HKNA 2QTXA 2CP6A 3JB9F 1MMNA 3AT1B 3OYLA 5CQXA 1VQ9T 3QHSA 4PJOF 3JRZA 4OB0B 1YI2T 3C12A 3OS1A 1D3BB 2RPNA 2VKNA 4J83A 3PFSA 1Y7XA 2R58A 3G71T 1U8RA 2QEXA 3OYGA 2OTLQ 1G83A 3CCRA 2J6KA 4M78D 1N5ZA 1PSFA 2P84A 3QSUA 5L23A 2KSSA 1AZEA 2HQHA 1YHQQ 3DB4A 1R0BG 3JCMW 4AFQC 2ZPGB 5KE2A 4J9BA 1WGSA 4LDYA 2XHCA 3RKWA 2ZPHB 3SWNC 4XK8E 3CCET 2K7AA 3RESA 4AT1B 4IKFA 2NUPB 2Y4XA 3MP8A 1PWTA 2QXFA 4MDWA 2VB6A 1VQPQ 1AWOA 1VIFA 1NLOC 5GAMd 1MHNA 3PGGA 4TVRA 3AHUA 3G6EA 3A98A 2P4RA 2KRNA 2YLCA 3JSCA 1VQOA 4M75B 2F2WA 3E19A 1KC8R 3QDFA 1M5Q1 2DF6A 2DL5A 3UT1A 2KYBA 4DA4A 1KC8C 3CBPA 2JXBA 3V7SA 4DOVA 5CKHA 3CCJQ 2COZA 2E3HA 1Z9QA 3SB2A 5C6SA 2YUPA 2YHTA 1NJIR 2RI2A 2LCLA 4R0KA 5FROA 4XTWA 1Y57A 3OBWA 1NJIC 1NEBA 3EG0A 1Q82U 1CKAA 1MNEA 5GJWB 3CCQQ 2BE9B 2E41A 2QQSA 2JMAA 1YI2Q 4OF1A 2BIVA 2XU8A 2R5AA 3INZA 1B7TA 2QG9B 1K8AR 4EDUA 2EYQA 4L6V5 2HNIA 1H3HA 4N4GA 1K8AC 3G6ET 4B9WA 2K79A 2M0OA 2L89A 2KDSA 3CC7T 4ZGEB 5CO7A 2KYMA 3M58A 2R5MA 2F5KA 1XTDA 1U3OA 3TCJA 3X28B 1ZSZC 3FJ5A 1WI7A 2DYIA 3G1JA 1KSWA 4B6MA 2D6FA 4DBRA 2L3RA 1VQ6Q 1RAAB 3OY9A 1WXBA 1WQ7A 2GQVA 2MWPA 1D3BA 1WJQA 3CCSA 1QKXA 3VS3A 1PRLC 1Z9ZA 4ZGDB 3VS0A 5GAN4 1AWXA 2AKKA 4AFZC 1SF9A 2KEAA 1K73R 2LC4A 2NUTB 1YBYA 4JZ4A 3WXMB 4BI4A 3JCMe 2CGHA 1K73C 2IG0A 3SWNB 1UECA 2J05A 4RCBA 1WHJA 5KYYB 2EQUA 2LCCA 4ZTFA 3PVLA 3RMQA 2RNAA 3OS2A 2CSQA 2CUDA 1VQ4A 2HQXA 4M78C 3I55T 3UATA 4A4FA 2BTTA 1WHMA 2NUPA 4J5YA 4OMFB 2KNBB 3URGA 2EYYA 4ZTJA 2YXYA 1OZ3A 1O75A 8ATCB 5I21A 4EPCA 3JCMQ 3M55A 2QQBA 4O5VA 1VQNA 1NE8A 4RUGA 5CKFA 3CD6Q 4J7FA 2KAFA 3TSZA 4F7UG 4M75G 2CP5A 4M75A 3CCLT 2AT1B 3BY7A 3UF4A 2AHJB 1G5VA 1AHJB 4CC3A 1NPPA 5CK9A 3RDVA 2C0OA 4A53A 3G4SQ 1UB4A 2RK1A 1K0SA 1OZ2A 1VQMT 2ZAEA 3VYGA 5LJ3g 2V8IA 2VUBA 2H3EB 2AZVA 4IIOA 1YITA 2DXUA 4ORZA 2BE7D 1G3YA 2EJ9A 2LVMA 2RO0A 2WSEE 3MKDA 9ATCB 2GTJA 2WSCE 3SFMA 2RHYA 1LOJA 1VQ4T 2V1RA 1Y96B 4AMCA 2KT1A 4M77D 1NYGA 2F5TX 1PM3A 4Y28E 2DXTA 3RUXA 1VQLQ 2OTJA 5FRMA 1YN8A 2FZCB 4JS5A 3QYHB 1W6XA 1KFZA 1N8RR 4IUQA 2QQ9A 2BZ8A 1ZSZB 1VQ5A 1M2OA 1IB8A 1D09B 3NMZC 5KYWA 1BYMA 3TEEA 5IHNA 2MF2A 4A63B 4OB1B 1K4US 2A08A 2LJ1A 1B07A 3EG9B 4LDXA 1M8VA 5LJ3h 5GANh 2F2VA 1GCQC 4C92G 2D9TA 1YITT 2KY9A 1M9SA 1I1JA 3VS5A 3C0CA 1MUZA 3NHNA 4AG2C 4QT7A 1UUEA 1AD5A 1I07A 3MEAA 1UFFA 2CZ7B 3OS5A 1OI1A 3CCUQ 2NUTA 5GAOp 4M78B 1G3TA 3QWYA 3EAEA 3SWNA 5L8RE 1ZBJA 5LJ5h 4RG8A 2RH2A 2EYZA 3V7RA 3CPWA 4QVZA 5D6YA 2DFUA 4XU3A 4WTOB 4AFSC 4V2SA 1VQMQ 3A5ZB 1IREB 1ZA2B 3LW5E 4II1A 4HVWA 3VS1A 4DOWA 4C5IA 3ZL7C 4J9HA 2EKOA 2ZZDA 2C0TA 2JZ2A 1ZSGA 1S1NA 1MNDA 1YCYA 1HYOA 1Q86R 1BCOA 2QQAA 4XAXB 2PNIA 5KCHA 3THKA 1Q86C 4Z88A 4J9CA 1W1FA 2DIGA 4LE9A 2E6NA 4N4HA 3GOXA 5A0DA 5J3BA 1R0CB 1XQHA 3O5ZA 5KYXB 1IGQA 4C8QD 1M90U 4PJJA 1Q7YU 2L3QA 2E1HA 2DNUA 3M0SA 1YIJT 4HVVA 4MZTA 3CPWS 1K9AA 1P92A 3L2RA 3CCMQ 1D1AA 1Y96A 2A28A 3QO3A 1B3QA 2LQNA 2EJFA 2YRVA 1WA7A 2DYBA 4PJMA 2JT4A 4JJBA 2FHDA 4C92D 4LDWA 1G2BA 2RF0A 2GF7A 4M7AD 1GBQA 1ZSZA 2PZ1A 3S3NA 1KD1U 1M4ZA 3V8JA 1ZX6A 1W70A 1QVPA 3I56Q 4EMKC 4M77C 2A36A 4JDSA 3CCVQ 4M75E 1WYXA 1UHCA 4Y92A 3RNJA 3QDRB 5D7UA 1YHQA 1X6OA 2G6FX 2QGGA 2JJ9A 3EG9A 3QJYA 1H8KA 4NL3A 4XTYA 2M51A 4M75F 2F69A 2R57A 3EHRA 3ZEHA 2HMAA 3V8KA 2KGTA 1KJWA 1YJWQ 2VGNA 1WHKA 2YUOA 4BE1A 3CC4T 3ER0A 2ZPBB 4PL6A 1X6BA 2ZCFB 2F2XA 4J6XA 1G8XA 3UA7A 1VQPA 1RABB 3NFCA 3X25B 2DA9A 3KXTA 2K9GA 4M78A 1M3BA 1TSFA 1UHFA 2RI3A 1ARKA 3ULRB 2XICA 4RMOA 4B9XA 3OYBA 1TOVA 2FZGB 2D8JA 2QAZA 2C0IA 2YDLA 2A37A 3HFNA 3PT9A 5GMKh 2DRKA 4BB7A 1TUCA 1K9MU 2LT1A 2EQKA 3CCJA 1YIJQ 1J3TA 1Q81R 5CIUA 5GANe 5LJ3e 2X3XD 3JCMV 1SSHA 2QDYB 1RAIB 2DJQA 5GAOq 5IHKA 2ZGWA 4E7ZA 2X3WD 1QW1A 3FEOA 4PJLA 1KK7A 3CCQA 2QA4Q 5I22A 1PD0A 3JV3A 1FMVA 3A1PA 1UGPB 3M5AA 2X4WA 2FPDA 3GP8A 3TU4K 3CMEQ 4JRIA 3JCMh 5AYFA 1ZLMA 2XIDA 2L8DA 5KYXA 2YSQA 3JCMX 1UGSB 5LJ3j 5GANj 4RTXA 3DLMA 3MP1A 4HT8A 3SEMA 5LJ5e 4GBQA 3I5SA 3M0UA 2KMTA 2LQWA 1WHLA 1M2VB 3EG3A 3GLXA 4C5GA 3MPUB 5GAMf 2DRMA 4BE2A 3JCMb 3M0TA 2YT6A 1M1KU 1GL5A 2GBQA 4C8QC 4J9FA 1VQ6A 1QCOA 2FVUA 2M0YA 4EMKB 4M77B 1VQ8A 2A7YA 1RI9A 4J7IA 2KXCA 4C5EA 3QZ9B 4HT9A 4PK4A 3I9QA 5LJ5j 2DXBA 2I2LA 2HL5C 1Q82C 2E3IA 3CC4Q 2RD1A 2KK4A 3S3OA 5CCAA 2CKKA 1YJ9Q 4NL2A 3HFOA 2AKLA 2EKHA 1GCQA 2RQTA 4GLMA 2ECZA 5GAN2 5GAOl 2DO3A 3SDZA 4D8DA 4C92C 4X34A 4F04B 2YUNA 1B34B 4A4HA 1CKBA 1VQ7Q 3RKYA 2EFIA 4M7AC 1O9SA 4KGXB 3RIRA 1YJNQ 2KQWA 2K5IA 2ZPIB 1IHWA 3OYNA 4O6JA 2D1XA 1AT1B 4DBHA 3CMAT 2ROLA 4KH0B 2GQIA 1EFNA 3MEUA 2FRWA 2NUZA 2DEUA 2DTHA 2NLUA 4D6WA 3O8VA 1G3SA 1PC0A 5DM7R 4BDZA 3OYHA 2PQWA 2EW3A 3CD6A 1VQ8T 3QYGB 4FU6A 2IIMA 1RAGB 8AT1B 4PKCC 2ED1A 2OAWA 2AIRB 1ZQ1A 3JCMd 1YWOA 4JJDA 4JUVA 4NOYA 4F7UB 4J6YA 3CPFA 4X9CA 4OMQA 3VUZA 3G4SA 2JMCA 1ACMB 3HRSA 5AT1B 1QCFA 2QEXT 3CCRT 3KBGA 5CAIA 4AG1C 1WXTA 2O88A 2EJGA 2DZCA 2OI3A 5KYNA 2VVKA 5FW9A 3OYEA 3C4SA 2F1LA 3R6OA 3LH0A 3OMCA 3CPWP 5FRNA 1QWEA 5FLXE 3CC2A 1AZGB 1HJDA 1VQLA 1D1CA 3LX7A 2DPPB 4PFOA 1SSFA 1VQ9Q 4JPBW 1TUDA 4HCBA 5A2QE 4XTZA 4M78E 