3IQLA

Crystal structure of the rat endophilin-a1 sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
b'SVGSDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Endophilin-A1
publication title SH3 domains from a subset of BAR proteins define a Ubl-binding domain and implicate parkin in synaptic ubiquitination.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
total genus 12
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3iqlA00
1G2BA 1K9AA 4LUEA 4RTTA 1UFFA 2M0YA 3C0CA 4ESRA 2DRMA 1EFNA 2E5KA 3H0FA 2DNUA 4AFSC 4FSSA 1JO8A 1A0NB 1UDLA 2PTKA 2DL7A 2FPEA 2GTJA 2K9GA 2V1QA 3TSWA 3FJ5A 4AG2C 2DMOA 2LJ1A 1GFCA 3I5RA 4WCIA 1K0SA 1OEBA 2CH4A 2LJ0A 1H3HA 3I35A 1JEGA 2CSQA 1JQQA 1VYVA 1M3AA 2DLPA 1BBZA 1WI7A 2JS2A 2V1RA 1QKWA 5ECAA 1WYXA 1Z9QA 1VYUA 3O5ZA 4RTZA 2YUOA 2FPDA 1QLYA 1BK2A 1GL5A 2FEIA 2VWFA 2KRMA 5FWBA 4OMPA 2GQIA 2K2MA 4K11A 3RBBB 5IHNA 4LN2A 1YP5A 3RNJA 1QWFA 2KBTA 2PNIA 3VS2A 1ARKA 3VRYA 1H8KA 2BTTA 2LNHB 1ZSGA 2DILA 1M3CA 1E6GA 1MV0B 2L3SA 3LH5A 4HCKA 2CT3A 3H0HA 2JM8A 2A36A 2FPFA 2KT1A 1X2QA 4J9EA 2MCNA 2DL4A 1YCSB 1B07A 2HEQA 5IHIA 1K1ZA 1V1CA 2EVRA 4M4ZA 2KYBA 2EYXA 2ESWA 2NWMA 2AKKA 2X3XD 2YUNA 2RQVA 4GLMA 3VS3A 1WDXA 2ABLA 2CDTA 4HVWA 2CT4A 1WXBA 3VS4A 1SHGA 2ED0A 5HCKA 2ECZA 2K3BA 4OMLA 2KNBB 4LUDA 3M0UA 1TG0A 1TUDA 4JZ4A 4DEYA 4OMMA 1GCQC 1MUZA 1RI9A 2FRWA 3NGPA 4A63B 2XMFA 2O9SA 2EYWA 1X6BA 4RTWA 1MV3A 1K4US 1W70A 2EBPA 5IHKA 2EW3A 2EYYA 4CC7A 1N5ZA 1FYNA 1PWTA 2O9VA 3M0TA 1E7OA 1UTIA 4CC2A 1PNJA 3IQLA 1NG2A 1NYGA 2J6OA 2EGEA 1UG1A 2I0NA 4GBQA 4HVUA 4OMQA 4Z88A 4D8DA 1CSKA 3QWYA 1XOVA 2GBQA 2EQIA 1SPKA 1ZUUA 1JU5C 2EKHA 1PKSA 4HXJA 1TUCA 1SSHA 3VS0A 1IO6A 2ROTA 2DX1A 1GBQA 3M0RA 1GCQA 3VRZA 1PKTA 3TSZA 2RNAA 1YN8A 2CUDA 3R6NA 2OAWA 1UE9A 2KR3A 1WLPB 3EG3A 1G83A 1T0HA 1AEYA 1X43A 2KT8A 2LX7A 3REBB 2P4RA 3PVQA 3VS7A 2LMJA 2O31A 2GTOA 1H92A 1HJDA 2RQTA 1M8MA 1RLQC 3EG2A 1I1JA 2EGCA 4CC4B 2MIOA 1NEGA 2QDLA 1Z9ZA 2YUQA 2JMAA 1T0JA 2VVKA 1X69A 2KEAA 1YWPA 4AFQC 4JJBA 3JV3A 2YT6A 4QT7A 3VS6A 3UATA 4JPBW 1B3QA 4LNPA 5FW9A 2O88A 4HVVA 1W1FA 1W6XA 1M30A 4Z8AA 2JT4A 1K76A 4E6RA 4F16A 2J06A 4J9HA 2KXDA 2RQUA 1AWOA 1PRLC 3EHQA 1S1NA 1GFDA 2DYBA 3KFVA 4J9BA 2FG0A 2C0OA 2J05A 1Y0MA 4JJCA 2A28A 1SEMA 2OI3A 2EPDA 3ZL7C 2AZSA 3VS1A 2RMOA 4OMOA 5IXBA 3REAB 5FWCA 2RF0A 2AZVA 2D8JA 3EGUA 4AG1C 2W10A 2CUBA 1T3SA 2CSIA 2KRNA 3PE0A 1FMKA 4CC3A 1AWJA 1JXMA 2F2WA 1E6HA 2H8HA 1NLOC 1PHTA 1UJ0A 3M0QA 1CKBA 2W0ZA 4RTUA 3UA7A 2DF6A 1OPLA 1GBRA 2LJ3A 1RLPC 2DL5A 1PRMC 1KIKA 2F2VA 2ED1A 2SRCA 3QWXX 1HD3A 3I5SA 3UF4A 1I0CA 1OV3A 2DE0X 1CKAA 3I9QA 2NUZA 5GJWB 1QWEA 2KGTA 3PVLA 1HSQA 2A37A 1BB9A 3GBQA 2M51A 1ZLMA 1QKXA 3H0IA 5L23A 2RQRA 2F2XA 5IXFA 2LQWA 5EC7A 4AFZC 2PZ1A 1VYTA 2DBMA 2D8HA 2DVJA 1NEBA 1T3LA 1UECA 2G6FX 2ROLA 2HSPA 2RQWA 2L3QA 4D8KA 1M3BA 4JZ3A 1WXUA 3ULRB 4X1VA 4J9FA 1KFZA 2SEMA 1LCKA 2AKLA 2BZXA 2K6DA 4RTVA 3U23A 1AWXA 3H41A 1X2KA 1ABQA 2EGAA 3TVTA 2C0TA 2JM9A 4RUGA 1AOJA 4OMNA 2JMCA 3EHRA 2C0IA 3SHWA 1ABOA 1KJWA 2J6KA 1SRMA 1RUWA 2MOXA 1NYFA 1NM7A 4ORZA 1BU1A 3M0SA 1U06A 2YUPA 1M27C 4J9IA 1UGVA 1YNZA 4F17A 3UA6A 1QCFA 2IIMA 3NHNA 2DL3A 2K79A 4F14A 1UUEA 1SRLA 1ZUKA 2JW4A 1GRIA 1WXTA 3NPFA 1WX6A 4IIMA 1X27A 2J6FA 2YSQA 4RTXA 1OPKA 2LQNA 2X3WD 4EIKA 2GNCA 3A98A 2ENMA 3SEMA 2RN8A 3CQTA 3M0PA 2KXCA 2D1XA 1AWWA 1J3TA 2J7IA 1UHFA 2LZ6B 4Y92A 2CREA 1GCPA 1U5SA 4ZNXA 2DJQA 1ZX6A 2VKNA 2KRSA 2K7AA 1AZGB 1JXOA 1KSWA 2JTEA 1YWOA 1AVZC 1ZUYA 2DBKA 1Y57A 2DRKA 4J9DA 1VA7A 5GJVB 2LCSA 2KYMA 4IIOA 2DL8A 2D0NA 2CH4W 3EG1A 3THKA 4DEXA 2JS0A 2KE9A 4R0KA 2OJ2A 4RTYA 1OOTA 4LE9A 2FO0A 2B86A 2L0AA 3NMZC 2BZYA 2EYZA 2DA9A 2YDLA 1WIEA 2FRYA 1U3OA 2HBWA 1UJYA 2A08A 2RPNA 3EG0A 1ZBJA 1K0XA 4JJDA 2BZ8A 3VS5A 4J9GA 2L2PA 1WFWA 2DM1A 1AZEA 4J9CA 1NLPC 2O2OA 2LP5A 4Z89A 1SHFA 5I11A 2L3PA 1AD5A 1UHCA 5IH2A 2HDAA 4KRTA 1WA7A 2HCKA 2KROA 1X6GA 2AK5A 5I22A 2JXBA 1I07A 4AFUC 2GGRA
chains in the Genus database with same CATH superfamily
1K9AA 3JB9F 1IGQA 3BDLA 5J39A 1EFNA 3OYJA 1YHQA 1VQ6T 5M9OA 1UDLA 1B34B 4D6WA 1M2OA 1N9SA 5CIUA 4XU0A 4OGCA 4ELZC 4BACA 2LJ1A 1GFCA 4LDUA 4PJOD 2FZKB 2ZGWA 2HQEA 1Q7YR 5CKBA 3CD6Q 2PUKB 3OS1A 5GMKh 3CCMA 1JRIA 1VQNQ 1M3AA 2D9TA 2R57A 3FDRA 1WI7A 3I55A 4M7AG 2V1RA 3L2UA 1WYXA 3O5ZA 1QP3A 4M78E 4E7ZA 1WGSA 2FPDA 1M8VA 2MAMA 2X4XA 3CCRT 2KRMA 3OYLA 3JCMc 3RBBB 4LN2A 1YP5A 3CCQA 4ATOA 3OMGA 3SWNB 1I4K1 1R0BG 1TSFA 4M7AB 3CPWA 1H8KA 1JBMA 1G8XA 2BTTA 3CXCP 3CCMT 3VKIA 5KYYA 2XDBA 4LDYA 7AT1B 5GAN5 3EFSA 2FPFA 2KT1A 1OU8A 1D3BB 4J9EA 1YCSB 5IHIA 1K1ZA 1NPRA 4N4GA 4F7UF 2EVRA 5KE2A 1GXIE 3EFOA 1P92A 5A0LA 2YUNA 3HL8A 5GAOl 2RQVA 3HRTA 1WDXA 2COYA 4RCBA 4A4EA 3CCQT 4QQDA 1LNXA 1VQ8Q 2ECZA 4FW2A 3EH1A 4XU1A 3E19A 3G4SQ 4LUDA 5HK3A 4QKUA 1NBEB 4DEYA 2ZAEA 3R6OA 5GAOn 2FRWA 3NGPA 1FWZA 1IZ6A 2LC4A 2EYWA 1W70A 3JB9G 3UPUA 3PIPA 4CC7A 4XAXB 3V8JA 2YRCA 3OW2P 4M78C 3LGFA 4IUUA 5FU6B 5D6YA 2J6OA 2EGEA 2I0NA 3JB9J 4GBQA 4Z88A 5GAN6 3TCJA 3QWYA 2RK2A 1VQ7A 1XQHA 1SPKA 1ZUUA 3A8GB 1RABB 1IB8A 1PKSA 2E5QA 3VS0A 1IO6A 4LDVA 1ZQ1A 4C5EA 2XIDA 3M0RA 1GCQA 4LD9K 3TSZA 5FROA 2RNAA 1YN8A 5L8RE 5AYFA 1KQSS 5LJ3e 4M7AE 1ZHIA 3M54A 3G6EQ 4PL6A 1UGSB 3SFMA 2XKOC 2LMJA 2O31A 2R5MA 1HJDA 5GMKi 2RQTA 2EGCA 4CC4B 1NEGA 1VQ7T 3CC4Q 1RAEB 1KQ1A 2G3RA 1QMCA 5GANd 2QEXQ 1UGRB 4PNOA 4C92D 2QGFB 3H6ZA 2KEAA 2XI9A 2YT6A 3VS6A 3UATA 1K73R 4F7UG 2QDYB 4X34A 1B3QA 3CPWP 4KUIA 5FW9A 1TS9A 3ME9A 3GF5A 4Z8AA 5DY9A 3V7SA 1K76A 1WJRA 4F16A 3MPUB 1JJ2S 1QCNA 4ZTFA 1YFNA 3VU3C 3KFVA 5CQXA 2KQWA 1BI3A 5GMKm 1W4SA 2FG0A 2ATCB 1RAAB 4BI3A 2J05A 5LJ5d 5CVIA 3M4YA 1I8FA 2OI3A 8AT1B 3JCMh 2EPDA 3QBYA 2NLUA 1BI0A 4OMOA 5IXBA 5FWCA 4XK8E 3G1JA 2D8JA 3EGUA 2W10A 2K3XA 3M56A 2KRNA 2DD4A 1FMKA 3V7CA 2RI5A 3SWNC 2F2WA 2H8HA 4WTOB 4M7AC 3M0QA 4HKEA 3RKWA 3PIOA 3X25B 2VV5A 4OVAA 2GQVA 1GBRA 1RLPC 1Q7YC 4KGZB 5KCHA 1M5Q1 2ED1A 1N27A 3I5SA 5I2SA 3I56Q 3CEYA 1G3YA 3P8DA 5GJWB 2KVQG 3PVLA 1LPLA 5C6SA 5KYYB 2YHTA 2M51A 2HZYA 1WHJA 4ZN1A 5IXFA 5EC7A 2IVWA 4AFZC 2PZ1A 1BI1A 3HP9A 1K73U 2CP0A 2D8HA 2DVJA 4A4FA 4JJNK 1T3LA 4OB2B 2ZPFB 2ROLA 3MJXA 2HSPA 2RQWA 