3IQLA

Crystal structure of the rat endophilin-a1 sh3 domain
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
66
structure length
66
Chain Sequence
SVGSDQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVALPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title SH3 domains from a subset of BAR proteins define a Ubl-binding domain and implicate parkin in synaptic ubiquitination.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Protein binding
molecule keywords Endophilin-A1
total genus 12
structure length 66
sequence length 66
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-08-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 3iqlA00
2W0ZA 1PRMC 5I22A 1T0HA 4CC3A 1ZLMA 2P4RA 2JS2A 1NYFA 4JZ3A 1PHTA 1J3TA 1K4US 5GJVB 2LP5A 1WA7A 1YWOA 1Y0MA 4OMNA 5FWCA 2AZVA 2YT6A 1NEGA 1CSKA 1Y57A 2DMOA 1I1JA 2X3XD 2HEQA 2JS0A 2F2XA 1ZBJA 3H41A 4AFQC 1UFFA 4AG2C 3UA6A 1PNJA 1RUWA 5HCKA 4D8DA 2FG0A 1ZUKA 2HCKA 2QDLA 4CC4B 2DRMA 4IIOA 3VRZA 5ECAA 1GFCA 1GBRA 1KJWA 4JJCA 2DL3A 2KE9A 1GL5A 1E6HA 1OPKA 1ARKA 2DBKA 4RTUA 1G83A 1GCQA 2M0YA 2IIMA 1OPLA 2RQRA 4RTWA 2DL7A 4J9FA 2KEAA 2RN8A 3PVQA 1T3LA 1VA7A 1X2KA 2X3WD 2DNUA 3SEMA 1S1NA 2A36A 2NWMA 1JEGA 2SRCA 2EYYA 2LJ0A 3UA7A 1X2QA 2J7IA 2CDTA 2J05A 4JPBW 2FPDA 1WI7A 4K11A 4LUDA 1YCSB 3U23A 2LQNA 4RTZA 3IQLA 5IHNA 1A0NB 2OJ2A 2CSQA 1UDLA 2D1XA 4JJDA 1QLYA 2JT4A 2K6DA 1W70A 1X43A 2CT4A 1BBZA 3VS4A 2KR3A 1BB9A 2KXDA 2O9VA 1JXMA 2A28A 1X69A 1KIKA 3UATA 1YN8A 2VKNA 2VWFA 2PNIA 2ABLA 5IH2A 1SEMA 1V1CA 3EG2A 2C0OA 1CKAA 2LX7A 4Y92A 1M3BA 4D8KA 1IO6A 2O88A 1TUCA 1ZUUA 2XMFA 1QWFA 4OMPA 3NPFA 1FYNA 2CH4W 1HD3A 1RI9A 2GBQA 2JM8A 1UE9A 4CC2A 2DL8A 4A63B 3M0PA 2OI3A 2MOXA 4QT7A 1ABQA 3VS5A 3VS7A 2CUDA 5L23A 1MUZA 2C0IA 2KBTA 4J9IA 4J9EA 4HVUA 1TG0A 4LNPA 1UJYA 1VYTA 4LUEA 4Z88A 1T3SA 3RNJA 4HVWA 1NM7A 2OAWA 2PZ1A 2L0AA 3RBBB 2AKLA 2BTTA 1B07A 4J9BA 3O5ZA 3NGPA 4F14A 1UHCA 1WXUA 4RUGA 4M4ZA 2VVKA 2DVJA 4J9CA 2DX1A 3C0CA 2KT8A 3REBB 2EKHA 4GLMA 2F2WA 3CQTA 3M0UA 5FWBA 1JU5C 3I9QA 1ZX6A 1SHGA 1PKTA 2DF6A 1NLPC 2JTEA 3FJ5A 1GCQC 3EG0A 1QWEA 2SEMA 1W1FA 2AK5A 1QKWA 1YNZA 1HJDA 2K2MA 4AG1C 2EVRA 1X6BA 3NHNA 1FMKA 2F2VA 2EGAA 1M30A 4Z8AA 2L3PA 2J6KA 3EHQA 1CKBA 2O9SA 2DA9A 2YDLA 4RTXA 1U3OA 3H0HA 5IHIA 2DE0X 3PVLA 2JM9A 2YUNA 4CC7A 1WDXA 1JXOA 1KFZA 3VS0A 1PRLC 3UF4A 2L3QA 3M0QA 2NUZA 2EYXA 1OV3A 4J9HA 1AWXA 1G2BA 2MCNA 4JJBA 4HCKA 2EQIA 1PWTA 2KGTA 2L2PA 1UJ0A 2RPNA 1RLQC 2KNBB 1XOVA 3EGUA 2LCSA 1JQQA 2LJ1A 2CREA 1SHFA 2LNHB 3THKA 2HSPA 2KRSA 1UGVA 1JO8A 3NMZC 1VYUA 2A37A 1W6XA 2A08A 2LJ3A 3M0RA 1TUDA 1YWPA 3EHRA 4F17A 1GCPA 2BZXA 2D8HA 2ROLA 2H8HA 2RMOA 2V1RA 1QKXA 3VS6A 1MV0B 1MV3A 2CSIA 3R6NA 2W10A 2JXBA 2D0NA 2CH4A 2K7AA 2EBPA 2AKKA 2AZSA 1E7OA 2RQUA 2DL5A 2GGRA 2K79A 1NYGA 2LMJA 2B86A 3M0SA 4EIKA 1KSWA 1B3QA 2O2OA 4J9GA 2FPFA 4RTYA 2J06A 2ESWA 5IHKA 2DJQA 4JZ4A 2ENMA 2FO0A 3ULRB 4DEYA 2CUBA 4WCIA 1AZEA 1K0XA 4ZNXA 1E6GA 2EW3A 2YUOA 4RTVA 1AEYA 3TSZA 2RQVA 2EYWA 3I35A 2G6FX 1ZUYA 3KFVA 1NLOC 1RLPC 2DM1A 3I5RA 2RQTA 1AD5A 2KRMA 1BK2A 2JMCA 1M3AA 3QWYA 1PKSA 4FSSA 3LH5A 2BZ8A 2BZYA 1H8KA 2GTOA 5EC7A 2EPDA 2KROA 3H0FA 4ORZA 2FRWA 4OMLA 1SPKA 1ZSGA 4KRTA 2V1QA 2C0TA 1T0JA 3JV3A 3TSWA 1AWWA 2FEIA 1GRIA 2YUQA 3VS1A 1X27A 2KYMA 4AFSC 2MIOA 2LQWA 2K9GA 1M3CA 2RNAA 2EGCA 1AZGB 1UECA 1H3HA 2I0NA 3I5SA 3TVTA 2JMAA 2DRKA 5GJWB 1SSHA 3H0IA 1QCFA 1WIEA 3PE0A 2PTKA 2JW4A 4DEXA 4Z89A 2KRNA 1WX6A 3VRYA 2EGEA 4RTTA 1EFNA 5IXBA 2J6FA 5I11A 1UTIA 4HVVA 1I07A 2M51A 1K76A 2KT1A 1LCKA 1YP5A 1M8MA 4F16A 1AVZC 1OEBA 3QWXX 2K3BA 2YSQA 2O31A 1WFWA 4OMQA 4ESRA 2ED0A 1GFDA 4HXJA 2DBMA 2EYZA 1AWJA 2HDAA 2HBWA 3EG1A 2DLPA 1WLPB 4J9DA 4AFUC 4X1VA 3A98A 1ABOA 4AFZC 2KXCA 4LN2A 1UG1A 1AOJA 4GBQA 5FW9A 2GTJA 1HSQA 4LE9A 1SRLA 1UUEA 1K0SA 1X6GA 1WXTA 2D8JA 3ZL7C 1NG2A 1N5ZA 2RF0A 2ECZA 1AWOA 2L3SA 2DILA 3EG3A 2E5KA 1UHFA 2KYBA 1BU1A 1GBQA 1U06A 1WYXA 2ED1A 2ROTA 1U5SA 1OOTA 1K1ZA 2RQWA 3SHWA 1Z9QA 2DYBA 1SRMA 1VYVA 2GQIA 4OMOA 2CT3A 5IXFA 1K9AA 3VS2A 4R0KA 1H92A 1WXBA 2YUPA 2FRYA 3VS3A 2FPEA 2LZ6B 4OMMA 3REAB 2DL4A 1Z9ZA 2GNCA 1NEBA 3GBQA 1M27C 4IIMA 4E6RA 1I0CA 3M0TA 2J6OA
chains in the Genus database with same CATH superfamily
3H8ZA 3JSCA 3QYGB 2W0ZA 5I22A 3OW2A 2R5AA 3BE3A 3OYJA 2JS2A 4BACA 4XTZA 1J3TA 1K4US 1IHWA 3FC3A 3PMTA 5KCHA 4PJOF 4IUPA 4OMNA 4E7IA 1VQMT 5LJ3g 3CCJT 2YT6A 4M75F 3CC4A 2QGGA 8AT1B 4CI0C 3G4SQ 3BW1A 3EFOB 4PKCC 3H41A 1KD1U 4EDUA 2Y4XA 1OZ3A 2HCKA 1VUBA 5GAOr 4CC4B 2EJ9A 2P84A 1H641 2A7YA 2RI2A 4L5GA 1GBRA 1KJWA 4II1A 4M7DG 3CXCS 3HRUA 2PVGB 4XTYA 1ARKA 1WJQA 3G7ZA 4C92C 1BIAA 3DKMA 5GAN5 1RAFB 2QG9B 5GAOl 2IIMA 4BUGA 4MZMA 1C0MA 4RTWA 5KCOA 5A2QE 3CMET 2X3WD 1S1NA 2A36A 2DEUA 4M7DF 1JEGA 1ZA2B 3MEVA 1PD0A 2J7IA 2CDTA 2FL7A 4KH0B 1IGUA 2DZCA 3CMEQ 3CCMQ 4M78E 1VQ7A 2X9HA 3RKXA 3OS5A 4DQ2A 3CCUA 4PJOD 1Q82C 1M2OA 1VQ5A 1X69A 3QZ5B 5GANe 3JCMP 2F69A 2VWFA 1JJ2P 2ABLA 3CC2Q 2LX7A 3M54A 4TVRA 2HSEB 3JCMJ 3PGGA 4D8KA 4KGZB 2D9TA 1IO6A 2PVOB 1PM3A 1UEBA 1VQPA 3CCQQ 2DXTA 1BCMA 1YHQQ 2QAZA 5GMKm 4M77D 1RI9A 4J6YA 1MMNA 3QJ6A 2F5KA 2KBTA 4DOVA 4B9WA 4A4KA 1G3SA 3RUXA 1KK7A 2KK4A 4Z88A 3RNJA 4A4FA 4HVWA 3BDUA 4PJMA 4C92A 2M02A 1K8AC 4FL6A 4JJNK 1G8XA 2E70A 3QZ9B 4C92E 3OYMA 2MMPA 1JRIA 8ATCB 1IRXA 2QEXT 3SD4A 1TTHB 5GAMj 2EQUA 1RAEB 4M77E 1PKTA 2E4HA 2HAXA 4C5GA 2SEMA 2CZ6B 1JJ2A 1S72Q 2K2MA 4C8QB 2EAYA 2CP7A 4M75E 4RCCA 1X6BA 5GAOp 1Q95G 2F2VA 2EGAA 2XDBA 5KYYB 1CKBA 2HL3A 1U3OA 4F7UB 3M59A 4C5IA 3JAME 2GFUA 2OTJQ 3UF4A 4R55A 2COWA 4J9HA 1VQKQ 4PJOB 1JJ2S 3G6EA 5HK3A 4FIBA 4JJBA 4C8QA 4OB1B 3KXTA 2KGTA 5FROA 4EMKC 2XD0A 4NOYA 1KC8U 3CCEA 2COZA 2LJ1A 1SHFA 2MF2A 1KQSA 2HSPA 1X75C 1JO8A 4JLIA 1K8AR 1VYUA 4M77F 4BE2A 1PSEA 2DKGA 5D6XA 4V2SA 2QASA 3JCMg 4QQ6A 2FZCB 3ZFJA 1QKXA 3WXMB 2CSIA 2QYZA 2W10A 1K9MC 2EQMA 2CH4A 1VQ8T 2D0QB 2AZSA 5IN1A 2V26A 3E9FA 2K79A 3EFRA 1C6VX 2LMJA 3V8JA 5CKFA 2QQBA 3EFSA 3LLRA 4IKFA 4J6XA 2E6ZA 2RO0A 2X51A 4KUDK 1D1AA 1PD1A 1Q86R 3M58A 2WSEE 5FRMA 1AEYA 2ZZDA 3TSZA 2RQVA 1KQSP 1IREB 2DXUA 3KFVA 4E47A 1RLPC 1VQ9T 2CYZB 2KRMA 1BK2A 5DY9A 5J26A 4M7DD 3HPWA 3JCMe 1Q7YC 2BZYA 1RI0A 4C8QG 