3X26B 2DJZA 3NTHA 4C8QB 3UDCA 3G71Q 3HL8A 2YWWA 4YTLA 1U1TA 1ZUUA 1D0XA 1QCNA 3OYYA 3SHWA 1M2VA 1FYNA 1VQOT 5KYWB 2CYZB 1K1ZA 1NBEB 3H0FA 3HKSA 5GMKe 3MP6A 4M78F 1PSEA 1RACB 3M57A 3BE3A 4M77G 2CZ6B 2RQWA 3LYIA 4EMKA 4M77A 2HD0A 3E9FA 2K3BA 2XI9A 1JQQA 5IT9E 1SPKA 1OU9A 4C0DC 5FWCA 3OYKA 4C92B 4DBFA 4D8KA 1X27A 1YP5A 2HDAA 4M7AB 1N27A 2HL3A 3CCEQ 5CKDA 5GMKj 3CCUA 2BZYA 3PMTA 3VRYA 2W0ZA 2GFUA 1MMAA 1RUWA 2E12A 2K5LA 2RHZA 1B34A 1AWJA 1KQSP 4NS5A 5J26A 2O9SA 1HD3A 3OYAA 1RAEB 5FU7C 4P5NA 2O4XB 4LDVA 2CDTA 4DBQA 3HSBA 3CCRQ 3DKMA 2KR3A 2M1HA 7AT1B 1OPLA 3H41A 4QVCA 1FWZA 2WSFE 3V8LA 1OV3A 2RHIA 2M9UA 2DBMA 2SEMA 1X01A 2DEQA 1YWPA 4FSXA 1M1GA 3A8GB 3OYIA 4M7DD 4F7UA 1QVFP 1S72A 1GFCA 3CCST 1VQKA 2JNGA 1IO6A 1PNJA 4LD6A 3CXCA 1RI0A 1WDXA 2IVWA 4RTWA 5CQYA 1GBRA 1ABQA 1WQWA 3G6EQ 3JCMJ 1EIFA 2X4YA 3QPHA 3CCMA 3CC7Q 1C0MA 1TH7A 2KI7A 2X4XA 2VXFA 1E7OA 2QASA 2EYWA 1RLPC 2RA2A 1TWBA 1XOVA 1XJWB 3E2UA 4JLGA 3PE0A 2GCXA 4WCIA 4MZPA 5KCOA 5J39A 1TTHB 3DLLA 4RTYA 4KGZB 4C8QG 1QVGS 1VQNT 1M8MA 4C8QA 2KROA 3L42A 1M90R 4ZGJB 3I56A 1Q7YR 4BUGA 2VV5A 3M0QA 5HKCA 3CCVA 1M90C 1Q7YC 4Y91A 3CXCS 2V8JA 4DQ2A 3VS7A 4C0DB 4CI0C 3MO8A 4GLKA 4JS4A 3QWXX 2LX9A 3QJ6A 1YJWA 2PUOB 4C92A 1IXDA 2KVQG 4JJCA 3I55Q 2MWOA 4M7AG 4M7AA 1CSKA 2LMJA 5I2SA 1X2QA 2HAXA 4HXJA 3CBMA 4BI8B 1KD1R 2MIOA 2Y90A 5FU7B 2E64A 3JCMc 2VASA 1KD1C 2QI2A 2OTJT 1KQ1A 3PIPA 3EGUA 1NZ9A 4HA8A 4QQDA 4IUPA 3META 4GY5A 4MMKA 3CCLQ 3J7AF 2O4XA 2VXEA 1VQ5T 1X43A 2LNHB 2JTFA 2GNCA 3MEVA 4HKEA 1LCKA 2ABLA 4FM4B 2X35A 2COYA 4L5GA 2FO0A 5KE3A 4R56A 3NGPA 3EG1A 4ME7A 2XDBA 2GTOA 1UJ0A 4ZN1A 1TXQA 4HCCA 3UWNA 1JEGA 3JB9I 2E5QA 1JJ2S 2DE0X 3P8BB 4M77E 1I0CA 3LH5A 1JU5C 1C6VX 3H0IA 3REBB 1VQ4Q 2QA4A 2K6DA 2GGRA 2RM4A 3FB9A 1OYXA 3JCMP 3M54A 3CMEA 3H8ZA 4M77F 3FIFA 1UEBA 1I8FA 2EQMA 4A4KA 1SEMA 1K9MR 5DLQE 3JAME 2KRMA 1QQJA 1F1BB 4HCKA 1QMCA 3OSSC 4M7DC 3TVTA 1K9MC 4QQ6A 2J06A 3M9QA 1VIEA 3EH1A 1YCSB 1BI3A 1JXOA 3FC3A 2RHXA 2K2MA 1N8RU 1OQKA 5LJ3d 5GANd 3MEWA 1WIEA 3M0RA 4OMMA 2M02A 5D6WA 2CH4A 3LWHA 1PCXA 2HEQA 3EGDB 3JB9H 3OYCA 4FYYB 3LWIA 3REAB 2YLBA 4QW2A 5GMKi 1YITQ 1UG1A 2CREA 2RJDA 4IUVA 2O31A 3VUBA 2OTLA 1KQSA 1BBZA 3LGFA 3T9NA 2RI5A 2ROTA 4F7UE 1GRIA 5LJ5d 1W2BS 5ECAA 5A0GA 2OTJQ 2LJ3A 4E7KA 1VQ7A 2RMOA 1UGQB 1SG5A 4OMPA 1YJNA 2RJFA 2E10A 2YRCA 5GJVB 4KGVB 3OS0A 1M1KR 3HTRA 2HSEB 1TS9A 3E1SA 4F7UF 2K3XA 2K4YA 1U5SA 1M1KC 4HCZA 5DY9A 2MI6A 2M16A 4VUBA 3OYMA 1I81A 2RQUA 1UTIA
chains in the Genus database with same CATH topology
1AVZC 3VS2A 1AEYA 4JZ4A 5IXFA 2D1XA 2LX7A 2FG0A 2JM8A 1UECA 2J05A 1UGVA 2ROLA 2GQIA 1EFNA 2YUQA 2EVRA 2FRWA 2NUZA 4AFUC 3PVLA 2RNAA 1ABOA 1UDLA 2QDLA 4J9GA 2CSQA 2JTEA 2CUDA 4CC7A 1M3AA 2MOXA 3NPFA 3UATA 2EW3A 2BTTA 1M3CA 1U06A 2IIMA 2CSIA 2ED1A 2OAWA 3EHQA 2KNBB 2EYYA 1T0HA 1YWOA 4JJDA 1MV3A 1K76A 2FEIA 2MCNA 4OMQA 2JMCA 1ZUYA 2EPDA 3I35A 2DLPA 4RUGA 4J9DA 1QCFA 2CUBA 2EQIA 4LUEA 3TSZA 4AG1C 1WXTA 2KE9A 2O88A 4LUDA 1BK2A 1PKTA 2OI3A 2XMFA 2VVKA 5FW9A 3UF4A 5EC7A 4CC3A 1FMKA 2RN8A 2C0OA 1WX6A 2DL3A 3IQLA 1QWEA 1K0SA 2HBWA 1T3LA 1AZGB 1BB9A 2AK5A 1JO8A 1HJDA 2LZ6B 2AZVA 4IIOA 4ORZA 2GTJA 1WXUA 2AZSA 2CH4W 4JPBW 1AOJA 1TUDA 2CT3A 4OMOA 4F17A 1OPKA 2V1RA 2KT1A 1GFDA 1NYGA 2DL7A 2E5KA 1OEBA 1H92A 2FPFA 2V1QA 2EBPA 1YN8A 1ZUUA 3SHWA 1FYNA 1W6XA 1KFZA 1KIKA 1K1ZA 3H0FA 2HSPA 2BZ8A 2L0AA 2VWFA 2RQRA 1K0XA 3NMZC 4HVUA 1M27C 2RQWA 1M30A 2LJ0A 2PTKA 2K3BA 1YNZA 1JQQA 4E6RA 1SPKA 5IHNA 4A63B 1K4US 5FWCA 3PVQA 2A08A 2LJ1A 3KFVA 4D8KA 1X27A 1YP5A 1B07A 2HDAA 3H0HA 2ESWA 2F2VA 2W10A 2BZYA 1GCQC 2DL4A 3VRYA 2W0ZA 4ZNXA 1VYVA 1I1JA 1RUWA 1QLYA 3VS5A 3C0CA 3VS6A 1MUZA 3NHNA 4AG2C 4QT7A 1AWJA 1UUEA 1AD5A 1I07A 3CQTA 2O9SA 1UFFA 2LP5A 1X2KA 1HD3A 2DMOA 3QWYA 2CDTA 2I0NA 3VRZA 1SHFA 4M4ZA 2KR3A 4ESRA 2ED0A 1WFWA 1ZBJA 2DILA 1OPLA 2JS2A 3H41A 4DEYA 1NEGA 1PKSA 2EYZA 4X1VA 1PHTA 1QWFA 1OV3A 1QKWA 2DBMA 4F14A 2SEMA 2DL8A 1TG0A 1NLPC 4CC4B 4AFSC 1YWPA 1VYUA 4Z89A 2D0NA 4IIMA 4HVWA 1GFCA 2H8HA 3VS1A 4J9EA 4EIKA 3TSWA 3ZL7C 4J9HA 4RTTA 2C0TA 5IH2A 1ZSGA 1S1NA 1IO6A 2JM9A 1V1CA 1BU1A 1PNJA 2EYXA 1AWWA 2LCSA 3VS4A 1VA7A 2KXDA 1WDXA 2PNIA 1Y0MA 2L3PA 5IXBA 3THKA 4RTWA 2O2OA 4Z8AA 1GCPA 4Z88A 4F16A 1GBRA 1ABQA 4J9CA 1W1FA 2JW4A 1VYTA 4LE9A 4OMNA 3EG2A 3O5ZA 4LNPA 2DX1A 1X6GA 2L3QA 2DNUA 1E7OA 3M0SA 1JXMA 1E6HA 5HCKA 2EYWA 2OJ2A 4HVVA 1T3SA 1RLPC 1XOVA 1K9AA 3PE0A 4WCIA 1SRLA 2A28A 4RTYA 2EGEA 1B3QA 1M8MA 2LQNA 2KROA 2CT4A 1MV0B 1WA7A 2DYBA 5FWBA 2JT4A 3M0QA 4JJBA 2FRYA 3UA6A 1PRMC 1G2BA 2RF0A 2B86A 2ENMA 1GBQA 3VS7A 2NWMA 2PZ1A 1ZX6A 4RTVA 1W70A 1ZUKA 2J6FA 2A36A 1WYXA 3QWXX 4DEXA 1UHCA 4Y92A 2RPNA 2VKNA 3RNJA 2RQVA 4JJCA 2G6FX 1NM7A 1H8KA 1G83A 1CSKA 2DVJA 1WLPB 2J6KA 2LMJA 2SRCA 1E6GA 1X2QA 2M51A 4HXJA 4RTZA 4KRTA 2L3SA 1N5ZA 2MIOA 3EHRA 5L23A 2KGTA 1KJWA 1UJYA 1X69A 2YUOA 1AZEA 1NG2A 3EGUA 1X6BA 2F2XA 4OMLA 3UA7A 2KBTA 2DA9A 4AFQC 2K9GA 4J9BA 1M3BA 2EGAA 1X43A 1T0JA 1UHFA 2GNCA 2LNHB 1ARKA 1LCKA 3ULRB 2ABLA 2K7AA 2JS0A 2BZXA 2FO0A 2D8JA 3NGPA 