3IQLA

Crystal structure of the rat endophilin-a1 sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
b'SVGSDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endophilin-A1
molecule tags Protein binding
source organism Rattus norvegicus
publication title SH3 domains from a subset of BAR proteins define a Ubl-binding domain and implicate parkin in synaptic ubiquitination.
pubmed doi rcsb
total genus 12
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3iqlA00
1JXMA 3KFVA 4JJBA 5FW9A 1G2BA 1RUWA 3CQTA 1T0HA 2DL7A 1PRMC 3H41A 2OJ2A 1QWEA 5IHKA 4J9IA 3ULRB 5GJWB 3H0FA 2LCSA 1VA7A 1ZLMA 1HJDA 4OMOA 3UATA 4R0KA 1AD5A 2CT4A 4J9BA 2CT3A 4Z88A 2D0NA 1H92A 1JQQA 2EKHA 1PHTA 2JW4A 1K9AA 1AWJA 1WA7A 2C0IA 2J05A 2KXCA 4M4ZA 3RNJA 2BZ8A 1UJ0A 1UFFA 3LH5A 2EBPA 1UHFA 1GFDA 4AFSC 2RQWA 4CC2A 1X2QA 2KRSA 2PTKA 3VRZA 1ZUKA 1JU5C 1X43A 1W70A 1M30A 2J6FA 3H0IA 2CH4A 5IXBA 1H3HA 1Z9ZA 2KEAA 3I5SA 2EYZA 2RN8A 2RQTA 4LE9A 2RQUA 3PVLA 4IIOA 4ORZA 1UJYA 2FPDA 1AWWA 2I0NA 2VWFA 4ZNXA 2EPDA 2CH4W 1BB9A 2LZ6B 4F14A 2RF0A 5ECAA 1BU1A 2DNUA 4AFQC 2EGAA 2ENMA 2FPEA 2X3XD 2ECZA 2JT4A 3EGUA 4IIMA 1N5ZA 1K76A 1Z9QA 1M8MA 1AZEA 1T0JA 4CC3A 1I0CA 1QKWA 1FMKA 1NLPC 2KRMA 1QKXA 2DE0X 1SHFA 5I22A 2AKKA 1WX6A 1OPKA 4GLMA 2FPFA 1CKAA 1MV3A 2DBKA 2W0ZA 1UECA 2D8JA 2RMOA 2W10A 5FWCA 2YDLA 1JEGA 1E6GA 4A63B 2DLPA 2J6KA 4HVVA 1B07A 2GBQA 2FRYA 2LJ3A 1HSQA 1M3CA 1UHCA 2RQVA 2DMOA 1CSKA 2F2XA 1NYGA 2H8HA 1OPLA 5IHNA 1UTIA 2ED0A 1U3OA 2HCKA 1GL5A 2PNIA 1VYUA 1HD3A 3VS3A 1ABQA 2NUZA 2V1QA 2D1XA 2L3SA 1LCKA 2VKNA 3VS6A 4DEXA 4D8KA 3A98A 1YN8A 2ROLA 2LQNA 2JTEA 2EGEA 2ED1A 4OMMA 3GBQA 1A0NB 5IH2A 2KRNA 2CSIA 2KYBA 2P4RA 3TSWA 4Y92A 3REAB 2AKLA 2XMFA 1RI9A 3EHRA 3I9QA 2A36A 1SSHA 4AFZC 2LX7A 1GCQC 2DX1A 1J3TA 2JMCA 2K6DA 4OMQA 2FG0A 3THKA 3M0RA 2HBWA 3EG2A 4RTZA 1UDLA 1W1FA 4RTTA 2DL8A 1PKTA 1WYXA 2FO0A 4OMPA 4WCIA 4J9CA 2LMJA 2MCNA 1UG1A 4JZ4A 1PRLC 2ESWA 3U23A 4CC7A 1YNZA 1SPKA 2K79A 2A08A 2GNCA 1TUDA 2KT1A 2J7IA 2KYMA 2KBTA 1WXTA 3IQLA 3VS1A 2JM8A 5FWBA 3O5ZA 4CC4B 2EQIA 4LNPA 2J6OA 1T3SA 2CREA 2HSPA 3UA6A 1YWPA 2C0OA 1NM7A 2B86A 4FSSA 2AZVA 3VS5A 1YCSB 2GTOA 1EFNA 4RTUA 2GGRA 1UUEA 1Y0MA 2MIOA 1SEMA 2JMAA 1XOVA 1PNJA 1AVZC 4AG2C 1AWXA 2DA9A 1YP5A 3M0SA 3I35A 3PVQA 2DRKA 1NEGA 2DJQA 2CDTA 2EGCA 5EC7A 1ZSGA 2GQIA 1GBRA 1ZUYA 4OMNA 2DILA 2SRCA 2EW3A 1ABOA 1WFWA 2AZSA 2IIMA 2LNHB 4JZ3A 4RUGA 2G6FX 2EVRA 5L23A 1K0SA 4RTYA 2YT6A 2VVKA 2L2PA 3SHWA 2HDAA 2KNBB 1WXBA 3VRYA 1JO8A 2JS2A 2E5KA 1TG0A 1K4US 1U06A 1OOTA 1MV0B 3VS2A 1GBQA 2F2VA 1RLQC 3RBBB 2K9GA 4J9FA 5HCKA 2FRWA 2DM1A 1FYNA 2DL4A 2LJ1A 5I11A 2GTJA 1X2KA 2O9VA 3FJ5A 3VS0A 3EG1A 4HCKA 4HXJA 3TVTA 2YUQA 2DL3A 4J9HA 1B3QA 4J9GA 1OV3A 1WI7A 4AFUC 2X3WD 4D8DA 1AZGB 1YWOA 3NPFA 1WXUA 1TUCA 1ZX6A 3EG3A 2O31A 2O2OA 1H8KA 1AOJA 3TSZA 2J06A 4HVUA 2M51A 1AWOA 2YSQA 3NHNA 3NGPA 4KRTA 1M3BA 1SRMA 1IO6A 3SEMA 4JJDA 2JS0A 2EYYA 2ABLA 4Z89A 2RPNA 2BZYA 2F2WA 1WLPB 1NLOC 2KROA 3H0HA 3VS4A 1I1JA 2DVJA 1K0XA 2JXBA 1NYFA 1RLPC 2BZXA 2CUBA 3C0CA 3UF4A 2LJ0A 4JJCA 1E6HA 3M0PA 1M3AA 2K7AA 1PKSA 1ARKA 1M27C 1GCPA 2A37A 2RQRA 1W6XA 3VS7A 3R6NA 4ESRA 1G83A 2AK5A 1UE9A 3JV3A 1JXOA 1QLYA 4K11A 4AG1C 2SEMA 2CUDA 2YUOA 2O9SA 2EYWA 1V1CA 4RTVA 1I07A 1KFZA 2L0AA 1ZBJA 2O88A 4JPBW 1QWFA 1PWTA 1NEBA 1VYTA 3I5RA 1QCFA 1WIEA 1UGVA 1Y57A 2BTTA 3EHQA 2V1RA 5IXFA 1E7OA 2A28A 2JM9A 4OMLA 2C0TA 2DL5A 4RTWA 1K1ZA 2FEIA 2ROTA 2NWMA 3PE0A 3REBB 1X6GA 2K3BA 3M0QA 4QT7A 2D8HA 1T3LA 1VYVA 2DYBA 1X69A 2K2MA 4J9DA 1ZUUA 1AEYA 1WDXA 2KXDA 1KSWA 2DF6A 2HEQA 3QWXX 2KR3A 3NMZC 3QWYA 4X1VA 2L3PA 1GFCA 1U5SA 4DEYA 1X27A 2PZ1A 3EG0A 2LP5A 1GRIA 1MUZA 1KJWA 3M0TA 1KIKA 2LQWA 2EYXA 4F17A 2L3QA 2KT8A 4J9EA 4EIKA 1SHGA 1S1NA 4HVWA 1NG2A 1SRLA 3ZL7C 2YUNA 2OI3A 4RTXA 1CKBA 4LUEA 4E6RA 5GJVB 2M0YA 1GCQA 2MOXA 5IHIA 2QDLA 4F16A 4LN2A 2DBMA 1X6BA 2DRMA 2YUPA 2KE9A 4LUDA 1OEBA 1BBZA 2OAWA 4GBQA 2KGTA 4Z8AA 3UA7A 3M0UA 1BK2A 2CSQA 2RNAA
chains in the Genus database with same CATH superfamily
1JXMA 4JJBA 2EQJA 3CQTA 1PRMC 5C6SA 1IHVA 3H41A 1QWEA 4C0GA 3OYCA 2CKKA 4OMOA 3UATA 2JUFA 4J9BA 4Z88A 5GAMf 2D0NA 2F5TX 3LWIA 4PJOB 2B8AA 1PHTA 2JW4A 2LVMA 3RNJA 2E3IA 5LJ3j 1UFFA 2CYZB 2HKNA 1GFDA 2Y4XA 2KRSA 5GAOr 1ZUKA 1VOMA 2WSFE 3OS1A 3H0IA 1VQNT 2CH4A 2DXTA 3JSCA 4X9CA 4ZTJA 2RQUA 4IIOA 4MDXA 4PJOF 4OMFB 2FPDA 4M7AE 4ZNXA 1MMGA 4J6XA 1N6AA 1HK9A 2ECZA 4ZN3A 3E1SA 1M8MA 4CC3A 1I0CA 4FYYB 4HCZA 3CC2A 5GANe 3QXEB 4FT4A 1M90C 1OU9A 2X4JA 1JJ2S 3OMGA 5GANh 1TUGB 1Q86C 3CCJQ 3CCVT 1SHFA 5I22A 2XK0A 1WX6A 4OB2B 5LJ3e 3CMET 2FPFA 4PJOA 3CCQA 3T9NA 2W10A 2YDLA 1E6GA 5GMKh 4ZGEB 2IVWA 4PLLA 1B07A 4C5GA 2FRYA 4B6MA 3RKYA 5GAOq 2RQVA 2ZGWA 1CSKA 1NYGA 1O9SA 5LJ3d 1YJWA 2COZA 3HP9A 2RD1A 3CCSQ 2PNIA 2QA4Q 4C0FA 3VS3A 2K4YA 1ABQA 2NUZA 3CC4Q 2VKNA 1D1CA 3SDZA 4D8KA 2GQVA 8ATCB 2LT1A 1YJ9A 1VQ7T 5AYFA 5GMKm 4TVRA 5KE2A 3RESA 2CP6A 1UB4A 3PIPA 5GAN8 3I56A 2HMAA 4J7FA 1I5LA 1TOVA 1JB0E 1XQHA 4J5YA 3CBOA 2KYBA 2XHCA 4E7KA 5CQXA 2XMFA 2A36A 2MWPA 2JMCA 4JS4A 2E65A 1AHJB 3M0RA 3MCAB 1UDLA 4RCCA 1HYOA 1W1FA 2DL8A 4QQDA 1G3TA 2D9TA 4LDYA 5KYXA 2KAFA 5LL6S 3G6EQ 4OMPA 1PM3A 1UG1A 1WZOA 4JZ4A 1ZSZC 2ESWA 1D0XA 4CC7A 2A08A 1TUDA 2MWOA 1LJOA 2FHDA 1VQOQ 3L2RA 4J6YA 4E7LA 3QZ5B 1R0BG 3LGLA 1T3SA 2XU8A 4M75C 1MMDA 3RMSA 2QGGA 4M78E 1YWPA 4LDWA 1WHLA 3VS5A 1YCSB 3V7CA 1YITT 3OSVA 4LDXA 3GP8A 2EQUA 1UUEA 2RJFA 1MMAA 5KYUA 1BCOA 2BE9B 1VQLA 1XOVA 1KG1A 2QTXA 1VQ5T 4IUPA 1Y96A 4AG2C 2DA9A 1QVGS 1YP5A 5CAIA 3PFSA 5EC7A 2GQIA 3OSSC 3V7SA 1UEBA 2KDSA 5DLQE 4OMNA 4PFZA 2EQMA 3HRUA 1ABOA 1TSFA 5FU7C 1PG5B 3HFOA 4RUGA 2KY9A 4OF1A 1NJIC 4RTYA 1ZSZA 1ZA2B 2NUTB 1QVGA 2X51A 5CQYA 3EGDB 2HDAA 3CXCP 3OW2S 3M57A 4N0AC 2E5KA 2DIGA 1S72A 5D6YA 2CZ6B 1U06A 1MV0B 3VS2A 5GANj 4V2SA 1K8AR 4J9FA 3URGA 4CI0C 1QVPA 4FW2A 3OS2A 2DL4A 5KYUB 1Q7YR 1YCYA 3DB4A 4ATOA 4ZGJB 3PT9A 1PD1A 4BDZA 2L8DA 4J9HA 4JUVA 3OYIA 4D8DA 4ZTFA 4OP0A 4BACA 2O31A 3H9NA 2DETA 1AOJA 2J06A 4HVUA 4EMHA 1RAHB 4J8OA 3MEVA 4A4KA 1Y07A 3PIOA 3NGPA 4KRTA 1VIEA 4JJDA 5GAOn 4C92G 4C8QF 5GMKi 1KC8C 2DEQA 2KROA 2F5KA 2MYSA 4PJOE 1M2VA 1I1JA 2DVJA 