4FYVB 2LX9A 2QQRA 3TU4K 1PSFA 3BW1A 3CXCS 2R5AA 1LJOA 4X1VA 5LJ3h 1N9RA 3OYNA 2AKLA 2GF7A 4YTLA 2HL5C 3QJ6A 3HRUA 2VGNA 5EG2A 1VQLQ 3MHXA 3QDRB 3CCVA 4RUGA 3HKSA 4OMNA 5KH6A 3EHRA 4M7DA 1KJWA 1SRMA 1W2BP 2MOXA 4QVDA 4JUVA 3OYKA 2RJDA 4ORZA 4ZTJA 3KXTA 4QQ6A 2NUPA 4C0DB 3CCEA 2X9HA 1MMAA 4MMLA 2NUTA 1M27C 1YNZA 2JOYA 4EMKA 3QZ9B 4OB1B 1LOJA 1QCFA 2IIMA 4E7JA 1X01A 3NTKA 2K79A 4XTUA 1RAIB 3HFNA 4F14A 2VGMA 2JW4A 2OTLQ 1GRIA 3NPFA 1WX6A 4OB3B 2YSQA 1S72Q 3CCVT 2O4XA 1NZ9A 2X3WD 2IG0A 1VQ5Q 1PD1A 2RN8A 1VQMQ 3CC7Q 2PUOB 2J7IA 1IHVA 4RKUE 4Y92A 3OW2S 3CCET 3E2UA 1U5SA 1ZSZC 3CCUQ 3M53A 2ZPEB 2OX7A 2V8IA 5CKEA 3KBGA 1TWBA 3CMAQ 1G3SA 1AVZC 1YIJQ 2EYQA 1OI1A 1ZUYA 2DBKA 1Y57A 4M78D 5GJVB 4A4GA 2KYMA 1VIEA 2CH4W 2JS0A 1OOTA 4LE9A 2FO0A 4X9CA 2EYZA 3CC2A 2DAQA 1VQ9T 2FRYA 1Q81U 2HBWA 2E6NA 4MDWA 1I5LA 2YRDA 4C92E 3GP8A 2RHXA 4A54A 4P5NA 5GAMf 2P4TA 3DB3A 1K73C 2QA4T 4FM4B 2RJFA 1UHCA 2HDAA 3J7AF 4KRTA 1WA7A 1VUBA 1I5OB 5I22A 5D6WA 3OYBA 4AFUC 2GGRA 1G2BA 1D3BA 4LUEA 1UFFA 2M0YA 1K9MU 4ESRA 3CC2T 2E5KA 4XU3A 4HT8A 5J3BA 4AFSC 3GNFB 4FSSA 3CD6A 1JO8A 1A0NB 2GFUA 3L2ZA 1YJ9Q 1IXDA 3FJPA 5LL6S 2V1QA 1VQNA 5GAOp 1VQ4T 3FJ5A 1BI2A 3I5RA 2E70A 4XQ3A 4OMFB 1OEBA 2CH4A 1H3HA 2VYTA 3I35A 3RUXA 1JQQA 1MMNA 2BIVA 2E12A 5CO7A 1MNEA 3OYEA 2MWOA 3M5AA 1Z9QA 2K3YA 2MWPA 2YUOA 3OMCA 1BK2A 2QTVA 1GL5A 3M4GA 2BE7D 2VWFA 2KY9A 3G7ZA 4K11A 1WHLA 5D7UA 3OY9A 2KBTA 1D1CA 4C92C 4KULA 3INZA 2DZ9A 5IAYA 3JCMX 1YBYA 1E6GA 2M9UA 2CT3A 3H0HA 2QYZA 1YCYA 4M7AD 4M75F 4EPCA 1B07A 2HEQA 1V1CA 3QJYA 4M4ZA 1M1GA 2M0OA 4C0GA 2ESWA 2NWMA 1JB0E 2AKKA 4CRIA 2RHYA 1KG1A 1TH7A 4DBRA 4HVWA 2CT4A 1MMDA 4M77F 3VS4A 4Y91A 2ED0A 3JCMf 3E1SA 3J80E 2PVOB 4IUTA 3M0UA 1TG0A 5GMKl 4JZ4A 2HKNA 1GCQC 4Y28E 4F04B 4EMKB 2CZ7B 5LJ5e 1BIAA 3LH0A 3LX7A 4A63B 3GOXA 4BI4A 1X6BA 3PTAA 1MV3A 2PVDB 5IHKA 2DEUA 3UDCA 1TUGB 1N5ZA 5FU7B 2H3JA 3OYFA 1Q86U 4KUDK 2ZZDA 2O9VA 2CGHA 3M0TA 1UTIA 2F69A 1C1AA 3IQLA 1K9MC 4LD6A 1UG1A 4HVUA 4D8DA 3CCLA 4C5IA 1YI2T 2EQIA 2RI2A 3FB9A 4F7UA 1WJQA 4HXJA 1TUCA 2F1LA 1SSHA 3G6EA 3QHSA 2ROTA 1YJNQ 4FCYA 3R6NA 2OAWA 2DYIA 5GMKj 1UE9A 1WLPB 2HNIA 2HMAA 1Y96B 3BY7A 1T0HA 2GFAA 2P4RA 3PVQA 2GTOA 1M8MA 3CCLT 3EG2A 1I1JA 2EKOA 2JTMA 3GIBA 1Y07A 3HSBA 4MZMA 4PJOF 4J5YA 2JMAA 3QPHA 1YHQT 2YLCA 2VVKA 1X69A 1YWPA 2QXFA 3TEEA 3KUFA 4M75G 1OQKA 4QT7A 2AHJB 4HCCA 4M7DE 3SDZA 3H8ZA 3WVDB 2E1HA 4LNPA 2O88A 2JJ9A 3RKYA 3FC3A 1VQPQ 3ZEHA 3CBPA 2JT4A 4Z02A 2J06A 4J9HA 2KXDA 2RQUA 1AWOA 1PRLC 4M77G 3EHQA 4DBHA 1X75C 4M75B 3UT1A 3I55T 1S1NA 5GAN8 1RACB 2K57A 5GANh 3OYMA 4J9BA 2RK1A 2XDDA 2HQXA 2E41A 2C0OA 3FRNA 1Y0MA 2DJZA 2MK5A 1QVGA 3VUZA 2RJEA 2V8KA 1SEMA 1RL2A 2AZSA 4M77B 1SKUB 2DKGA 1PD0A 5HY6A 2OTJA 1T3SA 2OAUA 5GAMj 2EQUA 1KHCA 3I56A 3HPWA 2R58A 2QG9B 4XTXA 1PHTA 2RB6A 1OX9A 1CKBA 3UA7A 1HYOA 2LDMA 1D0XA 3JCMQ 3EGXB 1UB4A 2DTHA 5LJ5h 2DXTA 3UF4A 1I0CA 1FX7A 3LGLA 2KI7A 5CQYA 5A0DA 1VQOA 2NUZA 2OTJT 4JLGA 1HSQA 1WQ7A 2RO0A 2DERA 3MEVA 4FT4A 3H0IA 4M7DC 3I56T 1M1KU 2F2XA 4ZGEB 4AT1B 1VYTA 5HKCA 3OYYA 2DBMA 4PJOG 3CBOA 4EMKC 4KBMB 1VQLA 2G6FX 2DXBA 4C5GA 2A7YA 4PJJA 4JZ3A 1VQOT 1WXUA 2P0PA 2CP7A 3JCMJ 3GNGA 2E3HA 4B6MA 1LCKA 2K6DA 5FU7C 3H41A 1X2KA 4JRQA 3TVTA 4DBFA 5I21A 4E7IA 2MMPA 3SHWA 1FMWA 2J6KA 2L8DA 1NYFA 4FYWB 5GAMg 1W2BA 3CCRQ 4RG2A 4V2SA 4N0AA 2X35A 3G71Q 1VQLT 1U06A 1S72A 2YUPA 1VQ5A 4HT9A 4TVRA 3NHNA 4J7IA 1VQMA 4XTYA 2F5TX 2J6FA 4L6V5 4F7UB 4C0FA 4RTXA 3L2RA 1OPKA 4FSXA 4EIKA 3C95A 5CCAA 2ENMA 2MF2A 3MP1A 3CMEQ 3CCUA 1TTHB 3CQTA 1QVGP 2L5QA 1SSFA 2KXCA 1AWWA 4C0ZA 4LDWA 3CMAA 3QO3A 1YIJA 1GCPA 2JNGA 2YXYA 1VQ5T 3CCQQ 5GAMd 2QGGA 2K7AA 1QVFA 2E3IA 4C8QA 1KSWA 1VQMT 2RHUA 4OB0B 3RESA 1YWOA 4BD3A 2COWA 1H641 2O01E 4J9DA 2LCSA 4RG8A 2LCCA 4IIOA 4JS5A 2VB6A 2D0NA 3THKA 2RHZA 2KE9A 3SD4A 4RTYA 1VQKQ 3P8HA 3MCAB 1TU0B 2L0AA 1X6OA 3EH2A 3CMAT 3HHTB 1YIJT 3L1AA 2VXEA 4FYYB 2X4YA 3EG0A 5DLQE 1K0XA 2BZ8A 1HK9A 3EG9A 1PCXA 1AZEA 2O2OA 2LP5A 1G3TA 2DD5A 3HFOA 1AD5A 2DTOA 1ZA1B 2HCKA 2AK5A 1YJ9A 1I07A 2QQ9A 2E6ZA 2FL7A 4JRPA 3C0CA 4IUVA 2DRMA 2HAXA 4JS4A 2PU9B 3JCMg 1Q81R 4BDZA 2PTKA 1WHGA 2DL7A 2FPEA 2GTJA 4E7SA 4F7UE 4C8QF 3TSWA 1VQ7Q 2VC8A 4AG2C 5FU6C 2DMOA 3JCMV 3V7RA 2WSEE 1K0SA 2JTFA 2KK4A 1JEGA 1YJ9T 5GAN3 1VYVA 1QW1A 1BBZA 1BYMA 3VYHB 2JS2A 4E47A 1QKWA 2RH2A 4BE1A 1VYUA 1K9MR 3NTHA 4RTZA 4O6JA 4Q5WA 4ZGDB 4RMOA 3JAME 5FWBA 2GQIA 2K2MA 5IHNA 5KYWA 3MP8A 3RNJA 3OYGA 3VS2A 1MGQA 1ARKA 2LNHB 1ZSGA 4CI0C 2DILA 1M3CA 3Q1JA 1MV0B 2LCLA 3LH5A 4HCKA 2A36A 2D6FA 1KC8U 4J7FA 6AT1B 3A8MB 2DL4A 3OYIA 1QVFP 2KYBA 2EYXA 4IURA 2LNVA 4II1A 4EMHA 5GANf 3JB9H 1IGUA 2QTXA 2X51A 2QQAA 1D0YA 2EQJA 2ABLA 2RM4A 1Y96A 4NL3A 4MZPA 4BUGA 1SHGA 3WVEB 3MEAA 4OMLA 4M7DD 4M78F 1TUDA 2XICA 2P84A 3MEWA 3OS2A 3MKDA 4DQ2A 1RI9A 4LXCA 4R56A 2XMFA 3CBMA 2O9SA 2PVGB 4RTWA 1K4US 2EBPA 3H9NA 5C0MA 2AIRB 1WNLA 4ZGJB 1FYNA 2HD0A 1PWTA 4UC4A 4PJLA 4PK4A 1YJNA 1SG5A 4C8QG 5GAN4 4OMQA 1H3ZA 1Y7XA 2XHCA 1CSKA 1XOVA 4M75A 3CPWS 2CP3A 5KCOA 4O5VA 2LQ8A 1OZ3A 3OS0A 4GLKA 4AMCA 1C6VX 3VRZA 5GAOq 4C8QB 2Y4YA 2QQSA 4M77A 2KR3A 2K5FA 1QCOA 3EG3A 1K8AR 1G83A 1QVGS 2CZ1B 5KYNA 1X43A 2KT8A 2EAYA 1YJNT 1Q86R 1O9SA 3VS7A 2CKKA 1H92A 3BE3A 3JCMW 3PT9A 1RLQC 2QDLA 5KYUA 2EIFA 2YUQA 4J6XA 1T0JA 1AHJB 3CD6T 3VJPA 2E10A 2QASA 3L2QA 2XK0A 3EGXA 1VQPA 4JRIA 4AFQC 3EG9B 2KAFA 1VQNT 2V26A 1EX4A 1U8RA 3O8VA 3QXEB 4HVVA 1W6XA 3QZ5B 1M1FA 4E6RA 4IKFA 4KH0B 4NS5A 5GAN2 1GFDA 1WHHA 2DYBA 1VQ8A 4HA8A 5CKFA 2Y4XA 1B7TA 4C0DC 4M78G 4M7AF 3G4SA 1VOMA 2A28A 2PQWA 3LWIA 1V76A 1NE8A 3S3MA 1IREB 1D09B 5FRMA 1M9SA 2RMOA 4X9DA 3REAB 3ER0A 2AZVA 1Q81C 1M2VB 3DLLA 1WJSA 4CC3A 4KGVB 2BUDA 4M78B 4PJMA 3OYHA 4PJOA 1AWJA 1KHIA 1JXMA 2RA2A 2VXFA 1U1SA 4OF1A 1VQ9Q 2W0ZA 1VQ8T 4RTUA 3LLRA 4ELYC 4C8QE 2DF6A 1OPLA 4XTZA 2CZ0B 1C0MA 1KIKA 3G4ST 2DEQA 2BE9B 2SRCA 1K8AU 2EJGA 3QWXX 1FMVA 2ZPIB 1OX8A 5GAMe 1OV3A 1G5VA 2DVEA 2QA4Q 2DE0X 5KYWB 1WZOA 4ME7A 1W2BS 1YJWQ 4ANJA 3M58A 3VUBA 1QWEA 2KGTA 2ZCFB 2KMTA 3HTRA 2A37A 1O75A 3GBQA 1ZLMA 1R0CB 1KK7A 5L23A 1QQJA 3JCMb 3ASKA 3JB9D 4PFPA 4N0AC 2JN0A 4FT2A 4A53A 4JDSA 3CC4A 1G3WA 4B9WA 1VQ4Q 2L3QA 