3IRRA

Crystal structure of a z-z junction (with hepes intercalating)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
63
structure length
63
Chain Sequence
GSHMEQRILKFLEELGEGKATTAHDLSGKLGTPKKEINRVLYSLAKKGKLQKEAGTPPLWKIA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Double-stranded RNA-specific adenosine deaminase
publication title Crystal structure of a junction between two Z-DNA helices.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/dna
total genus 17
structure length 63
sequence length 63
chains with identical sequence B, C, D
ec nomenclature ec 3.5.4.37: Double-stranded RNA adenine deaminase.
pdb deposition date 2009-08-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3irrA00
1S29A 3E5QA 3RDIA 1GVJA 3JAMK 1B4AA 1BJAA 4M72A 2M8EA 3DFGA 4KDPA 3FZVA 4A0YA 3RYRA 5JHUA 1TTYA 2RVCA 5LLQA 1E17A 2P5LC 2OZ6A 1BI2A 4UV8A 4ASNA 4AIKA 1ZRDA 4ZYHA 4OOIA 3ZQ7A 4M73A 2STWA 5HLHA 3FMRA 4LG0A 1MDMB 4RGXA 3EETA 3B02A 2HZTA 2M1BA 1ON1A 1XMAA 1D3YA 2HGCA 3IRQA 1YFHA 1Y0UA 1PDNC 1O3SA 3BZ6A 4KICA 2P8TA 1R1VA 2FF4A 1RIOH 2STTA 1ZYRF 2OBPA 1J2XA 3RJPA 3DPTA 1HKTA 3IC7A 4UXNA 4HBLA 5E1WA 1IN8A 4RAYA 1BC8C 4UVBA 3P9CA 3WU0A 3I58A 3P9KA 3T8TA 1TW3A 4Z2YA 1OYWA 2GWRA 4PGHA 3KLNA 2F5EA 4FHTA 1FNNA 5LHIA 2FA5A 4QWQA 2ZO4A 4ZZDA 3B73A 4R79A 3CUQA 1DUXC 2OA4A 2VC0A 2IVMA 1XGOA 5J8FA 3E6BA 1FYMA 4H0EA 4HX4A 3V7SA 1TQMA 5BPDA 4JQFA 4M6XA 4BAYA 4Q47A 2FSWA 1MDMA 2O8XA 1XMKA 3C18A 4A12A 1DDNA 2K4BA 3W6KB 4I7HA 5CVJA 5ILVA 1S8NA 5DCMB 3TO9A 2Q0OA 2R7DA 2W25A 2L54A 2QQBA 3K1NA 1R5GA 2QLZA 2HQRA 2A61A 3TOAA 2OZUA 1RNLA 5TJJA 2A6HF 2VT2A 5ICEA 1T98A 2D2WA 4I09A 5CVIA 3VOEA 4A5NA 3BDDA 2Z33A 2P4WA 3FWEA 5LGUA 3NEUA 1T39A 4IRHA 5BMZA 3HRMA 2XAJA 3F8CA 2QWWA 2P6SA 4MEYF 1U3EM 5FGMA 5ICGA 3IWFA 1SFUA 4HYEA 4U0YA 1NHAA 4WWCA 1MD0A 1QBJA 3I54A 2HFHA 1YYVA 2HOEA 4UNOA 5D8LB 2DQLA 5ILUA 4R8HA 4DNCA 2GQQA 2B0LA 5HDNA 2GZWA 3RPQA 3DF8A 3VFZA 4IHTA 3MQ0A 5CLSA 3JAMZ 2V79A 4MTDA 5CVRA 2DT5A 2H09A 1FLIA 2LDUA 5LRSA 5KVRA 2GAUA 4M9ZA 1WQ2A 3WTTC 5D5VB 1BIBA 4EJVA 1IZ1A 3T0YA 2YPRA 4NHJA 3V4GA 3MEXA 5D4SA 2UZKA 3DP7A 1KU3A 1SD6A 1FYKA 2PBIA 4L9JA 3SQNA 1FSEA 1H9TA 5FLXK 1FT9A 3TOBA 3C7JA 2DK8A 4ENKA 3V8LA 3FM3A 3GVAA 1Z6TA 4OMZA 1LB2A 5E18F 2GA1A 3ZMDA 3O6BB 2XV4S 4B09A 3REOA 1PUEE 2KIFA 5ED4A 4KMUX 2EV6A 2DK5A 2HS5A 3COAC 2MD5A 3ZMVA 2Z3YA 2KJBA 2QQAA 3DKWA 1IN6A 4WXCA 2XAHA 2IA2A 4G6QA 1WRJA 3HRUA 2ZCWA 2A69F 2BGCA 2M87A 2FRHA 2EK5A 5BQTA 3TKYA 2H27A 5EEHA 2DFIA 1LQ1A 4HZFA 3VODA 3K1MA 4HW0A 4KIGA 5D6EA 5JI6A 4D0PA 5E8IA 3ISPA 5DUKA 2A3SA 4FX4A 3R4KA 1EH8A 4L9TA 3RIRA 1KA8A 1HXDA 2RKHA 3FM5A 2XHKA 3HTUA 2P6TA 3WGHA 4UVAA 1GXQA 4UUVA 4DQ2A 3O3KA 3K2ZA 3HRTA 4MHGA 1XGSA 3I59B 1KU7A 3Q5FA 4IF4A 2ETHA 1YIOA 3VB2A 2FBIA 3JTGA 2V1UA 1FOKA 3V7CA 4EGZA 1J0RA 2J5PA 2VOPA 3R61A 1S7OA 3E5XA 4EJWA 5D5WB 5HVQC 2EA4A 2DAOA 2QM3A 2MH9A 2H94A 2ADUA 5TRDA 2G7HA 3KP7A 3E5UA 5K5QA 4EJUA 6PAXA 3BOQA 4I0BA 2IRFG 1WWXA 2L4MA 2MLKA 1CF7B 5CYVA 3GZ6A 4ZYEA 1KGSA 3FF5A 2XKPA 1SFEA 4LFUA 5E17F 1JGSA 5HLGA 4HA8A 1D5VA 4KUMA 4G94A 1K6OA 1JHFA 4L18B 3SHFA 1F5TA 1Q1HA 1XCVA 4KT5C 5ICCA 4S05A 1S7AA 1SMYF 2F5FA 3E6DA 3QU3A 2RGVA 1LDKB 1IN5A 3QPHA 1ZRCA 4BQAA 4EVIA 3J7AO 1GHCA 1D8JA 2CQKA 1JXSA 1EH7A 3ZMUA 2H6CA 3TDZC 2GA2A 2D1VA 2EFPA 4G7ZF 3RYPA 5AIQA 1Z05A 4EM0B 2XUBA 1QNTA 3L7WA 1ZLJA 1IXRC 1W5TA 2GIVA 3HRSA 4LK0F 5FLXZ 2CG4A 4U0WA 4BYYA 4QLCU 4A2UA 3M8FA 4HF1A 1RZ4A 4IPAA 4S04A 4JBAA 4G7HF 3R60A 2K4JA 4XSXF 2D1HA 2O0YA 5L3GA 3R0JA 3GFJA 3JSPA 1CF7A 1FP2A 3F22A 4F7ZA 4U7DA 5H6RA 3PQJA 2RQPA 2QBYB 1R5HA 4CHUA 4GGGA 3V7RA 1OR7A 2X0LA 2E1NA 4G7OF 2XAFA 1UB9A 4FT8A 1YW7A 1U78A 4JK1X 4WK8F 1STZA 3KP2A 2EFWA 3O2PE 1HKSA 5FD5A 2XIGA 3R6SA 2L02A 2PFBA 3HTSB 5AONA 3LFKA 3MZYA 1OPCA 4MTEA 3EDPA 1YW8A 3SXYA 1J75A 2EFNA 2PI0A 1BIAA 4OINF 2NAZA 3VEPA 2ZMEA 4ENNA 1P4AA 5E8GA 5JR3A 3QOPA 3GX4X 1U5TB 1HBXG 3S2WA 4CXFA 2Y0MA 3HHGA 2RN7A 1W5SA 3ZN0A 1SFXA 4L9NA 4YFKF 2RV8A 1WKMA 5DV5A 3Q9VA 3RKYA 2QBYA 4IRGA 4CO8A 2FE3A 3KLOA 4A0XA 3CTAA 2XVCA 1K79A 1D8KA 2NRAC 3DXJF 1ULYA 1ZARA 1XGMA 3H92A 1TNTA 1TQIA 1R1TA 4CZZA 4KIBA 3RTRA 2Q8KA 2MBFA 2F5DA 2F2EA 3G3ZA 4PCQA 4UVCA 3F8MA 3D0SA 2DTRA 3DV8A 1BC7C 5E1ZB 2Z5UA 2CO5A 3LAPA 5E1XA 3RKWA 2VE9A 4CDGA 2BV6A 5D6FA 2COMA 3RKXA 3MWMA 3GFIA 2IA0A 2MA3A 4OIRF 2XAGA 5ERIA 3R0AA 2DPUA 4OIOF 3GWZA 2WV0A 5FFZA 4HDVA 1QO0D 1U5TA 1YO5C 3HIFA 3F21A 1SMTA 4ON0A 2LF7A 1YS6A 3H3ZA 2JSCA 3V8KA 1TQPA 1XDSA 2M5WA 3BP8A 1UHWA 2O61A 3GLXA 4KNYA 3HHHA 2IP2A 4IHSA 4HV6A 3JTHA 2QVOA 3HSEA 1BN5A 4WCGA 2LSOA 3GFMA 1USTA 2KKOA 1XN7A 1DPUA 4CICA 2H6BA 2RNJA 2FQ3A 3LWFA 2ACJA 4ZH4F 4XBFA 1TLHB 2Y75A 1Z6RA 3LA3A 4CYDA 1IF1A 5HS8A 3QP6A 1L0OC 1LEBA 1T6SA 1H9GA 1KQ9A 2MC3A 3EQLF 3BPXA 1J7KA 1ZG5A 1LVAA 2L3DA 5F1RA 4G8XA 2YX7A 3MFKA 3U9GA 4ZYDA 4YFXF 1AWCA 2HDCA 4ETSA 4BXUA 2EV5A 1BI1A 4Y13A 1EV7A 4OIQF 5L3DA 5DCMA 2FMYA 4I0AA 4RB1A 4O5VA 3Q9SA 4R1HA 3J81K 1O3TA 4O3MA 5DYMA 2FBKA 3IWZA 4GYIA 2PN6A 3DEUA 3WE2A 2OQGA 4GO1A 4G9YA 2JZYA 4HDUA 4PZJA 5L3CA 5H6QA 3GFLA 5LRRA 4LB6B 2R3SA 3L00A 3GO5A 3BJOA 1LJ9A 2XKOA 1ZHFA 4I98B 1HQCA 4RGUA 1GXPA 5IT9K 2O03A 3CUOA 1A04A 4XSZF 1KYWA 4WXHA 2KRFA 4N9IA 1AOYA 5HS9A 5D5UB 2ZNZA 3MAJA 4LLLA 1OYIA 2A07F 1ZH5A 1R1UA 1P4WA 1G3YA 4XLPF 3E6CC 4P9FA 3ZPLA 3M7GA 3HSRA 2E1CA 5AIPA 5L3BA 5H20A 3P7NA 3WTYC 3I4PA 3QP5A 3TQNA 4BHCA 2MH2A 4Y15A 3ULQB 1BI3A 3LAJA 4WXDA 5ICFA 3WU1B 4GXOA 1G6NA 1PP7U 1DPRA 1G3SA 4L5IA 5CJ9A 5FD6A 1BOAA 2YSRA 1XSDA 4KA4A 1KU2A 3T5XA 1JHHA 3EYIA 2IT0A 2VBXA 4AIJA 2XAQA 5LGNA 2L4AA 1XSXA 5HS7A 2K7LA 3N4MA 3ZN1A 1W7PD 4YIFA 1G3WA 4MEXF 1MGTA 4YG2F 4PDKA 2PQ8A 2AXLA 2BEOA 2EFOA 1RUNA 1T2KA 3NQOA 1LDJA 3AAFA 2O6GE 5LEJA 2PJPA 3FHZA 3OV8A 1HSJA 3F3XA 2V1DA 2Y48A 3FXUA 2R7FA 5EEGA 5A2QK 3F8NA 2DW4A 2BYVE 3TDUC 3ABTA 1YQAA 1J59A 4LLNA 2L01A 4ENJA 2YR2A 3ZP5A 2FXAA 5HLIA 2JTVA 3PQKA 4HX8A 5BPIA 2JRTA 2V9VA 1ON2A 3CUQC 2DI3A 5FB2A 5E20A 3E3VA 1MZBA 3C1DA 1IRGA 3LQRA 1QQIA 2DU9A 5K1YA 1ZN2A 4IXAA 4O6JA 1TNSA 2JPBA 3FX3A 2OU2A 4Q5SF 3QU6A 1R22A 3I5UA 1F1ZA 1J5YA 3RI4A 3TO6A 5LGTA 4FX0A 4KFCA 1XCBA 2A68F 3RPUA 1XDUA 1FY7A 2WWYA 3I59A 4A6EA 3K9TA 2ZFWA 1QZYA 3IRRA 4HAMA 2W57A 1G4DA 2QZ8A 2VC1A 2FU4A 4HF0A 3EUHA 4L9VA 1YG2A 1SD7A 3WE3A 3HUGA 1LNWA 3LQQA 3LA7A 3OOPA 3WGIA 2EA2A 2HWVA 4UV9A 2J5OA 4NB5A 4U7BA 2P7CB 1I6XA 1HSTA 2GXBA 4HV5A 4XRFA 1J9IA 4RS8A 1B6AA 1KQ0A 1MJAA 4TV7A 2DPDA 2O3FA 2K02A 2BE5F 4A0ZA 1P4XA 2XRNA 2HYFA 1UFMA 2CSOA 1SD4A 1YW9A 2QUFA 1B9NA 1IXCA 2P7VB 4HQMA 2ZJ2A 4M6YA 2LKPA 3G73A 2FBHA 1DP7P 3BJAA 5FO5A 2CW0F 1B59A 1HW5A 5DDGA 3ZMSA 4ENMA 2EWNA 1E2XA 4KMFA 2GXGA 2VXZA 4RB3C 4MGRA 2XASA 3WTXC 2HTSA 3QAHA 3F23A 5L3EA 4ESBA 2XGXA 3GEZA 4LGWA 4ZZLA 2K86A 4RGRA 5DCFA 4P5OA 3KCCA 1LEAA 1OMIA 4EMSA 1Z7UA 2G7UA 3WTZA 1V3FA 2HYGD 1R36A 5J8CA 5A2QZ 1I1GA 2KJCA 1R00A 4N9HA 4WX9A 5DD8A 1I5ZA 2LNBA 4RB2C 4EJOA 5HDKA 4Y17A 3CUQB 3GYHX 3CLOA 3TGNA 3WTWC 2OD5A 3V8JA 4UHTA 2VT3A 1K7AA 4M9XA 3F6OA 2F5CA 5BOXA 4G6DA 2EV0A 3L09A 3WTUC 1TW2A 3ZMTA 3FMSA 3P9IA 3SZTA 1U8RA 5BS6A 1QGPA 2A5YB 4PGGA 3U2RA 2A6EF 4LK1F 3CO7C 3IHUA 1FC3A 1Z9CA 2EFQA 1P6RA 3MZHA 4L0YB 2W85A 3KP4A 3FXQA 2TDXA 3T1BA 5LBQA 1ZAOA 5D8KB 4RB0A 1LDDA 1SD5A 4HOBA 1IRFA 4KYWA 1ODDA 2HEOA 2G9WA 1FBSA 3I71A 3K0LA 1SAXA 5CVVA 3CJNA 3KP5A 4M74A 2CFXA 3SZPA 2VOOA 2JPCA 1ZGJA 3QRFF 3ROUA 2YX4A 2YU3A 4RAZA 4A5MA 1HW2A 3JSOA 3I0TA 4EQQA 2FNPA 2M45A 3KZZA 3LA2A 4L5JA 3HSFA 1F4KA 2JT1A 4AIHA 3ECOA 5LHGA 1QPMA 2Q2EA 4ESFA 3WGGA 2CGPA 4BH9A 1FZPB 4P9UA 4KN7X 2DBBA 2D45A 3GXOA 3C3WA 3GW2A 4YIIA 3BY6A 1R23A 1REPC 1P2FA 4EJTA 1IXSB 3J80K 2CYYA 2QENA 4OU0A 2W84A 1IW7F 4HLXA 4GCVA 1MJ9A 1TBXA 3IKTA 2Z99A 2PMUA 3L2CA 1R58A 3ERED 4EM2A 2FMLA 1XSVA 4M9SA 4ZYGA 3GUDA 2DO7A 3ML6A 1T38A 4AVPA 4L0ZB 2ESHA 4I2OA 2QQ9A 4LJZF 1XGNA 3KEOA 4HLYA 3HOSA 5HOOA 4B8XA 1ZREA 1IAWA 4U0VA 2QYOA 2MLGA 4LD5A 2IJLA 4LLGF 3EYYA 2NYXA 1OKRA 3N97A 3D5LA 1ZGAA 1O7LA 3BWGA 5D5XB 3BPVA 1O3RA 4BHBA 3K1PA 1P92A 3E6MA 4IVNA 1MKMA 2ZXJA 3I64A 1IUYA 2EJRA 5D4RA 3IL2A 3SFZA 4IRIA 1W7PB 2PLYA 4KIFA 3GF2A 5CVUA 3K69A 2VE8A 4ESJA 4P96A 1WI9A 1S3JA 3DPLC 2FNAA 1U2WA 1B1BA 1I27A 4BNCA 5K5RA 3KFWX 4EM1A 4CGZA 2E7WA 1ZLKA 2WTEA 1FBUA 4MQ9F 2UXXA 1CGPA 2ESNA 3BJ6A 3H3UA 4YFNF 2FEZA 1Z91A 2KIUA 3FMQA 1VTNC 4BHPA 1WSUA 2BBYA 4LMYA 5HDGA 4MNUA 3HYIA 2DQRA 4Q4ZF 1FX7A 3ECHA 3WTSC 1O7FA 5DD4A 3CO6C 2V1XA 3I53A 3KE2A 1I1SA 3U1DA 3L9FA 1F9NA 2IPQX 2UXNA 1ONVA 4I01A 3KEQA 3JW4A 1W7PA 1G3TA 1T0FA 2VBWA 4RGSA 5L3FA 3ZMZA 3ELKA 2LF8A 5KK1A 1RI7A 1K78B 5JFRA 2HKOA 4N0BA 2IW5A 5J6XA 4OMYA 1FPQA 3HOTA 1KYZA 2PMHA 1BBYA 5DUIA 2ZNYA 5F64A 3WG9A 1XB4A 2CWEA 1OYYA 1L3LA 2FOKA 3TO7A 1W4MA 5DEQA 1O3QA 4IJAA 3J80Z 1ZG1A 3QPTA 2EB7A 2ZKZA 3WODF 3BROA 1YLFA 2PEXA 1USSA 4Q48A 1U5TC 2HKXA 3CDHA 4OIPF 3PFIA 2NNYA 4P55A 3F8BA 3F6VA 5IT3A 3F72A 1UCRA 4U88A 1QZZA 1MJBA 1X3UA 3GZ5A 4GYGA 1B9MA 3KP6A 5LHHA 2HQNA 2UWMA 4AWXB 2AS5F 2HR3A 1O57A 4HX7A 1YS7A 2PG4A 1XD7A 2C6YA 5FFXA 2ELHA 2RC4A 1HKQA 2WC2A 2P5VA 1K78A 1RUOA 1ZRFA 1IN7A 3J81Z 4LB5A 3NRVA 1C0WA 1UHMA 4NQWA 2RDPA 5K5OA 2VONA 1YTYA 3FXRA 1Z1DA 3T8RA 1H0MA 2NS0A 3LSTA 2ISYA 4EGYA 2VN2A 2VBYA 1S6LA 4MQVA 2ISZA 2OQRA 3M1EA 4I02A 3KZYA 5IT9Z 1U6GA 2X4HA 1FWZA 4K2EA 5JVTA 4A6DA 1FYLA 1BM9A 1V4RA 4EV0A 2V6CA 2VBZA 1FP1D 2ZBKA 3F8FA 1KU9A 4XLNF 3M9AA 3KETA 4M71A 1HW1A 3M8EA 3MCZA 2DLLA 5F6FA 2IA1A 5ILSA 2XROA 2ZMEB 3WTVC 3E97A 2KIMA 1BI0A 2P5KA 3IKVA 1ZG3A 2M30A 2HTJA 2VODA 4KN4X 4HF2A 4E70A 3KP3A 3ABUA 2K27A 4LG0B 1FSHA 1PP8F 1IN4A 1FBQA 1EH6A 4AD9A 3DQVC 2W24A 5LEKA 3W6JB 2Z9OA 2E7XA 2OAZA 1R7JA 2NNNA 4WF2A 4HQEA 1JE8A 1KQ8A