4AT1B 2JXBA 2LQ8A 2KK4A 4C5IA 2CUBA 1QVFS 3HKSA 1I81A 4X34A 2RI5A 1D1BA 2VB6A 3VU3C 3QUIA 1VQ6Q 3JB9I 3KUFA 3MEUA 5FRNA 3N5BB 3L42A 3EAEA 3EFSA 1NBEB 3G4ST 4M7AG 1BI3A 3I56Q 2A7YA 3PMTA 3CCLA 2CUDA 3O8VA 5LJ3h 4XK8E 1V1CA 4FYXB 1I07A 4RTVA 4A53A 2L0AA 5HKCA 1W2BA 2DYIA 2O88A 4JPBW 1Y96B 1NEBA 3QKJA 2V1RA 3SB2A 2QI2A 4C8QA 2NUPB 3CCET 2EIFA 5GAMd 3RMQA 3OBYA 2ROTA 2CZ1B 5HK0A 3PE0A 2K3BA 3EH2A 2E6NA 4EMGA 2RHYA 4QT7A 3C95A 1YHQA 1VQOA 2DJZA 1HXDA 2K2MA 2EJGA 3QZ9B 3OYDA 1S72Q 1ZUUA 4A4HA 1AEYA 2Z0WA 2A0FB 3CPWA 4PLIA 3JB9F 3BE3A 2DF6A 2HEQA 4X1VA 2VXEA 1UGRB 1Q82U 1U5SA 3KXTA 2QA4T 3J7AF 2LP5A 1GRIA 3ZBDA 1VQLQ 3QIIA 1VQPQ 2CP2A 2ATCB 2EJ9A 3M0TA 1KIKA 2EYXA 2L3QA 3MP1A 4F7UE 2E1HA 3VKIA 4EIKA 3LW5E 1SHGA 2VUBA 1SRLA 4EMKB 1PSFA 3FC3A 4XTXA 1ZQ1A 1KK7A 4RTXA 3SWNA 4AMCA 2E10A 3JCMV 2KMTA 2QDLA 4F16A 3ZEHA 4FYWB 5J26A 4M75D 2YUPA 4ANJA 3NFCA 4LUDA 5LJ5j 2GCXA 2QXFA 2HNIA 2KSSA 4R55A 5A0GA 1YJNA 1RACB 1BKBA 4LXCA 2PVGB 1VQMT 2E6ZA 2OAWA 4Z8AA 3UA7A 1YI2Q 2M0OA 4XU1A 2IG0A 3NTIA 5FW9A 5CCAA 3EGXB 3CMAT 1XNIA 3OW2A 2OJ2A 4LDVA 3G1JA 5IHKA 3ULRB 1YJWT 2LCSA 2RB6A 2EWNA 5D6WA 1ZLMA 1HJDA 4R0KA 2O4XA 2CT4A 3CCLT 1KD1C 2L5QA 2HBPA 3CD6Q 3GLXA 4M7AF 2ZAEA 1K8AC 4PJLA 2V8IA 1K9AA 3HPWA 4B9WA 1AWJA 2C0IA 2KXCA 3VYHB 5FU6C 1QVGP 2BZ8A 1UJ0A 5GMKj 4ZN1A 1UHFA 3TQ7P 2HSEB 4E7JA 4DBHA 2PTKA 4F7UG 3ME9A 3VRZA 1M30A 1MGQA 4A4EA 4PJOD 5IXBA 1BCMA 4M77D 3CC2T 1Z9ZA 3I5SA 3S6WA 1BIAA 3TU4K 2RK2A 3PVLA 1M2VB 3CCQQ 2NUPA 1BU1A 3FIFA 2DNUA 2EGAA 4KGVB 2X3XD 2XIDA 3X24B 2JT4A 2RK1A 1RAGB 2QQSA 2MPXC 1K76A 3ASKA 4DBFA 5GMKe 1D09B 4XU3A 4XAXB 2H3JA 1VQ6A 2AKKA 2QA4A 3RKXA 4GLMA 2D8JA 1WHMA 1JEGA 2WSCE 4HCCA 2QTVA 4M77F 3CCUT 4LD9K 4HVVA 4N4IA 2GBQA 2QGFB 3UDCA 1HSQA 3OYNA 1N9SA 1M3CA 3PTAA 5CVIA 2PUKB 2RJEA 4FU6A 2DD5A 1UTIA 2JZ2A 5HK3A 1WPYA 1LNXA 3OQ5A 1VYUA 1HD3A 2V1QA 4M7AD 2D1XA 2L3SA 2HZYA 1LCKA 4L5GA 5J39A 3CCMT 2MAMA 1MMNA 1G3SA 2NLUA 2ZPEB 1YN8A 2E12A 5CKHA 4OMMA 1H641 4MDWA 4M78C 3VJPA 4M7DG 5IH2A 4JS5A 2KRNA 2P4RA 2P0KA 1QCNA 4PFPA 3BDUA 4Y92A 4FT2A 4WTOB 2XKOC 1VQ8T 3CC4A 1M4ZA 2EYQA 4C8QE 4OMQA 4O5VA 1MNEA 1D3BA 2HBWA 3OYKA 2DXUA 3WXMB 2DTOA 3OB9A 4BE1A 5GAMh 2LDMA 3EFOA 2FO0A 3M54A 2DTHA 2EQKA 2M9UA 3FDRA 3U23A 2DXBA 2K79A 3TREA 1VQ7Q 2RM4A 1G8XA 2KT1A 2J7IA 1M2OA 2RJDA 2KYMA 5LJ5e 5FWBA 1VQKT 2EQIA 4LNPA 2YRVA 5LJ5h 2DK3A 2J6OA 2HSPA 3JRZA 4M75G 3V8LA 1VQMQ 2AZVA 3JB9H 3OS5A 2JN0A 3E9GA 3CBPA 3CCQT 3DLLA 5GAN4 3H6ZA 5CKDA 2VV5A 2BUDA 1YJNT 3A8LB 1PNJA 3EG9B 2K5LA 3CMAQ 1AWXA 4VUBA 4C8QD 3PVQA 1PC0A 2CDTA 3V8JA 3AHUA 1ZSGA 1OX8A 3E2UA 2YRCA 2DILA 5A2QE 4ELYC 3RERA 2MMPA 3CCUQ 2AZSA 3S3OA 3JCMf 2HAXA 1K0SA 3M53A 1O75A 3G71T 3OYMA 5GAMj 2KNBB 3NTKA 3VRYA 3G71A 2QQBA 1JO8A 3MP8A 2CP7A 4PJOC 1GBQA 1ZA1B 4KBMB 4L59A 3RBBB 3CCJT 2LX9A 2K9GA 3SWNB 3CCVQ 4M75E 5HCKA 3GIBA 3LX7A 4LD6A 2DM1A 1FYNA 3MEAA 1G3WA 2ZPFB 3L2ZA 2L89A 4IKFA 3JCMe 1QQJA 1X2KA 2O9VA 3EG1A 3EG9A 3M4GA 4HXJA 3X20B 3HFNA 3FJPA 1OV3A 4M7DA 5IN1A 1YWOA 4XU2A 1ZX6A 3FB9A 3D7SB 2YSQA 3NHNA 2FYKA 1IO6A 3M58A 1TS9A 1QP2A 4ELZC 5DM7R 1TTHB 2JS0A 2ABLA 2RPNA 1WLPB 4M7DC 5GAN2 1BYMA 1MNDA 1RI0A 1UGPB 1K0XA 3UPUA 1R8OB 4BE0A 5C0MA 1NYFA 1N8RU 2BZXA 2MF2A 5A0LA 2CS7A 3X25B 4XU0A 2LJ0A 4JJCA 1E6HA 3M0PA 1M3AA 3FEOA 1OU8A 1I8FA 4IUUA 5GANd 3A8OB 4IUTA 3VS7A 3R6NA 2AT1B 1Q82R 4M77B 3GOXA 2GFUA 4JRKA 4M7DE 1EZZB 1YBYA 4FIBA 2CP3A 5KCHA 2RHXA 3Q1JA 1VQ8Q 2QEXT 2O9SA 2EYWA 2YXYA 1ZBJA 2HQHA 3R6OA 1QCFA 3MPUB 1UGVA 2LT4A 3EHQA 1NJIU 5IXFA 2DXCA 1M5Q1 2A28A 3LH0A 2ZPGB 4D6WA 3EFOB 1SG5A 9ATCB 4RTWA 1R0CB 3JCMX 2FEIA 2K3XA 3TEEA 3QYGB 1WQ7A 3S3MA 3OS0A 2JVVA 1K9MR 1K9MU 2HQXA 4F7UB 2D8HA 2DKGA 3G71Q 1VYVA 2DYBA 3JCMJ 2P0PA 2PVOB 4J9DA 4MZPA 2F69A 3JCMc 1QMCA 1RADB 3NMZC 3QWYA 2L3PA 2V8JA 1FMVA 4DEYA 2X4WA 3EG0A 2LC4A 2LQWA 1QP3A 3JCMQ 2KT8A 1TXQA 3OMCA 2K57A 1LOJA 1N8RC 1S1NA 1NG2A 5M9OA 1VQ4Q 1X6OA 2YUNA 1U1SA 3BFMA 2OI3A 1CKBA 3HSBA 4LUEA 2QYZA 5GJVB 2MI6A 4NS5A 1GCQA 3JCMh 4LN2A 4E7SA 1LVKA 4C92B 4QVZA 1VQLT 3CCUA 1Q81C 2F1LA 1BBZA 1D3BB 4GBQA 2KGTA 1YJ9Q 6AT1B 3HHTB 3M0UA 4XTZA 3QHSA 1BK2A 2RNAA 3JCMW 1W2BS 3RDVA 4DBRA 1T0HA 2DL7A 5GMKl 1KHIA 3DB3A 2M1HA 3NTHA 2FZGB 1TH7A 1VA7A 3OYGA 4MMLA 1H92A 4FCYA 2EKHA 5LJ5g 2J05A 4M4ZA 4M7DB 2OTLT 5CKBA 3CC7Q 2EBPA 4PJNA 3J81E 4AFSC 2RQWA 3X28B 4CC2A 2QEXQ 1X2QA 4XTYA 1RABB 1VQ8A 1X43A 4MZMA 1W70A 1VQNQ 2FL7A 3M59A 1Q95G 3OYHA 4Q5WA 2VC8A 1H3HA 4JJNK 2EYZA 2RQTA 1M1FA 4LE9A 1KC8U 2QG9B 3CC4T 1VQ6T 4Y91A 4JRPA 1UJYA 1AWWA 4BY6B 2CH4W 7AT1B 2LZ6B 4F14A 2QDYB 2RF0A 4AFQC 1D0ZA 1U8RA 1Y71A 3EGUA 3DLMA 4IIMA 3JCMg 1Z9QA 1XTDA 1AZEA 1QCOA 1QKWA 1NLPC 4ME7A 4F04B 2KRMA 3LYIA 1QKXA 2OTJT 4DOVA 3M55A 1K73C 1W4SA 1OPKA 1MV3A 2DBKA 3LGFA 4BB7A 2RMOA 4O6JA 3QBYA 5FWCA 1OX9A 3M9QA 3CMEA 3OYBA 4C0ZA 1R77A 4II1A 1VUBA 2LJ3A 1Q86U 2DFUA 2F2XA 1PCXA 2H8HA 2RJCA 4RCBA 2E70A 5IHNA 1RAFB 4C0DB 2XDPA 4OVAA 2ED0A 3E19A 1X01A 1LPLA 2LCCA 2E3HA 3PMIA 2FB7A 3F70A 3VS6A 3S3NA 1BI2A 4M7DD 2ZCFB 3OYAA 2FVUA 1TU0B 2JTEA 3L2QA 2K3YA 1P92A 2ED1A 1A0NB 4Z02A 5KCOA 1FWZA 1VQ5Q 3TSWA 3CCMQ 3REAB 1K8AU 3I9QA 2LNVA 4DOWA 3SD4A 1SSHA 1TWBA 3GPLA 1JBMA 3MKDA 4PL6A 2I2LA 1BI1A 3THKA 4C92E 1M1KR 3EG2A 4RTZA 3LLRA 4RTTA 4PJOG 2CZ0B 2R58A 1C6VX 1WYXA 2O01E 4WCIA 4J9CA 5KYYB 2LMJA 2MCNA 1PRLC 2R5AA 1SPKA 1VQ9A 1FXXA 1XJWB 5I2MA 1ZSZB 2KBTA 3IQLA 3VS1A 3EGDA 2JM8A 5CR2A 1QW1A 3O5ZA 1WHJA 1OI1A 2FZCB 2JTMA 4JLGA 4M7AA 1B34B 1NM7A 2B86A 4FSSA 5EG2A 2CZ7B 2PU9B 1G5VA 1M1KU 2GGRA 1Y0MA 2P0QA 2JJ9A 1PSEA 5GAN5 1IB8A 1SEMA 4QQGA 1YITA 1SF9A 5D7UA 4QVCA 2V26A 5LJ5f 1DJ7B 3HRSA 5IAYA 2X4YA 4C8QC 3AT1B 2DRKA 2DJQA 2QQRA 1N27A 4C8QB 5GAOl 3E9FA 4M7AC 3A8HB 2CP0A 4EMKC 4JDSA 4M78B 1GBRA 1ZUYA 4IUVA 1KD1U 4KGZB 3P8DA 2SRCA 2EW3A 3META 4IUQA 1WFWA 1JJ2P 2IIMA 2DIQA 4JZ3A 2G6FX 2COWA 2EVRA 3QYHB 2ZPIB 4C0DC 3CMAA 2E41A 2QAZA 1D1AA 4JRIA 2VVKA 1YI2A 1UGSB 2C06A 3QDFA 3CBMA 4XTUA 3A5ZB 5GAOp 1WXBA 4KT0E 2IPOB 1V29B 4RMOA 5I21A 1B34A 2P84A 1OZ2A 1K4US 1OOTA 5LJ3f 4KH0B 1RLQC 5A0DA 4NOYA 5GAN3 4QVDA 4L6V5 1NE8A 3OY9A 2LJ1A 3CPWS 3GNFB 4EPCA 3OYFA 3QO3A 3OYEA 5GANg 2P4TA 1I5OB 2DL3A 1KQ2A 2YHTA 