4A4KA 2QEXA 2MPXC 5DLOA 2D0QB 3ULRB 5IN1A 1KFZA 2HBPA 4PLIA 2Y90A 2SEMA 4OGEA 3JSCA 2GCXA 1N8RU 1AWXA 3CCRA 4E7KA 3OBWA 1ABQA 5LJ3f 3RKXA 3G71A 1EZZB 1QVFS 3G6ET 1M1KR 1ABOA 1IRXA 3QG1A 1RUWA 3WXMB 3A1PA 1KQ2A 1BU1A 3M0SA 3CC4T 1Y71A 3OB9A 2QEXT 1YITQ 1OYXA 4F17A 2DO3A 4C8QC 5FLXE 3UA6A 4BE2A 3CMEA 2DL3A 1QVPA 2EJFA 1UUEA 5GANj 1ZUKA 5AT1B 1WXTA 2K4YA 2QQBA 3G71T 4IIMA 1X27A 2EJ9A 3EFRA 4L5GA 2WSFE 3DLMA 2GNCA 2JVVA 3SEMA 9ATCB 4E7HA 1WPYA 1ZA2B 2D1XA 3V8LA 1J3TA 5KYXB 3OYAA 3F70A 1UHFA 4FU6A 3M59A 3CCSQ 1D1BA 2CREA 2JZ2A 1UEBA 1OZ2A 2MI6A 4XU2A 4ZNXA 2M02A 2CS7A 2DJQA 3JCMP 2FB7A 3CMET 2AT1B 2KRSA 1VQKA 2BKDN 3JCMe 1XJWB 2EFIA 4KT0E 5KYUB 1MMGA 4FIBA 3T9NA 5LJ5j 1VA7A 1K8AC 4ZN3A 2DK3A 3PMIA 2A3LA 1BKBA 3EG1A 4DEXA 1UGPB 5A2QE 4R0KA 2OJ2A 1Q86C 4QW2A 1RAFB 4C92A 5I2MA 3NMZC 2YDLA 3ZFJA 1U3OA 1WHMA 2RPNA 3CCJQ 5J26A 1ZBJA 5GAMh 1VQKT 2K2VA 3LW5E 2L2PA 1WFWA 1PM3A 1BCOA 2E65A 1YI2Q 1NPPA 4BI8B 4Z89A 5CKHA 1I81A 4PJNA 1Q7YU 2L3PA 5IH2A 1VQ6Q 1R77A 2KROA 4DOVA 5GANg 4DOWA 3M0PA 3X28B 4RTTA 1N8RC 1D0ZA 2XG8D 3H0FA 2K5IA 2DNUA 3OA6A 1Q82R 1TXQA 4DA4A 2LVMA 4M75E 1HXDA 3E9FA 3OSVA 4QQGA 2K9GA 3CCLQ 4PJOB 1BCMA 2EQMA 2LT4A 4WF2A 2JUFA 4LDXA 2XDPA 1YHQQ 4WCIA 4GY5A 3NFCA 4VUBA 3DB4A 2LJ0A 3FEOA 2CSQA 2OTLA 1SF9A 4M77E 3X24B 5GAOr 3C4SA 4C92F 2DLPA 3DKMA 2COZA 5LJ5g 5ECAA 2KDSA 3SB2A 1QLYA 3CCMQ 3V8KA 2FEIA 3CC7A 1ZSZB 3P8BB 2WSCE 3C94A 3D7SB 5CAIA 3PFSA 2DETA 4OMPA 3TQ7P 4BE0A 3I55Q 2L89A 2X4JA 1BIBA 3EGDB 1QWFA 2PNIA 3BDUA 1U1TA 3FIFA 3JB9I 3VRYA 2P0QA 4MDXA 2OTLT 2L3SA 2JM8A 3A8HB 3BFMA 2HKQB 3X20B 4B9XA 1X2QA 1S72T 2MCNA 2FVUA 3QKJA 2M1HA 1F1BB 4A4HA 4E2FB 2DTIA 2X3XD 5DM7R 3RMSA 3CC7T 5GAN7 1V29B 4GLMA 1RADB 3VS3A 2QI2A 4MZTA 4RCCA 2CDTA 2CZ6B 1WXBA 4HCZA 1N6AA 3MEUA 3CCUT 2XD0A 4BY6B 5HK0A 4M75C 5HCKA 2K3BA 2KNBB 1Q95G 2F5KA 1Q82U 2CP2A 1PSEA 4PLLA 4OMMA 1MUZA 2Z0WA 4XTWA 5CKDA 1KC8R 4KH1B 1M1KC 4PJOE 2OTJQ 3J81E 4M77C 4IUPA 3NTIA 1NJIR 2EW3A 2EYYA 1MHNA 1M90R 4FYXB 3UWNA 1LVKA 1WQWA 1E7OA 4NL2A 4BDYA 4CC2A 1PNJA 2RHIA 1NG2A 1NYGA 2DFUA 1KD1R 5LJ3j 2GBQA 2DXCA 4FL6A 1JU5C 4FW1A 2EKHA 2I2LA 1VQOQ 2C06A 2CP5A 1GBQA 2DX1A 3EFOB 4C92G 1PKTA 3LYIA 2CUDA 3MP6A 2YLBA 1D1AA 3QUIA 2DIGA 4C8QD 1RI0A 5CR2A 1AEYA 2LX7A 3REBB 4NOYA 1M2VA 4XTVA 2M16A 2P0KA 4OP0A 4M78A 2MIOA 4C92B 1Z9ZA 2DIQA 3OQ5A 4KGXB 2X4WA 4QVZA 4JJBA 3JV3A 2FZCB 4PKCC 2LQKA 3EAEA 4JPBW 2FYKA 3JCMd 3M9QA 5GAOm 1W1FA 2L3RA 2RJCA 4PJOC 1DJ7B 1M30A 3FLGA 3QDFA 1AT1B 2IPOB 4C5HA 1UGQB 2DXUA 1RAGB 1KQSA 1NJIU 1M90U 4JJCA 1MNDA 5LJ3g 1ACMB 1R8OB 3OYDA 3ZL7C 3AT1B 1VQ9A 2ZPBB 3VS1A 2YWWA 1KD1U 1Q82C 3N5BB 2RI3A 2RF0A 3RR6A 4AG1C 2CUBA 2CSIA 2VUBA 3PE0A 1B34A 4IUQA 1PG5B 1RAHB 4HCBA 2CYZB 2EQKA 2EWNA 4E7LA 1E6HA 1NLOC 1UJ0A 3E9GA 2QA4A 2A0FB 2ZPGB 2E64A 1YJWA 4M7DF 2HQHA 1TOVA 2LJ3A 1EIFA 3X26B 2DL5A 1PRMC 2F2VA 3VYGA 1HD3A 4L59A 2FHDA 4JRKA 2VASA 5LJ5f 1CKAA 1JJ2A 3I9QA 4R55A 3C12A 5LJ3d 3QIIA 1IHWA 4EMGA 4QVCA 1BB9A 1QKXA 2YRVA 5A0GA 3S6WA 2RQRA 4BY6C 2DZCA 1VQ4A 2LQWA 2LRQA 3SWNA 1YJWT 3AHUA 4M7AA 2K5LA 5KYXA 1NEBA 1UECA 4D8KA 2QAZA 1M3BA 2NYSA 4PFOA 3M57A 3RDVA 3PMTA 3A8OB 4J9FA 3QSUA 3GLXA 3RMQA 3U23A 2BZXA 4RTVA 3S3OA 3L42A 4PFZA 3META 2HSEB 2B8AA 2EGAA 2C0TA 2XU8A 3JRZA 5GMKe 2JM9A 2DPPB 1YITA 1AOJA 2JMCA 2C0IA 3CPFA 8ATCB 1QP2A 1NM7A 3TREA 4N4HA 2V8JA 4DBQA 1VIFA 3CCVQ 1FXXA 4J8OA 4J9IA 1UGVA 3VV0A 5IT9E 1KC8C 3QYHB 1OU9A 5KE3A 1SRLA 2CP6A 4J6WA 4N4IA 1N8RR 3CCSA 1NJIC 3CCEQ 1XTDA 3L2WA 1M90C 1KQSP 2LQNA 1YITT 4J6YA 4M75D 3A98A 3RERA 1M4ZA 1VQPT 5CK9A 3OYCA 3CXCA 3OSSC 1XNIA 5GANe 2LZ6B 1KD1C 4J83A 1ZBXA 1OULA 4M7DG 3MO8A 2RD1A 1ZX6A 3OBYA 3PNWC 3A5ZB 3PGGA 3S3NA 2KSSA 2VKNA 4M77D 3M55A 4MMKA 1AZGB 3RIRA 3A8LB 1JXOA 3OS5A 3CCST 2JTEA 4EDUA 2DRKA 2FZGB 3CCJA 2DL8A 2ZPHB 4M7DB 3LWHA 2H3EB 2LT1A 2B86A 2HL3A 3GPLA 1JJ2P 2BZYA 1YI2A 2DA9A 2E4HA 1WIEA 1PC0A 2MYSA 2NUPB 5FRNA 2NUTB 1UJYA 2A08A 1VQ6A 4JJDA 1ZSZA 4JLIA 5D6XA 3VS5A 4J9GA 2DM1A 3URGA 4J9CA 1NLPC 3CC2Q 1SHFA 3EGDA 2LTOA 5I11A 3HRSA 2O4XB 3QYGB 2WACA 2QK0A 3CCJT 3OW2A 1WHKA 1X6GA 2JXBA 3L2VA 3ZBDA 4BB7A
chains in the Genus database with same CATH topology
1G2BA 1K9AA 4LUEA 4RTTA 1UFFA 2M0YA 3C0CA 4ESRA 2DRMA 1EFNA 2E5KA 3H0FA 2DNUA 4AFSC 4FSSA 1JO8A 1A0NB 1UDLA 2PTKA 2DL7A 2FPEA 2GTJA 2K9GA 2V1QA 3TSWA 3FJ5A 4AG2C 2DMOA 2LJ1A 1GFCA 3I5RA 4WCIA 1K0SA 1OEBA 2CH4A 2LJ0A 1H3HA 3I35A 1JEGA 2CSQA 1JQQA 1VYVA 1M3AA 2DLPA 1BBZA 1WI7A 2JS2A 2V1RA 1QKWA 5ECAA 1WYXA 1Z9QA 1VYUA 3O5ZA 4RTZA 2YUOA 2FPDA 1QLYA 1BK2A 1GL5A 2FEIA 2VWFA 2KRMA 5FWBA 4OMPA 2GQIA 2K2MA 4K11A 3RBBB 5IHNA 4LN2A 1YP5A 3RNJA 1QWFA 2KBTA 2PNIA 3VS2A 1ARKA 3VRYA 1H8KA 2BTTA 2LNHB 1ZSGA 2DILA 1M3CA 1E6GA 1MV0B 2L3SA 3LH5A 4HCKA 2CT3A 3H0HA 2JM8A 2A36A 2FPFA 2KT1A 1X2QA 4J9EA 2MCNA 2DL4A 1YCSB 1B07A 2HEQA 5IHIA 1K1ZA 1V1CA 2EVRA 4M4ZA 2KYBA 2EYXA 2ESWA 2NWMA 2AKKA 2X3XD 2YUNA 2RQVA 4GLMA 3VS3A 1WDXA 2ABLA 2CDTA 4HVWA 2CT4A 1WXBA 3VS4A 1SHGA 2ED0A 5HCKA 2ECZA 2K3BA 4OMLA 2KNBB 4LUDA 3M0UA 1TG0A 1TUDA 4JZ4A 4DEYA 4OMMA 1GCQC 1MUZA 1RI9A 2FRWA 3NGPA 4A63B 2XMFA 2O9SA 2EYWA 1X6BA 4RTWA 1MV3A 1K4US 1W70A 2EBPA 5IHKA 2EW3A 2EYYA 4CC7A 1N5ZA 1FYNA 1PWTA 2O9VA 3M0TA 1E7OA 1UTIA 4CC2A 1PNJA 3IQLA 1NG2A 1NYGA 2J6OA 2EGEA 1UG1A 2I0NA 4GBQA 4HVUA 4OMQA 4Z88A 4D8DA 1CSKA 3QWYA 1XOVA 2GBQA 2EQIA 1SPKA 1ZUUA 1JU5C 2EKHA 1PKSA 4HXJA 1TUCA 1SSHA 3VS0A 1IO6A 2ROTA 2DX1A 1GBQA 3M0RA 1GCQA 3VRZA 1PKTA 3TSZA 2RNAA 1YN8A 2CUDA 3R6NA 2OAWA 1UE9A 2KR3A 1WLPB 3EG3A 1G83A 1T0HA 1AEYA 1X43A 2KT8A 2LX7A 3REBB 2P4RA 3PVQA 3VS7A 2LMJA 2O31A 2GTOA 1H92A 1HJDA 2RQTA 1M8MA 1RLQC 3EG2A 1I1JA 2EGCA 4CC4B 2MIOA 1NEGA 2QDLA 1Z9ZA 2YUQA 2JMAA 1T0JA 2VVKA 1X69A 2KEAA 1YWPA 4AFQC 4JJBA 3JV3A 2YT6A 4QT7A 3VS6A 3UATA 4JPBW 1B3QA 4LNPA 5FW9A 2O88A 4HVVA 1W1FA 1W6XA 1M30A 4Z8AA 2JT4A 1K76A 4E6RA 4F16A 2J06A 4J9HA 2KXDA 2RQUA 1AWOA 1PRLC 3EHQA 1S1NA 1GFDA 2DYBA 3KFVA 4J9BA 2FG0A 2C0OA 2J05A 1Y0MA 4JJCA 2A28A 1SEMA 2OI3A 2EPDA 3ZL7C 2AZSA 3VS1A 2RMOA 4OMOA 5IXBA 3REAB 5FWCA 2RF0A 2AZVA 2D8JA 3EGUA 4AG1C 2W10A 2CUBA 1T3SA 2CSIA 2KRNA 3PE0A 1FMKA 4CC3A 1AWJA 1JXMA 2F2WA 1E6HA 2H8HA 