chains in the Genus database with same CATH superfamily
1S29A 3E5QA 3BT9A 1NK2P 3RDIA 1GVJA 3L2UA 3A1YA 2L9SA 3JAMK 1B4AA 4XL9A 1BJAA 2F6CA 4M72A 2HXIA 2CS3A 1B8IA 3CMYA 1JKQC 2M8EA 3DFGA 1FJLA 1JKPC 4KDPA 3FZVA 3CCMI 2ZSHB 2NOJB 1AU7A 4A0YA 3RYRA 5JHUA 1TTYA 2RVCA 5LLQA 1X3WB 5F0FA 1E17A 1Y0NA 4CCKA 1FTZA 2MC4A 2P5LC 4BS9A 2OZ6A 1BI2A 4UV8A 3O8GA 4ASNA 4AIKA 2M0MA 1ZRDA 4ZYHA 1YJNI 4OOIA 2HDDA 3ZQ7A 4F91B 4M73A 2STWA 3C2HA 5HLHA 3FMRA 3KIOA 3CF5F 3OIQA 4LG0A 1MDMB 2Z1DA 3G1MA 3ERMA 3S1NJ 4RGXA 1QZEA 3B02A 3EETA 2HZTA 2M1BA 1ON1A 1XMAA 2XF5A 1D3YA 2HGCA 3IRQA 1TWFJ 1YFHA 2OPTA 3CC4I 1Y0UA 1PDNC 4HSRA 1O3SA 3BZ6A 4KICA 3G71I 1X1CA 2MG4A 2P8TA 2NVTJ 2ZXIA 1OQYA 1R1VA 3ZOBA 4RAGA 1RKWA 2FF4A 1RIOH 2STTA 2CMPA 1ZYRF 2OBPA 3A4CA 1J2XA 4BDYA 5DS9A 2WAFA 3DPTA 3RJPA 1HKTA 3IC7A 4UXNA 4HBLA 2IGNA 1B72B 5E1WA 4B3XA 4XN3A 1D1BA 5K7FA 3M3YJ 1IN8A 4RAYA 2OC6A 1BC8C 2XB5A 2WA0A 4UVBA 4IO9F 3P9CA 4PSXA 3WU0A 5EYRA 3I58A 3P9KA 1UMQA 3T8TA 1TW3A 2B7EA 1OYWA 2CQNA 2GWRA 4Z2YA 3AG1H 4J00A 4PGHA 3KLNA 2P81A 2F5EA 4FHTA 1FNNA 3CQZJ 3PNYA 5LHIA 2FA5A 4QWQA 2ZO4A 3BG3A 4NDLA 4ZZDA 3B73A 2JMWA 3CCSI 2JQ7A 4ABZA 2MD0A 4R79A 3CUQA 1DUXC 5IYDJ 3CCQI 4AC0A 3H0GJ 2OA4A 5M3MJ 2VC0A 3PO2J 2IVMA 1XGOA 3H5AA 4PFOA 5J8FA 1WJDA 3E6BA 4EEFG 1OCZH 3S2DJ 3TBIA 2K5CA 2L0KA 2V7FA 4E6KG 4H0EA 4HX4A 3V7SA 1FYMA 2GLOA 3IH3A 1TQMA 3JRDA 2DXIA 2L5QA 5BPDA 4JQFA 4M6XA 4BAYA 1Z3YA 4Q47A 2FSWA 1MDMA 3QYBA 2O8XA 1XMKA 3C18A 4A12A 1DDNA 4DYCA 1MH3A 1MMAA 3JREA 2K4BA 2JN6A 1LFPA 2X48A 3W6KB 2WBMA 1Z67A 4HPQA 4I7HA 2CUFA 2VUMJ 4F52A 3PNTA 5CVJA 5ILVA 1S8NA 5DCMB 4HNTA 3VWBA 3TO9A 2Q0OA 2R7DA 1ETXA 2DMQA 2L54A 2W25A 2QQBA 3K1NA 1POGA 4DW6A 1R5GA 4BQOA 3GBGA 2QLZA 2HQRA 1B72A 1F36A 2A61A 4RM2A 3TOAA 2R7VA 5C4XJ 1ENHA 2OZUA 1T56A 1RNLA 5TJJA 4BDZA 2A6HF 2VT2A 1TT0A 3WU2C 2Z16A 5ICEA 1MH4A 1UHSA 2EIMH 4BY7J 3VYRB 1T98A 1W0UA 4HG2A 2D2WA 4I09A 5CVIA 3VOEA 4A5NA 2XF7A 3BZCA 3QOEA 2CUEA 2ICWG 1FTTA 2E60A 4XORA 3BDDA 2CW7A 2A5WA 2LH9A 1IC8A 3O8HA 2Z33A 2P4WA 3FWEA 5LGUA 3NEUA 1T39A 1PYVA 4IRHA 1FOYA 5BMZA 3HRMA 2XAJA 3EUHC 3F8CA 1JT6A 2JUCA 5IOYA 1SEUA 1AKHB 1QVUA 2QWWA 4BXFA 3LSHA 2P6SA 3NWTA 4MEYF 1U3EM 4RA2A 4D7MA 5FGMA 5ICGA 3AL0B 1DGWY 3S1QJ 3IWFA 1SFUA 4P1WA 5J4YA 1JJ6C 2DYRH 4HYEA 2OV7A 4U0YA 1KONA 1NHAA 4WWCA 3EUKL 1MD0A 1QBJA 2FX0A 3I54A 2HFHA 1YYVA 2DJNA 2HOEA 1OFCX 5D8LB 4UNOA 3ZQHA 2DQLA 4R8HA 4DNCA 2GQQA 5ILUA 2B0LA 1IDZA 3TP3A 5HDNA 1GLNA 2M7AA 2HPIA 2GZWA 4IQ4A 3RPQA 5H2FC 1ZGWA 1VQNI 3DF8A 3VFZA 5M5XJ 3HG9A 4MIMA 2R93J 4CSWA 4E7KA 1AHDP 4IHTA 3L2QA 2KDOA 3MQ0A 5CLSA 3JAMZ 1IJWC 2F4MB 4XNFA 3UR3C 2I10A 2V79A 2OF7A 4MTDA 2EBIA 1Z77A 2X6WA 5CVRA 2DT5A 2H09A 1FLIA 2LLKA 2LDUA 3W2AA 3IP4B 5LRSA 5KVRA 3HOZJ 2GAUA 1VQKI 4M9ZA 1WQ2A 1RETA 3BTIA 1QU3A 3WTTC 5D5VB 2JWTA 2N8GA 1BIBA 3ABLH 3VYSB 4EJVA 3IAS2 1IZ1A 1IG7A 3ABMH 4CA0A 4BXXJ 2E5ZA 2ME6A 3K10A 3T0YA 4DYRA 2YPRA 5E3NA 4NHJA 3V4GA 4CYCB 3MEXA 5D4SA 2UZKA 2XPUA 2VPRA 2DA2A 3DP7A 5EZGA 1KU3A 3DCFA 1SD6A 1FYKA 1LVKA 5FLMJ 4UB8C 4FCYA 5FKMA 1AKHA 2PBIA 3H35A 4L9JA 3SQNA 1ZR4A 1FSEA 1H9TA 5M5YJ 5JLXA 2VPLA 4ZJZA 4IOAF 2HQAA 5FLXK 3I4NJ 5B1AH 3WG7H 2L7ZA 1FT9A 3TOBA 3OYNA 3IV5A 2FJ1A 3C7JA 2IAIA 3BG7A 5F1JA 1IGNA 2LY1A 2DK8A 3H0DA 4BQNA 4ENKA 3EPZA 4ZC3A 3V8LA 1A31A 1WVRA 3FM3A 3ZRGA 1X19A 2AQEA 3GVAA 1Z6TA 4OMZA 3OY9A 1LB2A 1T08B 1X4PA 3A0BC 5E18F 2GA1A 4X1EA 5GTIC 3ZMDA 1T95A 3BC8A 3O6BB 3DLLF 2XV4S 1OCPA 1VFCA 2FD5A 2EZHA 4B09A 2E34A 3REOA 1YIJI 1PUEE 2KIFA 5ED4A 4KMUX 2EV6A 2DK5A 2HS5A 3COAC 1X4OA 3KX2A 2MD5A 3BTCA 3ZMVA 2Z3YA 4Z6YA 2KJBA 2QQAA 2F5VA 1MBFA 3DKWA 1JTXA 1IN6A 3ZGKA 4WXCA 4PJNA 2XAHA 2IA2A 3IH4A 4G6QA 1WRJA 3HRUA 2ZCWA 2KISA 4Y33A 2DODA 2A69F 2BGCA 5IY5H 3PFYA 2M87A 2FRHA 2EK5A 1J09A 4IHYA 4PJMA 2TCTA 5BQTA 2JVGA 1UAAA 3S2HJ 3TKYA 2H27A 1TWGJ 5EEHA 2DFIA 1LQ1A 4HZFA 5GP9A 2X6XA 3VODA 1UG0A 3K1MA 4DYQA 3H5RA 4HW0A 4KIGA 5D6EA 5JI6A 3SDBA 4D0PA 5E8IA 1WH5A 3K4MA 3K7AJ 3ISPA 5DUKA 3K4JA 1TP4A 1ETVA 2A3SA 3HJEA 4FX4A 1ERDA 3R4KA 2WAEA 1EH8A 1VI0A 2XB0X 4L9TA 3RIRA 1KA8A 3W2WA 4PJJA 1HXDA 2RKHA 3FM5A 2X6YA 2L9NA 2XHKA 3HTUA 2KT0A 2P6TA 3CDIA 5TISC 3WGHA 4UVAA 4X6AJ 1TWHJ 1GXQA 4XLCA 1X1AA 4UUVA 1MBJA 4DQ2A 3O3KA 1BJZA 4XLFA 4A69C 1QVTA 4B47A 3CC2I 2WY7Q 1IO2A 2KRCA 3K2ZA 2K9SA 4PUSA 3HRTA 4XOTA 1VZ0A 4MHGA 1XGSA 3I59B 1KU7A 1WH7A 2E5NA 2KL4A 3Q5FA 2O8KA 1WJFA 4IF4A 3OR2C 5FRMA 2ETHA 3BG6A 4H4KC 1YIOA 1UELB 1T33A 3VB2A 2FBIA 1Z0XA 4F3QA 2R7XA 3BR3A 3FKJA 3JTGA 2V1UA 1FOKA 4OAYA 4LOCA 3ASOH 5KHDA 4X0GA 2MYSA 5CPRB 3V7CA 4EGZA 1J0RA 5TGTA 2IS2A 2XRLA 3HUGB 3NARA 2J5PA 5EEAA 1A6IA 2VOPA 2CW8A 2YS9A 2BXZA 1MMDA 1MMSA 3GTKJ 3R61A 1S7OA 3E5XA 4EJWA 3JRCA 2VJIA 5D5WB 1YE9A 3S32A 5HVQC 3LSMA 2DDAA 2EA4A 1TWCJ 3CCJI 2DAOA 5J40A 2QM3A 2MH9A 2H94A 2ADUA 3OYIA 5TRDA 1ACIA 1OCOH 2G7HA 1LFBA 3KP7A 2VB6A 3E5UA 5K5QA 1MNDA 4EJUA 6PAXA 3HOVJ 3BOQA 5GAEJ 4I0BA 5C4JJ 2IRFG 3HPGA 1WWXA 3QYEA 2L4MA 5FROA 2MLKA 1CF7B 2M2EA 5CYVA 3GZ6A 4ZYEA 1KGSA 3FF5A 4DGWB 2XKPA 1SFEA 4LFUA 1H89C 5E17F 1LKXA 1JGSA 3K6GA 5HLGA 4HA8A 1D5VA 4KUMA 4G94A 2M4KA 1K6OA 1JHFA 2BVLA 3BTLA 3CJRB 3SHFA 4L18B 1F5TA 3RPUD 2VLAA 2BVMA 1Q1HA 1XCVA 4KT5C 1X58A 5ICCA 3VSKA 4QPQA 4S05A 1Z21A 2ECBA 3DWLE 1S7AA 1SMYF 2F5FA 5DM6F 3E6DA 3QU3A 2RGVA 1LDKB 1IN5A 3QPHA 1ZRCA 3PUFA 4BQAA 5F27A 3DBRB 3RKQA 3KYLA 3J7ZI 4EVIA 2QEXI 3ZCOA 3J7AO 1GHCA 3A01B 2NVXJ 1D8JA 2CQKA 1JXSA 1EH7A 3I55I 4MO7A 2RREA 2BY1A 1U0JA 3ZMUA 2H6CA 3TDZC 2GA2A 2D1VA 3CF2A 3FK7A 2EFPA 4G7ZF 3RYPA 3JCUC 5AIQA 1Z05A 3C2BA 4EM0B 2RQQA 1RC9A 2XUBA 3GTQJ 1QNTA 3L1PA 3L7WA 1ZLJA 1IXRC 1W5TA 2GIVA 2R0QC 4A3MJ 3HRSA 4LK0F 5FLXZ 1ETKA 2CG4A 4U0WA 4BYYA 4QLCU 4A2UA 2K9LA 3M8FA 1CQTA 4HF1A 3CP2A 1RZ4A 4IPAA 4S04A 2HNHA 1JT0A 4JBAA 2YU9J 4G7HF 2UUZA 2IS4A 3R60A 4II2A 2K4JA 1YX5A 4XSXF 4KISA 2D1HA 2O0YA 2ID6A 3K4LA 5L3GA 3R0JA 3GFJA 3JSPA 2R5ZB 1CF7A 1FP2A 2V9KA 3M1CA 2G0EA 4QPOA 3F22A 4F7ZA 4U7DA 1R71A 4FE7A 3CCLI 5H6RA 3PQJA 2RQPA 2GOMA 2QBYB 1R5HA 4CHUA 4GGGA 3V7RA 2COBA 1OR7A 2X0LA 2E1NA 2Q1ZB 4G7OF 2XAFA 4UUTA 3HC7A 1UB9A 2ZSIB 3FXLA 4FT8A 1YW7A 2R5YA 1U78A 4JK1X 4WK8F 4DBQA 1V54H 3U1KA 1MNEA 1R6RA 1STZA 3FXJA 3KP2A 1D0YA 2EFWA 3ESWB 3O2PE 1HKSA 5FD5A 4ANJA 3FK6A 1P9QC 1ZQ3P 1V55H 3DEWA 4AVZA 2XIGA 4ZTJA 3R6SA 4BY1J 2CQQA 2L02A 3ONQA 4AM3A 3VYTB 1OISA 3KYCB 2PFBA 3PNVA 3HTSB 1IRXA 5AONA 3LOCA 3PL8A 3SYTA 1RR8C 3LFKA 2EH3A 1X1PA 1S5LC 3MZYA 1A5JA 1OPCA 1X1DA 2W00A 4IHWA 2R7UA 4MTEA 3A2KA 4MLOA 1MMGA 3EDPA 1YW8A 3SXYA 1J75A 3ASNH 2EFNA 2H1LA 1I50J 2PI0A 1BIAA 4OINF 2NAZA 3OYEA 3VEPA 2Y31A 2ZMEA 4ENNA 1P4AA 5E8GA 5JR3A 4QIWN 3QOPA 3GX4X 3CCRI 3FKIJ 1U5TB 1LFUP 2HYJA 1HBXG 1A6QA 3S2WA 2Y0MA 4CXFA 3HHGA 2RN7A 1W5SA 1HF0A 5C44J 4PJ0C 3ZN0A 3DKXA 1SFXA 1DGRM 2R5ZA 2MGQA 2KMUA 4L9NA 2LKSA 4YFKF 2RV8A 3GTMJ 1WKMA 4I6ZA 1JTYA 5DV5A 3Q9VA 1TC3C 3RKYA 2QBYA 4IRGA 4CO8A 2FE3A 5E3MA 1W0TA 3KLOA 3CESA 1D0ZA 2DA1A 4NC7A 3FHNA 1GV5A 4A0XA 2HU9A 3CTAA 2XVCA 1K79A 1D8KA 2NRAC 3DXJF 1ULYA 1MW7A 4E7LA 1ZARA 1XGMA 2DT6A 3H92A 1TNTA 1TQIA 1R1TA 3LSIA 2ME0A 4CZZA 4NBQA 3CD6I 4KIBA 3RTRA 2Q8KA 2MBFA 2F5DA 2F2EA 3RQIA 4BKXA 3G3ZA 4G12A 3JRFA 2QGUA 4PCQA 3MKLA 4UVCA 3F8MA 3D0SA 2DTRA 2K9QA 3DV8A 1BC7C 5E1ZB 1ZELA 2Z5UA 3HDDA 3QWLA 5CQGA 1PVEA 2CO5A 3DU6A 3S93A 3HEFA 1V5EA 3LAPA 5E1XA 3RKWA 1JI8A 1MBGA 