5I2SA 2F1LA 4ORZA 2FRWA 4OMLA 3FB9A 1UGSB 2V1QA 1T0JA 3JV3A 1AWWA 3OSSC 4X9DA 2PUOB 5CKDA 5KYUB 4XTUA 2YUQA 2DTHA 3OA6A 5FU6B 3CCVA 4ELZC 2LQWA 5LJ5d 2DEQA 1QVFS 3OYGA 3M56A 3CCLA 1SG5A 2LTOA 5CVIA 4XTWA 1NPPA 3A8GB 4QVDA 5GJWB 1SSHA 3I55Q 4PFOA 3H0IA 3OYLA 2HQEA 4O5VA 3G4ST 2AHJB 4GLKA 5CKHA 1BCOA 3OYIA 1JB0E 3E2UA 3WVDB 2EGEA 4RTTA 1FMWA 1VQNT 2R5MA 4PJOC 5I11A 2M51A 3A5ZB 1K76A 2ZPHB 2KT1A 4FW1A 2M16A 3O8VA 4A4HA 1YP5A 2RHXA 3ER0A 2EYQA 2E10A 2YSQA 3M9QA 4AT1B 3HHTB 1M4ZA 4HXJA 3CXCP 2IG0A 2QA4Q 5M9OA 1MGQA 2DLPA 4WTOB 5KYXA 3ZEHA 1FMVA 2O4XA 3M53A 2E64A 2KXCA 1UG1A 1AOJA 2HQXA 4N4HA 1SRLA 1UUEA 2X4WA 3QKJA 1AWOA 2CP5A 1BU1A 1U06A 4BDZA 2ED1A 3OS1A 1VQOT 2LVMA 1OOTA 4OF1A 4M7AF 2I2LA 4XAXB 4M78B 1Y07A 2GQIA 5GAOn 3I56T 3CC7A 2YUPA 3HL8A 1G5VA 3REAB 2DL4A 2EQKA 1Z9ZA 2GNCA 4JUVA 1NEBA 4M7DE 4WCIA 2J6OA 3V7CA 1K9MR 1PRMC 1YJWA 2DVEA 4E7HA 1YITQ 5FLXE 4JZ3A 4M7DB 4UC4A 5GJVB 3UWNA 1Y96A 1MHNA 4ZGEB 1Y0MA 2AIRB 2LT1A 5CIUA 3CBPA 4OGEA 5J3BA 4PJOA 1TXQA 3MJXA 5FU7B 2FVUA 2XK0A 2QK0A 4MDXA 4NS5A 2OTJA 1NEGA 5KH6A 2QQRA 1I1JA 3OYEA 2DD4A 2JS0A 2RJDA 2WACA 2F2XA 2ZGWA 2HBPA 5LJ5j 4IURA 1XNIA 4CRIA 5HCKA 2QQAA 1BI0A 4BE1A 2FG0A 1ZUKA 1UGQB 3NTHA 1VQOQ 1M2VB 1VQLQ 1VQLT 3VRZA 5ECAA 2OX7A 1QMCA 1YIJQ 2WSCE 1VQ5T 1OI1A 4JJCA 2DL3A 1GL5A 3QPHA 1VQ8A 2D6FA 3CD6Q 4C0GA 4LXCA 1WZOA 1OPLA 2DL7A 2KEAA 3PVQA 1VA7A 1K73U 4PFZA 2SRCA 5LJ5h 3RR6A 3S3OA 5LJ3d 1VQPT 3LGFA 3LH0A 5HY6A 4MMKA 2M1HA 2FPDA 1WI7A 1WHGA 5IAYA 1YCSB 3JCMd 4RTZA 3IQLA 1A0NB 4PJJA 3OY9A 4E7SA 4JJDA 2O01E 1X6OA 1QLYA 2DFUA 1KC8C 1X43A 3P8DA 2DXCA 5GMKl 4BE0A 1LJOA 3MEAA 3G71Q 1BB9A 4M75A 4BY6C 3TU4K 5GANj 2JJ9A 2O9VA 3QIIA 2A28A 1KIKA 1YN8A 4FYYB 2KDSA 2DTOA 4PJNA 5IH2A 1B7TA 2IVWA 2C0OA 3UPUA 1Q81C 4PFPA 2FZGB 4M78C 3PIOA 1IHVA 3CMAQ 2CP3A 1QVGS 2O88A 1X01A 1I81A 4BI3A 2L3RA 2RK2A 1B34A 1ZUUA 4OMPA 3CC2A 3CCLT 1FYNA 1HD3A 1QP2A 2VASA 2JM8A 4C92D 2QGFB 4M75G 3LX7A 3M0PA 1VQ5Q 3VS5A 3CCUQ 2CUDA 5L23A 3CPWA 3MP1A 2XICA 5GMKi 4HVUA 2E5QA 4M75D 1VQ7Q 2PU9B 3CCMA 4LUEA 5CQXA 1VIEA 4MMLA 5D7UA 3OYDA 3SDZA 1NM7A 1VQ4T 2AKLA 4JRPA 2M9UA 2OTLT 5LL6S 3V8LA 2DVJA 3REBB 4KGVB 2DO3A 5FWBA 1JU5C 1ZX6A 2QA4A 2DF6A 3OYNA 2JTEA 3FJ5A 1QWEA 1W1FA 4XU1A 1YNZA 1NZ9A 3HFOA 3QUIA 3NHNA 1FMKA 4LDUA 5LJ5e 4JS4A 1U1SA 1OU8A 4Z8AA 3EHQA 2CZ0B 1WHHA 2DA9A 2LC4A 4IUUA 3H0HA 4FU6A 3CC4T 4AMCA 3CC4Q 4E7LA 4FT2A 1PRLC 1I8FA 3M0QA 1N27A 1OV3A 1LOJA 3I55A 5GANh 1VQ9Q 2EQJA 3EH1A 4DA4A 4D6WA 1G2BA 3OS0A 4OMFB 3SFMA 1I5OB 1NJIC 2A0FB 2BE7D 1UJ0A 1WGSA 3CBMA 3OMGA 1XOVA 1JQQA 2X4XA 4F7UA 3X26B 4R56A 1RAHB 4L59A 4IUVA 2KRSA 1QVPA 2VYTA 2A08A 1VQ9A 3BDLA 2QQSA 3EHRA 4F17A 2BZXA 2H8HA 3JCMh 3UDCA 3OYFA 1MV0B 3R6NA 2RHIA 3OYHA 2JXBA 2K7AA 1E7OA 7AT1B 3GP8A 3FJPA 2GGRA 3M4GA 1NYGA 4NL3A 2B86A 4EIKA 1KSWA 1XTDA 1W4SA 1LNXA 5CO7A 4F04B 4XTVA 2DJQA 5IHKA 2E3IA 4JZ4A 2FO0A 3ULRB 3F70A 2CUBA 3JCMW 1IGQA 4M78F 3EGXB 4RTVA 3RKWA 2EYWA 1ZUYA 1Y7XA 4MDWA 3JB9J 5DLOA 3BFMA 2EWNA 4KH1B 4ELYC 3LWIA 1M3AA 1PKSA 1RAGB 2EPDA 3H0FA 1D0YA 2VB6A 4RG2A 4C92G 1GXIE 1SPKA 1YBYA 1TH7A 2XHCA 2C0TA 1M90U 2Y4YA 1XQHA 2FEIA 2CP2A 1GRIA 3LGLA 3RESA 1X27A 3CCEQ 3GIBA 4AFSC 3L2WA 1D0XA 5CQYA 1WHJA 1M3CA 3J81E 1QVGP 2CP6A 2DK3A 3URGA 2NYSA 3A8HB 3LWHA 3OSVA 3G6EQ 1IB8A 1YCYA 3OYBA 2P0KA 2DRKA 3HRTA 1KD1R 1KHIA 1C1AA 3LW5E 4M7AB 3FEOA 1QCFA 2K3XA 1WIEA 1SSFA 4C5EA 4M77C 1QVFA 1PG5B 2DERA 3CPFA 4DEXA 2DETA 1R8OB 1WX6A 4HT8A 2HNIA 1HK9A 2J6FA 2RK1A 1YJ9T 4FCYA 4HVVA 1Y71A 4J7IA 2X4YA 2BUDA 5DLQE 2L89A 1M8MA 5LJ5g 1WHKA 3A8LB 1TOVA 2O31A 4ANJA 4OMQA 1S72A 4ESRA 1GFDA 3SB2A 3HP9A 3G71A 3GNFB 2EYZA 2HBWA 3CC7T 1YJNA 2BIVA 1TS9A 3CEYA 4DBFA 3A98A 1G3YA 4AFZC 1MMDA 4LN2A 4ZTFA 4C92B 4GBQA 4C5HA 2GTJA 1YJWT 1O9SA 4LE9A 1K0SA 2ZAEA 2DJZA 3ZL7C 1M90R 1NPRA 2RF0A 3G6ET 1UHFA 2RJCA 1KHCA 2JOYA 2RHZA 3M57A 1TU0B 3KBGA 4DBRA 3JB9I 2FHDA 4LDVA 1U5SA 3EG9B 3SHWA 1VQ8Q 1Z9QA 1YJNQ 1VQ6Q 1SRMA 1VYVA 5KYXB 1VOMA 2MWPA 2HKNA 2K2VA 2LCCA 5KE3A 4OMOA 3L2VA 2LNVA 4LDWA 4R0KA 3JB9F 5KYWA 2C06A 1VQLA 3VS3A 2LZ6B 3JB9D 2E65A 3GBQA 1VQPQ 1WJSA 3I55T 2FZKB 2VV5A 3VV0A 1T0HA 1ZLMA 2AT1B 3CCST 1NYFA 3JB9G 5GAMh 4IUQA 5CAIA 1YWOA 4A4EA 2CS7A 3GLXA 5LJ3j 2EIFA 1OX9A 2AZVA 4M75C 1CSKA 2MWOA 1Y57A 1YITA 2BKDN 1YJWQ 3X25B 2X3XD 3CCRT 4AFQC 1UFFA 4HA8A 4P5NA 2E41A 3UA6A 1PNJA 1RUWA 3QSUA 2GCXA 1JBMA 2DAQA 1Q86C 2YRDA 3OW2S 2QDLA 3OBYA 4IIOA 3CC7Q 2MAMA 4Q5WA 3OYKA 3OYCA 1GFCA 4DBQA 4M7DA 2H3JA 4FYXB 2M0OA 3TREA 2KE9A 1YHQT 1E6HA 4ZN3A 2DBKA 4RTUA 3DLLA 1G83A 1VQNQ 3HRSA 4N4GA 5CK9A 1TSFA 1NBEB 1RAAB 3PFSA 1GCQA 2LCLA 2R58A 2RQRA 2RN8A 5GAMf 3L42A 1X2KA 5GANd 2CP0A 3RIRA 2EYYA 2LJ0A 2QXFA 5CKEA 1M2VA 2QEXA 2ZPBB 2LQ8A 2DYIA 2Z0WA 4JRKA 4PJOG 5IHNA 2CSQA 1UDLA 1D0ZA 2CT4A 2NLUA 3QDRB 3L2QA 3G4SA 2KR3A 1Q7YU 5LJ3f 1N8RU 2DD5A 3P8BB 1V29B 2YLCA 4RG8A 1WNLA 1M5Q1 3QHSA 4M78G 1VQ4A 1QVFP 2GFAA 1N6AA 4VUBA 1V1CA 2R57A 1VQMA 1CKAA 3C95A 3HTRA 4Y92A 1M3BA 4M7AE 1LPLA 2IPOB 1TUCA 5L8RE 3VU3C 5GAMd 1QWFA 4KGXB 3NPFA 4LDYA 1OZ2A 4C8QD 3MHXA 2K57A 3L2UA 3VJPA 4M75B 4XTXA 1ABQA 3VUZA 1MUZA 2C0IA 4J9EA 1EZZB 4KUIA 3QDFA 1TG0A 1M1KC 5FU6C 1G3WA 1UJYA 3CCVQ 1N8RR 4BD3A 3GPLA 2GQVA 3X20B 3QO3A 4FYWB 1ZSZB 1N9SA 2P4TA 4OB0B 1P92A 4PJLA 2L0AA 9ATCB 4F7UG 4ATOA 3G71T 2XI9A 4FT4A 1B07A 4J9BA 2NUTA 3O5ZA 1YJNT 3NGPA 1WXUA 2YRVA 3A8OB 4M4ZA 3EGDB 2VVKA 3I56A 2DX1A 3A1PA 3C0CA 2E6NA 2EKHA 4GLMA 3I9QA 2RJEA 2VC8A 4C8QE 2NUPB 3EG0A 3E9GA 1UGRB 3CCUT 1QKWA 4M78A 4M77B 4AG1C 2XIDA 4Z02A 3C4SA 2RA2A 3J7AF 2FYKA 4QKUA 5GAN3 1M30A 1M8VA 4QQGA 3FRNA 2YDLA 1QVGA 3QBYA 5IHIA 2FB7A 2VXFA 2DE0X 2HQHA 3GNGA 5DM7R 5LJ5f 2JM9A 2OTJT 1WDXA 1KFZA 1EIFA 2YXYA 2NUZA 2OAUA 5GMKh 2V8JA 1AWXA 4HT9A 4JRIA 5A0DA 1QCOA 2EQIA 1PWTA 4M77A 5KYWB 1YI2Q 1NE8A 4RKUE 4XU3A 1RLQC 4F7UF 3EGUA 1PCXA 3THKA 1Q82U 1ZBXA 2MPXC 2GF7A 3CMAA 1RAIB 4C8QF 5LJ3h 5GAN6 3AHUA 4BB7A 3DB4A 2LJ3A 3OW2P 3PT9A 1YWPA 5A0GA 5CKBA 5I21A 2HMAA 2YLBA 3VS6A 4M7AG 4QVCA 2ZCFB 2V8KA 3V7SA 1M1FA 4C0ZA 1KQ2A 2D0NA 2EBPA 2AKKA 1HXDA 2RQUA 2DL5A 1D3BA 2HZYA 1RADB 3V8KA 4A54A 2O2OA 3MP8A 1N9RA 4J9GA 3CCJA 2J06A 2KSSA 2CZ1B 1ZSZC 1KD1C 4DEYA 4HCBA 2RB6A 3GOXA 4ZNXA 