1NLOC 1PHTA 1UJ0A 3M0QA 1CKBA 2W0ZA 4RTUA 3UA7A 2DF6A 1OPLA 1GBRA 2LJ3A 1RLPC 2DL5A 1PRMC 1KIKA 2F2VA 2ED1A 2SRCA 3QWXX 1HD3A 3I5SA 3UF4A 1I0CA 1OV3A 2DE0X 1CKAA 3I9QA 2NUZA 5GJWB 1QWEA 2KGTA 3PVLA 1HSQA 2A37A 1BB9A 3GBQA 2M51A 1ZLMA 1QKXA 3H0IA 5L23A 2RQRA 2F2XA 5IXFA 2LQWA 5EC7A 4AFZC 2PZ1A 1VYTA 2DBMA 2D8HA 2DVJA 1NEBA 1T3LA 1UECA 2G6FX 2ROLA 2HSPA 2RQWA 2L3QA 4D8KA 1M3BA 4JZ3A 1WXUA 3ULRB 4X1VA 4J9FA 1KFZA 2SEMA 1LCKA 2AKLA 2BZXA 2K6DA 4RTVA 3U23A 1AWXA 3H41A 1X2KA 1ABQA 2EGAA 3TVTA 2C0TA 2JM9A 4RUGA 1AOJA 4OMNA 2JMCA 3EHRA 2C0IA 3SHWA 1ABOA 1KJWA 2J6KA 1SRMA 1RUWA 2MOXA 1NYFA 1NM7A 4ORZA 1BU1A 3M0SA 1U06A 2YUPA 1M27C 4J9IA 1UGVA 1YNZA 4F17A 3UA6A 1QCFA 2IIMA 3NHNA 2DL3A 2K79A 4F14A 1UUEA 1SRLA 1ZUKA 2JW4A 1GRIA 1WXTA 3NPFA 1WX6A 4IIMA 1X27A 2J6FA 2YSQA 4RTXA 1OPKA 2LQNA 2X3WD 4EIKA 2GNCA 3A98A 2ENMA 3SEMA 2RN8A 3CQTA 3M0PA 2KXCA 2D1XA 1AWWA 1J3TA 2J7IA 1UHFA 2LZ6B 4Y92A 2CREA 1GCPA 1U5SA 4ZNXA 2DJQA 1ZX6A 2VKNA 2KRSA 2K7AA 1AZGB 1JXOA 1KSWA 2JTEA 1YWOA 1AVZC 1ZUYA 2DBKA 1Y57A 2DRKA 4J9DA 1VA7A 5GJVB 2LCSA 2KYMA 4IIOA 2DL8A 2D0NA 2CH4W 3EG1A 3THKA 4DEXA 2JS0A 2KE9A 4R0KA 2OJ2A 4RTYA 1OOTA 4LE9A 2FO0A 2B86A 2L0AA 3NMZC 2BZYA 2EYZA 2DA9A 2YDLA 1WIEA 2FRYA 1U3OA 2HBWA 1UJYA 2A08A 2RPNA 3EG0A 1ZBJA 1K0XA 4JJDA 2BZ8A 3VS5A 4J9GA 2L2PA 1WFWA 2DM1A 1AZEA 4J9CA 1NLPC 2O2OA 2LP5A 4Z89A 1SHFA 5I11A 2L3PA 1AD5A 1UHCA 5IH2A 2HDAA 4KRTA 1WA7A 2HCKA 2KROA 1X6GA 2AK5A 5I22A 2JXBA 1I07A 4AFUC 2GGRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2B A;  1K9A A;  4LUE A;  4RTT A;  1UFF A;  2M0Y A;  3C0C A;  4ESR A;  2DRM A;  1EFN A;  2E5K A;  3H0F A;  2DNU A;  4AFS C;  4FSS A;  1JO8 A;  1A0N B;  1UDL A;  2PTK A;  2DL7 A;  2FPE A;  2GTJ A;  2K9G A;  2V1Q A;  3TSW A;  3FJ5 A;  4AG2 C;  2DMO A;  2LJ1 A;  1GFC A;  3I5R A;  4WCI A;  1K0S A;  1OEB A;  2CH4 A;  2LJ0 A;  1H3H A;  3I35 A;  1JEG A;  2CSQ A;  1JQQ A;  1VYV A;  1M3A A;  2DLP A;  1BBZ A;  1WI7 A;  2JS2 A;  2V1R A;  1QKW A;  5ECA A;  1WYX A;  1Z9Q A;  1VYU A;  3O5Z A;  4RTZ A;  2YUO A;  2FPD A;  1QLY A;  1BK2 A;  1GL5 A;  2FEI A;  2VWF A;  2KRM A;  5FWB A;  4OMP A;  2GQI A;  2K2M A;  4K11 A;  3RBB B;  5IHN A;  4LN2 A;  1YP5 A;  3RNJ A;  1QWF A;  2KBT A;  2PNI A;  3VS2 A;  1ARK A;  3VRY A;  1H8K A;  2BTT A;  2LNH B;  1ZSG A;  2DIL A;  1M3C A;  1E6G A;  1MV0 B;  2L3S A;  3LH5 A;  4HCK A;  2CT3 A;  3H0H A;  2JM8 A;  2A36 A;  2FPF A;  2KT1 A;  1X2Q A;  4J9E A;  2MCN A;  2DL4 A;  1YCS B;  1B07 A;  2HEQ A;  5IHI A;  1K1Z A;  1V1C A;  2EVR A;  4M4Z A;  2KYB A;  2EYX A;  2ESW A;  2NWM A;  2AKK A;  2X3X D;  2YUN A;  2RQV A;  4GLM A;  3VS3 A;  1WDX A;  2ABL A;  2CDT A;  4HVW A;  2CT4 A;  1WXB A;  3VS4 A;  1SHG A;  2ED0 A;  5HCK A;  2ECZ A;  2K3B A;  4OML A;  2KNB B;  4LUD A;  3M0U A;  1TG0 A;  1TUD A;  4JZ4 A;  4DEY A;  4OMM A;  1GCQ C;  1MUZ A;  1RI9 A;  2FRW A;  3NGP A;  4A63 B;  2XMF A;  2O9S A;  2EYW A;  1X6B A;  4RTW A;  1MV3 A;  1K4U S;  1W70 A;  2EBP A;  5IHK A;  2EW3 A;  2EYY A;  4CC7 A;  1N5Z A;  1FYN A;  1PWT A;  2O9V A;  3M0T A;  1E7O A;  1UTI A;  4CC2 A;  1PNJ A;  3IQL A;  1NG2 A;  1NYG A;  2J6O A;  2EGE A;  1UG1 A;  2I0N A;  4GBQ A;  4HVU A;  4OMQ A;  4Z88 A;  4D8D A;  1CSK A;  3QWY A;  1XOV A;  2GBQ A;  2EQI A;  1SPK A;  1ZUU A;  1JU5 C;  2EKH A;  1PKS A;  4HXJ A;  1TUC A;  1SSH A;  3VS0 A;  1IO6 A;  2ROT A;  2DX1 A;  1GBQ A;  3M0R A;  1GCQ A;  3VRZ A;  1PKT A;  3TSZ A;  2RNA A;  1YN8 A;  2CUD A;  3R6N A;  2OAW A;  1UE9 A;  2KR3 A;  1WLP B;  3EG3 A;  1G83 A;  1T0H A;  1AEY A;  1X43 A;  2KT8 A;  2LX7 A;  3REB B;  2P4R A;  3PVQ A;  3VS7 A;  2LMJ A;  2O31 A;  2GTO A;  1H92 A;  1HJD A;  2RQT A;  1M8M A;  1RLQ C;  3EG2 A;  1I1J A;  2EGC A;  4CC4 B;  2MIO A;  1NEG A;  2QDL A;  1Z9Z A;  2YUQ A;  2JMA A;  1T0J A;  2VVK A;  1X69 A;  2KEA A;  1YWP A;  4AFQ C;  4JJB A;  3JV3 A;  2YT6 A;  4QT7 A;  3VS6 A;  3UAT A;  4JPB W;  1B3Q A;  4LNP A;  5FW9 A;  2O88 A;  4HVV A;  1W1F A;  1W6X A;  1M30 A;  4Z8A A;  2JT4 A;  1K76 A;  4E6R A;  4F16 A;  2J06 A;  4J9H A;  2KXD A;  2RQU A;  1AWO A;  1PRL C;  3EHQ A;  1S1N A;  1GFD A;  2DYB A;  3KFV A;  4J9B A;  2FG0 A;  2C0O A;  2J05 A;  1Y0M A;  4JJC A;  2A28 A;  1SEM A;  2OI3 A;  2EPD A;  3ZL7 C;  2AZS A;  3VS1 A;  2RMO A;  4OMO A;  5IXB A;  3REA B;  5FWC A;  2RF0 A;  2AZV A;  2D8J A;  3EGU A;  4AG1 C;  2W10 A;  2CUB A;  1T3S A;  2CSI A;  2KRN A;  3PE0 A;  1FMK A;  4CC3 A;  1AWJ A;  1JXM A;  2F2W A;  1E6H A;  2H8H A;  1NLO C;  1PHT A;  1UJ0 A;  3M0Q A;  1CKB A;  2W0Z A;  4RTU A;  3UA7 A;  2DF6 A;  1OPL A;  1GBR A;  2LJ3 A;  1RLP C;  2DL5 A;  1PRM C;  1KIK A;  2F2V A;  2ED1 A;  2SRC A;  3QWX X;  1HD3 A;  3I5S A;  3UF4 A;  1I0C A;  1OV3 A;  2DE0 X;  1CKA A;  3I9Q A;  2NUZ A;  5GJW B;  1QWE A;  2KGT A;  3PVL A;  1HSQ A;  2A37 A;  1BB9 A;  3GBQ A;  2M51 A;  1ZLM A;  1QKX A;  3H0I A;  5L23 A;  2RQR A;  2F2X A;  5IXF A;  2LQW A;  5EC7 A;  4AFZ C;  2PZ1 A;  1VYT A;  2DBM A;  2D8H A;  2DVJ A;  1NEB A;  1T3L A;  1UEC A;  2G6F X;  2ROL A;  2HSP A;  2RQW A;  2L3Q A;  4D8K A;  1M3B A;  4JZ3 A;  1WXU A;  3ULR B;  4X1V A;  4J9F A;  1KFZ A;  2SEM A;  1LCK A;  2AKL A;  2BZX A;  2K6D A;  4RTV A;  3U23 A;  1AWX A;  3H41 A;  1X2K A;  1ABQ A;  2EGA A;  3TVT A;  2C0T A;  2JM9 A;  4RUG A;  1AOJ A;  4OMN A;  2JMC A;  3EHR A;  2C0I A;  3SHW A;  1ABO A;  1KJW A;  2J6K A;  1SRM A;  1RUW A;  2MOX A;  1NYF A;  1NM7 A;  4ORZ A;  1BU1 A;  3M0S A;  1U06 A;  2YUP A;  1M27 C;  4J9I A;  1UGV A;  1YNZ A;  4F17 A;  3UA6 A;  1QCF A;  2IIM A;  3NHN A;  2DL3 A;  2K79 A;  4F14 A;  1UUE A;  1SRL A;  1ZUK A;  2JW4 A;  1GRI A;  1WXT A;  3NPF A;  1WX6 A;  4IIM A;  1X27 A;  2J6F A;  2YSQ A;  4RTX A;  1OPK A;  2LQN A;  2X3W D;  4EIK A;  2GNC A;  3A98 A;  2ENM A;  3SEM A;  2RN8 A;  3CQT A;  3M0P A;  2KXC A;  2D1X A;  1AWW A;  1J3T A;  2J7I A;  1UHF A;  2LZ6 B;  4Y92 A;  2CRE A;  1GCP A;  1U5S A;  4ZNX A;  2DJQ A;  1ZX6 A;  2VKN A;  2KRS A;  2K7A A;  1AZG B;  1JXO A;  1KSW A;  2JTE A;  1YWO A;  1AVZ C;  1ZUY A;  2DBK A;  1Y57 A;  2DRK A;  4J9D A;  1VA7 A;  5GJV B;  2LCS A;  2KYM A;  4IIO A;  2DL8 A;  2D0N A;  2CH4 W;  3EG1 A;  3THK A;  4DEX A;  2JS0 A;  2KE9 A;  4R0K A;  2OJ2 A;  4RTY A;  1OOT A;  4LE9 A;  2FO0 A;  2B86 A;  2L0A A;  3NMZ C;  2BZY A;  2EYZ A;  2DA9 A;  2YDL A;  1WIE A;  2FRY A;  1U3O A;  2HBW A;  1UJY A;  2A08 A;  2RPN A;  3EG0 A;  1ZBJ A;  1K0X A;  4JJD A;  2BZ8 A;  3VS5 A;  4J9G A;  2L2P A;  1WFW A;  2DM1 A;  1AZE A;  4J9C A;  1NLP C;  2O2O A;  2LP5 A;  4Z89 A;  1SHF A;  5I11 A;  2L3P A;  1AD5 A;  1UHC A;  5IH2 A;  2HDA A;  4KRT A;  1WA7 A;  2HCK A;  2KRO A;  1X6G A;  2AK5 A;  5I22 A;  2JXB A;  1I07 A;  4AFU C;  2GGR A; 