2ECCA 2FUG2 2VE9A 4CDGA 2BV6A 4EATA 5D6FA 2COMA 4AIDA 4YELA 2VKHA 2ZJQF 3FISA 2I5UA 1V5FA 2KFDA 3Q3SA 4XQFA 3RKXA 3MWMA 3SDGA 3WHBA 2IA0A 3GFIA 4IX7A 1PUFB 2MA3A 4OIRF 1MBEA 5FKOA 2MABA 2V9PA 2XAGA 2XSDC 5ERIA 3R0AA 2VQHA 3GMEA 2DPUA 4OIOF 3GWZA 2WV0A 2VASA 1P7JA 5FFZA 4HDVA 1QO0D 1IDYA 1U5TA 4ZDOA 4HNUA 3OIOA 1YO5C 2DMUA 1XX5A 4CCOA 3HIFA 3F21A 1SMTA 4ON0A 2LF7A 1GUUA 1EJ9A 3DEEA 1Z3XA 3KZIC 1APLC 1LUJB 1YS6A 4XOPA 2X9DA 3RZDJ 4CZCA 3C2GA 3HBLA 4BJTA 3H3ZA 3FBIB 4D5CA 2JSCA 2OCCH 3V8KA 1TQPA 1XDSA 3HPHA 2VXDA 2R7WA 2M5WA 3BR1A 5BNGA 3S16J 3BP8A 3FDYA 3U21A 2LK2A 1YX3A 4C3HJ 1IRZA 1E3OC 1UHWA 4UY8I 1WHUA 2O61A 2EPFA 3S14J 3GLXA 4KNYA 3HHHA 2IP2A 1VQ6I 1FMWA 4D5FA 4IHSA 4HV6A 1R9TJ 3JTHA 2QVOA 3HSEA 2M9HA 1X1BA 1BN5A 3PSIA 4WCGA 2LSOA 3GFMA 5F04A 4BACA 1USTA 4PJLA 2KKOA 4DBRA 1XN7A 5IOZA 5HNFA 2PJRB 1DPUA 4CICA 3BR0A 2H6BA 1WGXA 2RNJA 2NVUB 2FQ3A 3LWFA 2V6EA 2GBYA 1F43A 4CH7A 2W48A 2ACJA 2NVYJ 4B44A 2X1DA 4ZH4F 4XBFA 4A3BJ 1PUFA 1TLHB 4JX4A 2Y75A 4LITA 5J3LA 1Z6RA 3LA3A 1BA5A 4CYDA 1IF1A 3GZNB 5HS8A 3QP6A 1L0OC 1LEBA 1T6SA 1H9GA 1IV8A 2CJJA 1HDDC 1KQ9A 2MC3A 4JOMA 3EQLF 5LD2C 2GOXB 2CFOA 1J7KA 3BPXA 1WZ2A 1HC8A 1Z7LA 1ZG5A 1LVAA 3K4CA 2L3DA 1MBHA 5F1RA 3H9JA 4G8XA 2HOSA 4CCJA 2YX7A 3MFKA 1N77A 3U9GA 3IH2A 4ZYDA 4YFXF 4FASD 3VYUB 2B9SA 1AWCA 2HDCA 5IP7J 4ETSA 4BXUA 2VQGA 2DMNA 3FBNB 5LFAA 1YJ9I 2EV5A 1BI1A 4Y13A 1R49A 1EV7A 5K7HA 4Y7NJ 4OIQF 5L3DA 5GAHJ 4KT6A 2LBFB 1Y39A 5DCMA 4D7NA 5E3OA 2FMYA 4I0AA 4RB1A 1YRNB 4O5VA 3Q9SA 3QQAA 5EGOB 4R1HA 3K4NA 2HXOA 3J81K 1O3TA 4IHVA 4O3MA 5DYMA 2FBKA 5EJCA 2IGKA 3IWZA 4GYIA 4HSTA 2EILH 2PN6A 5IP9J 3DEUA 3WE2A 2OQGA 4GO1A 2AQFA 3BCBA 1VNDA 2IS6A 3FXMA 5FKKA 2P0WA 4G9YA 2JZYA 3MKWB 1TZLA 2DTZA 4HDUA 4PZJA 5L3CA 1GDTA 2KLOA 5H6QA 2JA2A 3GFLA 5LRRA 4LB6B 3GTOJ 1WJEA 4I76A 3BTJA 2R3SA 3L00A 5M3FJ 1SC7A 1VF9A 3M4OJ 3GO5A 3BJOA 4N4OB 1T8IA 1LJ9A 2XKOA 1ZHFA 2QSFX 2R7QA 4I98B 1HQCA 1RKTA 1YJWI 4RGUA 1OJLA 2O5RA 1ZR2A 3HKZN 1GXPA 5IT9K 2O03A 1EA3A 3CUOA 5EG0B 5EDNA 1A04A 4XLAA 4S0HB 4XSZF 2Y9ZA 1KYWA 3JRHA 4WXHA 2KRFA 4N9IA 2WADA 1K4SA 2AO9A 1AOYA 5HS9A 5E79C 5D5UB 1ORKA 2ZNZA 2GXAA 3MAJA 4LLLA 1H88C 1OYIA 2RAEA 2A07F 2VJJA 4IKFA 2AHQA 1ZH5A 1R1UA 3I4MJ 2ZXWH 1P4WA 2QSGX 1BR4A 3TEDA 1G3YA 2LBFA 4XLEA 4XLPF 3E6CC 4P9FA 2XGEA 1HA8A 3ZPLA 2OTLI 2E71A 2QSHX 3M7GA 3A0HC 3G1OA 3HSRA 4BUPA 1YRNA 2E1CA 5CQEA 5AIPA 5EGOA 3L2RA 5L3BA 4G6TB 5H20A 3P7NA 3WTYC 3I4PA 2NS7A 3QP5A 3TQNA 4BHCA 2MH2A 4Y15A 5JLWA 4XIDA 4IOCF 2L2OA 3ULQB 1BI3A 3LAJA 4WXDA 2LD5A 1WJCA 5ICFA 3WU1B 2UV1A 1WJBA 3G1LA 1K83J 4GXOA 5FKLA 1G6NA 2JA7J 1PP7U 3G6EI 2CU7A 1OCCH 1DPRA 1G3SA 4L5IA 5CJ9A 5FD6A 1BOAA 2YSRA 1XSDA 2K85A 4KA4A 3OYFA 1KU2A 3T5XA 5F0HA 1JHHA 3EYIA 2EIJH 3PIOF 3K70C 4NC8A 2ZJPF 2IT0A 4CYCA 2VBXA 4ZYAA 3BCAA 3LSRA 2LR8A 2XAQA 4AIJA 5LGNA 2L4AA 2R7OA 1XSXA 2E19A 3PJRA 4OAZA 5HS7A 2K7LA 3ZQIA 1I3AA 3N4MA 3ZN1A 3J7AY 4A93J 1W7PD 3BZKA 3I56I 3BR6A 1G2HA 4YIFA 1G3WA 4MEXF 2NXNB 1MGTA 4YG2F 1UG2A 3MVPA 1S72I 3HKZA 5KAFC 4PDKA 2PQ8A 4PK4A 2AXLA 2BEOA 2EFOA 1RUNA 4B48A 2DCEA 1T2KA 3NQOA 1LDJA 1OCRH 2E1MC 2O7OA 3AAFA 2CV0A 2O6GE 4W1UA 5LEJA 2PJPA 2H8RA 1KZHA 2WB1N 5B66C 3FHZA 3OV8A 1HSJA 3F3XA 2V1DA 2Y48A 1GVDA 3FXUA 2R7FA 1TWAJ 5EEGA 1FOWA 3CCYA 3PSFA 5A2QK 2DFEA 3F8NA 2DW4A 3K4BA 2F48A 2BYVE 3TDUC 1D1AA 3ABTA 2DOFA 3M07A 1YQAA 5J1RA 1J59A 4LLNA 2L01A 4ENJA 2YR2A 3ZP5A 2FXAA 2R92J 5HLIA 2JTVA 2M8GX 4F92B 2XSJC 3PQKA 3OYGA 4HX8A 3DTIA 5BPIA 2JRTA 2V9VA 1ON2A 3CUQC 2DI3A 5FB2A 2VQLA 2EZIA 1V5GA 1ZK8A 5E20A 2O9LA 3E3VA 2QA4I 1I6HJ 3OYJA 1MZBA 4A3JJ 2VIXA 3C1DA 1IRGA 2LKXA 3LQRA 1QQIA 2DU9A 4BQQA 3TW7A 5K1YA 1ZN2A 3HOXJ 4IXAA 1XTAA 2GM4A 4O6JA 1TNSA 2JA6J 4C2TA 3H9QA 2JPBA 2DMPA 3FX3A 2CUJA 3H36A 2OU2A 4Q5SF 3QU6A 1JUSA 1R22A 3I5UA 1F1ZA 1N75A 2WAQN 1J5YA 2BY2A 3RI4A 3JRAA 3TO6A 3PIPF 3E7LA 2KHMA 5LGTA 4FX0A 1E3PA 4KFCA 2CUZA 1AA7A 4V19K 1XCBA 2A68F 3RPUA 1XDUA 1FY7A 2CRGA 4A3CJ 2WWYA 3S8PA 1JJ8C 3I59A 3K9TA 4A6EA 1FIAA 2ZFWA 3HL2A 1MSEC 1QZYA 3IRRA 3OWTA 4D1QA 3K2AA 3VSLA 1R4MB 2X1EA 4HAMA 3HOUJ 2W57A 2Y69H 3OR1C 1G4DA 2QZ8A 4IZZA 2VC1A 3OYKA 1SFOJ 2FU4A 4HF0A 2DA7A 3EUHA 3IUOA 2ZJRF 4L9VA 1YG2A 3LSJA 1SD7A 3WE3A 1FEXA 3HUGA 1YHQI 1LNWA 3LQQA 3LFUA 2HI3A 2JA5J 3LA7A 3OOPA 3DLAA 1EF4A 2DOEA 3S3OA 4BEHB 2Y0SN 2L9VA 2LY9A 4N4NB 5KCMA 3WGIA 4C2MJ 1W5CC 2E2IJ 4M3DA 2EA2A 2HWVA 3CLQA 4UV9A 2J5OA 4E4HA 4NB5A 4U7BA 4LIUA 2P7CB 1I6XA 1HSTA 1Y6IA 3LSPA 5EZHA 4M3EA 2GXBA 1H8AC 4HV5A 3S15J 4XRFA 1J9IA 4RS8A 2KP6A 4DZPA 2OTJI 1B6AA 4CUGA 1KQ0A 1MJAA 1A36A 3TW6A 4TV7A 2XGCA 2DPDA 2O3FA 1GV2A 2K02A 4CCLA 2H8WA 2JVHA 3HM5A 2BE5F 3MZ8A 4A0ZA 1P4XA 2WAQA 2XRNA 2HYFA 1UFMA 3QPLA 2CSOA 1RR7A 1SD4A 1XPXA 1BR2A 2XAUA 1YW9A 2QUFA 2D5VA 5FKNA 2M34A 4BU2A 1B9NA 1IXCA 2NOGA 2PX9A 3ZQLA 2P7VB 1ETWA 1G59A 2DYSH 4HQMA 3RCOA 2ZJ2A 4M6YA 2LKPA 3AFHA 2ELKA 3BG9A 4J01A 2E36A 4LG3A 3VPRA 2FBHA 3HGYA 3G73A 1DP7P 2VKDA 3BJAA 3GTJJ 5FO5A 4I99C 2CW0F 1B59A 2JRMA 2E2HJ 1K6YA 4XICA 2BXYA 1HW5A 3BQZA 2BHZA 2VKVA 3A01A 5GPCA 5DDGA 3ZMSA 4ENMA 2EWNA 1VQ9I 1E2XA 4KMFA 2LYCA 2GXGA 3IAM2 3DBLB 2VXZA 4ZTFA 3LL7A 4RB3C 1NH3A 4MGRA 3W6VA 2XASA 3WTXC 3CDLA 2MW8A 2HTSA 1QHHD 2QQ8A 3QAHA 4BEHA 3F23A 5L3EA 3CZ6A 3BLYA 2E1MB 3OOUA 4ESBA 2BY3A 2XGXA 3OYHA 2CV2A 3GEZA 3RQ4A 4LGWA 4ZZLA 1VQ8I 2K86A 1XC5A 4RGRA 5DCFA 4P5OA 3KCCA 4YIRX 1VQPI 1MSFC 2YUSA 1LEAA 1OMIA 2EZKA 4EMSA 4GFBA 3TL4X 4HRIA 1Z7UA 3FIWA 4BJ5C 2JA8J 2Y9YA 1K61A 1MNMC 2G7UA 3WTZA 3MMYB 2DDBA 1JUPA 4A3GJ 1O4XA 1V3FA 2HYGD 1R36A 3K4KA 4RLQA 5J8CA 1XS9A 1SANA 5A2QZ 2K9NA 2CH0A 1I1GA 4PFPA 1G8XA 1QRYA 2DA6A 3AG4H 3OYMA 2KJCA 1R00A 2ELJA 4N9HA 1UZCA 4WX9A 1K4TA 5DD8A 1I5ZA 4ZDLA 3VDXA 4BBSJ 2E1OA 2LNBA 3D5SC 4DZJA 4EJOA 4RB2C 5HDKA 4JYKA 2BW3B 4Y17A 3CUQB 3GYHX 2IS1A 1HDPA 1RPWA 3CLOA 3CCVI 2M3AA 3TGNA 3WTWC 2KDZA 2NS8A 5JHFA 1VQ7I 2OD5A 2V1NA 3V8JA 4AU7A 3OYLA 3EUAA 3K70D 4NC6A 4UHTA 2VT3A 2IXSA 1K7AA 2X51A 4M9XA 3F6OA 1JKOC 3HXLA 2F5CA 1T0FC 5BOXA 4G6DA 2FOWA 4A3EJ 2EV0A 3L09A 3WTUC 5EF6A 3ABKH 5KNLA 1TW2A 2Q2EB 1E3HA 3Q0UA 4IL6C 4XMYA 3ZMTA 4YEJA 2AXTC 2X85A 3FMSA 3P9IA 3SZTA 1U8RA 5BS6A 2L7KA 1QGPA 2A5YB 4PGGA 2HPMA 3OYCA 5M5WJ 3U2RA 2A6EF 1NK3P 2DT7B 2LRDA 5FRNA 4LK1F 3CO7C 3IHUA 1SFKA 1VQ5I 2V26A 2R7ZJ 4B3AA 1FC3A 3DBHB 2QKMB 1Z9CA 2LREA 5K7ZA 2OUMA 2EFQA 4ITVA 1P6RA 3MZHA 4XKBA 4L0YB 2W85A 3BR2A 3KP4A 3FXQA 1IV6A 4RMNA 4C2UA 2TDXA 5F08A 4BE0A 3HGGA 3T1BA 2Y2ZA 5LBQA 1ZAOA 2GIZA 5D8KB 1WJAA 3GTPJ 1PJRA 2DFHA 3JRGA 4Y52J 4RB0A 2LG4A 1LDDA 1SD5A 5J4VA 4HOBA 1IRFA 4KYWA 2TRTA 3CCEI 1ODDA 4AYBN 2HEOA 3DTKA 3A02A 2G9WA 1RESA 1FBSA 3I71A 3K0LA 1Y1VJ 4HNVA 1SAXA 2CV1A 4V2GA 3CC7I 1MBKA 5CVVA 3CJNA 3KP5A 5J1UA 4KITB 4M74A 2CFXA 1DP3A 4UUSB 3SZPA 1MIJA 2LP0A 2VOOA 1VQ4I 2JPCA 5FJ8J 2BW3A 4B1RA 1ZGJA 3ZQQA 3QRFF 4BBRJ 2VKEA 1ETOA 3ROUA 3DKYA 2M7BA 2YU3A 2YX4A 1VQOI 4RAZA 4A5MA 1HW2A 1VQMI 2HZDA 3JSOA 3I0TA 1R4NB 3I3LA 4EQQA 3V42A 2FNPA 2M45A 3KZZA 3LA2A 4L5JA 3GCMA 3HSFA 4NUBA 2JT1A 4DJAA 5B3SH 1F4KA 5HNHA 4AIHA 2HVSA 4BJ6C 3ECOA 5LHGA 5E3LA 1QPMA 2Q2EA 2WV1A 4JX5A 3LSKA 3WGGA 4ESFA 4C3JJ 4NNJA 2CGPA 3L2WA 3BQYA 4BH9A 2LTPA 1FZPB 4GRIA 2VJ5A 4LIVA 2XPVA 4P9UA 5FLVA 1SVMA 4E7IA 3B6CA 4KN7X 1E0EA 2DN0A 2DBBA 2D45A 5B5EC 3GXOA 3C3WA 3GW2A 4YIIA 3BY6A 2K3FA 1R23A 1EKEA 1REPC 1P2FA 3SZGA 1GT0C 4E7HA 1IXSB 4EJTA 3J80K 3KEYA 2CYYA 4ZDPA 2QKLB 2QENA 2E35A 4CCNA 3DU5A 3M8JA 4OU0A 3OS2A 1BOBA 2LC2A 2W84A 1XMXA 3MD2A 2VJ4A 1IW7F 4XKVA 4HLXA 1YI2I 4GCVA 1MJ9A 2LOOA 2W1OA 4AYBA 1TBXA 3IKTA 3B6AA 2Z99A 2IGOA 1WCMJ 2LMDA 2PMUA 3L2CA 1R58A 1UJ8A 1Y8QB 3ERED 3Q0WA 3Q0VA 2FMLA 4EM2A 1FOXA 4JX6A 2PMZN 5GADJ 4UUSA 1XSVA 3RZOJ 4M9SA 1OCTC 3GTGJ 1D5YA 3PUBA 4W97A 4XONA 2A6TA 2BY0A 4FISA 4ZYGA 3GUDA 2DO7A 4J19A 2A05A 1DU6A 2DA3A 3ML6A 1T38A 4AVPA 4L0ZB 2ESHA 4I2OA 2QQ9A 4LJZF 1XGNA 3KEOA 4HLYA 1P7IA 4YRVA 3HOSA 2WY8Q 3ZQFA 5HOOA 1NG7A 4B8XA 3H5NA 1ZREA 3OSGA 2DOAA 4Y3OA 1IAWA 2X1CA 4U0VA 1WFXA 2QYOA 2MLGA 1LE8B 4LD5A 2IJLA 1U8BA 5KAIC 1U9OA 2L7FP 4LLGF 3J7YJ 1NTCA 4E7ZA 3EYYA 3AG3H 1SVOA 2JSPA 2NYXA 1OKRA 1MMNA 2PJRA 4RDUA 2JJ7A 4RBOA 3N97A 4BE2A 4E7JA 3D5LA 1ZGAA 3H3VK 5IP6A 3MKZA 2ZXHA 1S9HA 3CMMA 1O7LA 3BWGA 4FE4A 5D5XB 3E0JB 3BPVA 1O3RA 3I9V2 3LNQA 4BHBA 3K1PA 1P92A 1W36C 4RM3A 3E6MA 4IVNA 2BOLA 1MKMA 4XRSA 2ZXJA 3I64A 4B43A 3BG5A 2EJRA 3RSNA 1OR7C 2IGMA 5D4RA 1IUYA 3IL2A 3SFZA 2KIQA 4UB6C 3TP0A 5GPAA 4IRIA 3OS0A 1W7PB 2PLYA 2XPWA 2FQ4A 4KIFA 3GF2A 2R7RA 2DFFA 5CVUA 2Z2SB 3K69A 2HQ5A 