1E6GA 2EW3A 3CCQT 3LYIA 2G6FX 2JTMA 1Q81U 4ZGDB 2XKOC 5GMKj 3SWNB 3TCJA 2DM1A 1VQ6T 2RQTA 1U8RA 3CD6A 3JCMc 2JMCA 3QWYA 4OB2B 4FSSA 3LH5A 2BZ8A 2GTOA 1I4K1 2G3RA 1VIFA 4PL6A 4OP0A 1AHJB 2KROA 4M77G 2RH2A 1QP3A 3H6ZA 1YIJA 2DZ9A 1R0BG 1Q7YR 2ZPGB 1EX4A 1UGPB 3QXEB 3CXCA 1VQOA 1S72T 3A8MB 4FW2A 3CCET 2CZ7B 2KYMA 2XG8D 1ZHIA 3GF5A 2PQWA 3JCMQ 2RNAA 3N5BB 4XU2A 1AZGB 1UECA 3SWNA 1H3HA 4EPCA 3I5SA 2JMAA 4EMGA 2DTIA 4A4GA 3JRZA 3L2RA 4ZGJB 3L1AA 4KULA 3EAEA 2JW4A 5FU7C 3VUBA 2KRNA 4HCCA 4ME7A 3VRYA 2RHYA 2B8AA 4N0AA 2CKKA 4M78D 4EMHA 3CPWP 4J7FA 3FLGA 2QA4T 3X24B 1TUGB 4F16A 2XDDA 2HD0A 3QWXX 2X4JA 3DLMA 1WFWA 1Q86U 1O75A 1D09B 2ED0A 2LRQA 3EG9A 1NJIR 3RMQA 2HDAA 1D1BA 2L8DA 1MNEA 4FSXA 2NUPA 4FM4B 3ZBDA 3CCJQ 4OVAA 4XK8E 4N0AC 1HSQA 5KYYA 3CCSA 4C92F 1X6GA 1WXTA 2K5LA 2NUTB 5GAMe 1N5ZA 4PLIA 2ECZA 2DILA 1IZ6A 2E5KA 2K5IA 1GBQA 1WYXA 3MPUB 1BI1A 2ROTA 1K8AU 1K1ZA 4YTLA 2H3EB 2P0QA 4KT0E 2DYBA 3HFNA 2VUBA 1XJWB 5IT9E 5IXFA 1K9AA 2KMTA 2COYA 2EJFA 4BI4A 1WXBA 4C0DB 5GANg 1WJRA 4E7ZA 4HKEA 4QVZA 4E6RA 1I0CA 2X35A 5HKCA 1SF9A 3G1JA 4CC3A 2P4RA 4A53A 4B6MA 2MK5A 1PHTA 3PNWC 3PIPA 2LP5A 1WA7A 1K73R 1BIBA 1YJ9Q 3KUFA 4JRQA 3MEWA 3HSBA 5FWCA 3CCLQ 3VKIA 2DMOA 3S3NA 1WQ7A 2HEQA 5KYNA 2RHUA 1ZBJA 4XU0A 3C94A 4AG2C 3CMAT 4D8DA 3CPWS 1WHLA 2DRMA 3NFCA 3OYYA 2L5QA 1QCNA 1NJIU 1D1CA 1RACB 4N4IA 3ME9A 5GAOm 3NTKA 5A0LA 2RJFA 2QI2A 4KBMB 1OPKA 3MCAB 2DPPB 3I56Q 4B9XA 1MMAA 2M0YA 4DBHA 2P0PA 4J9FA 5AT1B 1T3LA 1FX7A 2DNUA 3SEMA 2NWMA 4XQ3A 3UA7A 1ZQ1A 1X2QA 2J05A 2KVQG 4J8OA 4JPBW 4K11A 3OS2A 4LUDA 1OYXA 3M5AA 3U23A 3QJYA 3JCMb 2LQNA 2OJ2A 5FRNA 5KYUA 2D1XA 2ATCB 2JT4A 2K6DA 3EGXA 1W70A 3CD6T 1BBZA 4GY5A 3VS4A 2XU8A 2KAFA 3VYGA 3CCRQ 2KXDA 2JN0A 3OBWA 3RMSA 2HL5C 5LJ3e 1JXMA 2PVDB 3Q1JA 1BI3A 3UATA 4Y91A 5GAN2 1YJ9A 2VKNA 3J80E 2YRCA 2PNIA 4QW2A 2E12A 1YI2T 1SEMA 3EG2A 1DJ7B 2JUFA 1BI2A 4O6JA 3AT1B 2F5TX 4X9CA 1VQMQ 2XMFA 3OB9A 1VQ4Q 2CH4W 4X34A 2Y90A 2LDMA 2GBQA 4PNOA 1UE9A 4CC2A 3P8HA 2DL8A 2RI3A 4C0DC 4A63B 3C12A 2OI3A 2MOXA 4QT7A 3EGDA 1WPYA 3VS7A 5D6YA 4IUTA 5GAMg 4J9IA 1OQKA 4M7AA 3INZA 4EMKB 1MMGA 4FYVB 5I2MA 3CCVT 4LNPA 1VQKA 3QG1A 1KQ1A 1VYTA 1T3SA 4JDSA 3M4YA 2QEXQ 3PMIA 4RMOA 2HKQB 1B34B 2OAWA 4HCZA 2PZ1A 2MYSA 3RBBB 3CCSQ 2BTTA 1FWZA 3S3MA 4MZPA 4F14A 1UHCA 2LQKA 4RUGA 5GMKe 4M7DC 1OX8A 1M90C 4J9CA 1VQNA 2RM4A 2KT8A 2F2WA 4Y28E 3CQTA 3M0UA 3OQ5A 4E7JA 4M7AC 1SHGA 1NLPC 3ASKA 1GCQC 2AK5A 2O4XB 1HJDA 2EVRA 5J39A 2LX9A 2L3PA 2J6KA 2O9SA 4RTXA 4JLGA 3META 4LDXA 1BYMA 5AYFA 3PVLA 2YUNA 3E19A 4CC7A 3OYAA 1JXOA 1YITT 3VS0A 4BI8B 4J83A 1V76A 2L3QA 4NL2A 3JCMV 2EYXA 2OTLQ 3E1SA 1WQWA 2EJGA 3DB3A 2MCNA 2KQWA 4HCKA 1PSFA 2L2PA 2RPNA 3EFOA 5HK0A 2JVVA 2K4YA 2KNBB 2LCSA 1D3BB 4RCBA 2CREA 4OB3B 4MZTA 1YHQA 2RD1A 1MNDA 2LNHB 3CCQA 1RL2A 2LT4A 1IXDA 1UGVA 1OULA 4DOWA 3NMZC 2A37A 1W6XA 1Y96B 3NTIA 1VQ6A 1QQJA 1K73C 2ZPEB 3RDVA 3M0RA 1TUDA 2OTLA 2JNGA 3JCMf 1GCPA 2D8HA 2ROLA 2RMOA 4J6WA 2V1RA 1FXXA 1MV3A 3L2ZA 1YIJT 2QTVA 2QDYB 2YHTA 1QW1A 1AT1B 3CBOA 3M0SA 4M7AD 5CCAA 4PK4A 1B3QA 4RTYA 2FPFA 3CMEA 4PLLA 2ESWA 1W2BA 5GAN7 3TEEA 2ENMA 2K3YA 4C0FA 4WF2A 1AZEA 1K0XA 2YUOA 3H9NA 3RERA 1ZA1B 3I35A 1NLOC 5GANf 1VQ7T 1W2BS 3I5RA 1AD5A 2DIQA 5EC7A 1H8KA 3RKYA 1TWBA 2A3LA 3OMCA 3V7RA 6AT1B 3HKSA 5CR2A 3JCMX 2JZ2A 1ZSGA 1BKBA 4KRTA 3TSWA 1KC8R 2MI6A 3SWNC 2EKOA 3VS1A 2MIOA 4J5YA 2V8IA 2VGMA 4LD6A 2VGNA 3JB9H 2K9GA 3QYHB 2PUKB 1HYOA 1YI2A 2CGHA 2EGCA 2K5FA 1SKUB 1F1BB 2I0NA 3FDRA 3R6OA 2ZPIB 2KI7A 3TVTA 4E7KA 1YFNA 2RI5A 3D7SB 5EG2A 1RABB 4ZN1A 1Q81R 2KY9A 3PE0A 2JTFA 2VXEA 4C8QC 2PTKA 1N8RC 1M1KR 4Z89A 1R0CB 1LVKA 3M55A 4JS5A 3EH2A 3VYHB 1ZSZA 1EFNA 1M1GA 5IXBA 5KE2A 1UTIA 1I07A 4BDYA 1LCKA 3TQ7P 5GAN4 1AVZC 1OEBA 2YWWA 1I5LA 1VQKT 2DIGA 2E3HA 2K3BA 4F7UE 1H3ZA 4OGCA 5GAN8 3CCRA 2DBMA 3PTAA 4EMKA 1OU9A 3CC2T 2QQ9A 1AWJA 1KG1A 3MO8A 3EG1A 1WLPB 4J9DA 2ZPFB 3WVEB 4AFUC 2E1HA 4X1VA 3MEUA 4PJOE 5D6WA 1ABOA 1M9SA 1UB4A 5FW9A 1WHMA 1G3TA 1R77A 2D8JA 3CCMT 1NG2A 1PC0A 3BY7A 2BE9B 2L3SA 3S6WA 3EG3A 1KQSS 2KYBA 3T9NA 1K9MU 1Q82R 3MKDA 1W2BP 2RQWA 1U1TA 4ZTJA 5C0MA 2EFIA 2WSFE 4BY6B 2DXBA 4QQDA 2CT3A 3UT1A 3MP6A 3X28B 4E2FB 5GAOq 3VS2A 1H92A 2XDPA 2QTXA 2FRYA 1ACMB 3FIFA 2FPEA 4LD9K 4OMMA 5C6SA 1M27C 4IIMA 4L6V5 1M1KU 3M0TA
chains in the Genus database with same CATH topology
2W0ZA 1PRMC 5I22A 1T0HA 4CC3A 1ZLMA 2P4RA 2JS2A 1NYFA 4JZ3A 1PHTA 1J3TA 1K4US 5GJVB 2LP5A 1WA7A 1YWOA 1Y0MA 4OMNA 5FWCA 2AZVA 2YT6A 1NEGA 1CSKA 1Y57A 2DMOA 1I1JA 2X3XD 2HEQA 2JS0A 2F2XA 1ZBJA 3H41A 4AFQC 1UFFA 4AG2C 3UA6A 1PNJA 1RUWA 5HCKA 4D8DA 2FG0A 1ZUKA 2HCKA 2QDLA 4CC4B 2DRMA 4IIOA 3VRZA 5ECAA 1GFCA 1GBRA 1KJWA 4JJCA 2DL3A 2KE9A 1GL5A 1E6HA 1OPKA 1ARKA 2DBKA 4RTUA 1G83A 1GCQA 2M0YA 2IIMA 1OPLA 2RQRA 4RTWA 2DL7A 4J9FA 2KEAA 2RN8A 3PVQA 1T3LA 1VA7A 1X2KA 2X3WD 2DNUA 3SEMA 1S1NA 2A36A 2NWMA 1JEGA 2SRCA 2EYYA 2LJ0A 3UA7A 1X2QA 2J7IA 2CDTA 2J05A 4JPBW 2FPDA 1WI7A 4K11A 4LUDA 1YCSB 3U23A 2LQNA 4RTZA 3IQLA 5IHNA 1A0NB 2OJ2A 2CSQA 1UDLA 2D1XA 4JJDA 1QLYA 2JT4A 2K6DA 1W70A 1X43A 2CT4A 1BBZA 3VS4A 2KR3A 1BB9A 2KXDA 2O9VA 1JXMA 2A28A 1X69A 1KIKA 3UATA 1YN8A 2VKNA 2VWFA 2PNIA 2ABLA 5IH2A 1SEMA 1V1CA 3EG2A 2C0OA 1CKAA 2LX7A 4Y92A 1M3BA 4D8KA 1IO6A 2O88A 1TUCA 1ZUUA 2XMFA 1QWFA 4OMPA 3NPFA 1FYNA 2CH4W 1HD3A 1RI9A 2GBQA 2JM8A 1UE9A 4CC2A 2DL8A 4A63B 3M0PA 2OI3A 2MOXA 4QT7A 1ABQA 3VS5A 3VS7A 2CUDA 5L23A 1MUZA 2C0IA 2KBTA 4J9IA 4J9EA 4HVUA 1TG0A 4LNPA 1UJYA 1VYTA 4LUEA 4Z88A 1T3SA 3RNJA 4HVWA 1NM7A 2OAWA 2PZ1A 2L0AA 3RBBB 2AKLA 2BTTA 1B07A 4J9BA 3O5ZA 3NGPA 4F14A 1UHCA 1WXUA 4RUGA 4M4ZA 2VVKA 2DVJA 4J9CA 2DX1A 3C0CA 2KT8A 3REBB 2EKHA 4GLMA 2F2WA 3CQTA 3M0UA 5FWBA 1JU5C 3I9QA 1ZX6A 1SHGA 1PKTA 2DF6A 1NLPC 2JTEA 3FJ5A 1GCQC 3EG0A 1QWEA 2SEMA 1W1FA 2AK5A 1QKWA 1YNZA 1HJDA 2K2MA 4AG1C 2EVRA 1X6BA 3NHNA 1FMKA 2F2VA 2EGAA 1M30A 4Z8AA 2L3PA 2J6KA 3EHQA 1CKBA 2O9SA 2DA9A 2YDLA 4RTXA 1U3OA 3H0HA 5IHIA 2DE0X 3PVLA 2JM9A 2YUNA 4CC7A 1WDXA 1JXOA 1KFZA 3VS0A 1PRLC 3UF4A 2L3QA 3M0QA 2NUZA 2EYXA 1OV3A 4J9HA 1AWXA 1G2BA 2MCNA 4JJBA 4HCKA 2EQIA 1PWTA 2KGTA 2L2PA 1UJ0A 2RPNA 1RLQC 2KNBB 1XOVA 3EGUA 2LCSA 1JQQA 2LJ1A 2CREA 1SHFA 2LNHB 