4AFUC 1WNLA 1YIJA 2L3RA 1M90R 2X3WD 3NPFA 1EIFA 1WXUA 2OTJQ 3EG3A 2AHJB 2O2OA 3CCJA 1H8KA 2RO0A 2M51A 4GLKA 1N9RA 3P8BB 4IURA 2PQWA 4M77C 3SEMA 4OGEA 3CCRT 2EYYA 4BI8B 4OB3B 3C4SA 3BY7A 5FU6B 1VQKA 3H0HA 2RHUA 3GNGA 1IRXA 4JRQA 1IXDA 3EGXA 2DAQA 2ZZDA 4KUDK 2KQWA 3UF4A 3QJYA 4PJMA 5CKEA 2K7AA 1PKSA 1ARKA 1M90U 4PNOA 2A37A 4M75B 4C8QG 2YRDA 1D0YA 4ESRA 2AK5A 3JV3A 4HA8A 4NL2A 3L1AA 4K11A 4QQ6A 2MK5A 4KULA 3CD6A 3JCMP 5CKFA 2BKDN 2M02A 3I55T 1RL2A 1QWFA 4KUIA 3I5RA 1WIEA 1Y57A 2BTTA 1E7OA 3HL8A 4J83A 2JM9A 4EDUA 2C0TA 3SWNC 3HRTA 5HY6A 3G6EA 2X9HA 3RKWA 3REBB 1Q81R 5FRMA 1G3YA 5KH6A 4PFOA 4P5NA 3M0QA 1WHGA 4OB0B 1UGQB 2XD0A 4WF2A 4N4HA 5CO7A 2E4HA 1M9SA 2NUTA 1NPRA 5J3BA 1WDXA 1YHQT 1KSWA 4M75A 4XTWA 2JTFA 1BI0A 2HQEA 2LRQA 5IT9E 2YLBA 1ACMB 1GFCA 2HD0A 4C92F 1MUZA 1KJWA 4F17A 1K73U 3UT1A 5FU7B 4J9EA 3MHXA 2OTJA 4HVWA 2XICA 2D0QB 3VUZA 3ER0A 1PD0A 4MZTA 4E6RA 5KYWB 1BIBA 2M0YA 2MOXA 3BDLA 2EFIA 4BUGA 4HT8A 3CCEQ 2KE9A 1KC8R 1OEBA 5I2SA 2DTIA 4JLIA 5D6XA 4E47A 3MJXA 2CSQA 4J6WA 3CCST 2DO3A 1H3ZA 3RIRA 1VQ4A 3FRNA 5KYYA 2DEUA 3KFVA 1G2BA 1RUWA 2RA2A 4FYVB 4F7UF 3JCMb 2HL5C 4A54A 1WJRA 4J9IA 5GJWB 3H0FA 3HTRA 2FZKB 3JAME 3GF5A 3QG1A 4NL3A 1AD5A 2CT3A 3OYYA 1Q7YC 3CD6T 2DZCA 2VGMA 2ZPBB 1JQQA 3CCLQ 4M7AB 1WA7A 3JB9J 2OAUA 5GAMe 1K73R 5GANf 1Q86R 1IZ6A 1FX7A 1RAIB 3LH5A 4J7IA 4ZGDB 2RHZA 4UC4A 1JU5C 4QKUA 2X35A 3L2WA 2J6FA 4LDUA 2KEAA 3PGGA 1YIJT 3G6ET 1M8VA 2RN8A 1SSFA 1OQKA 3EFRA 4ORZA 4E7IA 3QJ6A 2I0NA 4M78A 2VWFA 2EPDA 2DD4A 1BB9A 2LQKA 2RI3A 3X26B 4M77G 1VQOT 2WACA 5ECAA 4PJJA 2ENMA 2FPEA 2OX7A 4OGCA 2VGNA 3CCRQ 1KQSA 1N5ZA 1VQNA 1T0JA 1RAEB 1FMKA 2K2VA 2GFAA 3WVDB 1GXIE 3PNWC 2DE0X 1ZBXA 4X9DA 3OYLA 1Y7XA 1CKAA 2W0ZA 1UECA 4A63B 2DLPA 4F7UA 4FSXA 2J6KA 2K5FA 1WJQA 4PKCC 3M4YA 2EJFA 1UHCA 1IREB 1ZHIA 2DMOA 1OPLA 3G4SA 2JNGA 1C0MA 4A4FA 4PK4A 1U3OA 1VQ5A 3G7ZA 2HCKA 3CCMA 1GL5A 1NPPA 3CCEA 2Y4YA 4E7HA 1YJNQ 5FLXE 4DEXA 1EX4A 2D6FA 2QQ9A 2BIVA 4BI4A 5DY9A 2COYA 3A98A 2PVDB 2ROLA 2LQNA 3UWNA 2BE7D 2EGEA 1QVFP 2E64A 4MMKA 3MEWA 3GBQA 3SFMA 1WGSA 1KQSP 2HKQB 1VQ9Q 2CSIA 2AKLA 3BW1A 1RI9A 3EHRA 3DKMA 3CC7T 2CP5A 5GAN7 4AFZC 1GCQC 2LX7A 2DX1A 1J3TA 2K6DA 4R56A 3RUXA 2FG0A 2YWWA 4HT9A 2YLCA 4M75F 2QQAA 4B9XA 3MO8A 5CK9A 1PKTA 5AT1B 1VQPA 2O4XB 2XDBA 3C94A 1WJSA 1YNZA 1B7TA 1YITQ 2GNCA 3M5AA 3V8KA 1I4K1 1WXTA 1KHCA 2VYTA 3CEYA 3QPHA 4A4GA 4CC4B 3CPFA 3VYGA 2CREA 1IGUA 4M77A 3UA6A 3EH1A 4C92D 2C0OA 1FMWA 2JOYA 4C5EA 4HKEA 2GTOA 1YFNA 4QW2A 1EFNA 4RTUA 2A3LA 4KGXB 1Q82C 3CXCS 3JB9D 2MIOA 3CCRA 2JMAA 3WVEB 1AVZC 4DQ2A 1SKUB 4N4GA 3M0SA 3I35A 3JB9G 2HL3A 1NEGA 2EGCA 2QASA 3CPWP 2GF7A 3JCMd 4M78F 5LJ5d 3QDRB 4BD3A 2E5QA 3KBGA 3RR6A 4N0AA 2DERA 1VIFA 4RKUE 2LNHB 4E7ZA 2WSEE 3I55A 5L23A 3QSUA 2DVEA 2H3EB 2YT6A 2LTOA 2G3RA 4M78D 2L2PA 3SHWA 2RI2A 1U1TA 3VV0A 5GAN6 4XTVA 3H8ZA 3I56T 2JS2A 1YIJQ 2KI7A 1TG0A 4EMKA 2EKOA 2F2VA 2FRWA 2XDDA 5KYWA 1MHNA 2OTLA 1Q7YU 1WHKA 5I11A 2GTJA 3FJ5A 4OB1B 1IGQA 3VS0A 1VQKQ 3FLGA 2VXFA 1YI2T 1M1GA 4HCKA 2DZ9A 3TVTA 2YUQA 4FM4B 1B3QA 4J9GA 2XG8D 3L2VA 3CC7A 1WI7A 4FL6A 1AZGB 1VQ9T 1TUCA 5GAMg 8AT1B 4C92A 3OW2P 5KE3A 4KH1B 2Y90A 3TSZA 1AWOA 1NJIR 4RG8A 1M3BA 1SRMA 2PUOB 5DLOA 4DA4A 1WHHA 4Z89A 2BZYA 2F2WA 3ZFJA 1NLOC 4CRIA 3VS4A 2EAYA 4RG2A 3G4SQ 2ZPHB 1RLPC 3P8HA 3C0CA 3CC2Q 4HCBA 1M27C 2R57A 1VQMA 1GCPA 5KYNA 2AIRB 1WQWA 2RQRA 1W6XA 2CGHA 2VASA 5KYXB 4BDYA 3LWHA 3A1PA 1JRIA 2M16A 1Q81U 2KVQG 1G83A 1UE9A 1JXOA 4BI3A 5GAOm 5FROA 1QLYA 3OBWA 1KD1R 3A8GB 3OYJA 3CMEQ 4AG1C 2SEMA 1IHWA 2YUOA 2XI9A 5CIUA 2LCLA 1KFZA 4E2FB 4DBQA 1OULA 2QEXA 1PWTA 1VYTA 1VQ4T 4Y28E 1YJ9T 3J80E 1NZ9A 1F1BB 4M78G 1S72T 4OMLA 2DL5A 3L2UA 2QK0A 1K1ZA 2RHIA 2NWMA 1X6GA 4YTLA 1RAAB 1VQ7A 3I55Q 3MP6A 1OYXA 1T3LA 1VQPT 5LJ3g 1X69A 4M7DF 1W2BP 1OZ3A 4BY6C 2KXDA 3VUBA 3TCJA 3INZA 2OTLQ 1C1AA 3QWXX 1K9MC 2KR3A 4M77E 3CCVA 1JJ2A 1M1KC 1X27A 2PZ1A 4XQ3A 5L8RE 4GY5A 3V7RA 4C5HA 1YHQQ 2V8KA 1YJWQ 1QVFA 3A8MB 4BE2A 1V76A 2K5IA 3M56A 3CCSA 2RH2A 3ZL7C 2DPPB 1N8RR 2NYSA 3CXCA 4FW1A 2X4XA 5IHIA 2R5MA 2DBMA 4C92C 1X6BA 1AT1B 2DRMA 1X75C 1KQSS 3C12A 3OA6A 1KQ1A
chains in the Genus database with same CATH topology
1JXMA 3KFVA 4JJBA 5FW9A 1G2BA 1RUWA 3CQTA 1T0HA 2DL7A 1PRMC 3H41A 2OJ2A 1QWEA 5IHKA 4J9IA 3ULRB 5GJWB 3H0FA 2LCSA 1VA7A 1ZLMA 1HJDA 4OMOA 3UATA 4R0KA 1AD5A 2CT4A 4J9BA 2CT3A 4Z88A 2D0NA 1H92A 1JQQA 2EKHA 1PHTA 2JW4A 1K9AA 1AWJA 1WA7A 2C0IA 2J05A 2KXCA 4M4ZA 3RNJA 2BZ8A 1UJ0A 1UFFA 3LH5A 2EBPA 1UHFA 1GFDA 4AFSC 2RQWA 4CC2A 1X2QA 2KRSA 2PTKA 3VRZA 1ZUKA 1JU5C 1X43A 1W70A 1M30A 2J6FA 3H0IA 2CH4A 5IXBA 1H3HA 1Z9ZA 2KEAA 3I5SA 2EYZA 2RN8A 2RQTA 4LE9A 2RQUA 3PVLA 4IIOA 4ORZA 1UJYA 2FPDA 1AWWA 2I0NA 2VWFA 4ZNXA 2EPDA 2CH4W 1BB9A 2LZ6B 4F14A 2RF0A 5ECAA 1BU1A 2DNUA 4AFQC 2EGAA 2ENMA 2FPEA 2X3XD 2ECZA 2JT4A 3EGUA 4IIMA 1N5ZA 1K76A 1Z9QA 1M8MA 1AZEA 1T0JA 4CC3A 1I0CA 1QKWA 1FMKA 1NLPC 2KRMA 1QKXA 2DE0X 1SHFA 5I22A 2AKKA 1WX6A 1OPKA 4GLMA 2FPFA 1CKAA 1MV3A 2DBKA 2W0ZA 1UECA 2D8JA 2RMOA 2W10A 5FWCA 2YDLA 1JEGA 1E6GA 4A63B 2DLPA 2J6KA 4HVVA 1B07A 2GBQA 2FRYA 2LJ3A 1HSQA 1M3CA 1UHCA 2RQVA 2DMOA 1CSKA 2F2XA 1NYGA 2H8HA 1OPLA 5IHNA 1UTIA 2ED0A 1U3OA 2HCKA 1GL5A 2PNIA 1VYUA 1HD3A 3VS3A 1ABQA 2NUZA 2V1QA 2D1XA 2L3SA 1LCKA 2VKNA 3VS6A 4DEXA 4D8KA 3A98A 1YN8A 2ROLA 2LQNA 2JTEA 2EGEA 2ED1A 4OMMA 3GBQA 1A0NB 5IH2A 2KRNA 2CSIA 2KYBA 2P4RA 3TSWA 4Y92A 3REAB 2AKLA 2XMFA 1RI9A 3EHRA 3I9QA 2A36A 1SSHA 4AFZC 2LX7A 1GCQC 2DX1A 1J3TA 2JMCA 2K6DA 4OMQA 2FG0A 3THKA 3M0RA 2HBWA 3EG2A 4RTZA 1UDLA 1W1FA 4RTTA 2DL8A 1PKTA 1WYXA 2FO0A 4OMPA 4WCIA 4J9CA 2LMJA 2MCNA 1UG1A 4JZ4A 1PRLC 2ESWA 3U23A 4CC7A 1YNZA 1SPKA 2K79A 2A08A 2GNCA 1TUDA 2KT1A 2J7IA 2KYMA 2KBTA 1WXTA 3IQLA 3VS1A 2JM8A 5FWBA 3O5ZA 4CC4B 2EQIA 4LNPA 2J6OA 1T3SA 2CREA 2HSPA 3UA6A 1YWPA 2C0OA 1NM7A 2B86A 4FSSA 2AZVA 3VS5A 1YCSB 2GTOA 1EFNA 4RTUA 2GGRA 1UUEA 1Y0MA 2MIOA 1SEMA 2JMAA 1XOVA 1PNJA 1AVZC 4AG2C 1AWXA 2DA9A 1YP5A 3M0SA 3I35A 3PVQA 2DRKA 1NEGA 2DJQA 2CDTA 2EGCA 5EC7A 1ZSGA 2GQIA 1GBRA 1ZUYA 4OMNA 2DILA 2SRCA 2EW3A 1ABOA 1WFWA 2AZSA 2IIMA 2LNHB 4JZ3A 4RUGA 2G6FX 2EVRA 5L23A 1K0SA 4RTYA 2YT6A 