2VE8A 4AUXA 4ESJA 1D0XA 4P96A 3TMOA 1WI9A 3S17J 1S3JA 3DPLC 2FNAA 2CQXA 1U2WA 3SEQA 1B1BA 1I27A 2PMZA 1HCRA 4BNCA 2EIKH 5K5RA 3L2VA 3KFWX 5DM7F 2HOAA 4EM1A 1Y1WJ 4CGZA 2B63J 2V4JC 2E7WA 4DIQA 1BL0A 2L9RA 3NAUA 1ZLKA 2WTEA 1D1CA 1JGGA 3JRBA 4BL0B 1FBUA 3N05A 5DTDA 2ID3A 4MQ9F 2UXXA 1WPKA 1YOVB 4XKWA 1CGPA 3W2VA 4L5EA 2ESNA 3BJ6A 3H3UA 3OIPA 4YFNF 2FEZA 3F9KA 1LE8A 2ZB9A 3HOYJ 1Z91A 2F4IA 1DU0A 4MFEA 4V2FA 2MFZA 2KIUA 3HZJA 1IUFA 4C3IJ 3FMQA 1A35A 4DOZA 2ZMEC 3AG2H 1VTNC 3PO3J 4BHPA 1WSUA 2BBYA 2LFBA 4LMYA 2NVQJ 5HDGA 4BGDA 4MNUA 3A03A 3HYIA 2DQRA 5IYCJ 4Q4ZF 1FX7A 4A3KJ 3S1RJ 3ECHA 3WTSC 1O7FA 5DD4A 1I3QJ 3CO6C 2V1XA 2KPMA 3ZQGA 4MFDA 3I53A 3KE2A 1I1SA 3U1DA 1M1EB 3L9FA 4XM3A 3W3CA 1F9NA 1X3ZB 2IPQX 4XRMA 1S7EA 4M3BA 4KJZA 2UXNA 3HB9A 1ONVA 4I01A 3KEQA 4RAFA 3JW4A 1OLTA 1X2NA 2RNGA 3QYFA 2K3PA 2XC7A 1W7PA 1G3TA 1T0FA 3D1NI 4M3FA 2VBWA 4GDFA 4RGSA 2KRHA 5EG0A 5L3FA 2EZLA 3ZMZA 3ELKA 3OMYA 4A3FJ 2LF8A 3GLLA 5KK1A 2JK3A 2BHYA 1RI7A 1K78B 3SFIA 2W82A 5JFRA 4XRSG 3QPSA 3D5RC 2HKOA 4A3LJ 1WI3A 3ZQCA 4N0BA 3OYDA 2K40A 4XK4A 5IYBJ 2W7NA 2IW5A 5J6XA 4OMYA 4Y4RA 1FPQA 3KYDB 3HOTA 1KYZA 4HEA2 4CCMA 2PMHA 4E7SA 2CQ7A 1BBYA 4NQWB 2M0CA 2ZNYA 5DUIA 5F64A 3WG9A 1XB4A 4XN0A 2CWEA 1OYYA 3NWSA 3BR5A 1L3LA 2FOKA 3TO7A 1NG6A 1W4MA 2KZVA 1ETQA 1Q1VA 4QSHA 5DEQA 3PM1A 1O3QA 1QHGA 4IJAA 3J80Z 1ZG1A 4XR6A 3OL4A 4IHXA 3QPTA 3MN2A 3CMEI 5F0CA 2EB7A 2ZKZA 3WODF 5J47A 4FTHA 2I8DA 1BR1A 3DPUA 3BROA 1YLFA 3CJQB 1W1WE 1ETYA 2PEXA 1USSA 4Q48A 1U5TC 2HKXA 3S3MA 2HVQA 3CDHA 4OIPF 4OWRB 1XG1A 3PFIA 2NNYA 4P55A 3F8BA 3F6VA 3G2BA 5IT3A 3F72A 1UCRA 2KQRA 4U88A 1QZZA 3OYAA 1MJBA 1X3UA 3GZ5A 4GYGA 1RRJA 3ZXSA 3OL3A 5HLTA 1WJ5A 1B9MA 3KP6A 3F0CA 2HVRA 4PSWA 5LHHA 2HQNA 2UWMA 4AWXB 3S1MJ 2AS5F 2HR3A 1O57A 4HX7A 1YS7A 2PG4A 3FXKA 4RLFA 1XD7A 3JRIA 4M3GA 4A3DJ 2C6YA 5FFXA 2M4GA 3WHCA 2ELHA 2RC4A 3HOWJ 4II3A 1X2MA 1HKQA 2WC2A 2P5VA 1K78A 1RUOA 1ZRFA 4IQJA 2R7TA 1U9NA 1IN7A 2DA5A 3J81Z 4XKCA 2E2JJ 2LVSA 2WB1A 2DA4A 4LB5A 4U87A 3NRVA 2F4OB 2LY2A 1C0WA 1UHMA 4M6VA 3AKZA 1LPQA 4NQWA 2K9MA 2RDPA 5K5OA 2VONA 4C9YA 1YTYA 1BW6A 3FXRA 1ITYA 1Z1DA 2XF6A 2VQCA 3DTEA 4JP0A 3OSFA 3T8RA 1QA6A 1H0MA 4IEJA 5C3EJ 2KZGA 2NS0A 3LSTA 1JUMA 2ISYA 4B4CA 5IPAA 4EGYA 2DMTA 2VN2A 2R5YB 2VBYA 1S6LA 2IEKA 4MQVA 2ISZA 5GAGJ 2OQRA 2EQRA 3M1EA 1DQUA 4I02A 3SEZA 3G4SI 2HOTA 4A3IJ 3KZYA 2VL8A 1TT5B 5IT9Z 3LMMA 3FXOA 4BE1A 1N78A 1U6GA 2X4HA 4FETA 1FWZA 2QCOA 4K2EA 5JVTA 1BW5A 4A6DA 1FYLA 2HDWA 3OYBA 2X6OA 1BM9A 1V4RA 4EV0A 2V6CA 1TL8A 2XDVA 2EINH 2VBZA 1FP1D 2ZBKA 3F8FA 1KU9A 4XLNF 1HLVA 3M9AA 3OS1A 3KETA 4FQGA 3UKGA 4M71A 2W4SA 1HW1A 3M8EA 3GTLJ 1B8IB 3MCZA 3MKYB 9ANTA 2DLLA 5F6FA 3S3NA 2QF7A 2IA1A 5ILSA 2MSYA 4XLHA 4F93B 2XROA 1SVLA 2IBDA 2ZMEB 2R7SA 3WTVC 3E97A 3QODA 3X2QH 2KIMA 2VI6A 1BI0A 2P5KA 2JUGA 3IKVA 1ZG3A 2M30A 2HTJA 2H1KA 2VODA 1SAUA 3JR9A 1Y8RB 2Y30A 4KN4X 4HF2A 3P5JA 4QTRA 4E70A 1QPIA 1JKRC 2BZTA 3KP3A 1W36D 3CMAI 5JVGF 5B1BH 1Y56A 1R5ID 2K27A 3ABUA 4LG0B 1YITI 1FSHA 2ZFUA 3CJTB 5CKTA 1PP8F 1IN4A 2ZC2A 2R4GA 1I39A 4F55A 1HOMA 1FBQA 2XGDA 3SJMA 3H1CA 1EH6A 4AD9A 3DQVC 2OCEA 2W24A 4C30A 5LEKA 1N25A 2L7MP 3LSGA 1FMVA 3UNGC 3W6JB 3ZR8X 2Z9OA 2E7XA 1FIPA 2OAZA 5J1YA 1R7JA 1ZTRA 5HODA 3H9GA 3KPHA 4D9JA 1VQLI 5GTHC 3AL0C 2Y0SA 3E1SA 2NNNA 4WF2A 4HQEA 2DJIA 1JE8A 1ZKGA 3CCUI 1KQ8A 2OJED 3CP8A
chains in the Genus database with same CATH topology
1S29A 3E5QA 3RDIA 1GVJA 3JAMK 1B4AA 1BJAA 4M72A 2M8EA 3DFGA 4KDPA 3FZVA 4A0YA 3RYRA 5JHUA 1TTYA 2RVCA 5LLQA 1E17A 2P5LC 2OZ6A 1BI2A 4UV8A 4ASNA 4AIKA 1ZRDA 4ZYHA 4OOIA 3ZQ7A 4M73A 2STWA 5HLHA 3FMRA 4LG0A 1MDMB 4RGXA 3EETA 3B02A 2HZTA 2M1BA 1ON1A 1XMAA 1D3YA 2HGCA 3IRQA 1YFHA 1Y0UA 1PDNC 1O3SA 3BZ6A 4KICA 2P8TA 1R1VA 2FF4A 1RIOH 2STTA 1ZYRF 2OBPA 1J2XA 3RJPA 3DPTA 1HKTA 3IC7A 4UXNA 4HBLA 5E1WA 1IN8A 4RAYA 1BC8C 4UVBA 3P9CA 3WU0A 3I58A 3P9KA 3T8TA 1TW3A 4Z2YA 1OYWA 2GWRA 4PGHA 3KLNA 2F5EA 4FHTA 1FNNA 5LHIA 2FA5A 4QWQA 2ZO4A 4ZZDA 3B73A 4R79A 3CUQA 1DUXC 2OA4A 2VC0A 2IVMA 1XGOA 5J8FA 3E6BA 1FYMA 4H0EA 4HX4A 3V7SA 1TQMA 5BPDA 4JQFA 4M6XA 4BAYA 4Q47A 2FSWA 1MDMA 2O8XA 1XMKA 3C18A 4A12A 1DDNA 2K4BA 3W6KB 4I7HA 5CVJA 5ILVA 1S8NA 5DCMB 3TO9A 2Q0OA 2R7DA 2W25A 2L54A 2QQBA 3K1NA 1R5GA 2QLZA 2HQRA 2A61A 3TOAA 2OZUA 1RNLA 5TJJA 2A6HF 2VT2A 5ICEA 1T98A 2D2WA 4I09A 5CVIA 3VOEA 4A5NA 3BDDA 2Z33A 2P4WA 3FWEA 5LGUA 3NEUA 1T39A 4IRHA 5BMZA 3HRMA 2XAJA 3F8CA 2QWWA 2P6SA 4MEYF 1U3EM 5FGMA 5ICGA 3IWFA 1SFUA 4HYEA 4U0YA 1NHAA 4WWCA 1MD0A 1QBJA 3I54A 2HFHA 1YYVA 2HOEA 4UNOA 5D8LB 2DQLA 5ILUA 4R8HA 4DNCA 2GQQA 2B0LA 5HDNA 2GZWA 3RPQA 3DF8A 3VFZA 4IHTA 3MQ0A 5CLSA 3JAMZ 2V79A 4MTDA 5CVRA 2DT5A 2H09A 1FLIA 2LDUA 5LRSA 5KVRA 2GAUA 4M9ZA 1WQ2A 3WTTC 5D5VB 1BIBA 4EJVA 1IZ1A 3T0YA 2YPRA 4NHJA 3V4GA 3MEXA 5D4SA 2UZKA 3DP7A 1KU3A 1SD6A 1FYKA 2PBIA 4L9JA 3SQNA 1FSEA 1H9TA 5FLXK 1FT9A 3TOBA 3C7JA 2DK8A 4ENKA 3V8LA 3FM3A 3GVAA 1Z6TA 4OMZA 1LB2A 5E18F 2GA1A 3ZMDA 3O6BB 2XV4S 4B09A 3REOA 1PUEE 2KIFA 5ED4A 4KMUX 2EV6A 2DK5A 2HS5A 3COAC 2MD5A 3ZMVA 2Z3YA 2KJBA 2QQAA 3DKWA 1IN6A 4WXCA 2XAHA 2IA2A 4G6QA 1WRJA 3HRUA 2ZCWA 2A69F 2BGCA 2M87A 2FRHA 2EK5A 5BQTA 3TKYA 2H27A 5EEHA 2DFIA 1LQ1A 4HZFA 3VODA 3K1MA 4HW0A 4KIGA 5D6EA 5JI6A 4D0PA 5E8IA 3ISPA 5DUKA 2A3SA 4FX4A 3R4KA 1EH8A 4L9TA 3RIRA 1KA8A 1HXDA 2RKHA 3FM5A 2XHKA 3HTUA 2P6TA 3WGHA 4UVAA 1GXQA 4UUVA 4DQ2A 3O3KA 3K2ZA 3HRTA 4MHGA 1XGSA 3I59B 1KU7A 3Q5FA 4IF4A 2ETHA 1YIOA 3VB2A 2FBIA 3JTGA 2V1UA 1FOKA 3V7CA 4EGZA 1J0RA 2J5PA 2VOPA 3R61A 1S7OA 3E5XA 4EJWA 5D5WB 5HVQC 2EA4A 2DAOA 2QM3A 2MH9A 2H94A 2ADUA 5TRDA 2G7HA 3KP7A 3E5UA 5K5QA 4EJUA 6PAXA 3BOQA 4I0BA 2IRFG 1WWXA 2L4MA 2MLKA 1CF7B 5CYVA 3GZ6A 4ZYEA 1KGSA 3FF5A 2XKPA 1SFEA 4LFUA 5E17F 1JGSA 5HLGA 4HA8A 1D5VA 4KUMA 4G94A 1K6OA 1JHFA 4L18B 3SHFA 1F5TA 1Q1HA 1XCVA 4KT5C 5ICCA 4S05A 1S7AA 1SMYF 2F5FA 3E6DA 3QU3A 2RGVA 1LDKB 1IN5A 3QPHA 1ZRCA 4BQAA 4EVIA 3J7AO 1GHCA 1D8JA 2CQKA 1JXSA 1EH7A 3ZMUA 2H6CA 3TDZC 2GA2A 2D1VA 2EFPA 4G7ZF 3RYPA 5AIQA 1Z05A 4EM0B 2XUBA 1QNTA 3L7WA 1ZLJA 1IXRC 1W5TA 2GIVA 3HRSA 4LK0F 5FLXZ 2CG4A 4U0WA 4BYYA 4QLCU 4A2UA 3M8FA 4HF1A 1RZ4A 4IPAA 4S04A 4JBAA 4G7HF 3R60A 2K4JA 4XSXF 2D1HA 2O0YA 5L3GA 3R0JA 3GFJA 3JSPA 1CF7A 1FP2A 3F22A 4F7ZA 4U7DA 5H6RA 3PQJA 2RQPA 2QBYB 1R5HA 4CHUA 4GGGA 3V7RA 1OR7A 2X0LA 2E1NA 4G7OF 2XAFA 1UB9A 4FT8A 1YW7A 1U78A 4JK1X 4WK8F 1STZA 3KP2A 2EFWA 3O2PE 1HKSA 5FD5A 2XIGA 3R6SA 2L02A 2PFBA 3HTSB 5AONA 3LFKA 3MZYA 1OPCA 4MTEA 3EDPA 1YW8A 3SXYA 1J75A 2EFNA 2PI0A 1BIAA 4OINF 2NAZA 3VEPA 2ZMEA 4ENNA 1P4AA 5E8GA 5JR3A 3QOPA 3GX4X 1U5TB 1HBXG 3S2WA 4CXFA 2Y0MA 3HHGA 2RN7A 1W5SA 3ZN0A 1SFXA 4L9NA 4YFKF 2RV8A 1WKMA 5DV5A 3Q9VA 3RKYA 2QBYA 4IRGA 4CO8A 2FE3A 3KLOA 4A0XA 3CTAA 2XVCA 1K79A 1D8KA 2NRAC 3DXJF 1ULYA 1ZARA 1XGMA 3H92A 1TNTA 1TQIA 1R1TA 4CZZA 4KIBA 3RTRA 2Q8KA 2MBFA 2F5DA 2F2EA 3G3ZA 4PCQA 4UVCA 3F8MA 3D0SA 2DTRA 3DV8A 1BC7C 5E1ZB 2Z5UA 2CO5A 3LAPA 5E1XA 3RKWA 2VE9A 4CDGA 2BV6A 5D6FA 2COMA 3RKXA 3MWMA 3GFIA 2IA0A 2MA3A 4OIRF 2XAGA 5ERIA 3R0AA 2DPUA 4OIOF 3GWZA 2WV0A 5FFZA 4HDVA 1QO0D 1U5TA 1YO5C 3HIFA 3F21A 1SMTA 4ON0A 2LF7A 1YS6A 3H3ZA 2JSCA 3V8KA 1TQPA 1XDSA 2M5WA 3BP8A 1UHWA 2O61A 3GLXA 4KNYA 3HHHA 2IP2A 4IHSA 4HV6A 3JTHA 2QVOA 3HSEA 1BN5A 4WCGA 2LSOA 3GFMA 1USTA 2KKOA 1XN7A 1DPUA 4CICA 2H6BA 2RNJA 2FQ3A 3LWFA 2ACJA 4ZH4F 4XBFA 1TLHB 2Y75A 1Z6RA 3LA3A 4CYDA 1IF1A 5HS8A 3QP6A 1L0OC 1LEBA 1T6SA 1H9GA 1KQ9A 2MC3A 3EQLF 3BPXA 1J7KA 1ZG5A 1LVAA 2L3DA 5F1RA 4G8XA 2YX7A 3MFKA 3U9GA 4ZYDA 4YFXF 1AWCA 2HDCA 4ETSA 4BXUA 2EV5A 1BI1A 4Y13A 1EV7A 4OIQF 5L3DA 5DCMA 2FMYA 4I0AA 4RB1A 4O5VA 3Q9SA 4R1HA 3J81K 1O3TA 4O3MA 5DYMA 2FBKA 3IWZA 4GYIA 2PN6A 3DEUA 3WE2A 2OQGA 4GO1A 4G9YA 2JZYA 4HDUA 4PZJA 5L3CA 5H6QA 3GFLA 5LRRA 4LB6B 2R3SA 3L00A 3GO5A 3BJOA 1LJ9A 2XKOA 1ZHFA 4I98B 1HQCA 4RGUA 1GXPA 5IT9K 2O03A 3CUOA 1A04A 4XSZF 1KYWA 4WXHA 2KRFA 4N9IA 1AOYA 5HS9A 5D5UB 2ZNZA 3MAJA 4LLLA 1OYIA 2A07F 1ZH5A 1R1UA 1P4WA 1G3YA 4XLPF 3E6CC 4P9FA 3ZPLA 3M7GA 3HSRA 2E1CA 5AIPA 5L3BA 5H20A 3P7NA 3WTYC 3I4PA 3QP5A 3TQNA 4BHCA 2MH2A 4Y15A 3ULQB 1BI3A 3LAJA 4WXDA 5ICFA 3WU1B 4GXOA 1G6NA 1PP7U 1DPRA 1G3SA 4L5IA 5CJ9A 5FD6A 1BOAA 2YSRA 1XSDA 4KA4A 1KU2A 3T5XA 1JHHA 3EYIA 2IT0A 2VBXA 4AIJA 2XAQA 5LGNA 2L4AA 1XSXA 5HS7A 2K7LA 3N4MA 3ZN1A 1W7PD 4YIFA 1G3WA 4MEXF 1MGTA 4YG2F 4PDKA 2PQ8A 2AXLA 2BEOA 2EFOA 1RUNA 1T2KA 3NQOA 1LDJA 3AAFA 2O6GE 5LEJA 2PJPA 3FHZA 3OV8A 1HSJA 3F3XA 2V1DA 2Y48A 3FXUA 2R7FA 5EEGA 5A2QK 3F8NA 2DW4A 2BYVE 