3THKA 2HSPA 2KRSA 1UGVA 1JO8A 3NMZC 1VYUA 2A37A 1W6XA 2A08A 2LJ3A 3M0RA 1TUDA 1YWPA 3EHRA 4F17A 1GCPA 2BZXA 2D8HA 2ROLA 2H8HA 2RMOA 2V1RA 1QKXA 3VS6A 1MV0B 1MV3A 2CSIA 3R6NA 2W10A 2JXBA 2D0NA 2CH4A 2K7AA 2EBPA 2AKKA 2AZSA 1E7OA 2RQUA 2DL5A 2GGRA 2K79A 1NYGA 2LMJA 2B86A 3M0SA 4EIKA 1KSWA 1B3QA 2O2OA 4J9GA 2FPFA 4RTYA 2J06A 2ESWA 5IHKA 2DJQA 4JZ4A 2ENMA 2FO0A 3ULRB 4DEYA 2CUBA 4WCIA 1AZEA 1K0XA 4ZNXA 1E6GA 2EW3A 2YUOA 4RTVA 1AEYA 3TSZA 2RQVA 2EYWA 3I35A 2G6FX 1ZUYA 3KFVA 1NLOC 1RLPC 2DM1A 3I5RA 2RQTA 1AD5A 2KRMA 1BK2A 2JMCA 1M3AA 3QWYA 1PKSA 4FSSA 3LH5A 2BZ8A 2BZYA 1H8KA 2GTOA 5EC7A 2EPDA 2KROA 3H0FA 4ORZA 2FRWA 4OMLA 1SPKA 1ZSGA 4KRTA 2V1QA 2C0TA 1T0JA 3JV3A 3TSWA 1AWWA 2FEIA 1GRIA 2YUQA 3VS1A 1X27A 2KYMA 4AFSC 2MIOA 2LQWA 2K9GA 1M3CA 2RNAA 2EGCA 1AZGB 1UECA 1H3HA 2I0NA 3I5SA 3TVTA 2JMAA 2DRKA 5GJWB 1SSHA 3H0IA 1QCFA 1WIEA 3PE0A 2PTKA 2JW4A 4DEXA 4Z89A 2KRNA 1WX6A 3VRYA 2EGEA 4RTTA 1EFNA 5IXBA 2J6FA 5I11A 1UTIA 4HVVA 1I07A 2M51A 1K76A 2KT1A 1LCKA 1YP5A 1M8MA 4F16A 1AVZC 1OEBA 3QWXX 2K3BA 2YSQA 2O31A 1WFWA 4OMQA 4ESRA 2ED0A 1GFDA 4HXJA 2DBMA 2EYZA 1AWJA 2HDAA 2HBWA 3EG1A 2DLPA 1WLPB 4J9DA 4AFUC 4X1VA 3A98A 1ABOA 4AFZC 2KXCA 4LN2A 1UG1A 1AOJA 4GBQA 5FW9A 2GTJA 1HSQA 4LE9A 1SRLA 1UUEA 1K0SA 1X6GA 1WXTA 2D8JA 3ZL7C 1NG2A 1N5ZA 2RF0A 2ECZA 1AWOA 2L3SA 2DILA 3EG3A 2E5KA 1UHFA 2KYBA 1BU1A 1GBQA 1U06A 1WYXA 2ED1A 2ROTA 1U5SA 1OOTA 1K1ZA 2RQWA 3SHWA 1Z9QA 2DYBA 1SRMA 1VYVA 2GQIA 4OMOA 2CT3A 5IXFA 1K9AA 3VS2A 4R0KA 1H92A 1WXBA 2YUPA 2FRYA 3VS3A 2FPEA 2LZ6B 4OMMA 3REAB 2DL4A 1Z9ZA 2GNCA 1NEBA 3GBQA 1M27C 4IIMA 4E6RA 1I0CA 3M0TA 2J6OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2W0Z A;  1PRM C;  5I22 A;  1T0H A;  4CC3 A;  1ZLM A;  2P4R A;  2JS2 A;  1NYF A;  4JZ3 A;  1PHT A;  1J3T A;  1K4U S;  5GJV B;  2LP5 A;  1WA7 A;  1YWO A;  1Y0M A;  4OMN A;  5FWC A;  2AZV A;  2YT6 A;  1NEG A;  1CSK A;  1Y57 A;  2DMO A;  1I1J A;  2X3X D;  2HEQ A;  2JS0 A;  2F2X A;  1ZBJ A;  3H41 A;  4AFQ C;  1UFF A;  4AG2 C;  3UA6 A;  1PNJ A;  1RUW A;  5HCK A;  4D8D A;  2FG0 A;  1ZUK A;  2HCK A;  2QDL A;  4CC4 B;  2DRM A;  4IIO A;  3VRZ A;  5ECA A;  1GFC A;  1GBR A;  1KJW A;  4JJC A;  2DL3 A;  2KE9 A;  1GL5 A;  1E6H A;  1OPK A;  1ARK A;  2DBK A;  4RTU A;  1G83 A;  1GCQ A;  2M0Y A;  2IIM A;  1OPL A;  2RQR A;  4RTW A;  2DL7 A;  4J9F A;  2KEA A;  2RN8 A;  3PVQ A;  1T3L A;  1VA7 A;  1X2K A;  2X3W D;  2DNU A;  3SEM A;  1S1N A;  2A36 A;  2NWM A;  1JEG A;  2SRC A;  2EYY A;  2LJ0 A;  3UA7 A;  1X2Q A;  2J7I A;  2CDT A;  2J05 A;  4JPB W;  2FPD A;  1WI7 A;  4K11 A;  4LUD A;  1YCS B;  3U23 A;  2LQN A;  4RTZ A;  3IQL A;  5IHN A;  1A0N B;  2OJ2 A;  2CSQ A;  1UDL A;  2D1X A;  4JJD A;  1QLY A;  2JT4 A;  2K6D A;  1W70 A;  1X43 A;  2CT4 A;  1BBZ A;  3VS4 A;  2KR3 A;  1BB9 A;  2KXD A;  2O9V A;  1JXM A;  2A28 A;  1X69 A;  1KIK A;  3UAT A;  1YN8 A;  2VKN A;  2VWF A;  2PNI A;  2ABL A;  5IH2 A;  1SEM A;  1V1C A;  3EG2 A;  2C0O A;  1CKA A;  2LX7 A;  4Y92 A;  1M3B A;  4D8K A;  1IO6 A;  2O88 A;  1TUC A;  1ZUU A;  2XMF A;  1QWF A;  4OMP A;  3NPF A;  1FYN A;  2CH4 W;  1HD3 A;  1RI9 A;  2GBQ A;  2JM8 A;  1UE9 A;  4CC2 A;  2DL8 A;  4A63 B;  3M0P A;  2OI3 A;  2MOX A;  4QT7 A;  1ABQ A;  3VS5 A;  3VS7 A;  2CUD A;  5L23 A;  1MUZ A;  2C0I A;  2KBT A;  4J9I A;  4J9E A;  4HVU A;  1TG0 A;  4LNP A;  1UJY A;  1VYT A;  4LUE A;  4Z88 A;  1T3S A;  3RNJ A;  4HVW A;  1NM7 A;  2OAW A;  2PZ1 A;  2L0A A;  3RBB B;  2AKL A;  2BTT A;  1B07 A;  4J9B A;  3O5Z A;  3NGP A;  4F14 A;  1UHC A;  1WXU A;  4RUG A;  4M4Z A;  2VVK A;  2DVJ A;  4J9C A;  2DX1 A;  3C0C A;  2KT8 A;  3REB B;  2EKH A;  4GLM A;  2F2W A;  3CQT A;  3M0U A;  5FWB A;  1JU5 C;  3I9Q A;  1ZX6 A;  1SHG A;  1PKT A;  2DF6 A;  1NLP C;  2JTE A;  3FJ5 A;  1GCQ C;  3EG0 A;  1QWE A;  2SEM A;  1W1F A;  2AK5 A;  1QKW A;  1YNZ A;  1HJD A;  2K2M A;  4AG1 C;  2EVR A;  1X6B A;  3NHN A;  1FMK A;  2F2V A;  2EGA A;  1M30 A;  4Z8A A;  2L3P A;  2J6K A;  3EHQ A;  1CKB A;  2O9S A;  2DA9 A;  2YDL A;  4RTX A;  1U3O A;  3H0H A;  5IHI A;  2DE0 X;  3PVL A;  2JM9 A;  2YUN A;  4CC7 A;  1WDX A;  1JXO A;  1KFZ A;  3VS0 A;  1PRL C;  3UF4 A;  2L3Q A;  3M0Q A;  2NUZ A;  2EYX A;  1OV3 A;  4J9H A;  1AWX A;  1G2B A;  2MCN A;  4JJB A;  4HCK A;  2EQI A;  1PWT A;  2KGT A;  2L2P A;  1UJ0 A;  2RPN A;  1RLQ C;  2KNB B;  1XOV A;  3EGU A;  2LCS A;  1JQQ A;  2LJ1 A;  2CRE A;  1SHF A;  2LNH B;  3THK A;  2HSP A;  2KRS A;  1UGV A;  1JO8 A;  3NMZ C;  1VYU A;  2A37 A;  1W6X A;  2A08 A;  2LJ3 A;  3M0R A;  1TUD A;  1YWP A;  3EHR A;  4F17 A;  1GCP A;  2BZX A;  2D8H A;  2ROL A;  2H8H A;  2RMO A;  2V1R A;  1QKX A;  3VS6 A;  1MV0 B;  1MV3 A;  2CSI A;  3R6N A;  2W10 A;  2JXB A;  2D0N A;  2CH4 A;  2K7A A;  2EBP A;  2AKK A;  2AZS A;  1E7O A;  2RQU A;  2DL5 A;  2GGR A;  2K79 A;  1NYG A;  2LMJ A;  2B86 A;  3M0S A;  4EIK A;  1KSW A;  1B3Q A;  2O2O A;  4J9G A;  2FPF A;  4RTY A;  2J06 A;  2ESW A;  5IHK A;  2DJQ A;  4JZ4 A;  2ENM A;  2FO0 A;  3ULR B;  4DEY A;  2CUB A;  4WCI A;  1AZE A;  1K0X A;  4ZNX A;  1E6G A;  2EW3 A;  2YUO A;  4RTV A;  1AEY A;  3TSZ A;  2RQV A;  2EYW A;  3I35 A;  2G6F X;  1ZUY A;  3KFV A;  1NLO C;  1RLP C;  2DM1 A;  3I5R A;  2RQT A;  1AD5 A;  2KRM A;  1BK2 A;  2JMC A;  1M3A A;  3QWY A;  1PKS A;  4FSS A;  3LH5 A;  2BZ8 A;  2BZY A;  1H8K A;  2GTO A;  5EC7 A;  2EPD A;  2KRO A;  3H0F A;  4ORZ A;  2FRW A;  4OML A;  1SPK A;  1ZSG A;  4KRT A;  2V1Q A;  2C0T A;  1T0J A;  3JV3 A;  3TSW A;  1AWW A;  2FEI A;  1GRI A;  2YUQ A;  3VS1 A;  1X27 A;  2KYM A;  4AFS C;  2MIO A;  2LQW A;  2K9G A;  1M3C A;  2RNA A;  2EGC A;  1AZG B;  1UEC A;  1H3H A;  2I0N A;  3I5S A;  3TVT A;  2JMA A;  2DRK A;  5GJW B;  1SSH A;  3H0I A;  1QCF A;  1WIE A;  3PE0 A;  2PTK A;  2JW4 A;  4DEX A;  4Z89 A;  2KRN A;  1WX6 A;  3VRY A;  2EGE A;  4RTT A;  1EFN A;  5IXB A;  2J6F A;  5I11 A;  1UTI A;  4HVV A;  1I07 A;  2M51 A;  1K76 A;  2KT1 A;  1LCK A;  1YP5 A;  1M8M A;  4F16 A;  1AVZ C;  1OEB A;  3QWX X;  2K3B A;  2YSQ A;  2O31 A;  1WFW A;  4OMQ A;  4ESR A;  2ED0 A;  1GFD A;  4HXJ A;  2DBM A;  2EYZ A;  1AWJ A;  2HDA A;  2HBW A;  3EG1 A;  2DLP A;  1WLP B;  4J9D A;  4AFU C;  4X1V A;  3A98 A;  1ABO A;  4AFZ C;  2KXC A;  4LN2 A;  1UG1 A;  1AOJ A;  4GBQ A;  5FW9 A;  2GTJ A;  1HSQ A;  4LE9 A;  1SRL A;  1UUE A;  1K0S A;  1X6G A;  1WXT A;  2D8J A;  3ZL7 C;  1NG2 A;  1N5Z A;  2RF0 A;  2ECZ A;  1AWO A;  2L3S A;  2DIL A;  3EG3 A;  2E5K A;  1UHF A;  2KYB A;  1BU1 A;  1GBQ A;  1U06 A;  1WYX A;  2ED1 A;  2ROT A;  1U5S A;  1OOT A;  1K1Z A;  2RQW A;  3SHW A;  1Z9Q A;  2DYB A;  1SRM A;  1VYV A;  2GQI A;  4OMO A;  2CT3 A;  5IXF A;  1K9A A;  3VS2 A;  4R0K A;  1H92 A;  1WXB A;  2YUP A;  2FRY A;  3VS3 A;  2FPE A;  2LZ6 B;  4OMM A;  3REA B;  2DL4 A;  1Z9Z A;  2GNC A;  1NEB A;  3GBQ A;  1M27 C;  4IIM A;  4E6R A;  1I0C A;  3M0T A;  2J6O A; 