2VVKA 2L2PA 3SHWA 2HDAA 2KNBB 1WXBA 3VRYA 1JO8A 2JS2A 2E5KA 1TG0A 1K4US 1U06A 1OOTA 1MV0B 3VS2A 1GBQA 2F2VA 1RLQC 3RBBB 2K9GA 4J9FA 5HCKA 2FRWA 2DM1A 1FYNA 2DL4A 2LJ1A 5I11A 2GTJA 1X2KA 2O9VA 3FJ5A 3VS0A 3EG1A 4HCKA 4HXJA 3TVTA 2YUQA 2DL3A 4J9HA 1B3QA 4J9GA 1OV3A 1WI7A 4AFUC 2X3WD 4D8DA 1AZGB 1YWOA 3NPFA 1WXUA 1TUCA 1ZX6A 3EG3A 2O31A 2O2OA 1H8KA 1AOJA 3TSZA 2J06A 4HVUA 2M51A 1AWOA 2YSQA 3NHNA 3NGPA 4KRTA 1M3BA 1SRMA 1IO6A 3SEMA 4JJDA 2JS0A 2EYYA 2ABLA 4Z89A 2RPNA 2BZYA 2F2WA 1WLPB 1NLOC 2KROA 3H0HA 3VS4A 1I1JA 2DVJA 1K0XA 2JXBA 1NYFA 1RLPC 2BZXA 2CUBA 3C0CA 3UF4A 2LJ0A 4JJCA 1E6HA 3M0PA 1M3AA 2K7AA 1PKSA 1ARKA 1M27C 1GCPA 2A37A 2RQRA 1W6XA 3VS7A 3R6NA 4ESRA 1G83A 2AK5A 1UE9A 3JV3A 1JXOA 1QLYA 4K11A 4AG1C 2SEMA 2CUDA 2YUOA 2O9SA 2EYWA 1V1CA 4RTVA 1I07A 1KFZA 2L0AA 1ZBJA 2O88A 4JPBW 1QWFA 1PWTA 1NEBA 1VYTA 3I5RA 1QCFA 1WIEA 1UGVA 1Y57A 2BTTA 3EHQA 2V1RA 5IXFA 1E7OA 2A28A 2JM9A 4OMLA 2C0TA 2DL5A 4RTWA 1K1ZA 2FEIA 2ROTA 2NWMA 3PE0A 3REBB 1X6GA 2K3BA 3M0QA 4QT7A 2D8HA 1T3LA 1VYVA 2DYBA 1X69A 2K2MA 4J9DA 1ZUUA 1AEYA 1WDXA 2KXDA 1KSWA 2DF6A 2HEQA 3QWXX 2KR3A 3NMZC 3QWYA 4X1VA 2L3PA 1GFCA 1U5SA 4DEYA 1X27A 2PZ1A 3EG0A 2LP5A 1GRIA 1MUZA 1KJWA 3M0TA 1KIKA 2LQWA 2EYXA 4F17A 2L3QA 2KT8A 4J9EA 4EIKA 1SHGA 1S1NA 4HVWA 1NG2A 1SRLA 3ZL7C 2YUNA 2OI3A 4RTXA 1CKBA 4LUEA 4E6RA 5GJVB 2M0YA 1GCQA 2MOXA 5IHIA 2QDLA 4F16A 4LN2A 2DBMA 1X6BA 2DRMA 2YUPA 2KE9A 4LUDA 1OEBA 1BBZA 2OAWA 4GBQA 2KGTA 4Z8AA 3UA7A 3M0UA 1BK2A 2CSQA 2RNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JXM A;  3KFV A;  4JJB A;  5FW9 A;  1G2B A;  1RUW A;  3CQT A;  1T0H A;  2DL7 A;  1PRM C;  3H41 A;  2OJ2 A;  1QWE A;  5IHK A;  4J9I A;  3ULR B;  5GJW B;  3H0F A;  2LCS A;  1VA7 A;  1ZLM A;  1HJD A;  4OMO A;  3UAT A;  4R0K A;  1AD5 A;  2CT4 A;  4J9B A;  2CT3 A;  4Z88 A;  2D0N A;  1H92 A;  1JQQ A;  2EKH A;  1PHT A;  2JW4 A;  1K9A A;  1AWJ A;  1WA7 A;  2C0I A;  2J05 A;  2KXC A;  4M4Z A;  3RNJ A;  2BZ8 A;  1UJ0 A;  1UFF A;  3LH5 A;  2EBP A;  1UHF A;  1GFD A;  4AFS C;  2RQW A;  4CC2 A;  1X2Q A;  2KRS A;  2PTK A;  3VRZ A;  1ZUK A;  1JU5 C;  1X43 A;  1W70 A;  1M30 A;  2J6F A;  3H0I A;  2CH4 A;  5IXB A;  1H3H A;  1Z9Z A;  2KEA A;  3I5S A;  2EYZ A;  2RN8 A;  2RQT A;  4LE9 A;  2RQU A;  3PVL A;  4IIO A;  4ORZ A;  1UJY A;  2FPD A;  1AWW A;  2I0N A;  2VWF A;  4ZNX A;  2EPD A;  2CH4 W;  1BB9 A;  2LZ6 B;  4F14 A;  2RF0 A;  5ECA A;  1BU1 A;  2DNU A;  4AFQ C;  2EGA A;  2ENM A;  2FPE A;  2X3X D;  2ECZ A;  2JT4 A;  3EGU A;  4IIM A;  1N5Z A;  1K76 A;  1Z9Q A;  1M8M A;  1AZE A;  1T0J A;  4CC3 A;  1I0C A;  1QKW A;  1FMK A;  1NLP C;  2KRM A;  1QKX A;  2DE0 X;  1SHF A;  5I22 A;  2AKK A;  1WX6 A;  1OPK A;  4GLM A;  2FPF A;  1CKA A;  1MV3 A;  2DBK A;  2W0Z A;  1UEC A;  2D8J A;  2RMO A;  2W10 A;  5FWC A;  2YDL A;  1JEG A;  1E6G A;  4A63 B;  2DLP A;  2J6K A;  4HVV A;  1B07 A;  2GBQ A;  2FRY A;  2LJ3 A;  1HSQ A;  1M3C A;  1UHC A;  2RQV A;  2DMO A;  1CSK A;  2F2X A;  1NYG A;  2H8H A;  1OPL A;  5IHN A;  1UTI A;  2ED0 A;  1U3O A;  2HCK A;  1GL5 A;  2PNI A;  1VYU A;  1HD3 A;  3VS3 A;  1ABQ A;  2NUZ A;  2V1Q A;  2D1X A;  2L3S A;  1LCK A;  2VKN A;  3VS6 A;  4DEX A;  4D8K A;  3A98 A;  1YN8 A;  2ROL A;  2LQN A;  2JTE A;  2EGE A;  2ED1 A;  4OMM A;  3GBQ A;  1A0N B;  5IH2 A;  2KRN A;  2CSI A;  2KYB A;  2P4R A;  3TSW A;  4Y92 A;  3REA B;  2AKL A;  2XMF A;  1RI9 A;  3EHR A;  3I9Q A;  2A36 A;  1SSH A;  4AFZ C;  2LX7 A;  1GCQ C;  2DX1 A;  1J3T A;  2JMC A;  2K6D A;  4OMQ A;  2FG0 A;  3THK A;  3M0R A;  2HBW A;  3EG2 A;  4RTZ A;  1UDL A;  1W1F A;  4RTT A;  2DL8 A;  1PKT A;  1WYX A;  2FO0 A;  4OMP A;  4WCI A;  4J9C A;  2LMJ A;  2MCN A;  1UG1 A;  4JZ4 A;  1PRL C;  2ESW A;  3U23 A;  4CC7 A;  1YNZ A;  1SPK A;  2K79 A;  2A08 A;  2GNC A;  1TUD A;  2KT1 A;  2J7I A;  2KYM A;  2KBT A;  1WXT A;  3IQL A;  3VS1 A;  2JM8 A;  5FWB A;  3O5Z A;  4CC4 B;  2EQI A;  4LNP A;  2J6O A;  1T3S A;  2CRE A;  2HSP A;  3UA6 A;  1YWP A;  2C0O A;  1NM7 A;  2B86 A;  4FSS A;  2AZV A;  3VS5 A;  1YCS B;  2GTO A;  1EFN A;  4RTU A;  2GGR A;  1UUE A;  1Y0M A;  2MIO A;  1SEM A;  2JMA A;  1XOV A;  1PNJ A;  1AVZ C;  4AG2 C;  1AWX A;  2DA9 A;  1YP5 A;  3M0S A;  3I35 A;  3PVQ A;  2DRK A;  1NEG A;  2DJQ A;  2CDT A;  2EGC A;  5EC7 A;  1ZSG A;  2GQI A;  1GBR A;  1ZUY A;  4OMN A;  2DIL A;  2SRC A;  2EW3 A;  1ABO A;  1WFW A;  2AZS A;  2IIM A;  2LNH B;  4JZ3 A;  4RUG A;  2G6F X;  2EVR A;  5L23 A;  1K0S A;  4RTY A;  2YT6 A;  2VVK A;  2L2P A;  3SHW A;  2HDA A;  2KNB B;  1WXB A;  3VRY A;  1JO8 A;  2JS2 A;  2E5K A;  1TG0 A;  1K4U S;  1U06 A;  1OOT A;  1MV0 B;  3VS2 A;  1GBQ A;  2F2V A;  1RLQ C;  3RBB B;  2K9G A;  4J9F A;  5HCK A;  2FRW A;  2DM1 A;  1FYN A;  2DL4 A;  2LJ1 A;  5I11 A;  2GTJ A;  1X2K A;  2O9V A;  3FJ5 A;  3VS0 A;  3EG1 A;  4HCK A;  4HXJ A;  3TVT A;  2YUQ A;  2DL3 A;  4J9H A;  1B3Q A;  4J9G A;  1OV3 A;  1WI7 A;  4AFU C;  2X3W D;  4D8D A;  1AZG B;  1YWO A;  3NPF A;  1WXU A;  1TUC A;  1ZX6 A;  3EG3 A;  2O31 A;  2O2O A;  1H8K A;  1AOJ A;  3TSZ A;  2J06 A;  4HVU A;  2M51 A;  1AWO A;  2YSQ A;  3NHN A;  3NGP A;  4KRT A;  1M3B A;  1SRM A;  1IO6 A;  3SEM A;  4JJD A;  2JS0 A;  2EYY A;  2ABL A;  4Z89 A;  2RPN A;  2BZY A;  2F2W A;  1WLP B;  1NLO C;  2KRO A;  3H0H A;  3VS4 A;  1I1J A;  2DVJ A;  1K0X A;  2JXB A;  1NYF A;  1RLP C;  2BZX A;  2CUB A;  3C0C A;  3UF4 A;  2LJ0 A;  4JJC A;  1E6H A;  3M0P A;  1M3A A;  2K7A A;  1PKS A;  1ARK A;  1M27 C;  1GCP A;  2A37 A;  2RQR A;  1W6X A;  3VS7 A;  3R6N A;  4ESR A;  1G83 A;  2AK5 A;  1UE9 A;  3JV3 A;  1JXO A;  1QLY A;  4K11 A;  4AG1 C;  2SEM A;  2CUD A;  2YUO A;  2O9S A;  2EYW A;  1V1C A;  4RTV A;  1I07 A;  1KFZ A;  2L0A A;  1ZBJ A;  2O88 A;  4JPB W;  1QWF A;  1PWT A;  1NEB A;  1VYT A;  3I5R A;  1QCF A;  1WIE A;  1UGV A;  1Y57 A;  2BTT A;  3EHQ A;  2V1R A;  5IXF A;  1E7O A;  2A28 A;  2JM9 A;  4OML A;  2C0T A;  2DL5 A;  4RTW A;  1K1Z A;  2FEI A;  2ROT A;  2NWM A;  3PE0 A;  3REB B;  1X6G A;  2K3B A;  3M0Q A;  4QT7 A;  2D8H A;  1T3L A;  1VYV A;  2DYB A;  1X69 A;  2K2M A;  4J9D A;  1ZUU A;  1AEY A;  1WDX A;  2KXD A;  1KSW A;  2DF6 A;  2HEQ A;  3QWX X;  2KR3 A;  3NMZ C;  3QWY A;  4X1V A;  2L3P A;  1GFC A;  1U5S A;  4DEY A;  1X27 A;  2PZ1 A;  3EG0 A;  2LP5 A;  1GRI A;  1MUZ A;  1KJW A;  3M0T A;  1KIK A;  2LQW A;  2EYX A;  4F17 A;  2L3Q A;  2KT8 A;  4J9E A;  4EIK A;  1SHG A;  1S1N A;  4HVW A;  1NG2 A;  1SRL A;  3ZL7 C;  2YUN A;  2OI3 A;  4RTX A;  1CKB A;  4LUE A;  4E6R A;  5GJV B;  2M0Y A;  1GCQ A;  2MOX A;  5IHI A;  2QDL A;  4F16 A;  4LN2 A;  2DBM A;  1X6B A;  2DRM A;  2YUP A;  2KE9 A;  4LUD A;  1OEB A;  1BBZ A;  2OAW A;  4GBQ A;  2KGT A;  4Z8A A;  3UA7 A;  3M0U A;  1BK2 A;  2CSQ A;  2RNA A; 