3TDUC 3ABTA 1YQAA 1J59A 4LLNA 2L01A 4ENJA 2YR2A 3ZP5A 2FXAA 5HLIA 2JTVA 3PQKA 4HX8A 5BPIA 2JRTA 2V9VA 1ON2A 3CUQC 2DI3A 5FB2A 5E20A 3E3VA 1MZBA 3C1DA 1IRGA 3LQRA 1QQIA 2DU9A 5K1YA 1ZN2A 4IXAA 4O6JA 1TNSA 2JPBA 3FX3A 2OU2A 4Q5SF 3QU6A 1R22A 3I5UA 1F1ZA 1J5YA 3RI4A 3TO6A 5LGTA 4FX0A 4KFCA 1XCBA 2A68F 3RPUA 1XDUA 1FY7A 2WWYA 3I59A 4A6EA 3K9TA 2ZFWA 1QZYA 3IRRA 4HAMA 2W57A 1G4DA 2QZ8A 2VC1A 2FU4A 4HF0A 3EUHA 4L9VA 1YG2A 1SD7A 3WE3A 3HUGA 1LNWA 3LQQA 3LA7A 3OOPA 3WGIA 2EA2A 2HWVA 4UV9A 2J5OA 4NB5A 4U7BA 2P7CB 1I6XA 1HSTA 2GXBA 4HV5A 4XRFA 1J9IA 4RS8A 1B6AA 1KQ0A 1MJAA 4TV7A 2DPDA 2O3FA 2K02A 2BE5F 4A0ZA 1P4XA 2XRNA 2HYFA 1UFMA 2CSOA 1SD4A 1YW9A 2QUFA 1B9NA 1IXCA 2P7VB 4HQMA 2ZJ2A 4M6YA 2LKPA 3G73A 2FBHA 1DP7P 3BJAA 5FO5A 2CW0F 1B59A 1HW5A 5DDGA 3ZMSA 4ENMA 2EWNA 1E2XA 4KMFA 2GXGA 2VXZA 4RB3C 4MGRA 2XASA 3WTXC 2HTSA 3QAHA 3F23A 5L3EA 4ESBA 2XGXA 3GEZA 4LGWA 4ZZLA 2K86A 4RGRA 5DCFA 4P5OA 3KCCA 1LEAA 1OMIA 4EMSA 1Z7UA 2G7UA 3WTZA 1V3FA 2HYGD 1R36A 5J8CA 5A2QZ 1I1GA 2KJCA 1R00A 4N9HA 4WX9A 5DD8A 1I5ZA 2LNBA 4RB2C 4EJOA 5HDKA 4Y17A 3CUQB 3GYHX 3CLOA 3TGNA 3WTWC 2OD5A 3V8JA 4UHTA 2VT3A 1K7AA 4M9XA 3F6OA 2F5CA 5BOXA 4G6DA 2EV0A 3L09A 3WTUC 1TW2A 3ZMTA 3FMSA 3P9IA 3SZTA 1U8RA 5BS6A 1QGPA 2A5YB 4PGGA 3U2RA 2A6EF 4LK1F 3CO7C 3IHUA 1FC3A 1Z9CA 2EFQA 1P6RA 3MZHA 4L0YB 2W85A 3KP4A 3FXQA 2TDXA 3T1BA 5LBQA 1ZAOA 5D8KB 4RB0A 1LDDA 1SD5A 4HOBA 1IRFA 4KYWA 1ODDA 2HEOA 2G9WA 1FBSA 3I71A 3K0LA 1SAXA 5CVVA 3CJNA 3KP5A 4M74A 2CFXA 3SZPA 2VOOA 2JPCA 1ZGJA 3QRFF 3ROUA 2YX4A 2YU3A 4RAZA 4A5MA 1HW2A 3JSOA 3I0TA 4EQQA 2FNPA 2M45A 3KZZA 3LA2A 4L5JA 3HSFA 1F4KA 2JT1A 4AIHA 3ECOA 5LHGA 1QPMA 2Q2EA 4ESFA 3WGGA 2CGPA 4BH9A 1FZPB 4P9UA 4KN7X 2DBBA 2D45A 3GXOA 3C3WA 3GW2A 4YIIA 3BY6A 1R23A 1REPC 1P2FA 4EJTA 1IXSB 3J80K 2CYYA 2QENA 4OU0A 2W84A 1IW7F 4HLXA 4GCVA 1MJ9A 1TBXA 3IKTA 2Z99A 2PMUA 3L2CA 1R58A 3ERED 4EM2A 2FMLA 1XSVA 4M9SA 4ZYGA 3GUDA 2DO7A 3ML6A 1T38A 4AVPA 4L0ZB 2ESHA 4I2OA 2QQ9A 4LJZF 1XGNA 3KEOA 4HLYA 3HOSA 5HOOA 4B8XA 1ZREA 1IAWA 4U0VA 2QYOA 2MLGA 4LD5A 2IJLA 4LLGF 3EYYA 2NYXA 1OKRA 3N97A 3D5LA 1ZGAA 1O7LA 3BWGA 5D5XB 3BPVA 1O3RA 4BHBA 3K1PA 1P92A 3E6MA 4IVNA 1MKMA 2ZXJA 3I64A 1IUYA 2EJRA 5D4RA 3IL2A 3SFZA 4IRIA 1W7PB 2PLYA 4KIFA 3GF2A 5CVUA 3K69A 2VE8A 4ESJA 4P96A 1WI9A 1S3JA 3DPLC 2FNAA 1U2WA 1B1BA 1I27A 4BNCA 5K5RA 3KFWX 4EM1A 4CGZA 2E7WA 1ZLKA 2WTEA 1FBUA 4MQ9F 2UXXA 1CGPA 2ESNA 3BJ6A 3H3UA 4YFNF 2FEZA 1Z91A 2KIUA 3FMQA 1VTNC 4BHPA 1WSUA 2BBYA 4LMYA 5HDGA 4MNUA 3HYIA 2DQRA 4Q4ZF 1FX7A 3ECHA 3WTSC 1O7FA 5DD4A 3CO6C 2V1XA 3I53A 3KE2A 1I1SA 3U1DA 3L9FA 1F9NA 2IPQX 2UXNA 1ONVA 4I01A 3KEQA 3JW4A 1W7PA 1G3TA 1T0FA 2VBWA 4RGSA 5L3FA 3ZMZA 3ELKA 2LF8A 5KK1A 1RI7A 1K78B 5JFRA 2HKOA 4N0BA 2IW5A 5J6XA 4OMYA 1FPQA 3HOTA 1KYZA 2PMHA 1BBYA 5DUIA 2ZNYA 5F64A 3WG9A 1XB4A 2CWEA 1OYYA 1L3LA 2FOKA 3TO7A 1W4MA 5DEQA 1O3QA 4IJAA 3J80Z 1ZG1A 3QPTA 2EB7A 2ZKZA 3WODF 3BROA 1YLFA 2PEXA 1USSA 4Q48A 1U5TC 2HKXA 3CDHA 4OIPF 3PFIA 2NNYA 4P55A 3F8BA 3F6VA 5IT3A 3F72A 1UCRA 4U88A 1QZZA 1MJBA 1X3UA 3GZ5A 4GYGA 1B9MA 3KP6A 5LHHA 2HQNA 2UWMA 4AWXB 2AS5F 2HR3A 1O57A 4HX7A 1YS7A 2PG4A 1XD7A 2C6YA 5FFXA 2ELHA 2RC4A 1HKQA 2WC2A 2P5VA 1K78A 1RUOA 1ZRFA 1IN7A 3J81Z 4LB5A 3NRVA 1C0WA 1UHMA 4NQWA 2RDPA 5K5OA 2VONA 1YTYA 3FXRA 1Z1DA 3T8RA 1H0MA 2NS0A 3LSTA 2ISYA 4EGYA 2VN2A 2VBYA 1S6LA 4MQVA 2ISZA 2OQRA 3M1EA 4I02A 3KZYA 5IT9Z 1U6GA 2X4HA 1FWZA 4K2EA 5JVTA 4A6DA 1FYLA 1BM9A 1V4RA 4EV0A 2V6CA 2VBZA 1FP1D 2ZBKA 3F8FA 1KU9A 4XLNF 3M9AA 3KETA 4M71A 1HW1A 3M8EA 3MCZA 2DLLA 5F6FA 2IA1A 5ILSA 2XROA 2ZMEB 3WTVC 3E97A 2KIMA 1BI0A 2P5KA 3IKVA 1ZG3A 2M30A 2HTJA 2VODA 4KN4X 4HF2A 4E70A 3KP3A 3ABUA 2K27A 4LG0B 1FSHA 1PP8F 1IN4A 1FBQA 1EH6A 4AD9A 3DQVC 2W24A 5LEKA 3W6JB 2Z9OA 2E7XA 2OAZA 1R7JA 2NNNA 4WF2A 4HQEA 1JE8A 1KQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S29 A;  3E5Q A;  3RDI A;  1GVJ A;  3JAM K;  1B4A A;  1BJA A;  4M72 A;  2M8E A;  3DFG A;  4KDP A;  3FZV A;  4A0Y A;  3RYR A;  5JHU A;  1TTY A;  2RVC A;  5LLQ A;  1E17 A;  2P5L C;  2OZ6 A;  1BI2 A;  4UV8 A;  4ASN A;  4AIK A;  1ZRD A;  4ZYH A;  4OOI A;  3ZQ7 A;  4M73 A;  2STW A;  5HLH A;  3FMR A;  4LG0 A;  1MDM B;  4RGX A;  3EET A;  3B02 A;  2HZT A;  2M1B A;  1ON1 A;  1XMA A;  1D3Y A;  2HGC A;  3IRQ A;  1YFH A;  1Y0U A;  1PDN C;  1O3S A;  3BZ6 A;  4KIC A;  2P8T A;  1R1V A;  2FF4 A;  1RIO H;  2STT A;  1ZYR F;  2OBP A;  1J2X A;  3RJP A;  3DPT A;  1HKT A;  3IC7 A;  4UXN A;  4HBL A;  5E1W A;  1IN8 A;  4RAY A;  1BC8 C;  4UVB A;  3P9C A;  3WU0 A;  3I58 A;  3P9K A;  3T8T A;  1TW3 A;  4Z2Y A;  1OYW A;  2GWR A;  4PGH A;  3KLN A;  2F5E A;  4FHT A;  1FNN A;  5LHI A;  2FA5 A;  4QWQ A;  2ZO4 A;  4ZZD A;  3B73 A;  4R79 A;  3CUQ A;  1DUX C;  2OA4 A;  2VC0 A;  2IVM A;  1XGO A;  5J8F A;  3E6B A;  1FYM A;  4H0E A;  4HX4 A;  3V7S A;  1TQM A;  5BPD A;  4JQF A;  4M6X A;  4BAY A;  4Q47 A;  2FSW A;  1MDM A;  2O8X A;  1XMK A;  3C18 A;  4A12 A;  1DDN A;  2K4B A;  3W6K B;  4I7H A;  5CVJ A;  5ILV A;  1S8N A;  5DCM B;  3TO9 A;  2Q0O A;  2R7D A;  2W25 A;  2L54 A;  2QQB A;  3K1N A;  1R5G A;  2QLZ A;  2HQR A;  2A61 A;  3TOA A;  2OZU A;  1RNL A;  5TJJ A;  2A6H F;  2VT2 A;  5ICE A;  1T98 A;  2D2W A;  4I09 A;  5CVI A;  3VOE A;  4A5N A;  3BDD A;  2Z33 A;  2P4W A;  3FWE A;  5LGU A;  3NEU A;  1T39 A;  4IRH A;  5BMZ A;  3HRM A;  2XAJ A;  3F8C A;  2QWW A;  2P6S A;  4MEY F;  1U3E M;  5FGM A;  5ICG A;  3IWF A;  1SFU A;  4HYE A;  4U0Y A;  1NHA A;  4WWC A;  1MD0 A;  1QBJ A;  3I54 A;  2HFH A;  1YYV A;  2HOE A;  4UNO A;  5D8L B;  2DQL A;  5ILU A;  4R8H A;  4DNC A;  2GQQ A;  2B0L A;  5HDN A;  2GZW A;  3RPQ A;  3DF8 A;  3VFZ A;  4IHT A;  3MQ0 A;  5CLS A;  3JAM Z;  2V79 A;  4MTD A;  5CVR A;  2DT5 A;  2H09 A;  1FLI A;  2LDU A;  5LRS A;  5KVR A;  2GAU A;  4M9Z A;  1WQ2 A;  3WTT C;  5D5V B;  1BIB A;  4EJV A;  1IZ1 A;  3T0Y A;  2YPR A;  4NHJ A;  3V4G A;  3MEX A;  5D4S A;  2UZK A;  3DP7 A;  1KU3 A;  1SD6 A;  1FYK A;  2PBI A;  4L9J A;  3SQN A;  1FSE A;  1H9T A;  5FLX K;  1FT9 A;  3TOB A;  3C7J A;  2DK8 A;  4ENK A;  3V8L A;  3FM3 A;  3GVA A;  1Z6T A;  4OMZ A;  1LB2 A;  5E18 F;  2GA1 A;  3ZMD A;  3O6B B;  2XV4 S;  4B09 A;  3REO A;  1PUE E;  2KIF A;  5ED4 A;  4KMU X;  2EV6 A;  2DK5 A;  2HS5 A;  3COA C;  2MD5 A;  3ZMV A;  2Z3Y A;  2KJB A;  2QQA A;  3DKW A;  1IN6 A;  4WXC A;  2XAH A;  2IA2 A;  4G6Q A;  1WRJ A;  3HRU A;  2ZCW A;  2A69 F;  2BGC A;  2M87 A;  2FRH A;  2EK5 A;  5BQT A;  3TKY A;  2H27 A;  5EEH A;  2DFI A;  1LQ1 A;  4HZF A;  3VOD A;  3K1M A;  4HW0 A;  4KIG A;  5D6E A;  5JI6 A;  4D0P A;  5E8I A;  3ISP A;  5DUK A;  2A3S A;  4FX4 A;  3R4K A;  1EH8 A;  4L9T A;  3RIR A;  1KA8 A;  1HXD A;  2RKH A;  3FM5 A;  2XHK A;  3HTU A;  2P6T A;  3WGH A;  4UVA A;  1GXQ A;  4UUV A;  4DQ2 A;  3O3K A;  3K2Z A;  3HRT A;  4MHG A;  1XGS A;  3I59 B;  1KU7 A;  3Q5F A;  4IF4 A;  2ETH A;  1YIO A;  3VB2 A;  2FBI A;  3JTG A;  2V1U A;  1FOK A;  3V7C A;  4EGZ A;  1J0R A;  2J5P A;  2VOP A;  3R61 A;  1S7O A;  3E5X A;  4EJW A;  5D5W B;  5HVQ C;  2EA4 A;  2DAO A;  2QM3 A;  2MH9 A;  2H94 A;  2ADU A;  5TRD A;  2G7H A;  3KP7 A;  3E5U A;  5K5Q A;  4EJU A;  6PAX A;  3BOQ A;  4I0B A;  2IRF G;  1WWX A;  2L4M A;  2MLK A;  1CF7 B;  5CYV A;  3GZ6 A;  4ZYE A;  1KGS A;  3FF5 A;  2XKP A;  1SFE A;  4LFU A;  5E17 F;  1JGS A;  5HLG A;  4HA8 A;  1D5V A;  4KUM A;  4G94 A;  1K6O A;  1JHF A;  4L18 B;  3SHF A;  1F5T A;  1Q1H A;  1XCV A;  4KT5 C;  5ICC A;  4S05 A;  1S7A A;  1SMY F;  2F5F A;  3E6D A;  3QU3 A;  2RGV A;  1LDK B;  1IN5 A;  3QPH A;  1ZRC A;  4BQA A;  4EVI A;  3J7A O;  1GHC A;  1D8J A;  2CQK A;  1JXS A;  1EH7 A;  3ZMU A;  2H6C A;  3TDZ C;  2GA2 A;  2D1V A;  2EFP A;  4G7Z F;  3RYP A;  5AIQ A;  1Z05 A;  4EM0 B;  2XUB A;  1QNT A;  3L7W A;  1ZLJ A;  1IXR C;  1W5T A;  2GIV A;  3HRS A;  4LK0 F;  5FLX Z;  2CG4 A;  4U0W A;  4BYY A;  4QLC U;  4A2U A;  3M8F A;  4HF1 A;  1RZ4 A;  4IPA A;  4S04 A;  4JBA A;  4G7H F;  3R60 A;  2K4J A;  4XSX F;  2D1H A;  2O0Y A;  5L3G A;  3R0J A;  3GFJ A;  3JSP A;  1CF7 A;  1FP2 A;  3F22 A;  4F7Z A;  4U7D A;  5H6R A;  3PQJ A;  2RQP A;  2QBY B;  1R5H A;  4CHU A;  4GGG A;  3V7R A;  1OR7 A;  2X0L A;  2E1N A;  4G7O F;  2XAF A;  1UB9 A;  4FT8 A;  1YW7 A;  1U78 A;  4JK1 X;  4WK8 F;  1STZ A;  3KP2 A;  2EFW A;  3O2P E;  1HKS A;  5FD5 A;  2XIG A;  3R6S A;  2L02 A;  2PFB A;  3HTS B;  5AON A;  3LFK A;  3MZY A;  1OPC A;  4MTE A;  3EDP A;  1YW8 A;  3SXY A;  