3EG1A 4LN2A 2HCKA 1PWTA 1SHGA 1AWOA 2GTOA 1UJ0A 2C0IA 1NLOC 1RLQC 2YDLA 2A37A 2DRKA 1JEGA 3A98A 1TUCA 2DE0X 2P4RA 2KRNA 2FPEA 1I0CA 1HSQA 3LH5A 1JU5C 2F2WA 3H0IA 3REBB 3U23A 2K6DA 4K11A 2GGRA 3R6NA 2DF6A 2DL5A 1J3TA 2O9VA 2KYBA 2X3XD 1SSHA 2EGCA 2JXBA 2DJQA 5IHKA 2X3WD 1SEMA 5IHIA 1Z9QA 5I22A 2KRMA 2YUPA 2D8HA 3JV3A 4HCKA 4R0KA 3TVTA 2FPDA 2J06A 1Y57A 1YCSB 1JXOA 3M0PA 2L2PA 1NYFA 2J7IA 1ZLMA 1NEBA 2YSQA 2K2MA 1SRMA 3EG0A 1WIEA 1CKAA 3M0RA 5GJWB 4RTXA 4OMMA 3SEMA 4GBQA 2CH4A 3I5SA 4JZ3A 2HEQA 3M0UA 2JMAA 2LQWA 1OOTA 3EG3A 3REAB 2DRMA 3M0TA 2DM1A 1UG1A 2CREA 2YT6A 1H3HA 1GL5A 2GBQA 2O31A 4J9FA 2K79A 4CC2A 1BBZA 2M0YA 1RI9A 2KXCA 2KYMA 2ROTA 3RBBB 4J9IA 3I9QA 2J6OA 1U3OA 1GRIA 3FJ5A 5ECAA 1UE9A 1WI7A 2DBKA 2LJ3A 2RMOA 1KSWA 4OMPA 1A0NB 1WXBA 5GJVB 2AKLA 2EKHA 1GCQA 2KRSA 2RQTA 3I5RA 4GLMA 2ECZA 1QKXA 3VS3A 1U5SA 2KT8A 3GBQA 1PRLC 1Z9ZA 4D8DA 4FSSA 3VS0A 2YUNA 1AWXA 2AKKA 4AFZC 1CKBA 4RTUA 2KEAA 2RQUA 5I11A 1UTIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AVZ C;  3VS2 A;  1AEY A;  4JZ4 A;  5IXF A;  2D1X A;  2LX7 A;  2FG0 A;  2JM8 A;  1UEC A;  2J05 A;  1UGV A;  2ROL A;  2GQI A;  1EFN A;  2YUQ A;  2EVR A;  2FRW A;  2NUZ A;  4AFU C;  3PVL A;  2RNA A;  1ABO A;  1UDL A;  2QDL A;  4J9G A;  2CSQ A;  2JTE A;  2CUD A;  4CC7 A;  1M3A A;  2MOX A;  3NPF A;  3UAT A;  2EW3 A;  2BTT A;  1M3C A;  1U06 A;  2IIM A;  2CSI A;  2ED1 A;  2OAW A;  3EHQ A;  2KNB B;  2EYY A;  1T0H A;  1YWO A;  4JJD A;  1MV3 A;  1K76 A;  2FEI A;  2MCN A;  4OMQ A;  2JMC A;  1ZUY A;  2EPD A;  3I35 A;  2DLP A;  4RUG A;  4J9D A;  1QCF A;  2CUB A;  2EQI A;  4LUE A;  3TSZ A;  4AG1 C;  1WXT A;  2KE9 A;  2O88 A;  4LUD A;  1BK2 A;  1PKT A;  2OI3 A;  2XMF A;  2VVK A;  5FW9 A;  3UF4 A;  5EC7 A;  4CC3 A;  1FMK A;  2RN8 A;  2C0O A;  1WX6 A;  2DL3 A;  3IQL A;  1QWE A;  1K0S A;  2HBW A;  1T3L A;  1AZG B;  1BB9 A;  2AK5 A;  1JO8 A;  1HJD A;  2LZ6 B;  2AZV A;  4IIO A;  4ORZ A;  2GTJ A;  1WXU A;  2AZS A;  2CH4 W;  4JPB W;  1AOJ A;  1TUD A;  2CT3 A;  4OMO A;  4F17 A;  1OPK A;  2V1R A;  2KT1 A;  1GFD A;  1NYG A;  2DL7 A;  2E5K A;  1OEB A;  1H92 A;  2FPF A;  2V1Q A;  2EBP A;  1YN8 A;  1ZUU A;  3SHW A;  1FYN A;  1W6X A;  1KFZ A;  1KIK A;  1K1Z A;  3H0F A;  2HSP A;  2BZ8 A;  2L0A A;  2VWF A;  2RQR A;  1K0X A;  3NMZ C;  4HVU A;  1M27 C;  2RQW A;  1M30 A;  2LJ0 A;  2PTK A;  2K3B A;  1YNZ A;  1JQQ A;  4E6R A;  1SPK A;  5IHN A;  4A63 B;  1K4U S;  5FWC A;  3PVQ A;  2A08 A;  2LJ1 A;  3KFV A;  4D8K A;  1X27 A;  1YP5 A;  1B07 A;  2HDA A;  3H0H A;  2ESW A;  2F2V A;  2W10 A;  2BZY A;  1GCQ C;  2DL4 A;  3VRY A;  2W0Z A;  4ZNX A;  1VYV A;  1I1J A;  1RUW A;  1QLY A;  3VS5 A;  3C0C A;  3VS6 A;  1MUZ A;  3NHN A;  4AG2 C;  4QT7 A;  1AWJ A;  1UUE A;  1AD5 A;  1I07 A;  3CQT A;  2O9S A;  1UFF A;  2LP5 A;  1X2K A;  1HD3 A;  2DMO A;  3QWY A;  2CDT A;  2I0N A;  3VRZ A;  1SHF A;  4M4Z A;  2KR3 A;  4ESR A;  2ED0 A;  1WFW A;  1ZBJ A;  2DIL A;  1OPL A;  2JS2 A;  3H41 A;  4DEY A;  1NEG A;  1PKS A;  2EYZ A;  4X1V A;  1PHT A;  1QWF A;  1OV3 A;  1QKW A;  2DBM A;  4F14 A;  2SEM A;  2DL8 A;  1TG0 A;  1NLP C;  4CC4 B;  4AFS C;  1YWP A;  1VYU A;  4Z89 A;  2D0N A;  4IIM A;  4HVW A;  1GFC A;  2H8H A;  3VS1 A;  4J9E A;  4EIK A;  3TSW A;  3ZL7 C;  4J9H A;  4RTT A;  2C0T A;  5IH2 A;  1ZSG A;  1S1N A;  1IO6 A;  2JM9 A;  1V1C A;  1BU1 A;  1PNJ A;  2EYX A;  1AWW A;  2LCS A;  3VS4 A;  1VA7 A;  2KXD A;  1WDX A;  2PNI A;  1Y0M A;  2L3P A;  5IXB A;  3THK A;  4RTW A;  2O2O A;  4Z8A A;  1GCP A;  4Z88 A;  4F16 A;  1GBR A;  1ABQ A;  4J9C A;  1W1F A;  2JW4 A;  1VYT A;  4LE9 A;  4OMN A;  3EG2 A;  3O5Z A;  4LNP A;  2DX1 A;  1X6G A;  2L3Q A;  2DNU A;  1E7O A;  3M0S A;  1JXM A;  1E6H A;  5HCK A;  2EYW A;  2OJ2 A;  4HVV A;  1T3S A;  1RLP C;  1XOV A;  1K9A A;  3PE0 A;  4WCI A;  1SRL A;  2A28 A;  4RTY A;  2EGE A;  1B3Q A;  1M8M A;  2LQN A;  2KRO A;  2CT4 A;  1MV0 B;  1WA7 A;  2DYB A;  5FWB A;  2JT4 A;  3M0Q A;  4JJB A;  2FRY A;  3UA6 A;  1PRM C;  1G2B A;  2RF0 A;  2B86 A;  2ENM A;  1GBQ A;  3VS7 A;  2NWM A;  2PZ1 A;  1ZX6 A;  4RTV A;  1W70 A;  1ZUK A;  2J6F A;  2A36 A;  1WYX A;  3QWX X;  4DEX A;  1UHC A;  4Y92 A;  2RPN A;  2VKN A;  3RNJ A;  2RQV A;  4JJC A;  2G6F X;  1NM7 A;  1H8K A;  1G83 A;  1CSK A;  2DVJ A;  1WLP B;  2J6K A;  2LMJ A;  2SRC A;  1E6G A;  1X2Q A;  2M51 A;  4HXJ A;  4RTZ A;  4KRT A;  2L3S A;  1N5Z A;  2MIO A;  3EHR A;  5L23 A;  2KGT A;  1KJW A;  1UJY A;  1X69 A;  2YUO A;  1AZE A;  1NG2 A;  3EGU A;  1X6B A;  2F2X A;  4OML A;  3UA7 A;  2KBT A;  2DA9 A;  4AFQ C;  2K9G A;  4J9B A;  1M3B A;  2EGA A;  1X43 A;  1T0J A;  1UHF A;  2GNC A;  2LNH B;  1ARK A;  1LCK A;  3ULR B;  2ABL A;  2K7A A;  2JS0 A;  2BZX A;  2FO0 A;  2D8J A;  3NGP A;  3EG1 A;  4LN2 A;  2HCK A;  1PWT A;  1SHG A;  1AWO A;  2GTO A;  1UJ0 A;  2C0I A;  1NLO C;  1RLQ C;  2YDL A;  2A37 A;  2DRK A;  1JEG A;  3A98 A;  1TUC A;  2DE0 X;  2P4R A;  2KRN A;  2FPE A;  1I0C A;  1HSQ A;  3LH5 A;  1JU5 C;  2F2W A;  3H0I A;  