#chains in the Genus database with same CATH topology
 1JXM A;  4JJB A;  2EQJ A;  3CQT A;  1PRM C;  5C6S A;  1IHV A;  3H41 A;  1QWE A;  4C0G A;  3OYC A;  2CKK A;  4OMO A;  3UAT A;  2JUF A;  4J9B A;  4Z88 A;  5GAM f;  2D0N A;  2F5T X;  3LWI A;  4PJO B;  2B8A A;  1PHT A;  2JW4 A;  2LVM A;  3RNJ A;  2E3I A;  5LJ3 j;  1UFF A;  2CYZ B;  2HKN A;  1GFD A;  2Y4X A;  2KRS A;  5GAO r;  1ZUK A;  1VOM A;  2WSF E;  3OS1 A;  3H0I A;  1VQN T;  2CH4 A;  2DXT A;  3JSC A;  4X9C A;  4ZTJ A;  2RQU A;  4IIO A;  4MDX A;  4PJO F;  4OMF B;  2FPD A;  4M7A E;  4ZNX A;  1MMG A;  4J6X A;  1N6A A;  1HK9 A;  2ECZ A;  4ZN3 A;  3E1S A;  1M8M A;  4CC3 A;  1I0C A;  4FYY B;  4HCZ A;  3CC2 A;  5GAN e;  3QXE B;  4FT4 A;  1M90 C;  1OU9 A;  2X4J A;  1JJ2 S;  3OMG A;  5GAN h;  1TUG B;  1Q86 C;  3CCJ Q;  3CCV T;  1SHF A;  5I22 A;  2XK0 A;  1WX6 A;  4OB2 B;  5LJ3 e;  3CME T;  2FPF A;  4PJO A;  3CCQ A;  3T9N A;  2W10 A;  2YDL A;  1E6G A;  5GMK h;  4ZGE B;  2IVW A;  4PLL A;  1B07 A;  4C5G A;  2FRY A;  4B6M A;  3RKY A;  5GAO q;  2RQV A;  2ZGW A;  1CSK A;  1NYG A;  1O9S A;  5LJ3 d;  1YJW A;  2COZ A;  3HP9 A;  2RD1 A;  3CCS Q;  2PNI A;  2QA4 Q;  4C0F A;  3VS3 A;  2K4Y A;  1ABQ A;  2NUZ A;  3CC4 Q;  2VKN A;  1D1C A;  3SDZ A;  4D8K A;  2GQV A;  8ATC B;  2LT1 A;  1YJ9 A;  1VQ7 T;  5AYF A;  5GMK m;  4TVR A;  5KE2 A;  3RES A;  2CP6 A;  1UB4 A;  3PIP A;  5GAN 8;  3I56 A;  2HMA A;  4J7F A;  1I5L A;  1TOV A;  1JB0 E;  1XQH A;  4J5Y A;  3CBO A;  2KYB A;  2XHC A;  4E7K A;  5CQX A;  2XMF A;  2A36 A;  2MWP A;  2JMC A;  4JS4 A;  2E65 A;  1AHJ B;  3M0R A;  3MCA B;  1UDL A;  4RCC A;  1HYO A;  1W1F A;  2DL8 A;  4QQD A;  1G3T A;  2D9T A;  4LDY A;  5KYX A;  2KAF A;  5LL6 S;  3G6E Q;  4OMP A;  1PM3 A;  1UG1 A;  1WZO A;  4JZ4 A;  1ZSZ C;  2ESW A;  1D0X A;  4CC7 A;  2A08 A;  1TUD A;  2MWO A;  1LJO A;  2FHD A;  1VQO Q;  3L2R A;  4J6Y A;  4E7L A;  3QZ5 B;  1R0B G;  3LGL A;  1T3S A;  2XU8 A;  4M75 C;  1MMD A;  3RMS A;  2QGG A;  4M78 E;  1YWP A;  4LDW A;  1WHL A;  3VS5 A;  1YCS B;  3V7C A;  1YIT T;  3OSV A;  4LDX A;  3GP8 A;  2EQU A;  1UUE A;  2RJF A;  1MMA A;  5KYU A;  1BCO A;  2BE9 B;  1VQL A;  1XOV A;  1KG1 A;  2QTX A;  1VQ5 T;  4IUP A;  1Y96 A;  4AG2 C;  2DA9 A;  1QVG S;  1YP5 A;  5CAI A;  3PFS A;  5EC7 A;  2GQI A;  3OSS C;  3V7S A;  1UEB A;  2KDS A;  5DLQ E;  4OMN A;  4PFZ A;  2EQM A;  3HRU A;  1ABO A;  1TSF A;  5FU7 C;  1PG5 B;  3HFO A;  4RUG A;  2KY9 A;  4OF1 A;  1NJI C;  4RTY A;  1ZSZ A;  1ZA2 B;  2NUT B;  1QVG A;  2X51 A;  5CQY A;  3EGD B;  2HDA A;  3CXC P;  3OW2 S;  3M57 A;  4N0A C;  2E5K A;  2DIG A;  1S72 A;  5D6Y A;  2CZ6 B;  1U06 A;  1MV0 B;  3VS2 A;  5GAN j;  4V2S A;  1K8A R;  4J9F A;  3URG A;  4CI0 C;  1QVP A;  4FW2 A;  3OS2 A;  2DL4 A;  5KYU B;  1Q7Y R;  1YCY A;  3DB4 A;  4ATO A;  4ZGJ B;  3PT9 A;  1PD1 A;  4BDZ A;  2L8D A;  4J9H A;  4JUV A;  3OYI A;  4D8D A;  4ZTF A;  4OP0 A;  4BAC A;  2O31 A;  3H9N A;  2DET A;  1AOJ A;  2J06 A;  4HVU A;  4EMH A;  1RAH B;  4J8O A;  3MEV A;  4A4K A;  1Y07 A;  3PIO A;  3NGP A;  4KRT A;  1VIE A;  4JJD A;  5GAO n;  4C92 G;  4C8Q F;  5GMK i;  1KC8 C;  2DEQ A;  2KRO A;  2F5K A;  2MYS A;  4PJO E;  1M2V A;  1I1J A;  2DVJ A;  4AT1 B;  2JXB A;  2LQ8 A;  2KK4 A;  4C5I A;  2CUB A;  1QVF S;  3HKS A;  1I81 A;  4X34 A;  2RI5 A;  1D1B A;  2VB6 A;  3VU3 C;  3QUI A;  1VQ6 Q;  3JB9 I;  3KUF A;  3MEU A;  5FRN A;  3N5B B;  3L42 A;  3EAE A;  3EFS A;  1NBE B;  3G4S T;  4M7A G;  1BI3 A;  3I56 Q;  2A7Y A;  3PMT A;  3CCL A;  2CUD A;  3O8V A;  5LJ3 h;  4XK8 E;  1V1C A;  4FYX B;  1I07 A;  4RTV A;  4A53 A;  2L0A A;  5HKC A;  1W2B A;  2DYI A;  2O88 A;  4JPB W;  1Y96 B;  1NEB A;  3QKJ A;  2V1R A;  3SB2 A;  2QI2 A;  4C8Q A;  2NUP B;  3CCE T;  2EIF A;  5GAM d;  3RMQ A;  3OBY A;  2ROT A;  2CZ1 B;  5HK0 A;  3PE0 A;  2K3B A;  3EH2 A;  2E6N A;  4EMG A;  2RHY A;  4QT7 A;  3C95 A;  1YHQ A;  1VQO A;  2DJZ A;  1HXD A;  2K2M A;  2EJG A;  3QZ9 B;  3OYD A;  1S72 Q;  1ZUU A;  4A4H A;  1AEY A;  2Z0W A;  2A0F B;  3CPW A;  4PLI A;  3JB9 F;  3BE3 A;  2DF6 A;  2HEQ A;  4X1V A;  2VXE A;  1UGR B;  1Q82 U;  1U5S A;  3KXT A;  2QA4 T;  3J7A F;  2LP5 A;  1GRI A;  3ZBD A;  1VQL Q;  3QII A;  1VQP Q;  2CP2 A;  2ATC B;  2EJ9 A;  3M0T A;  1KIK A;  2EYX A;  2L3Q A;  3MP1 A;  4F7U E;  2E1H A;  3VKI A;  4EIK A;  3LW5 E;  1SHG A;  2VUB A;  1SRL A;  4EMK B;  1PSF A;  3FC3 A;  4XTX A;  1ZQ1 A;  1KK7 A;  4RTX A;  3SWN A;  4AMC A;  2E10 A;  3JCM V;  2KMT A;  2QDL A;  4F16 A;  3ZEH A;  4FYW B;  5J26 A;  4M75 D;  2YUP A;  4ANJ A;  3NFC A;  4LUD A;  5LJ5 j;  2GCX A;  2QXF A;  2HNI A;  2KSS A;  4R55 A;  5A0G A;  1YJN A;  1RAC B;  1BKB A;  4LXC A;  2PVG B;  1VQM T;  2E6Z A;  2OAW A;  4Z8A A;  3UA7 A;  1YI2 Q;  2M0O A;  4XU1 A;  2IG0 A;  3NTI A;  5FW9 A;  5CCA A;  3EGX B;  3CMA T;  1XNI A;  3OW2 A;  2OJ2 A;  4LDV A;  3G1J A;  5IHK A;  3ULR B;  1YJW T;  2LCS A;  2RB6 A;  2EWN A;  5D6W A;  1ZLM A;  1HJD A;  4R0K A;  2O4X A;  2CT4 A;  3CCL T;  1KD1 C;  2L5Q A;  2HBP A;  3CD6 Q;  3GLX A;  4M7A F;  2ZAE A;  1K8A C;  4PJL A;  2V8I A;  1K9A A;  3HPW A;  4B9W A;  1AWJ A;  2C0I A;  2KXC A;  3VYH B;  5FU6 C;  1QVG P;  2BZ8 A;  1UJ0 A;  5GMK j;  4ZN1 A;  1UHF A;  3TQ7 P;  2HSE B;  4E7J A;  4DBH A;  2PTK A;  4F7U G;  3ME9 A;  3VRZ A;  1M30 A;  1MGQ A;  4A4E A;  4PJO D;  5IXB A;  1BCM A;  4M77 D;  3CC2 T;  1Z9Z A;  3I5S A;  3S6W A;  1BIA A;  3TU4 K;  2RK2 A;  3PVL A;  1M2V B;  3CCQ Q;  2NUP A;  1BU1 A;  3FIF A;  2DNU A;  2EGA A;  