1J75 A;  2EFN A;  2PI0 A;  1BIA A;  4OIN F;  2NAZ A;  3VEP A;  2ZME A;  4ENN A;  1P4A A;  5E8G A;  5JR3 A;  3QOP A;  3GX4 X;  1U5T B;  1HBX G;  3S2W A;  4CXF A;  2Y0M A;  3HHG A;  2RN7 A;  1W5S A;  3ZN0 A;  1SFX A;  4L9N A;  4YFK F;  2RV8 A;  1WKM A;  5DV5 A;  3Q9V A;  3RKY A;  2QBY A;  4IRG A;  4CO8 A;  2FE3 A;  3KLO A;  4A0X A;  3CTA A;  2XVC A;  1K79 A;  1D8K A;  2NRA C;  3DXJ F;  1ULY A;  1ZAR A;  1XGM A;  3H92 A;  1TNT A;  1TQI A;  1R1T A;  4CZZ A;  4KIB A;  3RTR A;  2Q8K A;  2MBF A;  2F5D A;  2F2E A;  3G3Z A;  4PCQ A;  4UVC A;  3F8M A;  3D0S A;  2DTR A;  3DV8 A;  1BC7 C;  5E1Z B;  2Z5U A;  2CO5 A;  3LAP A;  5E1X A;  3RKW A;  2VE9 A;  4CDG A;  2BV6 A;  5D6F A;  2COM A;  3RKX A;  3MWM A;  3GFI A;  2IA0 A;  2MA3 A;  4OIR F;  2XAG A;  5ERI A;  3R0A A;  2DPU A;  4OIO F;  3GWZ A;  2WV0 A;  5FFZ A;  4HDV A;  1QO0 D;  1U5T A;  1YO5 C;  3HIF A;  3F21 A;  1SMT A;  4ON0 A;  2LF7 A;  1YS6 A;  3H3Z A;  2JSC A;  3V8K A;  1TQP A;  1XDS A;  2M5W A;  3BP8 A;  1UHW A;  2O61 A;  3GLX A;  4KNY A;  3HHH A;  2IP2 A;  4IHS A;  4HV6 A;  3JTH A;  2QVO A;  3HSE A;  1BN5 A;  4WCG A;  2LSO A;  3GFM A;  1UST A;  2KKO A;  1XN7 A;  1DPU A;  4CIC A;  2H6B A;  2RNJ A;  2FQ3 A;  3LWF A;  2ACJ A;  4ZH4 F;  4XBF A;  1TLH B;  2Y75 A;  1Z6R A;  3LA3 A;  4CYD A;  1IF1 A;  5HS8 A;  3QP6 A;  1L0O C;  1LEB A;  1T6S A;  1H9G A;  1KQ9 A;  2MC3 A;  3EQL F;  3BPX A;  1J7K A;  1ZG5 A;  1LVA A;  2L3D A;  5F1R A;  4G8X A;  2YX7 A;  3MFK A;  3U9G A;  4ZYD A;  4YFX F;  1AWC A;  2HDC A;  4ETS A;  4BXU A;  2EV5 A;  1BI1 A;  4Y13 A;  1EV7 A;  4OIQ F;  5L3D A;  5DCM A;  2FMY A;  4I0A A;  4RB1 A;  4O5V A;  3Q9S A;  4R1H A;  3J81 K;  1O3T A;  4O3M A;  5DYM A;  2FBK A;  3IWZ A;  4GYI A;  2PN6 A;  3DEU A;  3WE2 A;  2OQG A;  4GO1 A;  4G9Y A;  2JZY A;  4HDU A;  4PZJ A;  5L3C A;  5H6Q A;  3GFL A;  5LRR A;  4LB6 B;  2R3S A;  3L00 A;  3GO5 A;  3BJO A;  1LJ9 A;  2XKO A;  1ZHF A;  4I98 B;  1HQC A;  4RGU A;  1GXP A;  5IT9 K;  2O03 A;  3CUO A;  1A04 A;  4XSZ F;  1KYW A;  4WXH A;  2KRF A;  4N9I A;  1AOY A;  5HS9 A;  5D5U B;  2ZNZ A;  3MAJ A;  4LLL A;  1OYI A;  2A07 F;  1ZH5 A;  1R1U A;  1P4W A;  1G3Y A;  4XLP F;  3E6C C;  4P9F A;  3ZPL A;  3M7G A;  3HSR A;  2E1C A;  5AIP A;  5L3B A;  5H20 A;  3P7N A;  3WTY C;  3I4P A;  3QP5 A;  3TQN A;  4BHC A;  2MH2 A;  4Y15 A;  3ULQ B;  1BI3 A;  3LAJ A;  4WXD A;  5ICF A;  3WU1 B;  4GXO A;  1G6N A;  1PP7 U;  1DPR A;  1G3S A;  4L5I A;  5CJ9 A;  5FD6 A;  1BOA A;  2YSR A;  1XSD A;  4KA4 A;  1KU2 A;  3T5X A;  1JHH A;  3EYI A;  2IT0 A;  2VBX A;  4AIJ A;  2XAQ A;  5LGN A;  2L4A A;  1XSX A;  5HS7 A;  2K7L A;  3N4M A;  3ZN1 A;  1W7P D;  4YIF A;  1G3W A;  4MEX F;  1MGT A;  4YG2 F;  4PDK A;  2PQ8 A;  2AXL A;  2BEO A;  2EFO A;  1RUN A;  1T2K A;  3NQO A;  1LDJ A;  3AAF A;  2O6G E;  5LEJ A;  2PJP A;  3FHZ A;  3OV8 A;  1HSJ A;  3F3X A;  2V1D A;  2Y48 A;  3FXU A;  2R7F A;  5EEG A;  5A2Q K;  3F8N A;  2DW4 A;  2BYV E;  3TDU C;  3ABT A;  1YQA A;  1J59 A;  4LLN A;  2L01 A;  4ENJ A;  2YR2 A;  3ZP5 A;  2FXA A;  5HLI A;  2JTV A;  3PQK A;  4HX8 A;  5BPI A;  2JRT A;  2V9V A;  1ON2 A;  3CUQ C;  2DI3 A;  5FB2 A;  5E20 A;  3E3V A;  1MZB A;  3C1D A;  1IRG A;  3LQR A;  1QQI A;  2DU9 A;  5K1Y A;  1ZN2 A;  4IXA A;  4O6J A;  1TNS A;  2JPB A;  3FX3 A;  2OU2 A;  4Q5S F;  3QU6 A;  1R22 A;  3I5U A;  1F1Z A;  1J5Y A;  3RI4 A;  3TO6 A;  5LGT A;  4FX0 A;  4KFC A;  1XCB A;  2A68 F;  3RPU A;  1XDU A;  1FY7 A;  2WWY A;  3I59 A;  4A6E A;  3K9T A;  2ZFW A;  1QZY A;  3IRR A;  4HAM A;  2W57 A;  1G4D A;  2QZ8 A;  2VC1 A;  2FU4 A;  4HF0 A;  3EUH A;  4L9V A;  1YG2 A;  1SD7 A;  3WE3 A;  3HUG A;  1LNW A;  3LQQ A;  3LA7 A;  3OOP A;  3WGI A;  2EA2 A;  2HWV A;  4UV9 A;  2J5O A;  4NB5 A;  4U7B A;  2P7C B;  1I6X A;  1HST A;  2GXB A;  4HV5 A;  4XRF A;  1J9I A;  4RS8 A;  1B6A A;  1KQ0 A;  1MJA A;  4TV7 A;  2DPD A;  2O3F A;  2K02 A;  2BE5 F;  4A0Z A;  1P4X A;  2XRN A;  2HYF A;  1UFM A;  2CSO A;  1SD4 A;  1YW9 A;  2QUF A;  1B9N A;  1IXC A;  2P7V B;  4HQM A;  2ZJ2 A;  4M6Y A;  2LKP A;  3G73 A;  2FBH A;  1DP7 P;  3BJA A;  5FO5 A;  2CW0 F;  1B59 A;  1HW5 A;  5DDG A;  3ZMS A;  4ENM A;  2EWN A;  1E2X A;  4KMF A;  2GXG A;  2VXZ A;  4RB3 C;  4MGR A;  2XAS A;  3WTX C;  2HTS A;  3QAH A;  3F23 A;  5L3E A;  4ESB A;  2XGX A;  3GEZ A;  4LGW A;  4ZZL A;  2K86 A;  4RGR A;  5DCF A;  4P5O A;  3KCC A;  1LEA A;  1OMI A;  4EMS A;  1Z7U A;  2G7U A;  3WTZ A;  1V3F A;  2HYG D;  1R36 A;  5J8C A;  5A2Q Z;  1I1G A;  2KJC A;  1R00 A;  4N9H A;  4WX9 A;  5DD8 A;  1I5Z A;  2LNB A;  4RB2 C;  4EJO A;  5HDK A;  4Y17 A;  3CUQ B;  3GYH X;  3CLO A;  3TGN A;  3WTW C;  2OD5 A;  3V8J A;  4UHT A;  2VT3 A;  1K7A A;  4M9X A;  3F6O A;  2F5C A;  5BOX A;  4G6D A;  2EV0 A;  3L09 A;  3WTU C;  1TW2 A;  3ZMT A;  3FMS A;  3P9I A;  3SZT A;  1U8R A;  5BS6 A;  1QGP A;  2A5Y B;  4PGG A;  3U2R A;  2A6E F;  4LK1 F;  3CO7 C;  3IHU A;  1FC3 A;  1Z9C A;  2EFQ A;  1P6R A;  3MZH A;  4L0Y B;  2W85 A;  3KP4 A;  3FXQ A;  2TDX A;  3T1B A;  5LBQ A;  1ZAO A;  5D8K B;  4RB0 A;  1LDD A;  1SD5 A;  4HOB A;  1IRF A;  4KYW A;  1ODD A;  2HEO A;  2G9W A;  1FBS A;  3I71 A;  3K0L A;  1SAX A;  5CVV A;  3CJN A;  3KP5 A;  4M74 A;  2CFX A;  3SZP A;  2VOO A;  2JPC A;  1ZGJ A;  3QRF F;  3ROU A;  2YX4 A;  2YU3 A;  4RAZ A;  4A5M A;  1HW2 A;  3JSO A;  3I0T A;  4EQQ A;  2FNP A;  2M45 A;  3KZZ A;  3LA2 A;  4L5J A;  3HSF A;  1F4K A;  2JT1 A;  4AIH A;  3ECO A;  5LHG A;  1QPM A;  2Q2E A;  4ESF A;  3WGG A;  2CGP A;  4BH9 A;  1FZP B;  4P9U A;  4KN7 X;  2DBB A;  2D45 A;  3GXO A;  3C3W A;  3GW2 A;  4YII A;  3BY6 A;  1R23 A;  1REP C;  1P2F A;  4EJT A;  1IXS B;  3J80 K;  2CYY A;  2QEN A;  4OU0 A;  2W84 A;  1IW7 F;  4HLX A;  4GCV A;  1MJ9 A;  1TBX A;  3IKT A;  2Z99 A;  2PMU A;  3L2C A;  1R58 A;  3ERE D;  4EM2 A;  2FML A;  1XSV A;  4M9S A;  4ZYG A;  3GUD A;  2DO7 A;  3ML6 A;  1T38 A;  4AVP A;  4L0Z B;  2ESH A;  4I2O A;  2QQ9 A;  4LJZ F;  1XGN A;  3KEO A;  4HLY A;  3HOS A;  5HOO A;  4B8X A;  1ZRE A;  1IAW A;  4U0V A;  2QYO A;  2MLG A;  4LD5 A;  2IJL A;  4LLG F;  3EYY A;  2NYX A;  1OKR A;  3N97 A;  3D5L A;  1ZGA A;  1O7L A;  3BWG A;  5D5X B;  3BPV A;  1O3R A;  4BHB A;  3K1P A;  1P92 A;  3E6M A;  4IVN A;  1MKM A;  2ZXJ A;  3I64 A;  1IUY A;  2EJR A;  5D4R A;  3IL2 A;  3SFZ A;  4IRI A;  1W7P B;  2PLY A;  4KIF A;  3GF2 A;  5CVU A;  3K69 A;  2VE8 A;  4ESJ A;  4P96 A;  1WI9 A;  1S3J A;  3DPL C;  2FNA A;  1U2W A;  1B1B A;  1I27 A;  4BNC A;  5K5R A;  3KFW X;  4EM1 A;  4CGZ A;  2E7W A;  1ZLK A;  2WTE A;  1FBU A;  4MQ9 F;  2UXX A;  1CGP A;  2ESN A;  3BJ6 A;  3H3U A;  4YFN F;  2FEZ A;  1Z91 A;  2KIU A;  3FMQ A;  1VTN C;  4BHP A;  1WSU A;  2BBY A;  4LMY A;  5HDG A;  4MNU A;  3HYI A;  2DQR A;  4Q4Z F;  1FX7 A;  3ECH A;  3WTS C;  1O7F A;  5DD4 A;  3CO6 C;  2V1X A;  3I53 A;  3KE2 A;  1I1S A;  3U1D A;  3L9F A;  1F9N A;  2IPQ X;  2UXN A;  1ONV A;  4I01 A;  3KEQ A;  3JW4 A;  1W7P A;  1G3T A;  1T0F A;  2VBW A;  4RGS A;  5L3F A;  3ZMZ A;  3ELK A;  2LF8 A;  5KK1 A;  1RI7 A;  1K78 B;  5JFR A;  2HKO A;  4N0B A;  2IW5 A;  5J6X A;  4OMY A;  1FPQ A;  3HOT A;  1KYZ A;  2PMH A;  1BBY A;  5DUI A;  2ZNY A;  5F64 A;  3WG9 A;  1XB4 A;  2CWE A;  1OYY A;  1L3L A;  2FOK A;  3TO7 A;  1W4M A;  5DEQ A;  1O3Q A;  4IJA A;  3J80 Z;  1ZG1 A;  3QPT A;  2EB7 A;  2ZKZ A;  3WOD F;  3BRO A;  1YLF A;  2PEX A;  1USS A;  4Q48 A;  1U5T C;  2HKX A;  3CDH A;  4OIP F;  3PFI A;  2NNY A;  4P55 A;  3F8B A;  3F6V A;  5IT3 A;  3F72 A;  1UCR A;  4U88 A;  1QZZ A;  1MJB A;  1X3U A;  3GZ5 A;  4GYG A;  1B9M A;  3KP6 A;  5LHH A;  2HQN A;  2UWM A;  4AWX B;  2AS5 F;  2HR3 A;  1O57 A;  4HX7 A;  1YS7 A;  2PG4 A;  1XD7 A;  2C6Y A;  5FFX A;  2ELH A;  2RC4 A;  1HKQ A;  2WC2 A;  2P5V A;  1K78 A;  1RUO A;  1ZRF A;  1IN7 A;  3J81 Z;  4LB5 A;  3NRV A;  1C0W A;  1UHM A;  4NQW A;  2RDP A;  5K5O A;  2VON A;  1YTY A;  3FXR A;  1Z1D A;  3T8R A;  1H0M A;  2NS0 A;  3LST A;  2ISY A;  4EGY A;  2VN2 A;  2VBY A;  1S6L A;  4MQV A;  2ISZ A;  2OQR A;  3M1E A;  4I02 A;  3KZY A;  5IT9 Z;  1U6G A;  2X4H A;  1FWZ A;  4K2E A;  5JVT A;  4A6D A;  1FYL A;  1BM9 A;  1V4R A;  4EV0 A;  2V6C A;  2VBZ A;  1FP1 D;  2ZBK A;  3F8F A;  1KU9 A;  4XLN F;  3M9A A;  3KET A;  4M71 A;  1HW1 A;  3M8E A;  3MCZ A;  2DLL A;  5F6F A;  2IA1 A;  5ILS A;  2XRO A;  2ZME B;  3WTV C;  3E97 A;  2KIM A;  1BI0 A;  2P5K A;  3IKV A;  1ZG3 A;  2M30 A;  2HTJ A;  2VOD A;  4KN4 X;  4HF2 A;  4E70 A;  3KP3 A;  3ABU A;  2K27 A;  4LG0 B;  1FSH A;  1PP8 F;  1IN4 A;  1FBQ A;  1EH6 A;  4AD9 A;  3DQV C;  2W24 A;  5LEK A;  3W6J B;  2Z9O A;  2E7X A;  2OAZ A;  1R7J A;  2NNN A;  4WF2 A;  4HQE A;  1JE8 A;  1KQ8 A; 