3REB B;  3U23 A;  2K6D A;  4K11 A;  2GGR A;  3R6N A;  2DF6 A;  2DL5 A;  1J3T A;  2O9V A;  2KYB A;  2X3X D;  1SSH A;  2EGC A;  2JXB A;  2DJQ A;  5IHK A;  2X3W D;  1SEM A;  5IHI A;  1Z9Q A;  5I22 A;  2KRM A;  2YUP A;  2D8H A;  3JV3 A;  4HCK A;  4R0K A;  3TVT A;  2FPD A;  2J06 A;  1Y57 A;  1YCS B;  1JXO A;  3M0P A;  2L2P A;  1NYF A;  2J7I A;  1ZLM A;  1NEB A;  2YSQ A;  2K2M A;  1SRM A;  3EG0 A;  1WIE A;  1CKA A;  3M0R A;  5GJW B;  4RTX A;  4OMM A;  3SEM A;  4GBQ A;  2CH4 A;  3I5S A;  4JZ3 A;  2HEQ A;  3M0U A;  2JMA A;  2LQW A;  1OOT A;  3EG3 A;  3REA B;  2DRM A;  3M0T A;  2DM1 A;  1UG1 A;  2CRE A;  2YT6 A;  1H3H A;  1GL5 A;  2GBQ A;  2O31 A;  4J9F A;  2K79 A;  4CC2 A;  1BBZ A;  2M0Y A;  1RI9 A;  2KXC A;  2KYM A;  2ROT A;  3RBB B;  4J9I A;  3I9Q A;  2J6O A;  1U3O A;  1GRI A;  3FJ5 A;  5ECA A;  1UE9 A;  1WI7 A;  2DBK A;  2LJ3 A;  2RMO A;  1KSW A;  4OMP A;  1A0N B;  1WXB A;  5GJV B;  2AKL A;  2EKH A;  1GCQ A;  2KRS A;  2RQT A;  3I5R A;  4GLM A;  2ECZ A;  1QKX A;  3VS3 A;  1U5S A;  2KT8 A;  3GBQ A;  1PRL C;  1Z9Z A;  4D8D A;  4FSS A;  3VS0 A;  2YUN A;  1AWX A;  2AKK A;  4AFZ C;  1CKB A;  4RTU A;  2KEA A;  2RQU A;  5I11 A;  1UTI A; 
#chains in the Genus database with same CATH topology
 1OX9 A;  1AVZ C;  2X9H A;  3GF5 A;  3JB9 D;  1QVF A;  1AEY A;  4PJO D;  2LX7 A;  2FG0 A;  3OW2 P;  1I5O B;  2OX7 A;  1UGV A;  2YUQ A;  2EVR A;  4XQ3 A;  4AFU C;  1UDL A;  4J9G A;  4BD3 A;  2COW A;  3BDL A;  1KQS S;  4CC7 A;  5GAM g;  2X4J A;  3NPF A;  1LVK A;  4BAC A;  4C8Q E;  1M3C A;  1U06 A;  1RAD B;  1IRX A;  3EHQ A;  3EFO B;  3M59 A;  3OB9 A;  1T0H A;  3L2Q A;  1MV3 A;  1K76 A;  5D6X A;  2MCN A;  1YHQ T;  4C8Q F;  1BIA A;  1ZUY A;  1H3Z A;  3I35 A;  2DLP A;  2MAM A;  3NTK A;  2CP7 A;  3S6W A;  1D0Z A;  1PKT A;  2CP3 A;  2XMF A;  4FYV B;  2JTM A;  4J6W A;  4C92 E;  1QVF S;  4IUT A;  3RMS A;  1FMK A;  2OAU A;  2RN8 A;  1WX6 A;  4M7D B;  1VQ9 A;  3IQL A;  1YI2 A;  4ZN3 A;  3MHX A;  1WHH A;  3L2U A;  1Q95 G;  1VQP T;  1ZHI A;  2O01 E;  2HBW A;  2XD0 A;  2AK5 A;  2V26 A;  1JO8 A;  1LPL A;  4C92 F;  3OA6 A;  2LZ6 B;  4A4E A;  1QVG P;  3G71 A;  1WNL A;  5GAO m;  2VC8 A;  4M7A F;  1OX8 A;  1WXU A;  2P4T A;  4E7S A;  5GAM h;  2CT3 A;  4OMO A;  4XTU A;  3CXC P;  4F17 A;  4E7L A;  3EH2 A;  1GFD A;  1UGR B;  2DL7 A;  4RCC A;  3DB3 A;  1H92 A;  3JCM f;  1PG5 B;  2FPF A;  3EGD A;  2QK0 A;  2EBP A;  3L2V A;  3C94 A;  1D1B A;  4OGE A;  3CCJ T;  4PFP A;  2CP2 A;  2PVO B;  1KIK A;  1Q82 R;  3GPL A;  4MDX A;  3J80 E;  1K0X A;  3CCE A;  4HVU A;  2EAY A;  1M27 C;  5M9O A;  2D0Q B;  2JOY A;  2LJ0 A;  3BFM A;  1EZZ B;  1YNZ A;  1LJO A;  3H9N A;  4E6R A;  5CKE A;  4FYX B;  3CCQ T;  2V8K A;  3PVQ A;  3KFV A;  3TQ7 P;  1QP2 A;  2ESW A;  4XU2 A;  2DD5 A;  3L2Z A;  1IZ6 A;  1JB0 E;  3GNF B;  2DL4 A;  2MPX C;  4ZNX A;  3BW1 A;  3PTA A;  3QBY A;  4KH1 B;  1R77 A;  3VS6 A;  1PD1 A;  2QQR A;  4C0Z A;  2MK5 A;  3OBY A;  2JN0 A;  1X75 C;  3FDR A;  2IPO B;  1D0Y A;  5A0L A;  4OB2 B;  2LP5 A;  2VGM A;  4XTX A;  5GMK l;  2CS7 A;  1BI0 A;  3RER A;  4JLI A;  1VQ6 T;  2PVD B;  4ESR A;  4M4Z A;  1JJ2 P;  5DLO A;  3QXE B;  2DIL A;  3M56 A;  2JS2 A;  4DEY A;  3M53 A;  1ZBX A;  2DTO A;  2PUK B;  2XG8 D;  1QWF A;  3WVE B;  1QKW A;  4F14 A;  2DL8 A;  4ATO A;  3OYD A;  2LNV A;  3NTI A;  4CC4 B;  1Q81 U;  4PJO C;  2QYZ A;  3EFO A;  4QQG A;  4Z89 A;  4IIM A;  1Y71 A;  4XTV A;  4PLL A;  2H8H A;  1ZA1 B;  4EIK A;  4RTT A;  5IH2 A;  1DJ7 B;  1LNX A;  1V1C A;  1V29 B;  5CR2 A;  2DXC A;  4FL6 A;  4PNO A;  3CC7 A;  2EYX A;  1VA7 A;  2KXD A;  1N9S A;  2DTI A;  3FJP A;  1Y0M A;  5IXB A;  1BKB A;  4Z8A A;  5CVI A;  1RL2 A;  1VOM A;  3RKX A;  4L59 A;  4M7D G;  2JW4 A;  1VYT A;  4M7D A;  1KQ2 A;  3EG2 A;  4N4I A;  1JBM A;  4KBM B;  2B8A A;  4FT2 A;  2Z0W A;  2OJ2 A;  2BKD N;  3CD6 T;  1V76 A;  1H64 1;  4ANJ A;  4E7H A;  2RK2 A;  2FL7 A;  4LDU A;  1W2B P;  1SRL A;  1XNI A;  1BIB A;  3G4S T;  4KUI A;  3QG1 A;  3ME9 A;  1MV0 B;  5FWB A;  2FRY A;  3UA6 A;  4JRQ A;  2B86 A;  3A8H B;  2PVG B;  2Y4Y A;  3I55 A;  2NWM A;  3OW2 A;  3QUI A;  2P0P A;  2DVE A;  3RR6 A;  3CMA Q;  1I4K 1;  4RTV A;  1ZUK A;  4JRK A;  2DD4 A;  1KHC A;  1QP3 A;  4OP0 A;  2J6F A;  3OQ5 A;  2CZ1 B;  3CC2 T;  4DEX A;  1MGQ A;  3OMG A;  5EG2 A;  3C95 A;  5IAY A;  2RQV A;  2XDP A;  1VQL T;  3PNW C;  1NM7 A;  2DVJ A;  2SRC A;  1WLP B;  1VQ8 Q;  1E6G A;  4JRP A;  4RTZ A;  3VYH B;  4KRT A;  3CCL A;  2L3S A;  5FU6 C;  4A54 A;  5HK0 A;  1UJY A;  1I5L A;  1X69 A;  2RJE A;  1NG2 A;  4UC4 A;  3HRU A;  5GAM e;  2XDD A;  2QEX Q;  2EIF A;  4OML A;  1VQM A;  2KBT A;  2WAC A;  2LTO A;  1TU0 B;  2EGA A;  1T0J A;  4A4G A;  2JS0 A;  2BZX A;  2DIQ A;  3OW2 S;  1KC8 U;  4PJO B;  4BE0 A;  4LN2 A;  2HCK A;  1SHG A;  3CBO A;  2RB6 A;  5GAM j;  1QVG A;  1RLQ C;  3X20 B;  5GAN 8;  3SD4 A;  2FPE A;  3ASK A;  1HSQ A;  3CCU T;  5KH6 A;  1NJI U;  2FB7 A;  3U23 A;  4Q5W A;  4K11 A;  2CP0 A;  5C0M A;  3R6N A;  2PU9 B;  