4KGV B;  2X3X D;  2XID A;  3X24 B;  2JT4 A;  2RK1 A;  1RAG B;  2QQS A;  2MPX C;  1K76 A;  3ASK A;  4DBF A;  5GMK e;  1D09 B;  4XU3 A;  4XAX B;  2H3J A;  1VQ6 A;  2AKK A;  2QA4 A;  3RKX A;  4GLM A;  2D8J A;  1WHM A;  1JEG A;  2WSC E;  4HCC A;  2QTV A;  4M77 F;  3CCU T;  4LD9 K;  4HVV A;  4N4I A;  2GBQ A;  2QGF B;  3UDC A;  1HSQ A;  3OYN A;  1N9S A;  1M3C A;  3PTA A;  5CVI A;  2PUK B;  2RJE A;  4FU6 A;  2DD5 A;  1UTI A;  2JZ2 A;  5HK3 A;  1WPY A;  1LNX A;  3OQ5 A;  1VYU A;  1HD3 A;  2V1Q A;  4M7A D;  2D1X A;  2L3S A;  2HZY A;  1LCK A;  4L5G A;  5J39 A;  3CCM T;  2MAM A;  1MMN A;  1G3S A;  2NLU A;  2ZPE B;  1YN8 A;  2E12 A;  5CKH A;  4OMM A;  1H64 1;  4MDW A;  4M78 C;  3VJP A;  4M7D G;  5IH2 A;  4JS5 A;  2KRN A;  2P4R A;  2P0K A;  1QCN A;  4PFP A;  3BDU A;  4Y92 A;  4FT2 A;  4WTO B;  2XKO C;  1VQ8 T;  3CC4 A;  1M4Z A;  2EYQ A;  4C8Q E;  4OMQ A;  4O5V A;  1MNE A;  1D3B A;  2HBW A;  3OYK A;  2DXU A;  3WXM B;  2DTO A;  3OB9 A;  4BE1 A;  5GAM h;  2LDM A;  3EFO A;  2FO0 A;  3M54 A;  2DTH A;  2EQK A;  2M9U A;  3FDR A;  3U23 A;  2DXB A;  2K79 A;  3TRE A;  1VQ7 Q;  2RM4 A;  1G8X A;  2KT1 A;  2J7I A;  1M2O A;  2RJD A;  2KYM A;  5LJ5 e;  5FWB A;  1VQK T;  2EQI A;  4LNP A;  2YRV A;  5LJ5 h;  2DK3 A;  2J6O A;  2HSP A;  3JRZ A;  4M75 G;  3V8L A;  1VQM Q;  2AZV A;  3JB9 H;  3OS5 A;  2JN0 A;  3E9G A;  3CBP A;  3CCQ T;  3DLL A;  5GAN 4;  3H6Z A;  5CKD A;  2VV5 A;  2BUD A;  1YJN T;  3A8L B;  1PNJ A;  3EG9 B;  2K5L A;  3CMA Q;  1AWX A;  4VUB A;  4C8Q D;  3PVQ A;  1PC0 A;  2CDT A;  3V8J A;  3AHU A;  1ZSG A;  1OX8 A;  3E2U A;  2YRC A;  2DIL A;  5A2Q E;  4ELY C;  3RER A;  2MMP A;  3CCU Q;  2AZS A;  3S3O A;  3JCM f;  2HAX A;  1K0S A;  3M53 A;  1O75 A;  3G71 T;  3OYM A;  5GAM j;  2KNB B;  3NTK A;  3VRY A;  3G71 A;  2QQB A;  1JO8 A;  3MP8 A;  2CP7 A;  4PJO C;  1GBQ A;  1ZA1 B;  4KBM B;  4L59 A;  3RBB B;  3CCJ T;  2LX9 A;  2K9G A;  3SWN B;  3CCV Q;  4M75 E;  5HCK A;  3GIB A;  3LX7 A;  4LD6 A;  2DM1 A;  1FYN A;  3MEA A;  1G3W A;  2ZPF B;  3L2Z A;  2L89 A;  4IKF A;  3JCM e;  1QQJ A;  1X2K A;  2O9V A;  3EG1 A;  3EG9 A;  3M4G A;  4HXJ A;  3X20 B;  3HFN A;  3FJP A;  1OV3 A;  4M7D A;  5IN1 A;  1YWO A;  4XU2 A;  1ZX6 A;  3FB9 A;  3D7S B;  2YSQ A;  3NHN A;  2FYK A;  1IO6 A;  3M58 A;  1TS9 A;  1QP2 A;  4ELZ C;  5DM7 R;  1TTH B;  2JS0 A;  2ABL A;  2RPN A;  1WLP B;  4M7D C;  5GAN 2;  1BYM A;  1MND A;  1RI0 A;  1UGP B;  1K0X A;  3UPU A;  1R8O B;  4BE0 A;  5C0M A;  1NYF A;  1N8R U;  2BZX A;  2MF2 A;  5A0L A;  2CS7 A;  3X25 B;  4XU0 A;  2LJ0 A;  4JJC A;  1E6H A;  3M0P A;  1M3A A;  3FEO A;  1OU8 A;  1I8F A;  4IUU A;  5GAN d;  3A8O B;  4IUT A;  3VS7 A;  3R6N A;  2AT1 B;  1Q82 R;  4M77 B;  3GOX A;  2GFU A;  4JRK A;  4M7D E;  1EZZ B;  1YBY A;  4FIB A;  2CP3 A;  5KCH A;  2RHX A;  3Q1J A;  1VQ8 Q;  2QEX T;  2O9S A;  2EYW A;  2YXY A;  1ZBJ A;  2HQH A;  3R6O A;  1QCF A;  3MPU B;  1UGV A;  2LT4 A;  3EHQ A;  1NJI U;  5IXF A;  2DXC A;  1M5Q 1;  2A28 A;  3LH0 A;  2ZPG B;  4D6W A;  3EFO B;  1SG5 A;  9ATC B;  4RTW A;  1R0C B;  3JCM X;  2FEI A;  2K3X A;  3TEE A;  3QYG B;  1WQ7 A;  3S3M A;  3OS0 A;  2JVV A;  1K9M R;  1K9M U;  2HQX A;  4F7U B;  2D8H A;  2DKG A;  3G71 Q;  1VYV A;  2DYB A;  3JCM J;  2P0P A;  2PVO B;  4J9D A;  4MZP A;  2F69 A;  3JCM c;  1QMC A;  1RAD B;  3NMZ C;  3QWY A;  2L3P A;  2V8J A;  1FMV A;  4DEY A;  2X4W A;  3EG0 A;  2LC4 A;  2LQW A;  1QP3 A;  3JCM Q;  2KT8 A;  1TXQ A;  3OMC A;  2K57 A;  1LOJ A;  1N8R C;  1S1N A;  1NG2 A;  5M9O A;  1VQ4 Q;  1X6O A;  2YUN A;  1U1S A;  3BFM A;  2OI3 A;  1CKB A;  3HSB A;  4LUE A;  2QYZ A;  5GJV B;  2MI6 A;  4NS5 A;  1GCQ A;  3JCM h;  4LN2 A;  4E7S A;  1LVK A;  4C92 B;  4QVZ A;  1VQL T;  3CCU A;  1Q81 C;  2F1L A;  1BBZ A;  1D3B B;  4GBQ A;  2KGT A;  1YJ9 Q;  6AT1 B;  3HHT B;  3M0U A;  4XTZ A;  3QHS A;  1BK2 A;  2RNA A;  3JCM W;  1W2B S;  3RDV A;  4DBR A;  1T0H A;  2DL7 A;  5GMK l;  1KHI A;  3DB3 A;  2M1H A;  3NTH A;  2FZG B;  1TH7 A;  1VA7 A;  3OYG A;  4MML A;  1H92 A;  4FCY A;  2EKH A;  5LJ5 g;  2J05 A;  4M4Z A;  4M7D B;  2OTL T;  5CKB A;  3CC7 Q;  2EBP A;  4PJN A;  3J81 E;  4AFS C;  2RQW A;  3X28 B;  4CC2 A;  2QEX Q;  1X2Q A;  4XTY A;  1RAB B;  1VQ8 A;  1X43 A;  4MZM A;  1W70 A;  1VQN Q;  2FL7 A;  3M59 A;  1Q95 G;  3OYH A;  4Q5W A;  2VC8 A;  1H3H A;  4JJN K;  2EYZ A;  2RQT A;  1M1F A;  4LE9 A;  1KC8 U;  2QG9 B;  3CC4 T;  1VQ6 T;  4Y91 A;  4JRP A;  1UJY A;  1AWW A;  4BY6 B;  2CH4 W;  7AT1 B;  2LZ6 B;  4F14 A;  2QDY B;  2RF0 A;  4AFQ C;  1D0Z A;  1U8R A;  1Y71 A;  3EGU A;  3DLM A;  4IIM A;  3JCM g;  1Z9Q A;  1XTD A;  1AZE A;  1QCO A;  1QKW A;  1NLP C;  4ME7 A;  4F04 B;  2KRM A;  3LYI A;  1QKX A;  2OTJ T;  4DOV A;  3M55 A;  1K73 C;  1W4S A;  1OPK A;  1MV3 A;  2DBK A;  3LGF A;  4BB7 A;  2RMO A;  4O6J A;  3QBY A;  5FWC A;  1OX9 A;  3M9Q A;  3CME A;  3OYB A;  4C0Z A;  1R77 A;  4II1 A;  1VUB A;  2LJ3 A;  1Q86 U;  2DFU A;  2F2X A;  1PCX A;  2H8H A;  2RJC A;  4RCB A;  2E70 A;  5IHN A;  1RAF B;  4C0D B;  2XDP A;  4OVA A;  2ED0 A;  3E19 A;  1X01 A;  1LPL A;  2LCC A;  2E3H A;  3PMI A;  2FB7 A;  3F70 A;  3VS6 A;  3S3N A;  1BI2 A;  4M7D D;  2ZCF B;  3OYA A;  2FVU A;  1TU0 B;  2JTE A;  3L2Q A;  2K3Y A;  1P92 A;  2ED1 A;  1A0N B;  4Z02 A;  5KCO A;  1FWZ A;  1VQ5 Q;  3TSW A;  3CCM Q;  3REA B;  1K8A U;  3I9Q A;  2LNV A;  4DOW A;  3SD4 A;  1SSH A;  1TWB A;  3GPL A;  1JBM A;  3MKD A;  4PL6 A;  2I2L A;  1BI1 A;  3THK A;  4C92 E;  1M1K R;  3EG2 A;  4RTZ A;  3LLR A;  4RTT A;  4PJO G;  2CZ0 B;  2R58 A;  1C6V X;  1WYX A;  2O01 E;  4WCI A;  4J9C A;  5KYY B;  2LMJ A;  2MCN A;  1PRL C;  2R5A A;  1SPK A;  1VQ9 A;  1FXX A;  1XJW B;  5I2M A;  1ZSZ B;  2KBT A;  3IQL A;  3VS1 A;  3EGD A;  2JM8 A;  5CR2 A;  1QW1 A;  3O5Z A;  1WHJ A;  1OI1 A;  2FZC B;  2JTM A;  4JLG A;  4M7A A;  1B34 B;  1NM7 A;  2B86 A;  4FSS A;  5EG2 A;  2CZ7 B;  2PU9 B;  1G5V A;  1M1K U;  2GGR A;  1Y0M A;  2P0Q A;  2JJ9 A;  1PSE A;  5GAN 5;  1IB8 A;  1SEM A;  4QQG A;  1YIT A;  1SF9 A;  5D7U A;  4QVC A;  2V26 A;  5LJ5 f;  1DJ7 B;  3HRS A;  5IAY A;  2X4Y A;  4C8Q C;  3AT1 