#chains in the Genus database with same CATH topology
 1K9A A;  3JB9 F;  1IGQ A;  3BDL A;  5J39 A;  1EFN A;  3OYJ A;  1YHQ A;  1VQ6 T;  5M9O A;  1UDL A;  1B34 B;  4D6W A;  1M2O A;  1N9S A;  5CIU A;  4XU0 A;  4OGC A;  4ELZ C;  4BAC A;  2LJ1 A;  1GFC A;  4LDU A;  4PJO D;  2FZK B;  2ZGW A;  2HQE A;  1Q7Y R;  5CKB A;  3CD6 Q;  2PUK B;  3OS1 A;  5GMK h;  3CCM A;  1JRI A;  1VQN Q;  1M3A A;  2D9T A;  2R57 A;  3FDR A;  1WI7 A;  3I55 A;  4M7A G;  2V1R A;  3L2U A;  1WYX A;  3O5Z A;  1QP3 A;  4M78 E;  4E7Z A;  1WGS A;  2FPD A;  1M8V A;  2MAM A;  2X4X A;  3CCR T;  2KRM A;  3OYL A;  3JCM c;  3RBB B;  4LN2 A;  1YP5 A;  3CCQ A;  4ATO A;  3OMG A;  3SWN B;  1I4K 1;  1R0B G;  1TSF A;  4M7A B;  3CPW A;  1H8K A;  1JBM A;  1G8X A;  2BTT A;  3CXC P;  3CCM T;  3VKI A;  5KYY A;  2XDB A;  4LDY A;  7AT1 B;  5GAN 5;  3EFS A;  2FPF A;  2KT1 A;  1OU8 A;  1D3B B;  4J9E A;  1YCS B;  5IHI A;  1K1Z A;  1NPR A;  4N4G A;  4F7U F;  2EVR A;  5KE2 A;  1GXI E;  3EFO A;  1P92 A;  5A0L A;  2YUN A;  3HL8 A;  5GAO l;  2RQV A;  3HRT A;  1WDX A;  2COY A;  4RCB A;  4A4E A;  3CCQ T;  4QQD A;  1LNX A;  1VQ8 Q;  2ECZ A;  4FW2 A;  3EH1 A;  4XU1 A;  3E19 A;  3G4S Q;  4LUD A;  5HK3 A;  4QKU A;  1NBE B;  4DEY A;  2ZAE A;  3R6O A;  5GAO n;  2FRW A;  3NGP A;  1FWZ A;  1IZ6 A;  2LC4 A;  2EYW A;  1W70 A;  3JB9 G;  3UPU A;  3PIP A;  4CC7 A;  4XAX B;  3V8J A;  2YRC A;  3OW2 P;  4M78 C;  3LGF A;  4IUU A;  5FU6 B;  5D6Y A;  2J6O A;  2EGE A;  2I0N A;  3JB9 J;  4GBQ A;  4Z88 A;  5GAN 6;  3TCJ A;  3QWY A;  2RK2 A;  1VQ7 A;  1XQH A;  1SPK A;  1ZUU A;  3A8G B;  1RAB B;  1IB8 A;  1PKS A;  2E5Q A;  3VS0 A;  1IO6 A;  4LDV A;  1ZQ1 A;  4C5E A;  2XID A;  3M0R A;  1GCQ A;  4LD9 K;  3TSZ A;  5FRO A;  2RNA A;  1YN8 A;  5L8R E;  5AYF A;  1KQS S;  5LJ3 e;  4M7A E;  1ZHI A;  3M54 A;  3G6E Q;  4PL6 A;  1UGS B;  3SFM A;  2XKO C;  2LMJ A;  2O31 A;  2R5M A;  1HJD A;  5GMK i;  2RQT A;  2EGC A;  4CC4 B;  1NEG A;  1VQ7 T;  3CC4 Q;  1RAE B;  1KQ1 A;  2G3R A;  1QMC A;  5GAN d;  2QEX Q;  1UGR B;  4PNO A;  4C92 D;  2QGF B;  3H6Z A;  2KEA A;  2XI9 A;  2YT6 A;  3VS6 A;  3UAT A;  1K73 R;  4F7U G;  2QDY B;  4X34 A;  1B3Q A;  3CPW P;  4KUI A;  5FW9 A;  1TS9 A;  3ME9 A;  3GF5 A;  4Z8A A;  5DY9 A;  3V7S A;  1K76 A;  1WJR A;  4F16 A;  3MPU B;  1JJ2 S;  1QCN A;  4ZTF A;  1YFN A;  3VU3 C;  3KFV A;  5CQX A;  2KQW A;  1BI3 A;  5GMK m;  1W4S A;  2FG0 A;  2ATC B;  1RAA B;  4BI3 A;  2J05 A;  5LJ5 d;  5CVI A;  3M4Y A;  1I8F A;  2OI3 A;  8AT1 B;  3JCM h;  2EPD A;  3QBY A;  2NLU A;  1BI0 A;  4OMO A;  5IXB A;  5FWC A;  4XK8 E;  3G1J A;  2D8J A;  3EGU A;  2W10 A;  2K3X A;  3M56 A;  2KRN A;  2DD4 A;  1FMK A;  3V7C A;  2RI5 A;  3SWN C;  2F2W A;  2H8H A;  4WTO B;  4M7A C;  3M0Q A;  4HKE A;  3RKW A;  3PIO A;  3X25 B;  2VV5 A;  4OVA A;  2GQV A;  1GBR A;  1RLP C;  1Q7Y C;  4KGZ B;  5KCH A;  1M5Q 1;  2ED1 A;  1N27 A;  3I5S A;  5I2S A;  3I56 Q;  3CEY A;  1G3Y A;  3P8D A;  5GJW B;  2KVQ G;  3PVL A;  1LPL A;  5C6S A;  5KYY B;  2YHT A;  2M51 A;  2HZY A;  1WHJ A;  4ZN1 A;  5IXF A;  5EC7 A;  2IVW A;  4AFZ C;  2PZ1 A;  1BI1 A;  3HP9 A;  1K73 U;  2CP0 A;  2D8H A;  2DVJ A;  4A4F A;  4JJN K;  1T3L A;  4OB2 B;  2ZPF B;  2ROL A;  3MJX A;  2HSP A;  2RQW A;  4FYV B;  2LX9 A;  2QQR A;  3TU4 K;  1PSF A;  3BW1 A;  3CXC S;  2R5A A;  1LJO A;  4X1V A;  5LJ3 h;  1N9R A;  3OYN A;  2AKL A;  2GF7 A;  4YTL A;  2HL5 C;  3QJ6 A;  3HRU A;  2VGN A;  5EG2 A;  1VQL Q;  3MHX A;  3QDR B;  3CCV A;  4RUG A;  3HKS A;  4OMN A;  5KH6 A;  3EHR A;  4M7D A;  1KJW A;  1SRM A;  1W2B P;  2MOX A;  4QVD A;  4JUV A;  3OYK A;  2RJD A;  4ORZ A;  4ZTJ A;  3KXT A;  4QQ6 A;  2NUP A;  4C0D B;  3CCE A;  2X9H A;  1MMA A;  4MML A;  2NUT A;  1M27 C;  1YNZ A;  2JOY A;  4EMK A;  3QZ9 B;  4OB1 B;  1LOJ A;  1QCF A;  2IIM A;  4E7J A;  1X01 A;  3NTK A;  2K79 A;  4XTU A;  1RAI B;  3HFN A;  4F14 A;  2VGM A;  2JW4 A;  2OTL Q;  1GRI A;  3NPF A;  1WX6 A;  4OB3 B;  2YSQ A;  1S72 Q;  3CCV T;  2O4X A;  1NZ9 A;  2X3W D;  2IG0 A;  1VQ5 Q;  1PD1 A;  2RN8 A;  1VQM Q;  3CC7 Q;  2PUO B;  2J7I A;  1IHV A;  4RKU E;  4Y92 A;  3OW2 S;  3CCE T;  3E2U A;  1U5S A;  1ZSZ C;  3CCU Q;  3M53 A;  2ZPE B;  2OX7 A;  2V8I A;  5CKE A;  3KBG A;  1TWB A;  3CMA Q;  1G3S A;  1AVZ C;  1YIJ Q;  2EYQ A;  1OI1 A;  1ZUY A;  2DBK A;  1Y57 A;  4M78 D;  5GJV B;  4A4G A;  2KYM A;  1VIE A;  2CH4 W;  2JS0 A;  1OOT A;  4LE9 A;  2FO0 A;  4X9C A;  2EYZ A;  3CC2 A;  2DAQ A;  1VQ9 T;  2FRY A;  1Q81 U;  2HBW A;  2E6N A;  4MDW A;  1I5L A;  2YRD A;  4C92 E;  3GP8 A;  2RHX A;  4A54 A;  4P5N A;  5GAM f;  2P4T A;  3DB3 A;  1K73 C;  2QA4 T;  4FM4 B;  2RJF A;  1UHC A;  2HDA A;  3J7A F;  4KRT A;  1WA7 A;  1VUB A;  1I5O B;  5I22 A;  5D6W A;  3OYB A;  4AFU C;  2GGR A;  1G2B A;  1D3B A;  4LUE A;  1UFF A;  2M0Y A;  1K9M U;  4ESR A;  3CC2 T;  2E5K A;  4XU3 A;  4HT8 A;  5J3B A;  4AFS C;  3GNF B;  4FSS A;  3CD6 A;  1JO8 A;  1A0N B;  2GFU A;  3L2Z A;  1YJ9 Q;  1IXD A;  3FJP A;  5LL6 S;  2V1Q A;  1VQN A;  5GAO p;  1VQ4 T;  3FJ5 A;  1BI2 A;  3I5R A;  2E70 A;  4XQ3 A;  4OMF B;  1OEB A;  2CH4 A;  1H3H A;  2VYT A;  3I35 A;  3RUX A;  1JQQ A;  1MMN A;  2BIV A;  2E12 A;  5CO7 A;  1MNE A;  3OYE A;  2MWO A;  3M5A A;  1Z9Q A;  2K3Y A;  2MWP A;  2YUO A;  3OMC A;  1BK2 A;  2QTV A;  1GL5 A;  3M4G A;  2BE7 D;  2VWF A;  2KY9 A;  3G7Z A;  4K11 A;  1WHL A;  5D7U A;  3OY9 A;  2KBT A;  1D1C A;  4C92 C;  4KUL A;  3INZ A;  2DZ9 A;  5IAY A;  3JCM X;  1YBY A;  1E6G A;  2M9U A;  2CT3 A;  3H0H A;  