3QII A;  2HKQ B;  3FRN A;  2O9V A;  4RG2 A;  2DET A;  2K57 A;  1GXI E;  2EGC A;  1KG1 A;  5GAN 7;  2HZY A;  1VQO Q;  2P0Q A;  5IHI A;  2LQK A;  5LL6 S;  3LLR A;  2D8H A;  5GAN 5;  1K8A U;  1FXX A;  4N0A C;  3E9G A;  2E65 A;  3M0P A;  2L2P A;  5GAN g;  1NYF A;  4PFZ A;  2J7I A;  1SRM A;  6AT1 B;  1N6A A;  4JZ3 A;  2K2V A;  1IGU A;  1OOT A;  3CC2 Q;  4BI3 A;  1RAH B;  5CKB A;  1S72 T;  2DM1 A;  1VQK T;  1JRI A;  4EMH A;  4CC2 A;  5LJ5 g;  3EGX B;  2H3J A;  3RBB B;  4J9I A;  2J6O A;  1N8R C;  4QVD A;  1UE9 A;  1K73 U;  2DBK A;  2ZPE B;  1JJ2 A;  1A0N B;  4FW2 A;  3A8M B;  2EQJ A;  3CCM T;  1R8O B;  2KRS A;  1RAF B;  5FU6 B;  3I5R A;  4FW1 A;  4KT0 E;  2KT8 A;  4E7J A;  2ATC B;  3GBQ A;  4FSS A;  5KYU B;  3M4Y A;  4RTU A;  4M7D E;  5LJ3 f;  5GAN f;  2JUF A;  5I11 A;  3F70 A;  4PJN A;  2A0F B;  3GNG A;  4C0F A;  1C1A A;  1N9R A;  3VS2 A;  2FZK B;  5IXF A;  4LXC A;  2MMP A;  3KUF A;  3N5B B;  3CCS Q;  2ZPF B;  2X51 A;  2JM8 A;  1WHG A;  4M7D F;  3D7S B;  3I56 T;  3CEY A;  1MMD A;  3CCV T;  1ABO A;  2QDL A;  2JTE A;  2QTV A;  1M3A A;  1YIJ A;  2MOX A;  4M75 D;  5KYY A;  3JB9 G;  2C06 A;  2E6Z A;  4E47 A;  5LJ5 f;  4PJO G;  2CSI A;  3G7Z A;  4PJO A;  5GAO n;  4CRI A;  2FEI A;  3QKJ A;  1YJW T;  4FIB A;  3M4G A;  2EPD A;  2LT4 A;  3UPU A;  4J9D A;  2CUB A;  2EQI A;  4LUE A;  5GAN 6;  2KE9 A;  4J8O A;  4LUD A;  1BK2 A;  1KHI A;  2LRQ A;  1W2B A;  2QGF B;  3S3M A;  5GAN 3;  4ELY C;  5EC7 A;  1TUG B;  3A8L B;  1VQN Q;  2DL3 A;  3OSV A;  3L1A A;  1T3L A;  1BB9 A;  1S72 Q;  1VQK Q;  1G3W A;  2EWN A;  4BDY A;  3GIB A;  2AZS A;  3EFR A;  3HHT B;  2CH4 W;  1AOJ A;  3LGL A;  1OPK A;  2L5Q A;  2E5K A;  2LDM A;  2NYS A;  3CC4 A;  1OEB A;  2DK3 A;  3ZBD A;  2V1Q A;  1YJ9 A;  4MML A;  4IUU A;  2DER A;  1W4S A;  3P8D A;  2HSP A;  4OB3 B;  2L0A A;  3BDU A;  4R55 A;  2QA4 T;  5GAO r;  1BCM A;  4KUD K;  2VWF A;  2RQR A;  3PMI A;  4XU0 A;  1HK9 A;  3CME T;  5IN1 A;  1WZO A;  1M30 A;  4BY6 C;  2PTK A;  1EX4 A;  2E4H A;  3EGX A;  2CZ0 B;  1BI2 A;  3A8O B;  4FYW B;  3OYJ A;  3MJX A;  3VV0 A;  1VQ5 Q;  4JJN K;  3VU3 C;  2LQ8 A;  2VYT A;  3H0H A;  1Y07 A;  3VJP A;  1M1F A;  1BI1 A;  2W10 A;  3HRT A;  3MCA B;  1VYV A;  4FT4 A;  3Q1J A;  4ELZ C;  4IUR A;  1QLY A;  3WVD B;  3FLG A;  5KYU A;  4WF2 A;  4QKU A;  3X24 B;  1WPY A;  1FMW A;  5I2M A;  2K5F A;  3CQT A;  4C5H A;  1X2K A;  3HPW A;  4OGC A;  4Z02 A;  2DMO A;  3VKI A;  4RKU E;  2I0N A;  1YJ9 T;  3VRZ A;  1SHF A;  2OTL T;  2ED0 A;  3QZ5 B;  1WFW A;  3JCM g;  1SKU B;  4M78 G;  4E2F B;  1NEG A;  1PKS A;  3TRE A;  4FCY A;  4X1V A;  1PHT A;  1Q86 U;  2BUD A;  3HP9 A;  1VQ7 T;  1NPR A;  1TG0 A;  1OU8 A;  1NLP C;  2JVV A;  1YJN T;  2HBP A;  1VYU A;  2D0N A;  2RJC A;  1YFN A;  2YRD A;  4J9E A;  2XK0 A;  3TSW A;  1IHV A;  4PLI A;  1HXD A;  2JM9 A;  2RHU A;  2FYK A;  1BU1 A;  1AWW A;  2XKO C;  1FX7 A;  2LCS A;  4M7A E;  3VS4 A;  4M75 C;  2L3P A;  2O2O A;  1GCP A;  1MMG A;  2GFA A;  4F16 A;  4N0A A;  3EFS A;  1Q81 C;  4OMN A;  2DZ9 A;  4E7I A;  4X9D A;  4LNP A;  2DX1 A;  4C0G A;  3JB9 J;  2G3R A;  1X6G A;  2MYS A;  3L2W A;  1JXM A;  3ZFJ A;  1E6H A;  5HCK A;  3OYF A;  1T3S A;  3J81 E;  1WJR A;  2DAQ A;  4MZM A;  5HY6 A;  3PIO A;  5HK3 A;  4EMG A;  2EGE A;  3CMA A;  1OUL A;  2K3Y A;  2E70 A;  4OVA A;  2CT4 A;  4LD9 K;  5GMK m;  1WJS A;  1VUB A;  3P8H A;  4BY6 B;  1PRM C;  4PJO E;  2HQE A;  2A3L A;  2ENM A;  4XU1 A;  2DKG A;  4KUL A;  1U1S A;  2P0K A;  3H6Z A;  3V7C A;  2HKN A;  2QTX A;  2CP6 A;  3JB9 F;  1MMN A;  3AT1 B;  3OYL A;  5CQX A;  1VQ9 T;  3QHS A;  4PJO F;  3JRZ A;  4OB0 B;  1YI2 T;  3C12 A;  3OS1 A;  1D3B B;  2RPN A;  2VKN A;  4J83 A;  3PFS A;  1Y7X A;  2R58 A;  3G71 T;  1U8R A;  2QEX A;  3OYG A;  2OTL Q;  1G83 A;  3CCR A;  2J6K A;  4M78 D;  1N5Z A;  1PSF A;  2P84 A;  3QSU A;  5L23 A;  2KSS A;  1AZE A;  2HQH A;  1YHQ Q;  3DB4 A;  1R0B G;  3JCM W;  4AFQ C;  2ZPG B;  5KE2 A;  4J9B A;  1WGS A;  4LDY A;  2XHC A;  3RKW A;  2ZPH B;  3SWN C;  4XK8 E;  3CCE T;  2K7A A;  3RES A;  4AT1 B;  4IKF A;  2NUP B;  2Y4X A;  3MP8 A;  1PWT A;  2QXF A;  4MDW A;  2VB6 A;  1VQP Q;  1AWO A;  1VIF A;  1NLO C;  5GAM d;  1MHN A;  3PGG A;  4TVR A;  3AHU A;  3G6E A;  3A98 A;  2P4R A;  2KRN A;  2YLC A;  3JSC A;  1VQO A;  4M75 B;  2F2W A;  3E19 A;  1KC8 R;  3QDF A;  1M5Q 1;  2DF6 A;  2DL5 A;  3UT1 A;  2KYB A;  4DA4 A;  1KC8 C;  3CBP A;  2JXB A;  3V7S A;  4DOV A;  5CKH A;  3CCJ Q;  2COZ A;  2E3H A;  1Z9Q A;  3SB2 A;  5C6S A;  2YUP A;  2YHT A;  1NJI R;  2RI2 A;  2LCL A;  4R0K A;  5FRO A;  4XTW A;  1Y57 A;  3OBW A;  1NJI C;  1NEB A;  3EG0 A;  1Q82 U;  1CKA A;  1MNE A;  5GJW B;  3CCQ Q;  2BE9 B;  2E41 A;  2QQS A;  2JMA A;  1YI2 Q;  4OF1 A;  2BIV A;  2XU8 A;  2R5A A;  3INZ A;  1B7T A;  2QG9 B;  1K8A R;  4EDU A;  2EYQ A;  4L6V 5;  2HNI A;  1H3H A;  4N4G A;  1K8A C;  3G6E T;  4B9W A;  2K79 A;  2M0O A;  2L89 A;  2KDS A;  3CC7 T;  4ZGE B;  5CO7 A;  2KYM A;  3M58 A;  2R5M A;  2F5K A;  1XTD