#chains in the Genus database with same CATH topology
 1S29 A;  3E5Q A;  3BT9 A;  1NK2 P;  3RDI A;  1GVJ A;  3L2U A;  3A1Y A;  2L9S A;  3JAM K;  1B4A A;  4XL9 A;  1BJA A;  2F6C A;  4M72 A;  2HXI A;  2CS3 A;  1B8I A;  3CMY A;  1JKQ C;  2M8E A;  3DFG A;  1FJL A;  1JKP C;  4KDP A;  3FZV A;  3CCM I;  2ZSH B;  2NOJ B;  1AU7 A;  4A0Y A;  3RYR A;  5JHU A;  1TTY A;  2RVC A;  5LLQ A;  1X3W B;  5F0F A;  1E17 A;  1Y0N A;  4CCK A;  1FTZ A;  2MC4 A;  2P5L C;  4BS9 A;  2OZ6 A;  1BI2 A;  4UV8 A;  3O8G A;  4ASN A;  4AIK A;  2M0M A;  1ZRD A;  4ZYH A;  1YJN I;  4OOI A;  2HDD A;  3ZQ7 A;  4F91 B;  4M73 A;  2STW A;  3C2H A;  5HLH A;  3FMR A;  3KIO A;  3CF5 F;  3OIQ A;  4LG0 A;  1MDM B;  2Z1D A;  3G1M A;  3ERM A;  3S1N J;  4RGX A;  1QZE A;  3B02 A;  3EET A;  2HZT A;  2M1B A;  1ON1 A;  1XMA A;  2XF5 A;  1D3Y A;  2HGC A;  3IRQ A;  1TWF J;  1YFH A;  2OPT A;  3CC4 I;  1Y0U A;  1PDN C;  4HSR A;  1O3S A;  3BZ6 A;  4KIC A;  3G71 I;  1X1C A;  2MG4 A;  2P8T A;  2NVT J;  2ZXI A;  1OQY A;  1R1V A;  3ZOB A;  4RAG A;  1RKW A;  2FF4 A;  1RIO H;  2STT A;  2CMP A;  1ZYR F;  2OBP A;  3A4C A;  1J2X A;  4BDY A;  5DS9 A;  2WAF A;  3DPT A;  3RJP A;  1HKT A;  3IC7 A;  4UXN A;  4HBL A;  2IGN A;  1B72 B;  5E1W A;  4B3X A;  4XN3 A;  1D1B A;  5K7F A;  3M3Y J;  1IN8 A;  4RAY A;  2OC6 A;  1BC8 C;  2XB5 A;  2WA0 A;  4UVB A;  4IO9 F;  3P9C A;  4PSX A;  3WU0 A;  5EYR A;  3I58 A;  3P9K A;  1UMQ A;  3T8T A;  1TW3 A;  2B7E A;  1OYW A;  2CQN A;  2GWR A;  4Z2Y A;  3AG1 H;  4J00 A;  4PGH A;  3KLN A;  2P81 A;  2F5E A;  4FHT A;  1FNN A;  3CQZ J;  3PNY A;  5LHI A;  2FA5 A;  4QWQ A;  2ZO4 A;  3BG3 A;  4NDL A;  4ZZD A;  3B73 A;  2JMW A;  3CCS I;  2JQ7 A;  4ABZ A;  2MD0 A;  4R79 A;  3CUQ A;  1DUX C;  5IYD J;  3CCQ I;  4AC0 A;  3H0G J;  2OA4 A;  5M3M J;  2VC0 A;  3PO2 J;  2IVM A;  1XGO A;  3H5A A;  4PFO A;  5J8F A;  1WJD A;  3E6B A;  4EEF G;  1OCZ H;  3S2D J;  3TBI A;  2K5C A;  2L0K A;  2V7F A;  4E6K G;  4H0E A;  4HX4 A;  3V7S A;  1FYM A;  2GLO A;  3IH3 A;  1TQM A;  3JRD A;  2DXI A;  2L5Q A;  5BPD A;  4JQF A;  4M6X A;  4BAY A;  1Z3Y A;  4Q47 A;  2FSW A;  1MDM A;  3QYB A;  2O8X A;  1XMK A;  3C18 A;  4A12 A;  1DDN A;  4DYC A;  1MH3 A;  1MMA A;  3JRE A;  2K4B A;  2JN6 A;  1LFP A;  2X48 A;  3W6K B;  2WBM A;  1Z67 A;  4HPQ A;  4I7H A;  2CUF A;  2VUM J;  4F52 A;  3PNT A;  5CVJ A;  5ILV A;  1S8N A;  5DCM B;  4HNT A;  3VWB A;  3TO9 A;  2Q0O A;  2R7D A;  1ETX A;  2DMQ A;  2L54 A;  2W25 A;  2QQB A;  3K1N A;  1POG A;  4DW6 A;  1R5G A;  4BQO A;  3GBG A;  2QLZ A;  2HQR A;  1B72 A;  1F36 A;  2A61 A;  4RM2 A;  3TOA A;  2R7V A;  5C4X J;  1ENH A;  2OZU A;  1T56 A;  1RNL A;  5TJJ A;  4BDZ A;  2A6H F;  2VT2 A;  1TT0 A;  3WU2 C;  2Z16 A;  5ICE A;  1MH4 A;  1UHS A;  2EIM H;  4BY7 J;  3VYR B;  1T98 A;  1W0U A;  4HG2 A;  2D2W A;  4I09 A;  5CVI A;  3VOE A;  4A5N A;  2XF7 A;  3BZC A;  3QOE A;  2CUE A;  2ICW G;  1FTT A;  2E60 A;  4XOR A;  3BDD A;  2CW7 A;  2A5W A;  2LH9 A;  1IC8 A;  3O8H A;  2Z33 A;  2P4W A;  3FWE A;  5LGU A;  3NEU A;  1T39 A;  1PYV A;  4IRH A;  1FOY A;  5BMZ A;  3HRM A;  2XAJ A;  3EUH C;  3F8C A;  1JT6 A;  2JUC A;  5IOY A;  1SEU A;  1AKH B;  1QVU A;  2QWW A;  4BXF A;  3LSH A;  2P6S A;  3NWT A;  4MEY F;  1U3E M;  4RA2 A;  4D7M A;  5FGM A;  5ICG A;  3AL0 B;  1DGW Y;  3S1Q J;  3IWF A;  1SFU A;  4P1W A;  5J4Y A;  1JJ6 C;  2DYR H;  4HYE A;  2OV7 A;  4U0Y A;  1KON A;  1NHA A;  4WWC A;  3EUK L;  1MD0 A;  1QBJ A;  2FX0 A;  3I54 A;  2HFH A;  1YYV A;  2DJN A;  2HOE A;  1OFC X;  5D8L B;  4UNO A;  3ZQH A;  2DQL A;  4R8H A;  4DNC A;  2GQQ A;  5ILU A;  2B0L A;  1IDZ A;  3TP3 A;  5HDN A;  1GLN A;  2M7A A;  2HPI A;  2GZW A;  4IQ4 A;  3RPQ A;  5H2F C;  1ZGW A;  1VQN I;  3DF8 A;  3VFZ A;  5M5X J;  3HG9 A;  4MIM A;  2R93 J;  4CSW A;  4E7K A;  1AHD P;  4IHT A;  3L2Q A;  2KDO A;  3MQ0 A;  5CLS A;  3JAM Z;  1IJW C;  2F4M B;  4XNF A;  3UR3 C;  2I10 A;  2V79 A;  2OF7 A;  4MTD A;  2EBI A;  1Z77 A;  2X6W A;  5CVR A;  2DT5 A;  2H09 A;  1FLI A;  2LLK A;  2LDU A;  3W2A A;  3IP4 B;  5LRS A;  5KVR A;  3HOZ J;  2GAU A;  1VQK I;  4M9Z A;  1WQ2 A;  1RET A;  3BTI A;  1QU3 A;  3WTT C;  5D5V B;  2JWT A;  2N8G A;  1BIB A;  3ABL H;  3VYS B;  4EJV A;  3IAS 2;  1IZ1 A;  1IG7 A;  3ABM H;  4CA0 A;  4BXX J;  2E5Z A;  2ME6 A;  3K10 A;  3T0Y A;  4DYR A;  2YPR A;  5E3N A;  4NHJ A;  3V4G A;  4CYC B;  3MEX A;  5D4S A;  2UZK A;  2XPU A;  2VPR A;  2DA2 A;  3DP7 A;  5EZG A;  1KU3 A;  3DCF A;  1SD6 A;  1FYK A;  1LVK A;  5FLM J;  4UB8 C;  4FCY A;  5FKM A;  1AKH A;  2PBI A;  3H35 A;  4L9J A;  3SQN A;  1ZR4 A;  1FSE A;  1H9T A;  5M5Y J;  5JLX A;  2VPL A;  4ZJZ A;  4IOA F;  2HQA A;  5FLX K;  3I4N J;  5B1A H;  3WG7 H;  2L7Z A;  1FT9 A;  3TOB A;  3OYN A;  3IV5 A;  2FJ1 A;  3C7J A;  2IAI A;  3BG7 A;  5F1J A;  1IGN A;  2LY1 A;  2DK8 A;  3H0D A;  4BQN A;  4ENK A;  3EPZ A;  4ZC3 A;  3V8L A;  1A31 A;  1WVR A;  3FM3 A;  3ZRG A;  1X19 A;  2AQE A;  3GVA A;  1Z6T A;  4OMZ A;  3OY9 A;  1LB2 A;  1T08 B;  1X4P A;  3A0B C;  5E18 F;  2GA1 A;  4X1E A;  5GTI C;  3ZMD A;  1T95 A;  3BC8 A;  3O6B B;  3DLL F;  2XV4 S;  1OCP A;  1VFC A;  2FD5 A;  2EZH A;  4B09 A;  2E34 A;  3REO A;  1YIJ I;  1PUE E;  2KIF A;  5ED4 A;  4KMU X;  2EV6 A;  2DK5 A;  2HS5 A;  3COA C;  1X4O A;  3KX2 A;  2MD5 A;  3BTC A;  3ZMV A;  2Z3Y A;  4Z6Y A;  2KJB A;  2QQA A;  2F5V A;  1MBF A;  3DKW A;  1JTX A;  1IN6 A;  3ZGK A;  4WXC A;  4PJN A;  2XAH A;  2IA2 A;  3IH4 A;  4G6Q A;  1WRJ A;  3HRU A;  2ZCW A;  2KIS A;  4Y33 A;  2DOD A;  2A69 F;  2BGC A;  5IY5 H;  3PFY A;  2M87 A;  2FRH A;  2EK5 A;  1J09 A;  4IHY A;  4PJM A;  2TCT A;  5BQT A;  2JVG A;  1UAA A;  3S2H J;  3TKY A;  2H27 A;  1TWG J;  5EEH A;  2DFI A;  1LQ1 A;  4HZF A;  5GP9 A;  2X6X A;  3VOD A;  1UG0 A;  3K1M A;  4DYQ A;  3H5R A;  4HW0 A;  4KIG A;  5D6E A;  5JI6 A;  3SDB A;  4D0P A;  5E8I A;  1WH5 A;  3K4M A;  3K7A J;  3ISP A;  5DUK A;  3K4J A;  1TP4 A;  1ETV A;  2A3S A;  3HJE A;  4FX4 A;  1ERD A;  3R4K A;  2WAE A;  1EH8 A;  1VI0 A;  2XB0 X;  4L9T A;  3RIR A;  1KA8 A;  3W2W A;  4PJJ A;  1HXD A;  2RKH A;  3FM5 A;  2X6Y A;  2L9N A;  2XHK A;  3HTU A;  2KT0 A;  2P6T A;  3CDI A;  5TIS C;  3WGH A;  4UVA A;  4X6A J;  1TWH J;  1GXQ A;  4XLC A;  1X1A A;  4UUV A;  1MBJ A;  4DQ2 A;  3O3K A;  1BJZ A;  4XLF A;  4A69 C;  1QVT A;  4B47 A;  3CC2 I;  2WY7 Q;  1IO2 A;  2KRC A;  3K2Z A;  2K9S A;  4PUS A;  3HRT A;  4XOT A;  1VZ0 A;  4MHG A;  1XGS A;  3I59 B;  1KU7 A;  1WH7 A;  2E5N A;  2KL4 A;  3Q5F A;  2O8K A;  1WJF A;  4IF4 A;  3OR2 C;  5FRM A;  2ETH A;  3BG6 A;  4H4K C;  1YIO A;  1UEL B;  1T33 A;  3VB2 A;  2FBI A;  1Z0X A;  4F3Q A;  2R7X A;  3BR3 A;  3FKJ A;  3JTG A;  2V1U A;  1FOK A;  4OAY A;  4LOC A;  3ASO H;  5KHD A;  4X0G A;  2MYS A;  5CPR B;  3V7C A;  4EGZ A;  1J0R A;  5TGT A;  2IS2 A;  2XRL A;  3HUG B;  3NAR A;  2J5P A;  5EEA A;  1A6I A;  2VOP A;  2CW8 A;  2YS9 A;  2BXZ A;  1MMD A;  1MMS A;  3GTK J;  3R61 A;  1S7O A;  3E5X A;  4EJW A;  3JRC A;  2VJI A;  5D5W B;  1YE9 A;  3S32 A;  5HVQ C;  3LSM A;  2DDA A;  2EA4 A;  1TWC J;  3CCJ I;  2DAO A;  5J40 A;  2QM3 A;  2MH9 A;  2H94 A;  2ADU A;  3OYI A;  5TRD A;  1ACI A;  1OCO H;  2G7H A;  1LFB A;  3KP7 A;  2VB6 A;  3E5U A;  5K5Q A;  1MND A;  4EJU A;  6PAX A;  3HOV J;  3BOQ A;  5GAE J;  4I0B A;  5C4J J;  2IRF G;  3HPG A;  1WWX A;  3QYE A;  2L4M A;  5FRO A;  2MLK A;  1CF7 B;  2M2E A;  5CYV A;  3GZ6 A;  4ZYE A;  1KGS A;  3FF5 A;  4DGW B;  2XKP A;  1SFE A;  4LFU A;  1H89 C;  5E17 F;  1LKX A;  1JGS A;  3K6G A;  5HLG A;  4HA8 A;  1D5V A;  4KUM A;  4G94 A;  2M4K A;  1K6O A;  1JHF A;  2BVL A;  3BTL A;  3CJR B;  3SHF A;  4L18 B;  1F5T A;  3RPU D;  2VLA A;  2BVM A;  1Q1H A;  1XCV A;  4KT5 C;  1X58 A;  5ICC A;  3VSK A;  4QPQ A;  4S05 A;  1Z21 A;  2ECB A;  3DWL E;  1S7A A;  1SMY F;  2F5F A;  5DM6 F;  3E6D A;  3QU3 A;  2RGV A;  1LDK B;  1IN5 A;  3QPH A;  1ZRC A;  3PUF A;  4BQA A;  5F27 A;  3DBR B;  3RKQ A;  3KYL A;  3J7Z I;  4EVI A;  2QEX I;  3ZCO A;  3J7A O;  1GHC A;  3A01 B;  2NVX J;  1D8J A;  2CQK A;  1JXS A;  1EH7 A;  3I55 I;  4MO7 A;  2RRE A;  2BY1 A;  1U0J A;  3ZMU A;  2H6C A;  3TDZ C;  2GA2 A;  2D1V A;  3CF2 A;  3FK7 A;  2EFP A;  4G7Z