2QYZ A;  1YCY A;  4M7A D;  4M75 F;  4EPC A;  1B07 A;  2HEQ A;  1V1C A;  3QJY A;  4M4Z A;  1M1G A;  2M0O A;  4C0G A;  2ESW A;  2NWM A;  1JB0 E;  2AKK A;  4CRI A;  2RHY A;  1KG1 A;  1TH7 A;  4DBR A;  4HVW A;  2CT4 A;  1MMD A;  4M77 F;  3VS4 A;  4Y91 A;  2ED0 A;  3JCM f;  3E1S A;  3J80 E;  2PVO B;  4IUT A;  3M0U A;  1TG0 A;  5GMK l;  4JZ4 A;  2HKN A;  1GCQ C;  4Y28 E;  4F04 B;  4EMK B;  2CZ7 B;  5LJ5 e;  1BIA A;  3LH0 A;  3LX7 A;  4A63 B;  3GOX A;  4BI4 A;  1X6B A;  3PTA A;  1MV3 A;  2PVD B;  5IHK A;  2DEU A;  3UDC A;  1TUG B;  1N5Z A;  5FU7 B;  2H3J A;  3OYF A;  1Q86 U;  4KUD K;  2ZZD A;  2O9V A;  2CGH A;  3M0T A;  1UTI A;  2F69 A;  1C1A A;  3IQL A;  1K9M C;  4LD6 A;  1UG1 A;  4HVU A;  4D8D A;  3CCL A;  4C5I A;  1YI2 T;  2EQI A;  2RI2 A;  3FB9 A;  4F7U A;  1WJQ A;  4HXJ A;  1TUC A;  2F1L A;  1SSH A;  3G6E A;  3QHS A;  2ROT A;  1YJN Q;  4FCY A;  3R6N A;  2OAW A;  2DYI A;  5GMK j;  1UE9 A;  1WLP B;  2HNI A;  2HMA A;  1Y96 B;  3BY7 A;  1T0H A;  2GFA A;  2P4R A;  3PVQ A;  2GTO A;  1M8M A;  3CCL T;  3EG2 A;  1I1J A;  2EKO A;  2JTM A;  3GIB A;  1Y07 A;  3HSB A;  4MZM A;  4PJO F;  4J5Y A;  2JMA A;  3QPH A;  1YHQ T;  2YLC A;  2VVK A;  1X69 A;  1YWP A;  2QXF A;  3TEE A;  3KUF A;  4M75 G;  1OQK A;  4QT7 A;  2AHJ B;  4HCC A;  4M7D E;  3SDZ A;  3H8Z A;  3WVD B;  2E1H A;  4LNP A;  2O88 A;  2JJ9 A;  3RKY A;  3FC3 A;  1VQP Q;  3ZEH A;  3CBP A;  2JT4 A;  4Z02 A;  2J06 A;  4J9H A;  2KXD A;  2RQU A;  1AWO A;  1PRL C;  4M77 G;  3EHQ A;  4DBH A;  1X75 C;  4M75 B;  3UT1 A;  3I55 T;  1S1N A;  5GAN 8;  1RAC B;  2K57 A;  5GAN h;  3OYM A;  4J9B A;  2RK1 A;  2XDD A;  2HQX A;  2E41 A;  2C0O A;  3FRN A;  1Y0M A;  2DJZ A;  2MK5 A;  1QVG A;  3VUZ A;  2RJE A;  2V8K A;  1SEM A;  1RL2 A;  2AZS A;  4M77 B;  1SKU B;  2DKG A;  1PD0 A;  5HY6 A;  2OTJ A;  1T3S A;  2OAU A;  5GAM j;  2EQU A;  1KHC A;  3I56 A;  3HPW A;  2R58 A;  2QG9 B;  4XTX A;  1PHT A;  2RB6 A;  1OX9 A;  1CKB A;  3UA7 A;  1HYO A;  2LDM A;  1D0X A;  3JCM Q;  3EGX B;  1UB4 A;  2DTH A;  5LJ5 h;  2DXT A;  3UF4 A;  1I0C A;  1FX7 A;  3LGL A;  2KI7 A;  5CQY A;  5A0D A;  1VQO A;  2NUZ A;  2OTJ T;  4JLG A;  1HSQ A;  1WQ7 A;  2RO0 A;  2DER A;  3MEV A;  4FT4 A;  3H0I A;  4M7D C;  3I56 T;  1M1K U;  2F2X A;  4ZGE B;  4AT1 B;  1VYT A;  5HKC A;  3OYY A;  2DBM A;  4PJO G;  3CBO A;  4EMK C;  4KBM B;  1VQL A;  2G6F X;  2DXB A;  4C5G A;  2A7Y A;  4PJJ A;  4JZ3 A;  1VQO T;  1WXU A;  2P0P A;  2CP7 A;  3JCM J;  3GNG A;  2E3H A;  4B6M A;  1LCK A;  2K6D A;  5FU7 C;  3H41 A;  1X2K A;  4JRQ A;  3TVT A;  4DBF A;  5I21 A;  4E7I A;  2MMP A;  3SHW A;  1FMW A;  2J6K A;  2L8D A;  1NYF A;  4FYW B;  5GAM g;  1W2B A;  3CCR Q;  4RG2 A;  4V2S A;  4N0A A;  2X35 A;  3G71 Q;  1VQL T;  1U06 A;  1S72 A;  2YUP A;  1VQ5 A;  4HT9 A;  4TVR A;  3NHN A;  4J7I A;  1VQM A;  4XTY A;  2F5T X;  2J6F A;  4L6V 5;  4F7U B;  4C0F A;  4RTX A;  3L2R A;  1OPK A;  4FSX A;  4EIK A;  3C95 A;  5CCA A;  2ENM A;  2MF2 A;  3MP1 A;  3CME Q;  3CCU A;  1TTH B;  3CQT A;  1QVG P;  2L5Q A;  1SSF A;  2KXC A;  1AWW A;  4C0Z A;  4LDW A;  3CMA A;  3QO3 A;  1YIJ A;  1GCP A;  2JNG A;  2YXY A;  1VQ5 T;  3CCQ Q;  5GAM d;  2QGG A;  2K7A A;  1QVF A;  2E3I A;  4C8Q A;  1KSW A;  1VQM T;  2RHU A;  4OB0 B;  3RES A;  1YWO A;  4BD3 A;  2COW A;  1H64 1;  2O01 E;  4J9D A;  2LCS A;  4RG8 A;  2LCC A;  4IIO A;  4JS5 A;  2VB6 A;  2D0N A;  3THK A;  2RHZ A;  2KE9 A;  3SD4 A;  4RTY A;  1VQK Q;  3P8H A;  3MCA B;  1TU0 B;  2L0A A;  1X6O A;  3EH2 A;  3CMA T;  3HHT B;  1YIJ T;  3L1A A;  2VXE A;  4FYY B;  2X4Y A;  3EG0 A;  5DLQ E;  1K0X A;  2BZ8 A;  1HK9 A;  3EG9 A;  1PCX A;  1AZE A;  2O2O A;  2LP5 A;  1G3T A;  2DD5 A;  3HFO A;  1AD5 A;  2DTO A;  1ZA1 B;  2HCK A;  2AK5 A;  1YJ9 A;  1I07 A;  2QQ9 A;  2E6Z A;  2FL7 A;  4JRP A;  3C0C A;  4IUV A;  2DRM A;  2HAX A;  4JS4 A;  2PU9 B;  3JCM g;  1Q81 R;  4BDZ A;  2PTK A;  1WHG A;  2DL7 A;  2FPE A;  2GTJ A;  4E7S A;  4F7U E;  4C8Q F;  3TSW A;  1VQ7 Q;  2VC8 A;  4AG2 C;  5FU6 C;  2DMO A;  3JCM V;  3V7R A;  2WSE E;  1K0S A;  2JTF A;  2KK4 A;  1JEG A;  1YJ9 T;  5GAN 3;  1VYV A;  1QW1 A;  1BBZ A;  1BYM A;  3VYH B;  2JS2 A;  4E47 A;  1QKW A;  2RH2 A;  4BE1 A;  1VYU A;  1K9M R;  3NTH A;  4RTZ A;  4O6J A;  4Q5W A;  4ZGD B;  4RMO A;  3JAM E;  5FWB A;  2GQI A;  2K2M A;  5IHN A;  5KYW A;  3MP8 A;  3RNJ A;  3OYG A;  3VS2 A;  1MGQ A;  1ARK A;  2LNH B;  1ZSG A;  4CI0 C;  2DIL A;  1M3C A;  3Q1J A;  1MV0 B;  2LCL A;  3LH5 A;  4HCK A;  2A36 A;  2D6F A;  1KC8 U;  4J7F A;  6AT1 B;  3A8M B;  2DL4 A;  3OYI A;  1QVF P;  2KYB A;  2EYX A;  4IUR A;  2LNV A;  4II1 A;  4EMH A;  5GAN f;  3JB9 H;  1IGU A;  2QTX A;  2X51 A;  2QQA A;  1D0Y A;  2EQJ A;  2ABL A;  2RM4 A;  1Y96 A;  4NL3 A;  4MZP A;  4BUG A;  1SHG A;  3WVE B;  3MEA A;  4OML A;  4M7D D;  4M78 F;  1TUD A;  2XIC A;  2P84 A;  3MEW A;  3OS2 A;  3MKD A;  4DQ2 A;  1RI9 A;  4LXC A;  4R56 A;  2XMF A;  3CBM A;  2O9S A;  2PVG B;  4RTW A;  1K4U S;  2EBP A;  3H9N A;  5C0M A;  2AIR B;  1WNL A;  4ZGJ B;  1FYN A;  2HD0 A;  1PWT A;  4UC4 A;  4PJL A;  4PK4 A;  1YJN A;  1SG5 A;  4C8Q G;  5GAN 4;  4OMQ A;  1H3Z A;  1Y7X A;  2XHC A;  1CSK A;  1XOV A;  4M75 A;  3CPW S;  2CP3 A;  5KCO A;  4O5V A;  2LQ8 A;  1OZ3 A;  3OS0 A;  4GLK A;  4AMC A;  1C6V X;  3VRZ A;  5GAO q;  4C8Q B;  2Y4Y A;  2QQS A;  4M77 A;  2KR3 A;  2K5F A;  1QCO A;  3EG3 A;  1K8A R;  1G83 A;  1QVG S;  2CZ1 B;  5KYN A;  1X43 A;  2KT8 A;  2EAY A;  1YJN T;  1Q86 R;  1O9S A;  3VS7 A;  2CKK A;  1H92 A;  3BE3 A;  3JCM W;  3PT9 A;  1RLQ C;  2QDL A;  5KYU A;  2EIF A;  2YUQ A;  4J6X A;  1T0J A;  1AHJ B;  3CD6 T;  3VJP A;  2E10 A;  2QAS A;  3L2Q A;  2XK0 A;  3EGX A;  1VQP A;  4JRI A;  4AFQ C;  3EG9 B;  2KAF A;  1VQN T;  2V26 A;  1EX4 A;  1U8R A;  3O8V A;  3QXE B;  4HVV A;  1W6X A;  3QZ5 B;  1M1F A;  4E6R A;  4IKF A;  4KH0 B;  4NS5 A;  5GAN 2;  1GFD A;  1WHH A;  2DYB A;  1VQ8 A;  4HA8 A;  5CKF A;  2Y4X A;  1B7T A;  4C0D C;  4M78 G;  4M7A F;  3G4S A;  1VOM A;  2A28 A;  2PQW A;  3LWI A;  1V76 A;  1NE8 A;  3S3M A;  1IRE B;  1D09 B;  5FRM A;  1M9S A;  2RMO A;  4X9D A;  3REA