A;  1U3O A;  3TCJ A;  3X28 B;  1ZSZ C;  3FJ5 A;  1WI7 A;  2DYI A;  3G1J A;  1KSW A;  4B6M A;  2D6F A;  4DBR A;  2L3R A;  1VQ6 Q;  1RAA B;  3OY9 A;  1WXB A;  1WQ7 A;  2GQV A;  2MWP A;  1D3B A;  1WJQ A;  3CCS A;  1QKX A;  3VS3 A;  1PRL C;  1Z9Z A;  4ZGD B;  3VS0 A;  5GAN 4;  1AWX A;  2AKK A;  4AFZ C;  1SF9 A;  2KEA A;  1K73 R;  2LC4 A;  2NUT B;  1YBY A;  4JZ4 A;  3WXM B;  4BI4 A;  3JCM e;  2CGH A;  1K73 C;  2IG0 A;  3SWN B;  1UEC A;  2J05 A;  4RCB A;  1WHJ A;  5KYY B;  2EQU A;  2LCC A;  4ZTF A;  3PVL A;  3RMQ A;  2RNA A;  3OS2 A;  2CSQ A;  2CUD A;  1VQ4 A;  2HQX A;  4M78 C;  3I55 T;  3UAT A;  4A4F A;  2BTT A;  1WHM A;  2NUP A;  4J5Y A;  4OMF B;  2KNB B;  3URG A;  2EYY A;  4ZTJ A;  2YXY A;  1OZ3 A;  1O75 A;  8ATC B;  5I21 A;  4EPC A;  3JCM Q;  3M55 A;  2QQB A;  4O5V A;  1VQN A;  1NE8 A;  4RUG A;  5CKF A;  3CD6 Q;  4J7F A;  2KAF A;  3TSZ A;  4F7U G;  4M75 G;  2CP5 A;  4M75 A;  3CCL T;  2AT1 B;  3BY7 A;  3UF4 A;  2AHJ B;  1G5V A;  1AHJ B;  4CC3 A;  1NPP A;  5CK9 A;  3RDV A;  2C0O A;  4A53 A;  3G4S Q;  1UB4 A;  2RK1 A;  1K0S A;  1OZ2 A;  1VQM T;  2ZAE A;  3VYG A;  5LJ3 g;  2V8I A;  2VUB A;  2H3E B;  2AZV A;  4IIO A;  1YIT A;  2DXU A;  4ORZ A;  2BE7 D;  1G3Y A;  2EJ9 A;  2LVM A;  2RO0 A;  2WSE E;  3MKD A;  9ATC B;  2GTJ A;  2WSC E;  3SFM A;  2RHY A;  1LOJ A;  1VQ4 T;  2V1R A;  1Y96 B;  4AMC A;  2KT1 A;  4M77 D;  1NYG A;  2F5T X;  1PM3 A;  4Y28 E;  2DXT A;  3RUX A;  1VQL Q;  2OTJ A;  5FRM A;  1YN8 A;  2FZC B;  4JS5 A;  3QYH B;  1W6X A;  1KFZ A;  1N8R R;  4IUQ A;  2QQ9 A;  2BZ8 A;  1ZSZ B;  1VQ5 A;  1M2O A;  1IB8 A;  1D09 B;  3NMZ C;  5KYW A;  1BYM A;  3TEE A;  5IHN A;  2MF2 A;  4A63 B;  4OB1 B;  1K4U S;  2A08 A;  2LJ1 A;  1B07 A;  3EG9 B;  4LDX A;  1M8V A;  5LJ3 h;  5GAN h;  2F2V A;  1GCQ C;  4C92 G;  2D9T A;  1YIT T;  2KY9 A;  1M9S A;  1I1J A;  3VS5 A;  3C0C A;  1MUZ A;  3NHN A;  4AG2 C;  4QT7 A;  1UUE A;  1AD5 A;  1I07 A;  3MEA A;  1UFF A;  2CZ7 B;  3OS5 A;  1OI1 A;  3CCU Q;  2NUT A;  5GAO p;  4M78 B;  1G3T A;  3QWY A;  3EAE A;  3SWN A;  5L8R E;  1ZBJ A;  5LJ5 h;  4RG8 A;  2RH2 A;  2EYZ A;  3V7R A;  3CPW A;  4QVZ A;  5D6Y A;  2DFU A;  4XU3 A;  4WTO B;  4AFS C;  4V2S A;  1VQM Q;  3A5Z B;  1IRE B;  1ZA2 B;  3LW5 E;  4II1 A;  4HVW A;  3VS1 A;  4DOW A;  4C5I A;  3ZL7 C;  4J9H A;  2EKO A;  2ZZD A;  2C0T A;  2JZ2 A;  1ZSG A;  1S1N A;  1MND A;  1YCY A;  1HYO A;  1Q86 R;  1BCO A;  2QQA A;  4XAX B;  2PNI A;  5KCH A;  3THK A;  1Q86 C;  4Z88 A;  4J9C A;  1W1F A;  2DIG A;  4LE9 A;  2E6N A;  4N4H A;  3GOX A;  5A0D A;  5J3B A;  1R0C B;  1XQH A;  3O5Z A;  5KYX B;  1IGQ A;  4C8Q D;  1M90 U;  4PJJ A;  1Q7Y U;  2L3Q A;  2E1H A;  2DNU A;  3M0S A;  1YIJ T;  4HVV A;  4MZT A;  3CPW S;  1K9A A;  1P92 A;  3L2R A;  3CCM Q;  1D1A A;  1Y96 A;  2A28 A;  3QO3 A;  1B3Q A;  2LQN A;  2EJF A;  2YRV A;  1WA7 A;  2DYB A;  4PJM A;  2JT4 A;  4JJB A;  2FHD A;  4C92 D;  4LDW A;  1G2B A;  2RF0 A;  2GF7 A;  4M7A D;  1GBQ A;  1ZSZ A;  2PZ1 A;  3S3N A;  1KD1 U;  1M4Z A;  3V8J A;  1ZX6 A;  1W70 A;  1QVP A;  3I56 Q;  4EMK C;  4M77 C;  2A36 A;  4JDS A;  3CCV Q;  4M75 E;  1WYX A;  1UHC A;  4Y92 A;  3RNJ A;  3QDR B;  5D7U A;  1YHQ A;  1X6O A;  2G6F X;  2QGG A;  2JJ9 A;  3EG9 A;  3QJY A;  1H8K A;  4NL3 A;  4XTY A;  2M51 A;  4M75 F;  2F69 A;  2R57 A;  3EHR A;  3ZEH A;  2HMA A;  3V8K A;  2KGT A;  1KJW A;  1YJW Q;  2VGN A;  1WHK A;  2YUO A;  4BE1 A;  3CC4 T;  3ER0 A;  2ZPB B;  4PL6 A;  1X6B A;  2ZCF B;  2F2X A;  4J6X A;  1G8X A;  3UA7 A;  1VQP A;  1RAB B;  3NFC A;  3X25 B;  2DA9 A;  3KXT A;  2K9G A;  4M78 A;  1M3B A;  1TSF A;  1UHF A;  2RI3 A;  1ARK A;  3ULR B;  2XIC A;  4RMO A;  4B9X A;  3OYB A;  1TOV A;  2FZG B;  2D8J A;  2QAZ A;  2C0I A;  2YDL A;  2A37 A;  3HFN A;  3PT9 A;  5GMK h;  2DRK A;  4BB7 A;  1TUC A;  1K9M U;  2LT1 A;  2EQK A;  3CCJ A;  1YIJ Q;  1J3T A;  1Q81 R;  5CIU A;  5GAN e;  5LJ3 e;  2X3X D;  3JCM V;  1SSH A;  2QDY B;  1RAI B;  2DJQ A;  5GAO q;  5IHK A;  2ZGW A;  4E7Z A;  2X3W D;  1QW1 A;  3FEO A;  4PJL A;  1KK7 A;  3CCQ A;  2QA4 Q;  5I22 A;  1PD0 A;  3JV3 A;  1FMV A;  3A1P A;  1UGP B;  3M5A A;  2X4W A;  2FPD A;  3GP8 A;  3TU4 K;  3CME Q;  4JRI A;  3JCM h;  5AYF A;  1ZLM A;  2XID A;  2L8D A;  5KYX A;  2YSQ A;  3JCM X;  1UGS B;  5LJ3 j;  5GAN j;  4RTX A;  3DLM A;  3MP1 A;  4HT8 A;  3SEM A;  5LJ5 e;  4GBQ A;  3I5S A;  3M0U A;  2KMT A;  2LQW A;  1WHL A;  1M2V B;  3EG3 A;  3GLX A;  4C5G A;  3MPU B;  5GAM f;  2DRM A;  4BE2 A;  3JCM b;  3M0T A;  2YT6 A;  1M1K U;  1GL5 A;  2GBQ A;  4C8Q C;  4J9F A;  1VQ6 A;  1QCO A;  2FVU A;  2M0Y A;  4EMK B;  4M77 B;  1VQ8 A;  2A7Y A;  1RI9 A;  4J7I A;  2KXC A;  4C5E A;  3QZ9 B;  4HT9 A;  4PK4 A;  3I9Q A;  5LJ5 j;  2DXB A;  2I2L A;  2HL5 C;  1Q82 C;  2E3I A;  3CC4 Q;  2RD1 A;  2KK4 A;  3S3O A;  5CCA A;  2CKK A;  1YJ9 Q;  4NL2 A;  3HFO A;  2AKL A;  2EKH A;  1GCQ A;  2RQT A;  4GLM A;  2ECZ A;  5GAN 2;  5GAO l;  2DO3 A;  3SDZ A;  4D8D A;  4C92 C;  4X34 A;  4F04 B;  2YUN A;  1B34 B;  4A4H