B;  2DRK A;  2DJQ A;  2QQR A;  1N27 A;  4C8Q B;  5GAO l;  3E9F A;  4M7A C;  3A8H B;  2CP0 A;  4EMK C;  4JDS A;  4M78 B;  1GBR A;  1ZUY A;  4IUV A;  1KD1 U;  4KGZ B;  3P8D A;  2SRC A;  2EW3 A;  3MET A;  4IUQ A;  1WFW A;  1JJ2 P;  2IIM A;  2DIQ A;  4JZ3 A;  2G6F X;  2COW A;  2EVR A;  3QYH B;  2ZPI B;  4C0D C;  3CMA A;  2E41 A;  2QAZ A;  1D1A A;  4JRI A;  2VVK A;  1YI2 A;  1UGS B;  2C06 A;  3QDF A;  3CBM A;  4XTU A;  3A5Z B;  5GAO p;  1WXB A;  4KT0 E;  2IPO B;  1V29 B;  4RMO A;  5I21 A;  1B34 A;  2P84 A;  1OZ2 A;  1K4U S;  1OOT A;  5LJ3 f;  4KH0 B;  1RLQ C;  5A0D A;  4NOY A;  5GAN 3;  4QVD A;  4L6V 5;  1NE8 A;  3OY9 A;  2LJ1 A;  3CPW S;  3GNF B;  4EPC A;  3OYF A;  3QO3 A;  3OYE A;  5GAN g;  2P4T A;  1I5O B;  2DL3 A;  1KQ2 A;  2YHT A;  4AFU C;  1WNL A;  1YIJ A;  2L3R A;  1M90 R;  2X3W D;  3NPF A;  1EIF A;  1WXU A;  2OTJ Q;  3EG3 A;  2AHJ B;  2O2O A;  3CCJ A;  1H8K A;  2RO0 A;  2M51 A;  4GLK A;  1N9R A;  3P8B B;  4IUR A;  2PQW A;  4M77 C;  3SEM A;  4OGE A;  3CCR T;  2EYY A;  4BI8 B;  4OB3 B;  3C4S A;  3BY7 A;  5FU6 B;  1VQK A;  3H0H A;  2RHU A;  3GNG A;  1IRX A;  4JRQ A;  1IXD A;  3EGX A;  2DAQ A;  2ZZD A;  4KUD K;  2KQW A;  3UF4 A;  3QJY A;  4PJM A;  5CKE A;  2K7A A;  1PKS A;  1ARK A;  1M90 U;  4PNO A;  2A37 A;  4M75 B;  4C8Q G;  2YRD A;  1D0Y A;  4ESR A;  2AK5 A;  3JV3 A;  4HA8 A;  4NL2 A;  3L1A A;  4K11 A;  4QQ6 A;  2MK5 A;  4KUL A;  3CD6 A;  3JCM P;  5CKF A;  2BKD N;  2M02 A;  3I55 T;  1RL2 A;  1QWF A;  4KUI A;  3I5R A;  1WIE A;  1Y57 A;  2BTT A;  1E7O A;  3HL8 A;  4J83 A;  2JM9 A;  4EDU A;  2C0T A;  3SWN C;  3HRT A;  5HY6 A;  3G6E A;  2X9H A;  3RKW A;  3REB B;  1Q81 R;  5FRM A;  1G3Y A;  5KH6 A;  4PFO A;  4P5N A;  3M0Q A;  1WHG A;  4OB0 B;  1UGQ B;  2XD0 A;  4WF2 A;  4N4H A;  5CO7 A;  2E4H A;  1M9S A;  2NUT A;  1NPR A;  5J3B A;  1WDX A;  1YHQ T;  1KSW A;  4M75 A;  4XTW A;  2JTF A;  1BI0 A;  2HQE A;  2LRQ A;  5IT9 E;  2YLB A;  1ACM B;  1GFC A;  2HD0 A;  4C92 F;  1MUZ A;  1KJW A;  4F17 A;  1K73 U;  3UT1 A;  5FU7 B;  4J9E A;  3MHX A;  2OTJ A;  4HVW A;  2XIC A;  2D0Q B;  3VUZ A;  3ER0 A;  1PD0 A;  4MZT A;  4E6R A;  5KYW B;  1BIB A;  2M0Y A;  2MOX A;  3BDL A;  2EFI A;  4BUG A;  4HT8 A;  3CCE Q;  2KE9 A;  1KC8 R;  1OEB A;  5I2S A;  2DTI A;  4JLI A;  5D6X A;  4E47 A;  3MJX A;  2CSQ A;  4J6W A;  3CCS T;  2DO3 A;  1H3Z A;  3RIR A;  1VQ4 A;  3FRN A;  5KYY A;  2DEU A;  3KFV A;  1G2B A;  1RUW A;  2RA2 A;  4FYV B;  4F7U F;  3JCM b;  2HL5 C;  4A54 A;  1WJR A;  4J9I A;  5GJW B;  3H0F A;  3HTR A;  2FZK B;  3JAM E;  3GF5 A;  3QG1 A;  4NL3 A;  1AD5 A;  2CT3 A;  3OYY A;  1Q7Y C;  3CD6 T;  2DZC A;  2VGM A;  2ZPB B;  1JQQ A;  3CCL Q;  4M7A B;  1WA7 A;  3JB9 J;  2OAU A;  5GAM e;  1K73 R;  5GAN f;  1Q86 R;  1IZ6 A;  1FX7 A;  1RAI B;  3LH5 A;  4J7I A;  4ZGD B;  2RHZ A;  4UC4 A;  1JU5 C;  4QKU A;  2X35 A;  3L2W A;  2J6F A;  4LDU A;  2KEA A;  3PGG A;  1YIJ T;  3G6E T;  1M8V A;  2RN8 A;  1SSF A;  1OQK A;  3EFR A;  4ORZ A;  4E7I A;  3QJ6 A;  2I0N A;  4M78 A;  2VWF A;  2EPD A;  2DD4 A;  1BB9 A;  2LQK A;  2RI3 A;  3X26 B;  4M77 G;  1VQO T;  2WAC A;  5ECA A;  4PJJ A;  2ENM A;  2FPE A;  2OX7 A;  4OGC A;  2VGN A;  3CCR Q;  1KQS A;  1N5Z A;  1VQN A;  1T0J A;  1RAE B;  1FMK A;  2K2V A;  2GFA A;  3WVD B;  1GXI E;  3PNW C;  2DE0 X;  1ZBX A;  4X9D A;  3OYL A;  1Y7X A;  1CKA A;  2W0Z A;  1UEC A;  4A63 B;  2DLP A;  4F7U A;  4FSX A;  2J6K A;  2K5F A;  1WJQ A;  4PKC C;  3M4Y A;  2EJF A;  1UHC A;  1IRE B;  1ZHI A;  2DMO A;  1OPL A;  3G4S A;  2JNG A;  1C0M A;  4A4F A;  4PK4 A;  1U3O A;  1VQ5 A;  3G7Z A;  2HCK A;  3CCM A;  1GL5 A;  1NPP A;  3CCE A;  2Y4Y A;  4E7H A;  1YJN Q;  5FLX E;  4DEX A;  1EX4 A;  2D6F A;  2QQ9 A;  2BIV A;  4BI4 A;  5DY9 A;  2COY A;  3A98 A;  2PVD B;  2ROL A;  2LQN A;  3UWN A;  2BE7 D;  2EGE A;  1QVF P;  2E64 A;  4MMK A;  3MEW A;  3GBQ A;  3SFM A;  1WGS A;  1KQS P;  2HKQ B;  1VQ9 Q;  2CSI A;  2AKL A;  3BW1 A;  1RI9 A;  3EHR A;  3DKM A;  3CC7 T;  2CP5 A;  5GAN 7;  4AFZ C;  1GCQ C;  2LX7 A;  2DX1 A;  1J3T A;  2K6D A;  4R56 A;  3RUX A;  2FG0 A;  2YWW A;  4HT9 A;  2YLC A;  4M75 F;  2QQA A;  4B9X A;  3MO8 A;  5CK9 A;  1PKT A;  5AT1 B;  1VQP A;  2O4X B;  2XDB A;  3C94 A;  1WJS A;  1YNZ A;  1B7T A;  1YIT Q;  2GNC A;  3M5A A;  3V8K A;  1I4K 1;  1WXT A;  1KHC A;  2VYT A;  3CEY A;  3QPH A;  4A4G A;  4CC4 B;  3CPF A;  3VYG A;  2CRE A;  1IGU A;  4M77 A;  3UA6 A;  3EH1 A;  4C92 D;  2C0O A;  1FMW A;  2JOY A;  4C5E A;  4HKE A;  2GTO A;  1YFN A;  4QW2 A;  1EFN A;  4RTU A;  2A3L A;  4KGX B;  1Q82 C;  3CXC S;  3JB9 D;  2MIO A;  3CCR A;  2JMA A;  3WVE B;  1AVZ C;  4DQ2 A;  1SKU B;  4N4G A;  3M0S A;  3I35 A;  3JB9 G;  2HL3 A;  1NEG A;  2EGC A;  2QAS A;  3CPW P;  2GF7 A;  3JCM d;  4M78 F;  5LJ5 d;  3QDR B;  4BD3 A;  2E5Q A;  3KBG A;  3RR6 A;  4N0A A;  2DER A;  1VIF A;  4RKU E;  2LNH B;  4E7Z A;  2WSE E;  3I55 A;  5L23 A;  3QSU A;  2DVE A;  2H3E B;  2YT6 A;  2LTO A;  2G3R A;  4M78 D;  2L2P A;  3SHW A;  2RI2 A;  1U1T A;  3VV0 A;  5GAN 6;  4XTV A;  3H8Z A;  3I56 T;  2JS2 A;  1YIJ Q;  2KI7 A;  1TG0 A;  4EMK A;  2EKO A;  2F2V A;  2FRW A;  2XDD A;  5KYW A;  1MHN A;  2OTL A;  1Q7Y U;  1WHK A;  5I11 A;  2GTJ A;  3FJ5 A;  4OB1 B;  1IGQ A;  3VS0 A;  1VQK Q;  3FLG A;  2VXF A;  1YI2 T;  1M1G A;  4HCK A;  2DZ9 A;  3TVT A;  2YUQ A;  4FM4 B;  1B3Q A;  4J9G A;  2XG8 D;  3L2V A;  3CC7 A;  1WI7 A;  4FL6 A;  1AZG B;  1VQ9 T;  1TUC A;  5GAM g;  8AT1 B;  4C92 A;  3OW2 P;  5KE3 A;  4KH1 B;  2Y90 A;  3TSZ A;  1AWO A;  1NJI R;  4RG8 A;  1M3B A;  1SRM A;  2PUO B;  5DLO A;  4DA4 A;  1WHH A;  4Z89 A;  2BZY A;  2F2W A;  3ZFJ A;  1NLO C;  4CRI A;  3VS4 A;  2EAY A;  4RG2 A;  3G4S Q;  2ZPH B;  1RLP C;  3P8H A;  3C0C A;  3CC2 Q;  4HCB A;  1M27 C;  2R57 A;  1VQM A;  1GCP A;  5KYN A;  2AIR B;  1WQW A;  2RQR A;  1W6X A;  2CGH A;  2VAS A;  5KYX B;  4BDY A;  3LWH A;  3A1P A;  1JRI A;  2M16 A;  1Q81 U;  2KVQ G;  1G83 A;  1UE9 A;  1JXO A;  4BI3 A;  5GAO m;  5FRO A;  1QLY A;  3OBW A;  1KD1 R;  3A8G B;  3OYJ A;  3CME Q;  4AG1 C;  2SEM A;  1IHW A;  2YUO A;  2XI9 A;  5CIU A;  2LCL A;  1KFZ A;  4E2F B;  4DBQ A;  1OUL A;  2QEX A;  1PWT A;  1VYT A;  1VQ4 T;  4Y28 E;  1YJ9 T;  3J80 E;  1NZ9 A;  1F1B B;  4M78 G;  1S72 T;  4OML A;  2DL5 A;  3L2U A;  2QK0 A;  1K1Z A;  2RHI A;  2NWM A;  1X6G A;  4YTL A;  1RAA B;  1VQ7 A;  3I55 Q;  3MP6 A;  1OYX A;  1T3L A;  1VQP T;  5LJ3 g;  1X69 A;  4M7D F;  1W2B P;  1OZ3 A;  4BY6 C;  2KXD A;  3VUB A;  3TCJ A;  3INZ A;  2OTL Q;  1C1A A;  3QWX X;  1K9M C;  2KR3 A;  4M77 E;  3CCV A;  1JJ2 A;  1M1K C;  1X27 A;  2PZ1 A;  4XQ3 A;  5L8R E;  4GY5 A;  3V7R A;  4C5H A;  1YHQ Q;  2V8K A;  1YJW Q;  1QVF A;  3A8M B;  4BE2 A;  1V76 A;  2K5I A;  3M56 A;  3CCS A;  2RH2 A;  3ZL7 C;  2DPP B;  1N8R R;  2NYS A;  3CXC A;  4FW1 A;  2X4X A;  5IHI A;  2R5M A;  2DBM A;  4C92 C;  1X6B A;  1AT1 B;  2DRM A;  1X75 C;  1KQS S;  3C12 A;  3OA6 A;  1KQ1 A; 