B;  3ER0 A;  2AZV A;  1Q81 C;  1M2V B;  3DLL A;  1WJS A;  4CC3 A;  4KGV B;  2BUD A;  4M78 B;  4PJM A;  3OYH A;  4PJO A;  1AWJ A;  1KHI A;  1JXM A;  2RA2 A;  2VXF A;  1U1S A;  4OF1 A;  1VQ9 Q;  2W0Z A;  1VQ8 T;  4RTU A;  3LLR A;  4ELY C;  4C8Q E;  2DF6 A;  1OPL A;  4XTZ A;  2CZ0 B;  1C0M A;  1KIK A;  3G4S T;  2DEQ A;  2BE9 B;  2SRC A;  1K8A U;  2EJG A;  3QWX X;  1FMV A;  2ZPI B;  1OX8 A;  5GAM e;  1OV3 A;  1G5V A;  2DVE A;  2QA4 Q;  2DE0 X;  5KYW B;  1WZO A;  4ME7 A;  1W2B S;  1YJW Q;  4ANJ A;  3M58 A;  3VUB A;  1QWE A;  2KGT A;  2ZCF B;  2KMT A;  3HTR A;  2A37 A;  1O75 A;  3GBQ A;  1ZLM A;  1R0C B;  1KK7 A;  5L23 A;  1QQJ A;  3JCM b;  3ASK A;  3JB9 D;  4PFP A;  4N0A C;  2JN0 A;  4FT2 A;  4A53 A;  4JDS A;  3CC4 A;  1G3W A;  4B9W A;  1VQ4 Q;  2L3Q A;  4A4K A;  2QEX A;  2MPX C;  5DLO A;  2D0Q B;  3ULR B;  5IN1 A;  1KFZ A;  2HBP A;  4PLI A;  2Y90 A;  2SEM A;  4OGE A;  3JSC A;  2GCX A;  1N8R U;  1AWX A;  3CCR A;  4E7K A;  3OBW A;  1ABQ A;  5LJ3 f;  3RKX A;  3G71 A;  1EZZ B;  1QVF S;  3G6E T;  1M1K R;  1ABO A;  1IRX A;  3QG1 A;  1RUW A;  3WXM B;  3A1P A;  1KQ2 A;  1BU1 A;  3M0S A;  3CC4 T;  1Y71 A;  3OB9 A;  2QEX T;  1YIT Q;  1OYX A;  4F17 A;  2DO3 A;  4C8Q C;  5FLX E;  3UA6 A;  4BE2 A;  3CME A;  2DL3 A;  1QVP A;  2EJF A;  1UUE A;  5GAN j;  1ZUK A;  5AT1 B;  1WXT A;  2K4Y A;  2QQB A;  3G71 T;  4IIM A;  1X27 A;  2EJ9 A;  3EFR A;  4L5G A;  2WSF E;  3DLM A;  2GNC A;  2JVV A;  3SEM A;  9ATC B;  4E7H A;  1WPY A;  1ZA2 B;  2D1X A;  3V8L A;  1J3T A;  5KYX B;  3OYA A;  3F70 A;  1UHF A;  4FU6 A;  3M59 A;  3CCS Q;  1D1B A;  2CRE A;  2JZ2 A;  1UEB A;  1OZ2 A;  2MI6 A;  4XU2 A;  4ZNX A;  2M02 A;  2CS7 A;  2DJQ A;  3JCM P;  2FB7 A;  3CME T;  2AT1 B;  2KRS A;  1VQK A;  2BKD N;  3JCM e;  1XJW B;  2EFI A;  4KT0 E;  5KYU B;  1MMG A;  4FIB A;  3T9N A;  5LJ5 j;  1VA7 A;  1K8A C;  4ZN3 A;  2DK3 A;  3PMI A;  2A3L A;  1BKB A;  3EG1 A;  4DEX A;  1UGP B;  5A2Q E;  4R0K A;  2OJ2 A;  1Q86 C;  4QW2 A;  1RAF B;  4C92 A;  5I2M A;  3NMZ C;  2YDL A;  3ZFJ A;  1U3O A;  1WHM A;  2RPN A;  3CCJ Q;  5J26 A;  1ZBJ A;  5GAM h;  1VQK T;  2K2V A;  3LW5 E;  2L2P A;  1WFW A;  1PM3 A;  1BCO A;  2E65 A;  1YI2 Q;  1NPP A;  4BI8 B;  4Z89 A;  5CKH A;  1I81 A;  4PJN A;  1Q7Y U;  2L3P A;  5IH2 A;  1VQ6 Q;  1R77 A;  2KRO A;  4DOV A;  5GAN g;  4DOW A;  3M0P A;  3X28 B;  4RTT A;  1N8R C;  1D0Z A;  2XG8 D;  3H0F A;  2K5I A;  2DNU A;  3OA6 A;  1Q82 R;  1TXQ A;  4DA4 A;  2LVM A;  4M75 E;  1HXD A;  3E9F A;  3OSV A;  4QQG A;  2K9G A;  3CCL Q;  4PJO B;  1BCM A;  2EQM A;  2LT4 A;  4WF2 A;  2JUF A;  4LDX A;  2XDP A;  1YHQ Q;  4WCI A;  4GY5 A;  3NFC A;  4VUB A;  3DB4 A;  2LJ0 A;  3FEO A;  2CSQ A;  2OTL A;  1SF9 A;  4M77 E;  3X24 B;  5GAO r;  3C4S A;  4C92 F;  2DLP A;  3DKM A;  2COZ A;  5LJ5 g;  5ECA A;  2KDS A;  3SB2 A;  1QLY A;  3CCM Q;  3V8K A;  2FEI A;  3CC7 A;  1ZSZ B;  3P8B B;  2WSC E;  3C94 A;  3D7S B;  5CAI A;  3PFS A;  2DET A;  4OMP A;  3TQ7 P;  4BE0 A;  3I55 Q;  2L89 A;  2X4J A;  1BIB A;  3EGD B;  1QWF A;  2PNI A;  3BDU A;  1U1T A;  3FIF A;  3JB9 I;  3VRY A;  2P0Q A;  4MDX A;  2OTL T;  2L3S A;  2JM8 A;  3A8H B;  3BFM A;  2HKQ B;  3X20 B;  4B9X A;  1X2Q A;  1S72 T;  2MCN A;  2FVU A;  3QKJ A;  2M1H A;  1F1B B;  4A4H A;  4E2F B;  2DTI A;  2X3X D;  5DM7 R;  3RMS A;  3CC7 T;  5GAN 7;  1V29 B;  4GLM A;  1RAD B;  3VS3 A;  2QI2 A;  4MZT A;  4RCC A;  2CDT A;  2CZ6 B;  1WXB A;  4HCZ A;  1N6A A;  3MEU A;  3CCU T;  2XD0 A;  4BY6 B;  5HK0 A;  4M75 C;  5HCK A;  2K3B A;  2KNB B;  1Q95 G;  2F5K A;  1Q82 U;  2CP2 A;  1PSE A;  4PLL A;  4OMM A;  1MUZ A;  2Z0W A;  4XTW A;  5CKD A;  1KC8 R;  4KH1 B;  1M1K C;  4PJO E;  2OTJ Q;  3J81 E;  4M77 C;  4IUP A;  3NTI A;  1NJI R;  2EW3 A;  2EYY A;  1MHN A;  1M90 R;  4FYX B;  3UWN A;  1LVK A;  1WQW A;  1E7O A;  4NL2 A;  4BDY A;  4CC2 A;  1PNJ A;  2RHI A;  1NG2 A;  1NYG A;  2DFU A;  1KD1 R;  5LJ3 j;  2GBQ A;  2DXC A;  4FL6 A;  1JU5 C;  4FW1 A;  2EKH A;  2I2L A;  1VQO Q;  2C06 A;  2CP5 A;  1GBQ A;  2DX1 A;  3EFO B;  4C92 G;  1PKT A;  3LYI A;  2CUD A;  3MP6 A;  2YLB A;  1D1A A;  3QUI A;  2DIG A;  4C8Q D;  1RI0 A;  5CR2 A;  1AEY A;  2LX7 A;  3REB B;  4NOY A;  1M2V A;  4XTV A;  2M16 A;  2P0K A;  4OP0 A;  4M78 A;  2MIO A;  4C92 B;  1Z9Z A;  2DIQ A;  3OQ5 A;  4KGX B;  2X4W A;  4QVZ A;  4JJB A;  3JV3 A;  2FZC B;  4PKC C;  2LQK A;  3EAE A;  4JPB W;  2FYK A;  3JCM d;  3M9Q A;  5GAO m;  1W1F A;  2L3R A;  2RJC A;  4PJO C;  1DJ7 B;  1M30 A;  3FLG A;  3QDF A;  1AT1 B;  2IPO B;  4C5H A;  1UGQ B;  2DXU A;  1RAG B;  1KQS A;  1NJI U;  1M90 U;  4JJC A;  1MND A;  5LJ3 g;  1ACM B;  1R8O B;  3OYD A;  3ZL7 C;  3AT1 B;  1VQ9 A;  2ZPB B;  3VS1 A;  2YWW A;  1KD1 U;  1Q82 C;  3N5B B;  2RI3 A;  2RF0 A;  3RR6 A;  4AG1 C;  2CUB A;  2CSI A;  2VUB A;  3PE0 A;  1B34 A;  4IUQ A;  1PG5 B;  1RAH B;  4HCB A;  2CYZ B;  2EQK A;  2EWN A;  4E7L A;  1E6H A;  1NLO C;  1UJ0 A;  3E9G A;  2QA4 A;  2A0F B;  2ZPG B;  2E64 A;  1YJW A;  4M7D F;  2HQH A;  1TOV A;  2LJ3 A;  1EIF A;  3X26 B;  2DL5 A;  1PRM C;  2F2V A;  3VYG A;  1HD3 A;  4L59 A;  2FHD A;  4JRK A;  2VAS A;  5LJ5 f;  1CKA A;  1JJ2 A;  3I9Q A;  4R55 A;  3C12 A;  5LJ3 d;  3QII A;  1IHW A;  4EMG A;  4QVC A;  1BB9 A;  1QKX A;  2YRV A;  5A0G A;  3S6W A;  2RQR A;  4BY6 C;  2DZC A;  1VQ4 A;  2LQW A;  2LRQ A;  3SWN A;  1YJW T;  3AHU A;  4M7A A;  2K5L A;  5KYX A;  1NEB A;  1UEC A;  4D8K A;  2QAZ A;  1M3B A;  2NYS A;  4PFO A;  3M57 A;  3RDV A;  3PMT A;  3A8O B;  4J9F A;  3QSU A;  3GLX A;  3RMQ A;  3U23 A;  2BZX A;  4RTV A;  3S3O A;  3L42 A;  4PFZ A;  3MET A;  2HSE B;  2B8A A;  2EGA A;  2C0T A;  2XU8 A;  3JRZ A;  5GMK e;  2JM9 A;  2DPP B;  1YIT A;  1AOJ A;  2JMC A;  2C0I A;  3CPF A;  8ATC B;  1QP2 A;  1NM7 A;  3TRE A;  4N4H A;  2V8J A;  4DBQ A;  1VIF A;  3CCV Q;  1FXX A;  4J8O A;  4J9I A;  1UGV A;  3VV0 A;  5IT9 E;  1KC8 C;  3QYH B;  1OU9 A;  5KE3 A;  1SRL A;  2CP6 A;  4J6W A;  4N4I A;  1N8R R;  3CCS A;  1NJI C;  3CCE Q;  1XTD A;  3L2W A;  1M90 C;  1KQS P;  2LQN A;  1YIT T;  4J6Y A;  4M75 D;  3A98 A;  3RER A;  1M4Z A;  1VQP T;  5CK9 A;  3OYC A;  3CXC A;  3OSS C;  1XNI A;  5GAN e;  2LZ6 B;  1KD1 C;  4J83 A;  1ZBX A;  1OUL A;  4M7D G;  3MO8 A;  2RD1 A;  1ZX6 A;  3OBY A;  3PNW C;  3A5Z B;  3PGG A;  3S3N A;  2KSS A;  2VKN A;  4M77 D;  3M55 A;  4MMK A;  1AZG B;  3RIR A;  3A8L B;  1JXO A;  3OS5 A;  3CCS T;  2JTE A;  4EDU A;  2DRK A;  2FZG B;  3CCJ A;  2DL8 A;  2ZPH B;  4M7D B;  3LWH A;  2H3E B;  2LT1 A;  2B86 A;  2HL3 A;  3GPL A;  1JJ2 P;  2BZY A;  1YI2 A;  2DA9 A;  2E4H A;  1WIE A;  1PC0 A;  2MYS A;  2NUP B;  5FRN A;  2NUT B;  1UJY A;  2A08 A;  1VQ6 A;  4JJD A;  1ZSZ A;  4JLI A;  5D6X A;  3VS5 A;  4J9G A;  2DM1 A;  3URG A;  4J9C A;  1NLP C;  3CC2 Q;  1SHF A;  3EGD A;  2LTO A;  5I11 A;  3HRS A;  2O4X B;  3QYG B;  2WAC A;  2QK0 A;  3CCJ T;  3OW2 A;  1WHK A;  1X6G A;  2JXB A;  3L2V A;  3ZBD A;  4BB7 A; 