A;  1CKB A;  1VQ7 Q;  3RKY A;  2EFI A;  4M7A C;  1O9S A;  4KGX B;  3RIR A;  1YJN Q;  2KQW A;  2K5I A;  2ZPI B;  1IHW A;  3OYN A;  4O6J A;  2D1X A;  1AT1 B;  4DBH A;  3CMA T;  2ROL A;  4KH0 B;  2GQI A;  1EFN A;  3MEU A;  2FRW A;  2NUZ A;  2DEU A;  2DTH A;  2NLU A;  4D6W A;  3O8V A;  1G3S A;  1PC0 A;  5DM7 R;  4BDZ A;  3OYH A;  2PQW A;  2EW3 A;  3CD6 A;  1VQ8 T;  3QYG B;  4FU6 A;  2IIM A;  1RAG B;  8AT1 B;  4PKC C;  2ED1 A;  2OAW A;  2AIR B;  1ZQ1 A;  3JCM d;  1YWO A;  4JJD A;  4JUV A;  4NOY A;  4F7U B;  4J6Y A;  3CPF A;  4X9C A;  4OMQ A;  3VUZ A;  3G4S A;  2JMC A;  1ACM B;  3HRS A;  5AT1 B;  1QCF A;  2QEX T;  3CCR T;  3KBG A;  5CAI A;  4AG1 C;  1WXT A;  2O88 A;  2EJG A;  2DZC A;  2OI3 A;  5KYN A;  2VVK A;  5FW9 A;  3OYE A;  3C4S A;  2F1L A;  3R6O A;  3LH0 A;  3OMC A;  3CPW P;  5FRN A;  1QWE A;  5FLX E;  3CC2 A;  1AZG B;  1HJD A;  1VQL A;  1D1C A;  3LX7 A;  2DPP B;  4PFO A;  1SSF A;  1VQ9 Q;  4JPB W;  1TUD A;  4HCB A;  5A2Q E;  4XTZ A;  4M78 E;  3X26 B;  2DJZ A;  3NTH A;  4C8Q B;  3UDC A;  3G71 Q;  3HL8 A;  2YWW A;  4YTL A;  1U1T A;  1ZUU A;  1D0X A;  1QCN A;  3OYY A;  3SHW A;  1M2V A;  1FYN A;  1VQO T;  5KYW B;  2CYZ B;  1K1Z A;  1NBE B;  3H0F A;  3HKS A;  5GMK e;  3MP6 A;  4M78 F;  1PSE A;  1RAC B;  3M57 A;  3BE3 A;  4M77 G;  2CZ6 B;  2RQW A;  3LYI A;  4EMK A;  4M77 A;  2HD0 A;  3E9F A;  2K3B A;  2XI9 A;  1JQQ A;  5IT9 E;  1SPK A;  1OU9 A;  4C0D C;  5FWC A;  3OYK A;  4C92 B;  4DBF A;  4D8K A;  1X27 A;  1YP5 A;  2HDA A;  4M7A B;  1N27 A;  2HL3 A;  3CCE Q;  5CKD A;  5GMK j;  3CCU A;  2BZY A;  3PMT A;  3VRY A;  2W0Z A;  2GFU A;  1MMA A;  1RUW A;  2E12 A;  2K5L A;  2RHZ A;  1B34 A;  1AWJ A;  1KQS P;  4NS5 A;  5J26 A;  2O9S A;  1HD3 A;  3OYA A;  1RAE B;  5FU7 C;  4P5N A;  2O4X B;  4LDV A;  2CDT A;  4DBQ A;  3HSB A;  3CCR Q;  3DKM A;  2KR3 A;  2M1H A;  7AT1 B;  1OPL A;  3H41 A;  4QVC A;  1FWZ A;  2WSF E;  3V8L A;  1OV3 A;  2RHI A;  2M9U A;  2DBM A;  2SEM A;  1X01 A;  2DEQ A;  1YWP A;  4FSX A;  1M1G A;  3A8G B;  3OYI A;  4M7D D;  4F7U A;  1QVF P;  1S72 A;  1GFC A;  3CCS T;  1VQK A;  2JNG A;  1IO6 A;  1PNJ A;  4LD6 A;  3CXC A;  1RI0 A;  1WDX A;  2IVW A;  4RTW A;  5CQY A;  1GBR A;  1ABQ A;  1WQW A;  3G6E Q;  3JCM J;  1EIF A;  2X4Y A;  3QPH A;  3CCM A;  3CC7 Q;  1C0M A;  1TH7 A;  2KI7 A;  2X4X A;  2VXF A;  1E7O A;  2QAS A;  2EYW A;  1RLP C;  2RA2 A;  1TWB A;  1XOV A;  1XJW B;  3E2U A;  4JLG A;  3PE0 A;  2GCX A;  4WCI A;  4MZP A;  5KCO A;  5J39 A;  1TTH B;  3DLL A;  4RTY A;  4KGZ B;  4C8Q G;  1QVG S;  1VQN T;  1M8M A;  4C8Q A;  2KRO A;  3L42 A;  1M90 R;  4ZGJ B;  3I56 A;  1Q7Y R;  4BUG A;  2VV5 A;  3M0Q A;  5HKC A;  3CCV A;  1M90 C;  1Q7Y C;  4Y91 A;  3CXC S;  2V8J A;  4DQ2 A;  3VS7 A;  4C0D B;  4CI0 C;  3MO8 A;  4GLK A;  4JS4 A;  3QWX X;  2LX9 A;  3QJ6 A;  1YJW A;  2PUO B;  4C92 A;  1IXD A;  2KVQ G;  4JJC A;  3I55 Q;  2MWO A;  4M7A G;  4M7A A;  1CSK A;  2LMJ A;  5I2S A;  1X2Q A;  2HAX A;  4HXJ A;  3CBM A;  4BI8 B;  1KD1 R;  2MIO A;  2Y90 A;  5FU7 B;  2E64 A;  3JCM c;  2VAS A;  1KD1 C;  2QI2 A;  2OTJ T;  1KQ1 A;  3PIP A;  3EGU A;  1NZ9 A;  4HA8 A;  4QQD A;  4IUP A;  3MET A;  4GY5 A;  4MMK A;  3CCL Q;  3J7A F;  2O4X A;  2VXE A;  1VQ5 T;  1X43 A;  2LNH B;  2JTF A;  2GNC A;  3MEV A;  4HKE A;  1LCK A;  2ABL A;  4FM4 B;  2X35 A;  2COY A;  4L5G A;  2FO0 A;  5KE3 A;  4R56 A;  3NGP A;  3EG1 A;  4ME7 A;  2XDB A;  2GTO A;  1UJ0 A;  4ZN1 A;  1TXQ A;  4HCC A;  3UWN A;  1JEG A;  3JB9 I;  2E5Q A;  1JJ2 S;  2DE0 X;  3P8B B;  4M77 E;  1I0C A;  3LH5 A;  1JU5 C;  1C6V X;  3H0I A;  3REB B;  1VQ4 Q;  2QA4 A;  2K6D A;  2GGR A;  2RM4 A;  3FB9 A;  1OYX A;  3JCM P;  3M54 A;  3CME A;  3H8Z A;  4M77 F;  3FIF A;  1UEB A;  1I8F A;  2EQM A;  4A4K A;  1SEM A;  1K9M R;  5DLQ E;  3JAM E;  2KRM A;  1QQJ A;  1F1B B;  4HCK A;  1QMC A;  3OSS C;  4M7D C;  3TVT A;  1K9M C;  4QQ6 A;  2J06 A;  3M9Q A;  1VIE A;  3EH1 A;  1YCS B;  1BI3 A;  1JXO A;  3FC3 A;  2RHX A;  2K2M A;  1N8R U;  1OQK A;  5LJ3 d;  5GAN d;  3MEW A;  1WIE A;  3M0R A;  4OMM A;  2M02 A;  5D6W A;  2CH4 A;  3LWH A;  1PCX A;  2HEQ A;  3EGD B;  3JB9 H;  3OYC A;  4FYY B;  3LWI A;  3REA B;  2YLB A;  4QW2 A;  5GMK i;  1YIT Q;  1UG1 A;  2CRE A;  2RJD A;  4IUV A;  2O31 A;  3VUB A;  2OTL A;  1KQS A;  1BBZ A;  3LGF A;  3T9N A;  2RI5 A;  2ROT A;  4F7U E;  1GRI A;  5LJ5 d;  1W2B S;  5ECA A;  5A0G A;  2OTJ Q;  2LJ3 A;  4E7K A;  1VQ7 A;  2RMO A;  1UGQ B;  1SG5 A;  4OMP A;  1YJN A;  2RJF A;  2E10 A;  2YRC A;  5GJV B;  4KGV B;  3OS0 A;  1M1K R;  3HTR A;  2HSE B;  1TS9 A;  3E1S A;  4F7U F;  2K3X A;  2K4Y A;  1U5S A;  1M1K C;  4HCZ A;  5DY9 A;  2MI6 A;  2M16 A;  4VUB A;  3OYM A;  1I81 A;  2RQU A;  1UTI A; 
#chains in the Genus database with same CATH homology