#chains in the Genus database with same CATH topology
 3H8Z A;  3JSC A;  3QYG B;  2W0Z A;  5I22 A;  3OW2 A;  2R5A A;  3BE3 A;  3OYJ A;  2JS2 A;  4BAC A;  4XTZ A;  1J3T A;  1K4U S;  1IHW A;  3FC3 A;  3PMT A;  5KCH A;  4PJO F;  4IUP A;  4OMN A;  4E7I A;  1VQM T;  5LJ3 g;  3CCJ T;  2YT6 A;  4M75 F;  3CC4 A;  2QGG A;  8AT1 B;  4CI0 C;  3G4S Q;  3BW1 A;  3EFO B;  4PKC C;  3H41 A;  1KD1 U;  4EDU A;  2Y4X A;  1OZ3 A;  2HCK A;  1VUB A;  5GAO r;  4CC4 B;  2EJ9 A;  2P84 A;  1H64 1;  2A7Y A;  2RI2 A;  4L5G A;  1GBR A;  1KJW A;  4II1 A;  4M7D G;  3CXC S;  3HRU A;  2PVG B;  4XTY A;  1ARK A;  1WJQ A;  3G7Z A;  4C92 C;  1BIA A;  3DKM A;  5GAN 5;  1RAF B;  2QG9 B;  5GAO l;  2IIM A;  4BUG A;  4MZM A;  1C0M A;  4RTW A;  5KCO A;  5A2Q E;  3CME T;  2X3W D;  1S1N A;  2A36 A;  2DEU A;  4M7D F;  1JEG A;  1ZA2 B;  3MEV A;  1PD0 A;  2J7I A;  2CDT A;  2FL7 A;  4KH0 B;  1IGU A;  2DZC A;  3CME Q;  3CCM Q;  4M78 E;  1VQ7 A;  2X9H A;  3RKX A;  3OS5 A;  4DQ2 A;  3CCU A;  4PJO D;  1Q82 C;  1M2O A;  1VQ5 A;  1X69 A;  3QZ5 B;  5GAN e;  3JCM P;  2F69 A;  2VWF A;  1JJ2 P;  2ABL A;  3CC2 Q;  2LX7 A;  3M54 A;  4TVR A;  2HSE B;  3JCM J;  3PGG A;  4D8K A;  4KGZ B;  2D9T A;  1IO6 A;  2PVO B;  1PM3 A;  1UEB A;  1VQP A;  3CCQ Q;  2DXT A;  1BCM A;  1YHQ Q;  2QAZ A;  5GMK m;  4M77 D;  1RI9 A;  4J6Y A;  1MMN A;  3QJ6 A;  2F5K A;  2KBT A;  4DOV A;  4B9W A;  4A4K A;  1G3S A;  3RUX A;  1KK7 A;  2KK4 A;  4Z88 A;  3RNJ A;  4A4F A;  4HVW A;  3BDU A;  4PJM A;  4C92 A;  2M02 A;  1K8A C;  4FL6 A;  4JJN K;  1G8X A;  2E70 A;  3QZ9 B;  4C92 E;  3OYM A;  2MMP A;  1JRI A;  8ATC B;  1IRX A;  2QEX T;  3SD4 A;  1TTH B;  5GAM j;  2EQU A;  1RAE B;  4M77 E;  1PKT A;  2E4H A;  2HAX A;  4C5G A;  2SEM A;  2CZ6 B;  1JJ2 A;  1S72 Q;  2K2M A;  4C8Q B;  2EAY A;  2CP7 A;  4M75 E;  4RCC A;  1X6B A;  5GAO p;  1Q95 G;  2F2V A;  2EGA A;  2XDB A;  5KYY B;  1CKB A;  2HL3 A;  1U3O A;  4F7U B;  3M59 A;  4C5I A;  3JAM E;  2GFU A;  2OTJ Q;  3UF4 A;  4R55 A;  2COW A;  4J9H A;  1VQK Q;  4PJO B;  1JJ2 S;  3G6E A;  5HK3 A;  4FIB A;  4JJB A;  4C8Q A;  4OB1 B;  3KXT A;  2KGT A;  5FRO A;  4EMK C;  2XD0 A;  4NOY A;  1KC8 U;  3CCE A;  2COZ A;  2LJ1 A;  1SHF A;  2MF2 A;  1KQS A;  2HSP A;  1X75 C;  1JO8 A;  4JLI A;  1K8A R;  1VYU A;  4M77 F;  4BE2 A;  1PSE A;  2DKG A;  5D6X A;  4V2S A;  2QAS A;  3JCM g;  4QQ6 A;  2FZC B;  3ZFJ A;  1QKX A;  3WXM B;  2CSI A;  2QYZ A;  2W10 A;  1K9M C;  2EQM A;  2CH4 A;  1VQ8 T;  2D0Q B;  2AZS A;  5IN1 A;  2V26 A;  3E9F A;  2K79 A;  3EFR A;  1C6V X;  2LMJ A;  3V8J A;  5CKF A;  2QQB A;  3EFS A;  3LLR A;  4IKF A;  4J6X A;  2E6Z A;  2RO0 A;  2X51 A;  4KUD K;  1D1A A;  1PD1 A;  1Q86 R;  3M58 A;  2WSE E;  5FRM A;  1AEY A;  2ZZD A;  3TSZ A;  2RQV A;  1KQS P;  1IRE B;  2DXU A;  3KFV A;  4E47 A;  1RLP C;  1VQ9 T;  2CYZ B;  2KRM A;  1BK2 A;  5DY9 A;  5J26 A;  4M7D D;  3HPW A;  3JCM e;  1Q7Y C;  2BZY A;  1RI0 A;  4C8Q G;  5I2S A;  2F1L A;  4ORZ A;  2FRW A;  4OML A;  3FB9 A;  1UGS B;  2V1Q A;  1T0J A;  3JV3 A;  1AWW A;  3OSS C;  4X9D A;  2PUO B;  5CKD A;  5KYU B;  4XTU A;  2YUQ A;  2DTH A;  3OA6 A;  5FU6 B;  3CCV A;  4ELZ C;  2LQW A;  5LJ5 d;  2DEQ A;  1QVF S;  3OYG A;  3M56 A;  3CCL A;  1SG5 A;  2LTO A;  5CVI A;  4XTW A;  1NPP A;  3A8G B;  4QVD A;  5GJW B;  1SSH A;  3I55 Q;  4PFO A;  3H0I A;  3OYL A;  2HQE A;  4O5V A;  3G4S T;  2AHJ B;  4GLK A;  5CKH A;  1BCO A;  3OYI A;  1JB0 E;  3E2U A;  3WVD B;  2EGE A;  4RTT A;  1FMW A;  1VQN T;  2R5M A;  4PJO C;  5I11 A;  2M51 A;  3A5Z B;  1K76 A;  2ZPH B;  2KT1 A;  4FW1 A;  2M16 A;  3O8V A;  4A4H A;  1YP5 A;  2RHX A;  3ER0 A;  2EYQ A;  2E10 A;  2YSQ A;  3M9Q A;  4AT1 B;  3HHT B;  1M4Z A;  4HXJ A;  3CXC P;  2IG0 A;  2QA4 Q;  5M9O A;  1MGQ A;  2DLP A;  4WTO B;  5KYX A;  3ZEH A;  1FMV A;  2O4X A;  3M53 A;  2E64 A;  2KXC A;  1UG1 A;  1AOJ A;  2HQX A;  4N4H A;  1SRL A;  1UUE A;  2X4W A;  3QKJ A;  1AWO A;  2CP5 A;  1BU1 A;  1U06 A;  4BDZ A;  2ED1 A;  3OS1 A;  1VQO T;  2LVM A;  1OOT A;  4OF1 A;  4M7A F;  2I2L A;  4XAX B;  4M78 B;  1Y07 A;  2GQI A;  5GAO n;  3I56 T;  3CC7 A;  2YUP A;  3HL8 A;  1G5V A;  3REA B;  2DL4 A;  2EQK A;  1Z9Z A;  2GNC A;  4JUV A;  1NEB A;  4M7D E;  4WCI A;  2J6O A;  3V7C A;  1K9M R;  1PRM C;  1YJW A;  2DVE A;  4E7H A;  1YIT Q;  5FLX E;  4JZ3 A;  4M7D B;  4UC4 A;  5GJV B;  3UWN A;  1Y96 A;  1MHN A;  4ZGE B;  1Y0M A;  2AIR B;  2LT1 A;  5CIU A;  3CBP A;  4OGE A;  5J3B A;  4PJO A;  1TXQ A;  3MJX A;  5FU7 B;  2FVU A;  2XK0 A;  2QK0 A;  4MDX A;  4NS5 A;  2OTJ A;  1NEG A;  5KH6 A;  2QQR A;  1I1J A;  3OYE A;  2DD4 A;  2JS0 A;  2RJD A;  2WAC A;  2F2X A;  2ZGW A;  2HBP A;  5LJ5 j;  4IUR A;  1XNI A;  4CRI A;  5HCK A;  2QQA A;  1BI0 A;  4BE1 A;  2FG0 A;  1ZUK A;  1UGQ B;  3NTH A;  1VQO Q;  1M2V B;  1VQL Q;  1VQL T;  3VRZ A;  5ECA A;  2OX7 A;  1QMC A;  1YIJ Q;  2WSC E;  1VQ5 T;  1OI1 A;  4JJC A;  2DL3 A;  1GL5 A;  3QPH A;  1VQ8 A;  2D6F A;  3CD6 Q;  4C0G A;  4LXC A;  1WZO A;  1OPL A;  2DL7 A;  2KEA A;  3PVQ A;  1VA7 A;  1K73 U;  4PFZ A;  2SRC A;  5LJ5 h;  3RR6 A;  3S3O A;  5LJ3 d;  1VQP T;  3LGF A;  3LH0 A;  5HY6 A;  4MMK A;  2M1H A;  2FPD A;  1WI7 A;  1WHG A;  5IAY A;  1YCS B;  3JCM d;  4RTZ A;  3IQL A;  1A0N B;  4PJJ A;  3OY9 A;  4E7S A;  4JJD A;  2O01 E;  1X6O A;  1QLY A;  2DFU A;  1KC8 C;  1X43 A;  3P8D A;  2DXC A;  5GMK l;  4BE0 A;  1LJO A;  3MEA A;  3G71 Q;  1BB9 A;  4M75 A;  