#chains in the Genus database with same CATH homology
 1G2B A;  1K9A A;  4LUE A;  4RTT A;  1UFF A;  2M0Y A;  3C0C A;  4ESR A;  2DRM A;  1EFN A;  2E5K A;  3H0F A;  2DNU A;  4AFS C;  4FSS A;  1JO8 A;  1A0N B;  1UDL A;  2PTK A;  2DL7 A;  2FPE A;  2GTJ A;  2K9G A;  2V1Q A;  3TSW A;  3FJ5 A;  4AG2 C;  2DMO A;  2LJ1 A;  1GFC A;  3I5R A;  4WCI A;  1K0S A;  1OEB A;  2CH4 A;  2LJ0 A;  1H3H A;  3I35 A;  1JEG A;  2CSQ A;  1JQQ A;  1VYV A;  1M3A A;  2DLP A;  1BBZ A;  1WI7 A;  2JS2 A;  2V1R A;  1QKW A;  5ECA A;  1WYX A;  1Z9Q A;  1VYU A;  3O5Z A;  4RTZ A;  2YUO A;  2FPD A;  1QLY A;  1BK2 A;  1GL5 A;  2FEI A;  2VWF A;  2KRM A;  5FWB A;  4OMP A;  2GQI A;  2K2M A;  4K11 A;  3RBB B;  5IHN A;  4LN2 A;  1YP5 A;  3RNJ A;  1QWF A;  2KBT A;  2PNI A;  3VS2 A;  1ARK A;  3VRY A;  1H8K A;  2BTT A;  2LNH B;  1ZSG A;  2DIL A;  1M3C A;  1E6G A;  1MV0 B;  2L3S A;  3LH5 A;  4HCK A;  2CT3 A;  3H0H A;  2JM8 A;  2A36 A;  2FPF A;  2KT1 A;  1X2Q A;  4J9E A;  2MCN A;  2DL4 A;  1YCS B;  1B07 A;  2HEQ A;  5IHI A;  1K1Z A;  1V1C A;  2EVR A;  4M4Z A;  2KYB A;  2EYX A;  2ESW A;  2NWM A;  2AKK A;  2X3X D;  2YUN A;  2RQV A;  4GLM A;  3VS3 A;  1WDX A;  2ABL A;  2CDT A;  4HVW A;  2CT4 A;  1WXB A;  3VS4 A;  1SHG A;  2ED0 A;  5HCK A;  2ECZ A;  2K3B A;  4OML A;  2KNB B;  4LUD A;  3M0U A;  1TG0 A;  1TUD A;  4JZ4 A;  4DEY A;  4OMM A;  1GCQ C;  1MUZ A;  1RI9 A;  2FRW A;  3NGP A;  4A63 B;  2XMF A;  2O9S A;  2EYW A;  1X6B A;  4RTW A;  1MV3 A;  1K4U S;  1W70 A;  2EBP A;  5IHK A;  2EW3 A;  2EYY A;  4CC7 A;  1N5Z A;  1FYN A;  1PWT A;  2O9V A;  3M0T A;  1E7O A;  1UTI A;  4CC2 A;  1PNJ A;  3IQL A;  1NG2 A;  1NYG A;  2J6O A;  2EGE A;  1UG1 A;  2I0N A;  4GBQ A;  4HVU A;  4OMQ A;  4Z88 A;  4D8D A;  1CSK A;  3QWY A;  1XOV A;  2GBQ A;  2EQI A;  1SPK A;  1ZUU A;  1JU5 C;  2EKH A;  1PKS A;  4HXJ A;  1TUC A;  1SSH A;  3VS0 A;  1IO6 A;  2ROT A;  2DX1 A;  1GBQ A;  3M0R A;  1GCQ A;  3VRZ A;  1PKT A;  3TSZ A;  2RNA A;  1YN8 A;  2CUD A;  3R6N A;  2OAW A;  1UE9 A;  2KR3 A;  1WLP B;  3EG3 A;  1G83 A;  1T0H A;  1AEY A;  1X43 A;  2KT8 A;  2LX7 A;  3REB B;  2P4R A;  3PVQ A;  3VS7 A;  2LMJ A;  2O31 A;  2GTO A;  1H92 A;  1HJD A;  2RQT A;  1M8M A;  1RLQ C;  3EG2 A;  1I1J A;  2EGC A;  4CC4 B;  2MIO A;  1NEG A;  2QDL A;  1Z9Z A;  2YUQ A;  2JMA A;  1T0J A;  2VVK A;  1X69 A;  2KEA A;  1YWP A;  4AFQ C;  4JJB A;  3JV3 A;  2YT6 A;  4QT7 A;  3VS6 A;  3UAT A;  4JPB W;  1B3Q A;  4LNP A;  5FW9 A;  2O88 A;  4HVV A;  1W1F A;  1W6X A;  1M30 A;  4Z8A A;  2JT4 A;  1K76 A;  4E6R A;  4F16 A;  2J06 A;  4J9H A;  2KXD A;  2RQU A;  1AWO A;  1PRL C;  3EHQ A;  1S1N A;  1GFD A;  2DYB A;  3KFV A;  4J9B A;  2FG0 A;  2C0O A;  2J05 A;  1Y0M A;  4JJC A;  2A28 A;  1SEM A;  2OI3 A;  2EPD A;  3ZL7 C;  2AZS A;  3VS1 A;  2RMO A;  4OMO A;  5IXB A;  3REA B;  5FWC A;  2RF0 A;  2AZV A;  2D8J A;  3EGU A;  4AG1 C;  2W10 A;  2CUB A;  1T3S A;  2CSI A;  2KRN A;  3PE0 A;  1FMK A;  4CC3 A;  1AWJ A;  1JXM A;  2F2W A;  1E6H A;  2H8H A;  1NLO C;  1PHT A;  1UJ0 A;  3M0Q A;  1CKB A;  2W0Z A;  4RTU A;  3UA7 A;  2DF6 A;  1OPL A;  1GBR A;  2LJ3 A;  1RLP C;  2DL5 A;  1PRM C;  1KIK A;  2F2V A;  2ED1 A;  2SRC A;  3QWX X;  1HD3 A;  3I5S A;  3UF4 A;  1I0C A;  1OV3 A;  2DE0 X;  1CKA A;  3I9Q A;  2NUZ A;  5GJW B;  1QWE A;  2KGT A;  3PVL A;  1HSQ A;  2A37 A;  1BB9 A;  3GBQ A;  2M51 A;  1ZLM A;  1QKX A;  3H0I A;  5L23 A;  2RQR A;  2F2X A;  5IXF A;  2LQW A;  5EC7 A;  4AFZ C;  2PZ1 A;  1VYT A;  2DBM A;  2D8H A;  2DVJ A;  1NEB A;  1T3L A;  1UEC A;  2G6F X;  2ROL A;  2HSP A;  2RQW A;  2L3Q A;  4D8K A;  1M3B A;  4JZ3 A;  1WXU A;  3ULR B;  4X1V A;  4J9F A;  1KFZ A;  2SEM A;  1LCK A;  2AKL A;  2BZX A;  2K6D A;  4RTV A;  3U23 A;  1AWX A;  3H41 A;  1X2K A;  1ABQ A;  2EGA A;  3TVT A;  2C0T A;  2JM9 A;  4RUG A;  1AOJ A;  4OMN A;  2JMC A;  3EHR A;  2C0I A;  3SHW A;  1ABO A;  1KJW A;  2J6K A;  1SRM A;  1RUW A;  2MOX A;  1NYF A;  1NM7 A;  4ORZ A;  1BU1 A;  3M0S A;  1U06 A;  2YUP A;  1M27 C;  4J9I A;  1UGV A;  1YNZ A;  4F17 A;  3UA6 A;  1QCF A;  2IIM A;  3NHN A;  2DL3 A;  2K79 A;  4F14 A;  1UUE A;  1SRL A;  1ZUK A;  2JW4 A;  1GRI A;  1WXT A;  3NPF A;  1WX6 A;  4IIM A;  1X27 A;  2J6F A;  2YSQ A;  4RTX A;  1OPK A;  2LQN A;  2X3W D;  4EIK A;  2GNC A;  3A98 A;  2ENM A;  3SEM A;  2RN8 A;  3CQT A;  3M0P A;  2KXC A;  2D1X A;  1AWW A;  1J3T A;  2J7I A;  1UHF A;  2LZ6 B;  4Y92 A;  2CRE A;  1GCP A;  1U5S A;  4ZNX A;  2DJQ A;  1ZX6 A;  2VKN A;  2KRS A;  2K7A A;  1AZG B;  1JXO A;  1KSW A;  2JTE A;  1YWO A;  1AVZ C;  1ZUY A;  2DBK A;  1Y57 A;  2DRK A;  4J9D A;  1VA7 A;  5GJV B;  2LCS A;  2KYM A;  4IIO A;  2DL8 A;  2D0N A;  2CH4 W;  3EG1 A;  3THK A;  4DEX A;  2JS0 A;  2KE9 A;  4R0K A;  2OJ2 A;  4RTY A;  1OOT A;  4LE9 A;  2FO0 A;  2B86 A;  2L0A A;  3NMZ C;  2BZY A;  2EYZ A;  2DA9 A;  2YDL A;  1WIE A;  2FRY A;  1U3O A;  2HBW A;  1UJY A;  2A08 A;  2RPN A;  3EG0 A;  1ZBJ A;  1K0X A;  4JJD A;  2BZ8 A;  3VS5 A;  4J9G A;  2L2P A;  1WFW A;  2DM1 A;  1AZE A;  4J9C A;  1NLP C;  2O2O A;  2LP5 A;  4Z89 A;  1SHF A;  5I11 A;  2L3P A;  1AD5 A;  1UHC A;  5IH2 A;  2HDA A;  4KRT A;  1WA7 A;  2HCK A;  2KRO A;  1X6G A;  2AK5 A;  5I22 A;  2JXB A;  1I07 A;  4AFU C;  2GGR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...