 1AVZ C;  3VS2 A;  1AEY A;  4JZ4 A;  5IXF A;  2D1X A;  2LX7 A;  2FG0 A;  2JM8 A;  1UEC A;  2J05 A;  1UGV A;  2ROL A;  2GQI A;  1EFN A;  2YUQ A;  2EVR A;  2FRW A;  2NUZ A;  4AFU C;  3PVL A;  2RNA A;  1ABO A;  1UDL A;  2QDL A;  4J9G A;  2CSQ A;  2JTE A;  2CUD A;  4CC7 A;  1M3A A;  2MOX A;  3NPF A;  3UAT A;  2EW3 A;  2BTT A;  1M3C A;  1U06 A;  2IIM A;  2CSI A;  2ED1 A;  2OAW A;  3EHQ A;  2KNB B;  2EYY A;  1T0H A;  1YWO A;  4JJD A;  1MV3 A;  1K76 A;  2FEI A;  2MCN A;  4OMQ A;  2JMC A;  1ZUY A;  2EPD A;  3I35 A;  2DLP A;  4RUG A;  4J9D A;  1QCF A;  2CUB A;  2EQI A;  4LUE A;  3TSZ A;  4AG1 C;  1WXT A;  2KE9 A;  2O88 A;  4LUD A;  1BK2 A;  1PKT A;  2OI3 A;  2XMF A;  2VVK A;  5FW9 A;  3UF4 A;  5EC7 A;  4CC3 A;  1FMK A;  2RN8 A;  2C0O A;  1WX6 A;  2DL3 A;  3IQL A;  1QWE A;  1K0S A;  2HBW A;  1T3L A;  1AZG B;  1BB9 A;  2AK5 A;  1JO8 A;  1HJD A;  2LZ6 B;  2AZV A;  4IIO A;  4ORZ A;  2GTJ A;  1WXU A;  2AZS A;  2CH4 W;  4JPB W;  1AOJ A;  1TUD A;  2CT3 A;  4OMO A;  4F17 A;  1OPK A;  2V1R A;  2KT1 A;  1GFD A;  1NYG A;  2DL7 A;  2E5K A;  1OEB A;  1H92 A;  2FPF A;  2V1Q A;  2EBP A;  1YN8 A;  1ZUU A;  3SHW A;  1FYN A;  1W6X A;  1KFZ A;  1KIK A;  1K1Z A;  3H0F A;  2HSP A;  2BZ8 A;  2L0A A;  2VWF A;  2RQR A;  1K0X A;  3NMZ C;  4HVU A;  1M27 C;  2RQW A;  1M30 A;  2LJ0 A;  2PTK A;  2K3B A;  1YNZ A;  1JQQ A;  4E6R A;  1SPK A;  5IHN A;  4A63 B;  1K4U S;  5FWC A;  3PVQ A;  2A08 A;  2LJ1 A;  3KFV A;  4D8K A;  1X27 A;  1YP5 A;  1B07 A;  2HDA A;  3H0H A;  2ESW A;  2F2V A;  2W10 A;  2BZY A;  1GCQ C;  2DL4 A;  3VRY A;  2W0Z A;  4ZNX A;  1VYV A;  1I1J A;  1RUW A;  1QLY A;  3VS5 A;  3C0C A;  3VS6 A;  1MUZ A;  3NHN A;  4AG2 C;  4QT7 A;  1AWJ A;  1UUE A;  1AD5 A;  1I07 A;  3CQT A;  2O9S A;  1UFF A;  2LP5 A;  1X2K A;  1HD3 A;  2DMO A;  3QWY A;  2CDT A;  2I0N A;  3VRZ A;  1SHF A;  4M4Z A;  2KR3 A;  4ESR A;  2ED0 A;  1WFW A;  1ZBJ A;  2DIL A;  1OPL A;  2JS2 A;  3H41 A;  4DEY A;  1NEG A;  1PKS A;  2EYZ A;  4X1V A;  1PHT A;  1QWF A;  1OV3 A;  1QKW A;  2DBM A;  4F14 A;  2SEM A;  2DL8 A;  1TG0 A;  1NLP C;  4CC4 B;  4AFS C;  1YWP A;  1VYU A;  4Z89 A;  2D0N A;  4IIM A;  4HVW A;  1GFC A;  2H8H A;  3VS1 A;  4J9E A;  4EIK A;  3TSW A;  3ZL7 C;  4J9H A;  4RTT A;  2C0T A;  5IH2 A;  1ZSG A;  1S1N A;  1IO6 A;  2JM9 A;  1V1C A;  1BU1 A;  1PNJ A;  2EYX A;  1AWW A;  2LCS A;  3VS4 A;  1VA7 A;  2KXD A;  1WDX A;  2PNI A;  1Y0M A;  2L3P A;  5IXB A;  3THK A;  4RTW A;  2O2O A;  4Z8A A;  1GCP A;  4Z88 A;  4F16 A;  1GBR A;  1ABQ A;  4J9C A;  1W1F A;  2JW4 A;  1VYT A;  4LE9 A;  4OMN A;  3EG2 A;  3O5Z A;  4LNP A;  2DX1 A;  1X6G A;  2L3Q A;  2DNU A;  1E7O A;  3M0S A;  1JXM A;  1E6H A;  5HCK A;  2EYW A;  2OJ2 A;  4HVV A;  1T3S A;  1RLP C;  1XOV A;  1K9A A;  3PE0 A;  4WCI A;  1SRL A;  2A28 A;  4RTY A;  2EGE A;  1B3Q A;  1M8M A;  2LQN A;  2KRO A;  2CT4 A;  1MV0 B;  1WA7 A;  2DYB A;  5FWB A;  2JT4 A;  3M0Q A;  4JJB A;  2FRY A;  3UA6 A;  1PRM C;  1G2B A;  2RF0 A;  2B86 A;  2ENM A;  1GBQ A;  3VS7 A;  2NWM A;  2PZ1 A;  1ZX6 A;  4RTV A;  1W70 A;  1ZUK A;  2J6F A;  2A36 A;  1WYX A;  3QWX X;  4DEX A;  1UHC A;  4Y92 A;  2RPN A;  2VKN A;  3RNJ A;  2RQV A;  4JJC A;  2G6F X;  1NM7 A;  1H8K A;  1G83 A;  1CSK A;  2DVJ A;  1WLP B;  2J6K A;  2LMJ A;  2SRC A;  1E6G A;  1X2Q A;  2M51 A;  4HXJ A;  4RTZ A;  4KRT A;  2L3S A;  1N5Z A;  2MIO A;  3EHR A;  5L23 A;  2KGT A;  1KJW A;  1UJY A;  1X69 A;  2YUO A;  1AZE A;  1NG2 A;  3EGU A;  1X6B A;  2F2X A;  4OML A;  3UA7 A;  2KBT A;  2DA9 A;  4AFQ C;  2K9G A;  4J9B A;  1M3B A;  2EGA A;  1X43 A;  1T0J A;  1UHF A;  2GNC A;  2LNH B;  1ARK A;  1LCK A;  3ULR B;  2ABL A;  2K7A A;  2JS0 A;  2BZX A;  2FO0 A;  2D8J A;  3NGP A;  3EG1 A;  4LN2 A;  2HCK A;  1PWT A;  1SHG A;  1AWO A;  2GTO A;  1UJ0 A;  2C0I A;  1NLO C;  1RLQ C;  2YDL A;  2A37 A;  2DRK A;  1JEG A;  3A98 A;  1TUC A;  2DE0 X;  2P4R A;  2KRN A;  2FPE A;  1I0C A;  1HSQ A;  3LH5 A;  1JU5 C;  2F2W A;  3H0I A;  3REB B;  3U23 A;  2K6D A;  4K11 A;  2GGR A;  3R6N A;  2DF6 A;  2DL5 A;  1J3T A;  2O9V A;  2KYB A;  2X3X D;  1SSH A;  2EGC A;  2JXB A;  2DJQ A;  5IHK A;  2X3W D;  1SEM A;  5IHI A;  1Z9Q A;  5I22 A;  2KRM A;  2YUP A;  2D8H A;  3JV3 A;  4HCK A;  4R0K A;  3TVT A;  2FPD A;  2J06 A;  1Y57 A;  1YCS B;  1JXO A;  3M0P A;  2L2P A;  1NYF A;  2J7I A;  1ZLM A;  1NEB A;  2YSQ A;  2K2M A;  1SRM A;  3EG0 A;  1WIE A;  1CKA A;  3M0R A;  5GJW B;  4RTX A;  4OMM A;  3SEM A;  4GBQ A;  2CH4 A;  3I5S A;  4JZ3 A;  2HEQ A;  3M0U A;  2JMA A;  2LQW A;  1OOT A;  3EG3 A;  3REA B;  2DRM A;  3M0T A;  2DM1 A;  1UG1 A;  2CRE A;  2YT6 A;  1H3H A;  1GL5 A;  2GBQ A;  2O31 A;  4J9F A;  2K79 A;  4CC2 A;  1BBZ A;  2M0Y A;  1RI9 A;  2KXC A;  2KYM A;  2ROT A;  3RBB B;  4J9I A;  3I9Q A;  2J6O A;  1U3O A;  1GRI A;  3FJ5 A;  5ECA A;  1UE9 A;  1WI7 A;  2DBK A;  2LJ3 A;  2RMO A;  1KSW A;  4OMP A;  1A0N B;  1WXB A;  5GJV B;  2AKL A;  2EKH A;  1GCQ A;  2KRS A;  2RQT A;  3I5R A;  4GLM A;  2ECZ A;  1QKX A;  3VS3 A;  1U5S A;  2KT8 A;  3GBQ A;  1PRL C;  1Z9Z A;  4D8D A;  4FSS A;  3VS0 A;  2YUN A;  1AWX A;  2AKK A;  4AFZ C;  1CKB A;  4RTU A;  2KEA A;  2RQU A;  5I11 A;  1UTI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...