4BY6 C;  3TU4 K;  5GAN j;  2JJ9 A;  2O9V A;  3QII A;  2A28 A;  1KIK A;  1YN8 A;  4FYY B;  2KDS A;  2DTO A;  4PJN A;  5IH2 A;  1B7T A;  2IVW A;  2C0O A;  3UPU A;  1Q81 C;  4PFP A;  2FZG B;  4M78 C;  3PIO A;  1IHV A;  3CMA Q;  2CP3 A;  1QVG S;  2O88 A;  1X01 A;  1I81 A;  4BI3 A;  2L3R A;  2RK2 A;  1B34 A;  1ZUU A;  4OMP A;  3CC2 A;  3CCL T;  1FYN A;  1HD3 A;  1QP2 A;  2VAS A;  2JM8 A;  4C92 D;  2QGF B;  4M75 G;  3LX7 A;  3M0P A;  1VQ5 Q;  3VS5 A;  3CCU Q;  2CUD A;  5L23 A;  3CPW A;  3MP1 A;  2XIC A;  5GMK i;  4HVU A;  2E5Q A;  4M75 D;  1VQ7 Q;  2PU9 B;  3CCM A;  4LUE A;  5CQX A;  1VIE A;  4MML A;  5D7U A;  3OYD A;  3SDZ A;  1NM7 A;  1VQ4 T;  2AKL A;  4JRP A;  2M9U A;  2OTL T;  5LL6 S;  3V8L A;  2DVJ A;  3REB B;  4KGV B;  2DO3 A;  5FWB A;  1JU5 C;  1ZX6 A;  2QA4 A;  2DF6 A;  3OYN A;  2JTE A;  3FJ5 A;  1QWE A;  1W1F A;  4XU1 A;  1YNZ A;  1NZ9 A;  3HFO A;  3QUI A;  3NHN A;  1FMK A;  4LDU A;  5LJ5 e;  4JS4 A;  1U1S A;  1OU8 A;  4Z8A A;  3EHQ A;  2CZ0 B;  1WHH A;  2DA9 A;  2LC4 A;  4IUU A;  3H0H A;  4FU6 A;  3CC4 T;  4AMC A;  3CC4 Q;  4E7L A;  4FT2 A;  1PRL C;  1I8F A;  3M0Q A;  1N27 A;  1OV3 A;  1LOJ A;  3I55 A;  5GAN h;  1VQ9 Q;  2EQJ A;  3EH1 A;  4DA4 A;  4D6W A;  1G2B A;  3OS0 A;  4OMF B;  3SFM A;  1I5O B;  1NJI C;  2A0F B;  2BE7 D;  1UJ0 A;  1WGS A;  3CBM A;  3OMG A;  1XOV A;  1JQQ A;  2X4X A;  4F7U A;  3X26 B;  4R56 A;  1RAH B;  4L59 A;  4IUV A;  2KRS A;  1QVP A;  2VYT A;  2A08 A;  1VQ9 A;  3BDL A;  2QQS A;  3EHR A;  4F17 A;  2BZX A;  2H8H A;  3JCM h;  3UDC A;  3OYF A;  1MV0 B;  3R6N A;  2RHI A;  3OYH A;  2JXB A;  2K7A A;  1E7O A;  7AT1 B;  3GP8 A;  3FJP A;  2GGR A;  3M4G A;  1NYG A;  4NL3 A;  2B86 A;  4EIK A;  1KSW A;  1XTD A;  1W4S A;  1LNX A;  5CO7 A;  4F04 B;  4XTV A;  2DJQ A;  5IHK A;  2E3I A;  4JZ4 A;  2FO0 A;  3ULR B;  3F70 A;  2CUB A;  3JCM W;  1IGQ A;  4M78 F;  3EGX B;  4RTV A;  3RKW A;  2EYW A;  1ZUY A;  1Y7X A;  4MDW A;  3JB9 J;  5DLO A;  3BFM A;  2EWN A;  4KH1 B;  4ELY C;  3LWI A;  1M3A A;  1PKS A;  1RAG B;  2EPD A;  3H0F A;  1D0Y A;  2VB6 A;  4RG2 A;  4C92 G;  1GXI E;  1SPK A;  1YBY A;  1TH7 A;  2XHC A;  2C0T A;  1M90 U;  2Y4Y A;  1XQH A;  2FEI A;  2CP2 A;  1GRI A;  3LGL A;  3RES A;  1X27 A;  3CCE Q;  3GIB A;  4AFS C;  3L2W A;  1D0X A;  5CQY A;  1WHJ A;  1M3C A;  3J81 E;  1QVG P;  2CP6 A;  2DK3 A;  3URG A;  2NYS A;  3A8H B;  3LWH A;  3OSV A;  3G6E Q;  1IB8 A;  1YCY A;  3OYB A;  2P0K A;  2DRK A;  3HRT A;  1KD1 R;  1KHI A;  1C1A A;  3LW5 E;  4M7A B;  3FEO A;  1QCF A;  2K3X A;  1WIE A;  1SSF A;  4C5E A;  4M77 C;  1QVF A;  1PG5 B;  2DER A;  3CPF A;  4DEX A;  2DET A;  1R8O B;  1WX6 A;  4HT8 A;  2HNI A;  1HK9 A;  2J6F A;  2RK1 A;  1YJ9 T;  4FCY A;  4HVV A;  1Y71 A;  4J7I A;  2X4Y A;  2BUD A;  5DLQ E;  2L89 A;  1M8M A;  5LJ5 g;  1WHK A;  3A8L B;  1TOV A;  2O31 A;  4ANJ A;  4OMQ A;  1S72 A;  4ESR A;  1GFD A;  3SB2 A;  3HP9 A;  3G71 A;  3GNF B;  2EYZ A;  2HBW A;  3CC7 T;  1YJN A;  2BIV A;  1TS9 A;  3CEY A;  4DBF A;  3A98 A;  1G3Y A;  4AFZ C;  1MMD A;  4LN2 A;  4ZTF A;  4C92 B;  4GBQ A;  4C5H A;  2GTJ A;  1YJW T;  1O9S A;  4LE9 A;  1K0S A;  2ZAE A;  2DJZ A;  3ZL7 C;  1M90 R;  1NPR A;  2RF0 A;  3G6E T;  1UHF A;  2RJC A;  1KHC A;  2JOY A;  2RHZ A;  3M57 A;  1TU0 B;  3KBG A;  4DBR A;  3JB9 I;  2FHD A;  4LDV A;  1U5S A;  3EG9 B;  3SHW A;  1VQ8 Q;  1Z9Q A;  1YJN Q;  1VQ6 Q;  1SRM A;  1VYV A;  5KYX B;  1VOM A;  2MWP A;  2HKN A;  2K2V A;  2LCC A;  5KE3 A;  4OMO A;  3L2V A;  2LNV A;  4LDW A;  4R0K A;  3JB9 F;  5KYW A;  2C06 A;  1VQL A;  3VS3 A;  2LZ6 B;  3JB9 D;  2E65 A;  3GBQ A;  1VQP Q;  1WJS A;  3I55 T;  2FZK B;  2VV5 A;  3VV0 A;  1T0H A;  1ZLM A;  2AT1 B;  3CCS T;  1NYF A;  3JB9 G;  5GAM h;  4IUQ A;  5CAI A;  1YWO A;  4A4E A;  2CS7 A;  3GLX A;  5LJ3 j;  2EIF A;  1OX9 A;  2AZV A;  4M75 C;  1CSK A;  2MWO A;  1Y57 A;  1YIT A;  2BKD N;  1YJW Q;  3X25 B;  2X3X D;  3CCR T;  4AFQ C;  1UFF A;  4HA8 A;  4P5N A;  2E41 A;  3UA6 A;  1PNJ A;  1RUW A;  3QSU A;  2GCX A;  1JBM A;  2DAQ A;  1Q86 C;  2YRD A;  3OW2 S;  2QDL A;  3OBY A;  4IIO A;  3CC7 Q;  2MAM A;  4Q5W A;  3OYK A;  3OYC A;  1GFC A;  4DBQ A;  4M7D A;  2H3J A;  4FYX B;  2M0O A;  3TRE A;  2KE9 A;  1YHQ T;  1E6H A;  4ZN3 A;  2DBK A;  4RTU A;  3DLL A;  1G83 A;  1VQN Q;  3HRS A;  4N4G A;  5CK9 A;  1TSF A;  1NBE B;  1RAA B;  3PFS A;  1GCQ A;  2LCL A;  2R58 A;  2RQR A;  2RN8 A;  5GAM f;  3L42 A;  1X2K A;  5GAN d;  2CP0 A;  3RIR A;  2EYY A;  2LJ0 A;  2QXF A;  5CKE A;  1M2V A;  2QEX A;  2ZPB B;  2LQ8 A;  2DYI A;  2Z0W A;  4JRK A;  4PJO G;  5IHN A;  2CSQ A;  1UDL A;  1D0Z A;  2CT4 A;  2NLU A;  3QDR B;  3L2Q A;  3G4S A;  2KR3 A;  1Q7Y U;  5LJ3 f;  1N8R U;  2DD5 A;  3P8B B;  1V29 B;  2YLC A;  4RG8 A;  1WNL A;  1M5Q 1;  3QHS A;  4M78 G;  1VQ4 A;  1QVF P;  2GFA A;  1N6A A;  4VUB A;  1V1C A;  2R57 A;  1VQM A;  1CKA A;  3C95 A;  3HTR A;  4Y92 A;  1M3B A;  4M7A E;  1LPL A;  2IPO B;  1TUC A;  5L8R E;  3VU3 C;  5GAM d;  1QWF A;  4KGX B;  3NPF A;  4LDY A;  1OZ2 A;  4C8Q D;  3MHX A;  2K57 A;  3L2U A;  3VJP A;  4M75 B;  4XTX A;  1ABQ A;  3VUZ A;  1MUZ A;  2C0I A;  4J9E A;  1EZZ B;  4KUI A;  3QDF A;  1TG0 A;  1M1K C;  5FU6 C;  1G3W A;  1UJY A;  3CCV Q;  1N8R R;  4BD3 A;  3GPL A;  2GQV A;  3X20 B;  3QO3 A;  4FYW B;  1ZSZ B;  1N9S A;  2P4T A;  4OB0 B;  1P92 A;  4PJL A;  2L0A A;  9ATC B;  4F7U G;  4ATO A;  3G71 T;  2XI9 A;  4FT4 A;  1B07 A;  4J9B A;  2NUT A;  3O5Z A;  1YJN T;  3NGP A;  1WXU A;  2YRV A;  3A8O B;  4M4Z A;  3EGD B;  2VVK A;  3I56 A;  2DX1 A;  3A1P A;  3C0C A;  2E6N A;  2EKH A;  4GLM A;  3I9Q A;  2RJE A;  2VC8 A;  4C8Q E;  2NUP B;  3EG0 A;  3E9G A;  1UGR B;  3CCU T;  1QKW A;  4M78 A;  4M77 B;  4AG1 C;  2XID A;  4Z02 A;  3C4S A;  2RA2 A;  3J7A F;  2FYK A;  4QKU A;  5GAN 3;  1M30 A;  1M8V A;  4QQG A;  3FRN A;  2YDL A;  1QVG A;  3QBY A;  5IHI A;  2FB7 A;  2VXF A;  2DE0 X;  2HQH A;  3GNG A;  5DM7 R;  5LJ5 f;  2JM9 A;  2OTJ T;  1WDX A;  1KFZ A;  1EIF A;  2YXY A;  2NUZ A;  2OAU A;  5GMK h;  2V8J A;  1AWX A;  4HT9 A;  4JRI A;  5A0D A;  1QCO A;  2EQI A;  1PWT A;  4M77 A;  5KYW B;  1YI2 Q;  1NE8 A;  