#chains in the Genus database with same CATH homology
 1JXM A;  3KFV A;  4JJB A;  5FW9 A;  1G2B A;  1RUW A;  3CQT A;  1T0H A;  2DL7 A;  1PRM C;  3H41 A;  2OJ2 A;  1QWE A;  5IHK A;  4J9I A;  3ULR B;  5GJW B;  3H0F A;  2LCS A;  1VA7 A;  1ZLM A;  1HJD A;  4OMO A;  3UAT A;  4R0K A;  1AD5 A;  2CT4 A;  4J9B A;  2CT3 A;  4Z88 A;  2D0N A;  1H92 A;  1JQQ A;  2EKH A;  1PHT A;  2JW4 A;  1K9A A;  1AWJ A;  1WA7 A;  2C0I A;  2J05 A;  2KXC A;  4M4Z A;  3RNJ A;  2BZ8 A;  1UJ0 A;  1UFF A;  3LH5 A;  2EBP A;  1UHF A;  1GFD A;  4AFS C;  2RQW A;  4CC2 A;  1X2Q A;  2KRS A;  2PTK A;  3VRZ A;  1ZUK A;  1JU5 C;  1X43 A;  1W70 A;  1M30 A;  2J6F A;  3H0I A;  2CH4 A;  5IXB A;  1H3H A;  1Z9Z A;  2KEA A;  3I5S A;  2EYZ A;  2RN8 A;  2RQT A;  4LE9 A;  2RQU A;  3PVL A;  4IIO A;  4ORZ A;  1UJY A;  2FPD A;  1AWW A;  2I0N A;  2VWF A;  4ZNX A;  2EPD A;  2CH4 W;  1BB9 A;  2LZ6 B;  4F14 A;  2RF0 A;  5ECA A;  1BU1 A;  2DNU A;  4AFQ C;  2EGA A;  2ENM A;  2FPE A;  2X3X D;  2ECZ A;  2JT4 A;  3EGU A;  4IIM A;  1N5Z A;  1K76 A;  1Z9Q A;  1M8M A;  1AZE A;  1T0J A;  4CC3 A;  1I0C A;  1QKW A;  1FMK A;  1NLP C;  2KRM A;  1QKX A;  2DE0 X;  1SHF A;  5I22 A;  2AKK A;  1WX6 A;  1OPK A;  4GLM A;  2FPF A;  1CKA A;  1MV3 A;  2DBK A;  2W0Z A;  1UEC A;  2D8J A;  2RMO A;  2W10 A;  5FWC A;  2YDL A;  1JEG A;  1E6G A;  4A63 B;  2DLP A;  2J6K A;  4HVV A;  1B07 A;  2GBQ A;  2FRY A;  2LJ3 A;  1HSQ A;  1M3C A;  1UHC A;  2RQV A;  2DMO A;  1CSK A;  2F2X A;  1NYG A;  2H8H A;  1OPL A;  5IHN A;  1UTI A;  2ED0 A;  1U3O A;  2HCK A;  1GL5 A;  2PNI A;  1VYU A;  1HD3 A;  3VS3 A;  1ABQ A;  2NUZ A;  2V1Q A;  2D1X A;  2L3S A;  1LCK A;  2VKN A;  3VS6 A;  4DEX A;  4D8K A;  3A98 A;  1YN8 A;  2ROL A;  2LQN A;  2JTE A;  2EGE A;  2ED1 A;  4OMM A;  3GBQ A;  1A0N B;  5IH2 A;  2KRN A;  2CSI A;  2KYB A;  2P4R A;  3TSW A;  4Y92 A;  3REA B;  2AKL A;  2XMF A;  1RI9 A;  3EHR A;  3I9Q A;  2A36 A;  1SSH A;  4AFZ C;  2LX7 A;  1GCQ C;  2DX1 A;  1J3T A;  2JMC A;  2K6D A;  4OMQ A;  2FG0 A;  3THK A;  3M0R A;  2HBW A;  3EG2 A;  4RTZ A;  1UDL A;  1W1F A;  4RTT A;  2DL8 A;  1PKT A;  1WYX A;  2FO0 A;  4OMP A;  4WCI A;  4J9C A;  2LMJ A;  2MCN A;  1UG1 A;  4JZ4 A;  1PRL C;  2ESW A;  3U23 A;  4CC7 A;  1YNZ A;  1SPK A;  2K79 A;  2A08 A;  2GNC A;  1TUD A;  2KT1 A;  2J7I A;  2KYM A;  2KBT A;  1WXT A;  3IQL A;  3VS1 A;  2JM8 A;  5FWB A;  3O5Z A;  4CC4 B;  2EQI A;  4LNP A;  2J6O A;  1T3S A;  2CRE A;  2HSP A;  3UA6 A;  1YWP A;  2C0O A;  1NM7 A;  2B86 A;  4FSS A;  2AZV A;  3VS5 A;  1YCS B;  2GTO A;  1EFN A;  4RTU A;  2GGR A;  1UUE A;  1Y0M A;  2MIO A;  1SEM A;  2JMA A;  1XOV A;  1PNJ A;  1AVZ C;  4AG2 C;  1AWX A;  2DA9 A;  1YP5 A;  3M0S A;  3I35 A;  3PVQ A;  2DRK A;  1NEG A;  2DJQ A;  2CDT A;  2EGC A;  5EC7 A;  1ZSG A;  2GQI A;  1GBR A;  1ZUY A;  4OMN A;  2DIL A;  2SRC A;  2EW3 A;  1ABO A;  1WFW A;  2AZS A;  2IIM A;  2LNH B;  4JZ3 A;  4RUG A;  2G6F X;  2EVR A;  5L23 A;  1K0S A;  4RTY A;  2YT6 A;  2VVK A;  2L2P A;  3SHW A;  2HDA A;  2KNB B;  1WXB A;  3VRY A;  1JO8 A;  2JS2 A;  2E5K A;  1TG0 A;  1K4U S;  1U06 A;  1OOT A;  1MV0 B;  3VS2 A;  1GBQ A;  2F2V A;  1RLQ C;  3RBB B;  2K9G A;  4J9F A;  5HCK A;  2FRW A;  2DM1 A;  1FYN A;  2DL4 A;  2LJ1 A;  5I11 A;  2GTJ A;  1X2K A;  2O9V A;  3FJ5 A;  3VS0 A;  3EG1 A;  4HCK A;  4HXJ A;  3TVT A;  2YUQ A;  2DL3 A;  4J9H A;  1B3Q A;  4J9G A;  1OV3 A;  1WI7 A;  4AFU C;  2X3W D;  4D8D A;  1AZG B;  1YWO A;  3NPF A;  1WXU A;  1TUC A;  1ZX6 A;  3EG3 A;  2O31 A;  2O2O A;  1H8K A;  1AOJ A;  3TSZ A;  2J06 A;  4HVU A;  2M51 A;  1AWO A;  2YSQ A;  3NHN A;  3NGP A;  4KRT A;  1M3B A;  1SRM A;  1IO6 A;  3SEM A;  4JJD A;  2JS0 A;  2EYY A;  2ABL A;  4Z89 A;  2RPN A;  2BZY A;  2F2W A;  1WLP B;  1NLO C;  2KRO A;  3H0H A;  3VS4 A;  1I1J A;  2DVJ A;  1K0X A;  2JXB A;  1NYF A;  1RLP C;  2BZX A;  2CUB A;  3C0C A;  3UF4 A;  2LJ0 A;  4JJC A;  1E6H A;  3M0P A;  1M3A A;  2K7A A;  1PKS A;  1ARK A;  1M27 C;  1GCP A;  2A37 A;  2RQR A;  1W6X A;  3VS7 A;  3R6N A;  4ESR A;  1G83 A;  2AK5 A;  1UE9 A;  3JV3 A;  1JXO A;  1QLY A;  4K11 A;  4AG1 C;  2SEM A;  2CUD A;  2YUO A;  2O9S A;  2EYW A;  1V1C A;  4RTV A;  1I07 A;  1KFZ A;  2L0A A;  1ZBJ A;  2O88 A;  4JPB W;  1QWF A;  1PWT A;  1NEB A;  1VYT A;  3I5R A;  1QCF A;  1WIE A;  1UGV A;  1Y57 A;  2BTT A;  3EHQ A;  2V1R A;  5IXF A;  1E7O A;  2A28 A;  2JM9 A;  4OML A;  2C0T A;  2DL5 A;  4RTW A;  1K1Z A;  2FEI A;  2ROT A;  2NWM A;  3PE0 A;  3REB B;  1X6G A;  2K3B A;  3M0Q A;  4QT7 A;  2D8H A;  1T3L A;  1VYV A;  2DYB A;  1X69 A;  2K2M A;  4J9D A;  1ZUU A;  1AEY A;  1WDX A;  2KXD A;  1KSW A;  2DF6 A;  2HEQ A;  3QWX X;  2KR3 A;  3NMZ C;  3QWY A;  4X1V A;  2L3P A;  1GFC A;  1U5S A;  4DEY A;  1X27 A;  2PZ1 A;  3EG0 A;  2LP5 A;  1GRI A;  1MUZ A;  1KJW A;  3M0T A;  1KIK A;  2LQW A;  2EYX A;  4F17 A;  2L3Q A;  2KT8 A;  4J9E A;  4EIK A;  1SHG A;  1S1N A;  4HVW A;  1NG2 A;  1SRL A;  3ZL7 C;  2YUN A;  2OI3 A;  4RTX A;  1CKB A;  4LUE A;  4E6R A;  5GJV B;  2M0Y A;  1GCQ A;  2MOX A;  5IHI A;  2QDL A;  4F16 A;  4LN2 A;  2DBM A;  1X6B A;  2DRM A;  2YUP A;  2KE9 A;  4LUD A;  1OEB A;  1BBZ A;  2OAW A;  4GBQ A;  2KGT A;  4Z8A A;  3UA7 A;  3M0U A;  1BK2 A;  2CSQ A;  2RNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...