4RKU E;  4XU3 A;  1RLQ C;  4F7U F;  3EGU A;  1PCX A;  3THK A;  1Q82 U;  1ZBX A;  2MPX C;  2GF7 A;  3CMA A;  1RAI B;  4C8Q F;  5LJ3 h;  5GAN 6;  3AHU A;  4BB7 A;  3DB4 A;  2LJ3 A;  3OW2 P;  3PT9 A;  1YWP A;  5A0G A;  5CKB A;  5I21 A;  2HMA A;  2YLB A;  3VS6 A;  4M7A G;  4QVC A;  2ZCF B;  2V8K A;  3V7S A;  1M1F A;  4C0Z A;  1KQ2 A;  2D0N A;  2EBP A;  2AKK A;  1HXD A;  2RQU A;  2DL5 A;  1D3B A;  2HZY A;  1RAD B;  3V8K A;  4A54 A;  2O2O A;  3MP8 A;  1N9R A;  4J9G A;  3CCJ A;  2J06 A;  2KSS A;  2CZ1 B;  1ZSZ C;  1KD1 C;  4DEY A;  4HCB A;  2RB6 A;  3GOX A;  4ZNX A;  1E6G A;  2EW3 A;  3CCQ T;  3LYI A;  2G6F X;  2JTM A;  1Q81 U;  4ZGD B;  2XKO C;  5GMK j;  3SWN B;  3TCJ A;  2DM1 A;  1VQ6 T;  2RQT A;  1U8R A;  3CD6 A;  3JCM c;  2JMC A;  3QWY A;  4OB2 B;  4FSS A;  3LH5 A;  2BZ8 A;  2GTO A;  1I4K 1;  2G3R A;  1VIF A;  4PL6 A;  4OP0 A;  1AHJ B;  2KRO A;  4M77 G;  2RH2 A;  1QP3 A;  3H6Z A;  1YIJ A;  2DZ9 A;  1R0B G;  1Q7Y R;  2ZPG B;  1EX4 A;  1UGP B;  3QXE B;  3CXC A;  1VQO A;  1S72 T;  3A8M B;  4FW2 A;  3CCE T;  2CZ7 B;  2KYM A;  2XG8 D;  1ZHI A;  3GF5 A;  2PQW A;  3JCM Q;  2RNA A;  3N5B B;  4XU2 A;  1AZG B;  1UEC A;  3SWN A;  1H3H A;  4EPC A;  3I5S A;  2JMA A;  4EMG A;  2DTI A;  4A4G A;  3JRZ A;  3L2R A;  4ZGJ B;  3L1A A;  4KUL A;  3EAE A;  2JW4 A;  5FU7 C;  3VUB A;  2KRN A;  4HCC A;  4ME7 A;  3VRY A;  2RHY A;  2B8A A;  4N0A A;  2CKK A;  4M78 D;  4EMH A;  3CPW P;  4J7F A;  3FLG A;  2QA4 T;  3X24 B;  1TUG B;  4F16 A;  2XDD A;  2HD0 A;  3QWX X;  2X4J A;  3DLM A;  1WFW A;  1Q86 U;  1O75 A;  1D09 B;  2ED0 A;  2LRQ A;  3EG9 A;  1NJI R;  3RMQ A;  2HDA A;  1D1B A;  2L8D A;  1MNE A;  4FSX A;  2NUP A;  4FM4 B;  3ZBD A;  3CCJ Q;  4OVA A;  4XK8 E;  4N0A C;  1HSQ A;  5KYY A;  3CCS A;  4C92 F;  1X6G A;  1WXT A;  2K5L A;  2NUT B;  5GAM e;  1N5Z A;  4PLI A;  2ECZ A;  2DIL A;  1IZ6 A;  2E5K A;  2K5I A;  1GBQ A;  1WYX A;  3MPU B;  1BI1 A;  2ROT A;  1K8A U;  1K1Z A;  4YTL A;  2H3E B;  2P0Q A;  4KT0 E;  2DYB A;  3HFN A;  2VUB A;  1XJW B;  5IT9 E;  5IXF A;  1K9A A;  2KMT A;  2COY A;  2EJF A;  4BI4 A;  1WXB A;  4C0D B;  5GAN g;  1WJR A;  4E7Z A;  4HKE A;  4QVZ A;  4E6R A;  1I0C A;  2X35 A;  5HKC A;  1SF9 A;  3G1J A;  4CC3 A;  2P4R A;  4A53 A;  4B6M A;  2MK5 A;  1PHT A;  3PNW C;  3PIP A;  2LP5 A;  1WA7 A;  1K73 R;  1BIB A;  1YJ9 Q;  3KUF A;  4JRQ A;  3MEW A;  3HSB A;  5FWC A;  3CCL Q;  3VKI A;  2DMO A;  3S3N A;  1WQ7 A;  2HEQ A;  5KYN A;  2RHU A;  1ZBJ A;  4XU0 A;  3C94 A;  4AG2 C;  3CMA T;  4D8D A;  3CPW S;  1WHL A;  2DRM A;  3NFC A;  3OYY A;  2L5Q A;  1QCN A;  1NJI U;  1D1C A;  1RAC B;  4N4I A;  3ME9 A;  5GAO m;  3NTK A;  5A0L A;  2RJF A;  2QI2 A;  4KBM B;  1OPK A;  3MCA B;  2DPP B;  3I56 Q;  4B9X A;  1MMA A;  2M0Y A;  4DBH A;  2P0P A;  4J9F A;  5AT1 B;  1T3L A;  1FX7 A;  2DNU A;  3SEM A;  2NWM A;  4XQ3 A;  3UA7 A;  1ZQ1 A;  1X2Q A;  2J05 A;  2KVQ G;  4J8O A;  4JPB W;  4K11 A;  3OS2 A;  4LUD A;  1OYX A;  3M5A A;  3U23 A;  3QJY A;  3JCM b;  2LQN A;  2OJ2 A;  5FRN A;  5KYU A;  2D1X A;  2ATC B;  2JT4 A;  2K6D A;  3EGX A;  1W70 A;  3CD6 T;  1BBZ A;  4GY5 A;  3VS4 A;  2XU8 A;  2KAF A;  3VYG A;  3CCR Q;  2KXD A;  2JN0 A;  3OBW A;  3RMS A;  2HL5 C;  5LJ3 e;  1JXM A;  2PVD B;  3Q1J A;  1BI3 A;  3UAT A;  4Y91 A;  5GAN 2;  1YJ9 A;  2VKN A;  3J80 E;  2YRC A;  2PNI A;  4QW2 A;  2E12 A;  1YI2 T;  1SEM A;  3EG2 A;  1DJ7 B;  2JUF A;  1BI2 A;  4O6J A;  3AT1 B;  2F5T X;  4X9C A;  1VQM Q;  2XMF A;  3OB9 A;  1VQ4 Q;  2CH4 W;  4X34 A;  2Y90 A;  2LDM A;  2GBQ A;  4PNO A;  1UE9 A;  4CC2 A;  3P8H A;  2DL8 A;  2RI3 A;  4C0D C;  4A63 B;  3C12 A;  2OI3 A;  2MOX A;  4QT7 A;  3EGD A;  1WPY A;  3VS7 A;  5D6Y A;  4IUT A;  5GAM g;  4J9I A;  1OQK A;  4M7A A;  3INZ A;  4EMK B;  1MMG A;  4FYV B;  5I2M A;  3CCV T;  4LNP A;  1VQK A;  3QG1 A;  1KQ1 A;  1VYT A;  1T3S A;  4JDS A;  3M4Y A;  2QEX Q;  3PMI A;  4RMO A;  2HKQ B;  1B34 B;  2OAW A;  4HCZ A;  2PZ1 A;  2MYS A;  3RBB B;  3CCS Q;  2BTT A;  1FWZ A;  3S3M A;  4MZP A;  4F14 A;  1UHC A;  2LQK A;  4RUG A;  5GMK e;  4M7D C;  1OX8 A;  1M90 C;  4J9C A;  1VQN A;  2RM4 A;  2KT8 A;  2F2W A;  4Y28 E;  3CQT A;  3M0U A;  3OQ5 A;  4E7J A;  4M7A C;  1SHG A;  1NLP C;  3ASK A;  1GCQ C;  2AK5 A;  2O4X B;  1HJD A;  2EVR A;  5J39 A;  2LX9 A;  2L3P A;  2J6K A;  2O9S A;  4RTX A;  4JLG A;  3MET A;  4LDX A;  1BYM A;  5AYF A;  3PVL A;  2YUN A;  3E19 A;  4CC7 A;  3OYA A;  1JXO A;  1YIT T;  3VS0 A;  4BI8 B;  4J83 A;  1V76 A;  2L3Q A;  4NL2 A;  3JCM V;  2EYX A;  2OTL Q;  3E1S A;  1WQW A;  2EJG A;  3DB3 A;  2MCN A;  2KQW A;  4HCK A;  1PSF A;  2L2P A;  2RPN A;  3EFO A;  5HK0 A;  2JVV A;  2K4Y A;  2KNB B;  2LCS A;  1D3B B;  4RCB A;  2CRE A;  4OB3 B;  4MZT A;  1YHQ A;  2RD1 A;  1MND A;  2LNH B;  3CCQ A;  1RL2 A;  2LT4 A;  1IXD A;  1UGV A;  1OUL A;  4DOW A;  3NMZ C;  2A37 A;  1W6X A;  1Y96 B;  3NTI A;  1VQ6 A;  1QQJ A;  1K73 C;  2ZPE B;  3RDV A;  3M0R A;  1TUD A;  2OTL A;  2JNG A;  3JCM f;  1GCP A;  2D8H A;  2ROL A;  2RMO A;  4J6W A;  2V1R A;  1FXX A;  1MV3 A;  3L2Z A;  1YIJ T;  2QTV A;  2QDY B;  2YHT A;  1QW1 A;  1AT1 B;  3CBO A;  3M0S A;  4M7A D;  5CCA A;  4PK4 A;  1B3Q A;  4RTY A;  2FPF A;  3CME A;  4PLL A;  2ESW A;  1W2B A;  5GAN 7;  3TEE A;  2ENM A;  2K3Y A;  4C0F A;  4WF2 A;  1AZE A;  1K0X A;  2YUO A;  3H9N A;  3RER A;  1ZA1 B;  3I35 A;  1NLO C;  5GAN f;  1VQ7 T;  1W2B S;  3I5R A;  1AD5 A;  2DIQ A;  5EC7 A;  1H8K A;  3RKY A;  1TWB A;  2A3L A;  3OMC A;  3V7R A;  6AT1 B;  3HKS A;  5CR2 A;  3JCM X;  2JZ2 A;  1ZSG A;  1BKB A;  4KRT A;  3TSW A;  1KC8 R;  2MI6 A;  3SWN C;  2EKO A;  3VS1 A;  2MIO A;  4J5Y A;  2V8I A;  2VGM A;  4LD6 A;  2VGN A;  3JB9 H;  2K9G A;  3QYH B;  2PUK B;  1HYO A;  1YI2 A;  2CGH A;  2EGC A;  2K5F A;  1SKU B;  1F1B B;  2I0N A;  3FDR A;  3R6O A;  2ZPI B;  2KI7 A;  3TVT A;  4E7K A;  1YFN A;  2RI5 A;  3D7S B;  5EG2 A;  1RAB B;  4ZN1 A;  1Q81 R;  2KY9 A;  3PE0 A;  2JTF A;  2VXE A;  4C8Q C;  2PTK A;  1N8R C;  1M1K R;  4Z89 A;  1R0C B;  1LVK A;  3M55 A;  4JS5 A;  3EH2 A;  3VYH B;  1ZSZ A;  1EFN A;  1M1G A;  5IXB A;  5KE2 A;  1UTI A;  1I07 A;  4BDY A;  1LCK A;  3TQ7 P;  5GAN 4;  1AVZ C;  1OEB A;  2YWW A;  1I5L A;  1VQK T;  2DIG A;  2E3H A;  2K3B A;  4F7U E;  1H3Z A;  4OGC A;  5GAN 8;  3CCR A;  2DBM A;  3PTA A;  4EMK A;  1OU9 A;  3CC2 T;  2QQ9 A;  1AWJ A;  1KG1 A;  3MO8 A;  3EG1 A;  1WLP B;  4J9D A;  2ZPF B;  3WVE B;  4AFU C;  2E1H A;  4X1V A;  3MEU A;  4PJO E;  5D6W A;  1ABO A;  1M9S A;  1UB4 A;  5FW9 A;  1WHM A;  1G3T A;  1R77 A;  2D8J A;  3CCM T;  1NG2 A;  1PC0 A;  3BY7 A;  2BE9 B;  2L3S A;  3S6W A;  3EG3 A;  1KQS S;  2KYB A;  3T9N A;  1K9M U;  1Q82 R;  3MKD A;  1W2B P;  2RQW A;  1U1T A;  4ZTJ A;  5C0M A;  2EFI A;  2WSF E;  4BY6 B;  2DXB A;  4QQD A;  2CT3 A;  3UT1 A;  3MP6 A;  3X28 B;  4E2F B;  5GAO q;  3VS2 A;  1H92 A;  2XDP A;  2QTX A;  2FRY A;  1ACM B;  3FIF A;  2FPE A;  4LD9 K;  4OMM A;  5C6S A;  1M27 C;  4IIM A;  4L6V 5;  1M1K U;  3M0T A; 
#chains in the Genus database with same CATH homology
 2W0Z A;  1PRM C;  5I22 A;  1T0H A;  4CC3 A;  1ZLM A;  2P4R A;  2JS2 A;  1NYF A;  4JZ3 A;  1PHT A;  1J3T A;  1K4U S;  5GJV B;  2LP5 A;  1WA7 A;  1YWO A;  1Y0M A;  4OMN A;  5FWC A;  2AZV A;  2YT6 A;  1NEG A;  1CSK A;  1Y57 A;  2DMO A;  1I1J A;  2X3X D;  2HEQ A;  2JS0 A;  2F2X A;  1ZBJ A;  3H41 A;  4AFQ C;  1UFF A;  4AG2 C;  3UA6 A;  1PNJ A;  1RUW A;  5HCK A;  4D8D A;  2FG0 A;  1ZUK A;  2HCK A;  2QDL A;  4CC4 B;  2DRM A;  4IIO A;  3VRZ A;  5ECA A;  1GFC A;  1GBR A;  1KJW A;  4JJC A;  2DL3 A;  2KE9 A;  1GL5 A;  1E6H A;  1OPK A;  1ARK A;  2DBK A;  4RTU A;  1G83 A;  1GCQ A;  2M0Y A;  2IIM A;  1OPL A;  2RQR A;  4RTW A;  2DL7 A;  4J9F A;  2KEA A;  2RN8 A;  3PVQ A;  1T3L A;  1VA7 A;  1X2K A;  2X3W D;  2DNU A;  3SEM A;  1S1N A;  2A36 A;  2NWM A;  1JEG A;  2SRC A;  2EYY A;  2LJ0 A;  3UA7 A;  1X2Q A;  2J7I A;  2CDT A;  2J05 A;  4JPB W;  2FPD A;  1WI7 A;  4K11 A;  4LUD A;  1YCS B;  3U23 A;  2LQN A;  4RTZ A;  3IQL A;  5IHN A;  1A0N B;  2OJ2 A;  2CSQ A;  1UDL A;  2D1X A;  4JJD A;  1QLY A;  2JT4 A;  2K6D A;  1W70 A;  1X43 A;  2CT4 A;  1BBZ A;  3VS4 A;  2KR3 A;  1BB9 A;  2KXD A;  2O9V A;  1JXM A;  2A28 A;  1X69 A;  1KIK A;  3UAT A;  1YN8 A;  2VKN A;  2VWF A;  2PNI A;  2ABL A;  5IH2 A;  1SEM A;  1V1C A;  3EG2 A;  2C0O A;  1CKA A;  2LX7 A;  4Y92 A;  1M3B A;  4D8K A;  1IO6 A;  2O88 A;  1TUC A;  1ZUU A;  2XMF A;  1QWF A;  4OMP A;  3NPF A;  1FYN A;  2CH4 W;  1HD3 A;  1RI9 A;  2GBQ A;  2JM8 A;  1UE9 A;  4CC2 A;  2DL8 A;  4A63 B;  3M0P A;  2OI3 A;  2MOX A;  4QT7 A;  1ABQ A;  3VS5 A;  3VS7 A;  2CUD A;  5L23 A;  1MUZ A;  2C0I A;  2KBT A;  4J9I A;  4J9E A;  4HVU A;  1TG0 A;  4LNP A;  1UJY A;  1VYT A;  4LUE A;  4Z88 A;  1T3S A;  3RNJ A;  4HVW A;  1NM7 A;  2OAW A;  2PZ1 A;  2L0A A;  3RBB B;  2AKL A;  2BTT A;  1B07 A;  4J9B A;  3O5Z A;  3NGP A;  4F14 A;  1UHC A;  1WXU A;  4RUG A;  4M4Z A;  2VVK A;  2DVJ A;  4J9C A;  2DX1 A;  3C0C A;  2KT8 A;  3REB B;  2EKH A;  4GLM A;  2F2W A;  3CQT A;  3M0U A;  5FWB A;  1JU5 C;  3I9Q A;  1ZX6 A;  1SHG A;  1PKT A;  2DF6 A;  1NLP C;  2JTE A;  3FJ5 A;  1GCQ C;  3EG0 A;  1QWE A;  2SEM A;  1W1F A;  2AK5 A;  1QKW A;  1YNZ A;  1HJD A;  2K2M A;  4AG1 C;  2EVR A;  1X6B A;  3NHN A;  1FMK A;  2F2V A;  2EGA A;  1M30 A;  4Z8A A;  2L3P A;  2J6K A;  3EHQ A;  1CKB A;  2O9S A;  2DA9 A;  2YDL A;  4RTX A;  1U3O A;  3H0H A;  5IHI A;  2DE0 X;  3PVL A;  2JM9 A;  2YUN A;  4CC7 A;  1WDX A;  1JXO A;  1KFZ A;  3VS0 A;  1PRL C;  3UF4 A;  2L3Q A;  3M0Q A;  2NUZ A;  2EYX A;  1OV3 A;  4J9H A;  1AWX A;  1G2B A;  2MCN A;  4JJB A;  4HCK A;  2EQI A;  1PWT A;  2KGT A;  2L2P A;  1UJ0 A;  2RPN A;  1RLQ C;  2KNB B;  1XOV A;  3EGU A;  2LCS A;  1JQQ A;  2LJ1 A;  2CRE A;  1SHF A;  2LNH B;  3THK A;  2HSP A;  2KRS A;  1UGV A;  1JO8 A;  3NMZ C;  1VYU A;  2A37 A;  1W6X A;  2A08 A;  2LJ3 A;  3M0R A;  1TUD A;  1YWP A;  3EHR A;  4F17 A;  1GCP A;  2BZX A;  2D8H A;  2ROL A;  2H8H A;  2RMO A;  2V1R A;  1QKX A;  3VS6 A;  1MV0 B;  1MV3 A;  2CSI A;  3R6N A;  2W10 A;  2JXB A;  2D0N A;  2CH4 A;  2K7A A;  2EBP A;  2AKK A;  2AZS A;  1E7O A;  2RQU A;  2DL5 A;  2GGR A;  2K79 A;  1NYG A;  2LMJ A;  2B86 A;  3M0S A;  4EIK A;  1KSW A;  1B3Q A;  2O2O A;  4J9G A;  2FPF A;  4RTY A;  2J06 A;  2ESW A;  5IHK A;  2DJQ A;  4JZ4 A;  2ENM A;  2FO0 A;  3ULR B;  4DEY A;  2CUB A;  4WCI A;  1AZE A;  1K0X A;  4ZNX A;  1E6G A;  2EW3 A;  2YUO A;  4RTV A;  1AEY A;  3TSZ A;  2RQV A;  2EYW A;  3I35 A;  2G6F X;  1ZUY A;  3KFV A;  1NLO C;  1RLP C;  2DM1 A;  3I5R A;  2RQT A;  1AD5 A;  2KRM A;  1BK2 A;  2JMC A;  1M3A A;  3QWY A;  1PKS A;  4FSS A;  3LH5 A;  2BZ8 A;  2BZY A;  1H8K A;  2GTO A;  5EC7 A;  2EPD A;  2KRO A;  3H0F A;  4ORZ A;  2FRW A;  4OML A;  1SPK A;  1ZSG A;  4KRT A;  2V1Q A;  2C0T A;  1T0J A;  3JV3 A;  3TSW A;  1AWW A;  2FEI A;  1GRI A;  2YUQ A;  3VS1 A;  1X27 A;  2KYM A;  4AFS C;  2MIO A;  2LQW A;  2K9G A;  1M3C A;  2RNA A;  2EGC A;  1AZG B;  1UEC A;  1H3H A;  2I0N A;  3I5S A;  3TVT A;  2JMA A;  2DRK A;  5GJW B;  1SSH A;  3H0I A;  1QCF A;  1WIE A;  3PE0 A;  2PTK A;  2JW4 A;  4DEX A;  4Z89 A;  2KRN A;  1WX6 A;  3VRY A;  2EGE A;  4RTT A;  1EFN A;  5IXB A;  2J6F A;  5I11 A;  1UTI A;  4HVV A;  1I07 A;  2M51 A;  1K76 A;  2KT1 A;  1LCK A;  1YP5 A;  1M8M A;  4F16 A;  1AVZ C;  1OEB A;  3QWX X;  2K3B A;  2YSQ A;  2O31 A;  1WFW A;  4OMQ A;  4ESR A;  2ED0 A;  1GFD A;  4HXJ A;  2DBM A;  2EYZ A;  1AWJ A;  2HDA A;  2HBW A;  3EG1 A;  2DLP A;  1WLP B;  4J9D A;  4AFU C;  4X1V A;  3A98 A;  1ABO A;  4AFZ C;  2KXC A;  4LN2 A;  1UG1 A;  1AOJ A;  4GBQ A;  5FW9 A;  2GTJ A;  1HSQ A;  4LE9 A;  1SRL A;  1UUE A;  1K0S A;  1X6G A;  1WXT A;  2D8J A;  3ZL7 C;  1NG2 A;  1N5Z A;  2RF0 A;  2ECZ A;  1AWO A;  2L3S A;  2DIL A;  3EG3 A;  2E5K A;  1UHF A;  2KYB A;  1BU1 A;  1GBQ A;  1U06 A;  1WYX A;  2ED1 A;  2ROT A;  1U5S A;  1OOT A;  1K1Z A;  2RQW A;  3SHW A;  1Z9Q A;  2DYB A;  1SRM A;  1VYV A;  2GQI A;  4OMO A;  2CT3 A;  5IXF A;  1K9A A;  3VS2 A;  4R0K A;  1H92 A;  1WXB A;  2YUP A;  2FRY A;  3VS3 A;  2FPE A;  2LZ6 B;  4OMM A;  3REA B;  2DL4 A;  1Z9Z A;  2GNC A;  1NEB A;  3GBQ A;  1M27 C;  4IIM A;  4E6R A;  1I0C A;  3M0T A;  2J6O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...