F;  3RYP A;  3JCU C;  5AIQ A;  1Z05 A;  3C2B A;  4EM0 B;  2RQQ A;  1RC9 A;  2XUB A;  3GTQ J;  1QNT A;  3L1P A;  3L7W A;  1ZLJ A;  1IXR C;  1W5T A;  2GIV A;  2R0Q C;  4A3M J;  3HRS A;  4LK0 F;  5FLX Z;  1ETK A;  2CG4 A;  4U0W A;  4BYY A;  4QLC U;  4A2U A;  2K9L A;  3M8F A;  1CQT A;  4HF1 A;  3CP2 A;  1RZ4 A;  4IPA A;  4S04 A;  2HNH A;  1JT0 A;  4JBA A;  2YU9 J;  4G7H F;  2UUZ A;  2IS4 A;  3R60 A;  4II2 A;  2K4J A;  1YX5 A;  4XSX F;  4KIS A;  2D1H A;  2O0Y A;  2ID6 A;  3K4L A;  5L3G A;  3R0J A;  3GFJ A;  3JSP A;  2R5Z B;  1CF7 A;  1FP2 A;  2V9K A;  3M1C A;  2G0E A;  4QPO A;  3F22 A;  4F7Z A;  4U7D A;  1R71 A;  4FE7 A;  3CCL I;  5H6R A;  3PQJ A;  2RQP A;  2GOM A;  2QBY B;  1R5H A;  4CHU A;  4GGG A;  3V7R A;  2COB A;  1OR7 A;  2X0L A;  2E1N A;  2Q1Z B;  4G7O F;  2XAF A;  4UUT A;  3HC7 A;  1UB9 A;  2ZSI B;  3FXL A;  4FT8 A;  1YW7 A;  2R5Y A;  1U78 A;  4JK1 X;  4WK8 F;  4DBQ A;  1V54 H;  3U1K A;  1MNE A;  1R6R A;  1STZ A;  3FXJ A;  3KP2 A;  1D0Y A;  2EFW A;  3ESW B;  3O2P E;  1HKS A;  5FD5 A;  4ANJ A;  3FK6 A;  1P9Q C;  1ZQ3 P;  1V55 H;  3DEW A;  4AVZ A;  2XIG A;  4ZTJ A;  3R6S A;  4BY1 J;  2CQQ A;  2L02 A;  3ONQ A;  4AM3 A;  3VYT B;  1OIS A;  3KYC B;  2PFB A;  3PNV A;  3HTS B;  1IRX A;  5AON A;  3LOC A;  3PL8 A;  3SYT A;  1RR8 C;  3LFK A;  2EH3 A;  1X1P A;  1S5L C;  3MZY A;  1A5J A;  1OPC A;  1X1D A;  2W00 A;  4IHW A;  2R7U A;  4MTE A;  3A2K A;  4MLO A;  1MMG A;  3EDP A;  1YW8 A;  3SXY A;  1J75 A;  3ASN H;  2EFN A;  2H1L A;  1I50 J;  2PI0 A;  1BIA A;  4OIN F;  2NAZ A;  3OYE A;  3VEP A;  2Y31 A;  2ZME A;  4ENN A;  1P4A A;  5E8G A;  5JR3 A;  4QIW N;  3QOP A;  3GX4 X;  3CCR I;  3FKI J;  1U5T B;  1LFU P;  2HYJ A;  1HBX G;  1A6Q A;  3S2W A;  2Y0M A;  4CXF A;  3HHG A;  2RN7 A;  1W5S A;  1HF0 A;  5C44 J;  4PJ0 C;  3ZN0 A;  3DKX A;  1SFX A;  1DGR M;  2R5Z A;  2MGQ A;  2KMU A;  4L9N A;  2LKS A;  4YFK F;  2RV8 A;  3GTM J;  1WKM A;  4I6Z A;  1JTY A;  5DV5 A;  3Q9V A;  1TC3 C;  3RKY A;  2QBY A;  4IRG A;  4CO8 A;  2FE3 A;  5E3M A;  1W0T A;  3KLO A;  3CES A;  1D0Z A;  2DA1 A;  4NC7 A;  3FHN A;  1GV5 A;  4A0X A;  2HU9 A;  3CTA A;  2XVC A;  1K79 A;  1D8K A;  2NRA C;  3DXJ F;  1ULY A;  1MW7 A;  4E7L A;  1ZAR A;  1XGM A;  2DT6 A;  3H92 A;  1TNT A;  1TQI A;  1R1T A;  3LSI A;  2ME0 A;  4CZZ A;  4NBQ A;  3CD6 I;  4KIB A;  3RTR A;  2Q8K A;  2MBF A;  2F5D A;  2F2E A;  3RQI A;  4BKX A;  3G3Z A;  4G12 A;  3JRF A;  2QGU A;  4PCQ A;  3MKL A;  4UVC A;  3F8M A;  3D0S A;  2DTR A;  2K9Q A;  3DV8 A;  1BC7 C;  5E1Z B;  1ZEL A;  2Z5U A;  3HDD A;  3QWL A;  5CQG A;  1PVE A;  2CO5 A;  3DU6 A;  3S93 A;  3HEF A;  1V5E A;  3LAP A;  5E1X A;  3RKW A;  1JI8 A;  1MBG A;  2ECC A;  2FUG 2;  2VE9 A;  4CDG A;  2BV6 A;  4EAT A;  5D6F A;  2COM A;  4AID A;  4YEL A;  2VKH A;  2ZJQ F;  3FIS A;  2I5U A;  1V5F A;  2KFD A;  3Q3S A;  4XQF A;  3RKX A;  3MWM A;  3SDG A;  3WHB A;  2IA0 A;  3GFI A;  4IX7 A;  1PUF B;  2MA3 A;  4OIR F;  1MBE A;  5FKO A;  2MAB A;  2V9P A;  2XAG A;  2XSD C;  5ERI A;  3R0A A;  2VQH A;  3GME A;  2DPU A;  4OIO F;  3GWZ A;  2WV0 A;  2VAS A;  1P7J A;  5FFZ A;  4HDV A;  1QO0 D;  1IDY A;  1U5T A;  4ZDO A;  4HNU A;  3OIO A;  1YO5 C;  2DMU A;  1XX5 A;  4CCO A;  3HIF A;  3F21 A;  1SMT A;  4ON0 A;  2LF7 A;  1GUU A;  1EJ9 A;  3DEE A;  1Z3X A;  3KZI C;  1APL C;  1LUJ B;  1YS6 A;  4XOP A;  2X9D A;  3RZD J;  4CZC A;  3C2G A;  3HBL A;  4BJT A;  3H3Z A;  3FBI B;  4D5C A;  2JSC A;  2OCC H;  3V8K A;  1TQP A;  1XDS A;  3HPH A;  2VXD A;  2R7W A;  2M5W A;  3BR1 A;  5BNG A;  3S16 J;  3BP8 A;  3FDY A;  3U21 A;  2LK2 A;  1YX3 A;  4C3H J;  1IRZ A;  1E3O C;  1UHW A;  4UY8 I;  1WHU A;  2O61 A;  2EPF A;  3S14 J;  3GLX A;  4KNY A;  3HHH A;  2IP2 A;  1VQ6 I;  1FMW A;  4D5F A;  4IHS A;  4HV6 A;  1R9T J;  3JTH A;  2QVO A;  3HSE A;  2M9H A;  1X1B A;  1BN5 A;  3PSI A;  4WCG A;  2LSO A;  3GFM A;  5F04 A;  4BAC A;  1UST A;  4PJL A;  2KKO A;  4DBR A;  1XN7 A;  5IOZ A;  5HNF A;  2PJR B;  1DPU A;  4CIC A;  3BR0 A;  2H6B A;  1WGX A;  2RNJ A;  2NVU B;  2FQ3 A;  3LWF A;  2V6E A;  2GBY A;  1F43 A;  4CH7 A;  2W48 A;  2ACJ A;  2NVY J;  4B44 A;  2X1D A;  4ZH4 F;  4XBF A;  4A3B J;  1PUF A;  1TLH B;  4JX4 A;  2Y75 A;  4LIT A;  5J3L A;  1Z6R A;  3LA3 A;  1BA5 A;  4CYD A;  1IF1 A;  3GZN B;  5HS8 A;  3QP6 A;  1L0O C;  1LEB A;  1T6S A;  1H9G A;  1IV8 A;  2CJJ A;  1HDD C;  1KQ9 A;  2MC3 A;  4JOM A;  3EQL F;  5LD2 C;  2GOX B;  2CFO A;  1J7K A;  3BPX A;  1WZ2 A;  1HC8 A;  1Z7L A;  1ZG5 A;  1LVA A;  3K4C A;  2L3D A;  1MBH A;  5F1R A;  3H9J A;  4G8X A;  2HOS A;  4CCJ A;  2YX7 A;  3MFK A;  1N77 A;  3U9G A;  3IH2 A;  4ZYD A;  4YFX F;  4FAS D;  3VYU B;  2B9S A;  1AWC A;  2HDC A;  5IP7 J;  4ETS A;  4BXU A;  2VQG A;  2DMN A;  3FBN B;  5LFA A;  1YJ9 I;  2EV5 A;  1BI1 A;  4Y13 A;  1R49 A;  1EV7 A;  5K7H A;  4Y7N J;  4OIQ F;  5L3D A;  5GAH J;  4KT6 A;  2LBF B;  1Y39 A;  5DCM A;  4D7N A;  5E3O A;  2FMY A;  4I0A A;  4RB1 A;  1YRN B;  4O5V A;  3Q9S A;  3QQA A;  5EGO B;  4R1H A;  3K4N A;  2HXO A;  3J81 K;  1O3T A;  4IHV A;  4O3M A;  5DYM A;  2FBK A;  5EJC A;  2IGK A;  3IWZ A;  4GYI A;  4HST A;  2EIL H;  2PN6 A;  5IP9 J;  3DEU A;  3WE2 A;  2OQG A;  4GO1 A;  2AQF A;  3BCB A;  1VND A;  2IS6 A;  3FXM A;  5FKK A;  2P0W A;  4G9Y A;  2JZY A;  3MKW B;  1TZL A;  2DTZ A;  4HDU A;  4PZJ A;  5L3C A;  1GDT A;  2KLO A;  5H6Q A;  2JA2 A;  3GFL A;  5LRR A;  4LB6 B;  3GTO J;  1WJE A;  4I76 A;  3BTJ A;  2R3S A;  3L00 A;  5M3F J;  1SC7 A;  1VF9 A;  3M4O J;  3GO5 A;  3BJO A;  4N4O B;  1T8I A;  1LJ9 A;  2XKO A;  1ZHF A;  2QSF X;  2R7Q A;  4I98 B;  1HQC A;  1RKT A;  1YJW I;  4RGU A;  1OJL A;  2O5R A;  1ZR2 A;  3HKZ N;  1GXP A;  5IT9 K;  2O03 A;  1EA3 A;  3CUO A;  5EG0 B;  5EDN A;  1A04 A;  4XLA A;  4S0H B;  4XSZ F;  2Y9Z A;  1KYW A;  3JRH A;  4WXH A;  2KRF A;  4N9I A;  2WAD A;  1K4S A;  2AO9 A;  1AOY A;  5HS9 A;  5E79 C;  5D5U B;  1ORK A;  2ZNZ A;  2GXA A;  3MAJ A;  4LLL A;  1H88 C;  1OYI A;  2RAE A;  2A07 F;  2VJJ A;  4IKF A;  2AHQ A;  1ZH5 A;  1R1U A;  3I4M J;  2ZXW H;  1P4W A;  2QSG X;  1BR4 A;  3TED A;  1G3Y A;  2LBF A;  4XLE A;  4XLP F;  3E6C C;  4P9F A;  2XGE A;  1HA8 A;  3ZPL A;  2OTL I;  2E71 A;  2QSH X;  3M7G A;  3A0H C;  3G1O A;  3HSR A;  4BUP A;  1YRN A;  2E1C A;  5CQE A;  5AIP A;  5EGO A;  3L2R A;  5L3B A;  4G6T B;  5H20 A;  3P7N A;  3WTY C;  3I4P A;  2NS7 A;  3QP5 A;  3TQN A;  4BHC A;  2MH2 A;  4Y15 A;  5JLW A;  4XID A;  4IOC F;  2L2O A;  3ULQ B;  1BI3 A;  3LAJ A;  4WXD A;  2LD5 A;  1WJC A;  5ICF A;  3WU1 B;  2UV1 A;  1WJB A;  3G1L A;  1K83 J;  4GXO A;  5FKL A;  1G6N A;  2JA7 J;  1PP7 U;  3G6E I;  2CU7 A;  1OCC H;  1DPR A;  1G3S A;  4L5I A;  5CJ9 A;  5FD6 A;  1BOA A;  2YSR A;  1XSD A;  2K85 A;  4KA4 A;  3OYF A;  1KU2 A;  3T5X A;  5F0H A;  1JHH A;  3EYI A;  2EIJ H;  3PIO F;  3K70 C;  4NC8 A;  2ZJP F;  2IT0 A;  4CYC A;  2VBX A;  4ZYA A;  3BCA A;  3LSR A;  2LR8 A;  2XAQ A;  4AIJ A;  5LGN A;  2L4A A;  2R7O A;  1XSX A;  2E19 A;  3PJR A;  4OAZ A;  5HS7 A;  2K7L A;  3ZQI A;  1I3A A;  3N4M A;  3ZN1 A;  3J7A Y;  4A93 J;  1W7P D;  3BZK A;  3I56 I;  3BR6 A;  1G2H A;  4YIF A;  1G3W A;  4MEX F;  2NXN B;  1MGT A;  4YG2 F;  1UG2 A;  3MVP A;  1S72 I;  3HKZ A;  5KAF C;  4PDK A;  2PQ8 A;  4PK4 A;  2AXL A;  2BEO A;  2EFO A;  1RUN A;  4B48 A;  2DCE A;  1T2K A;  3NQO A;  1LDJ A;  1OCR H;  2E1M C;  2O7O A;  3AAF A;  2CV0 A;  2O6G E;  4W1U A;  5LEJ A;  2PJP A;  2H8R A;  1KZH A;  2WB1 N;  5B66 C;  3FHZ A;  3OV8 A;  1HSJ A;  3F3X A;  2V1D A;  2Y48 A;  1GVD A;  3FXU A;  2R7F A;  1TWA J;  5EEG A;  1FOW A;  3CCY A;  3PSF A;  5A2Q K;  2DFE A;  3F8N A;  2DW4 A;  3K4B A;  2F48 A;  2BYV E;  3TDU C;  1D1A A;  3ABT A;  2DOF A;  3M07 A;  1YQA A;  5J1R A;  1J59 A;  4LLN A;  2L01 A;  4ENJ A;  2YR2 A;  3ZP5 A;  2FXA A;  2R92 J;  5HLI A;  2JTV A;  2M8G X;  4F92 B;  2XSJ C;  3PQK A;  3OYG A;  4HX8 A;  3DTI A;  5BPI A;  2JRT A;  2V9V A;  1ON2 A;  3CUQ C;  2DI3 A;  5FB2 A;  2VQL A;  2EZI A;  1V5G A;  1ZK8 A;  5E20 A;  2O9L A;  3E3V A;  2QA4 I;  1I6H J;  3OYJ A;  1MZB A;  4A3J J;  2VIX A;  3C1D A;  1IRG A;  2LKX A;  3LQR A;  1QQI A;  2DU9 A;  4BQQ A;  3TW7 A;  5K1Y A;  1ZN2 A;  3HOX J;  4IXA A;  1XTA A;  2GM4 A;  4O6J A;  1TNS A;  2JA6 J;  4C2T A;  3H9Q A;  2JPB A;  2DMP A;  3FX3 A;  2CUJ A;  3H36 A;  2OU2 A;  4Q5S F;  3QU6 A;  1JUS A;  1R22 A;  3I5U A;  1F1Z A;  1N75 A;  2WAQ N;  1J5Y A;  2BY2 A;  3RI4 A;  3JRA A;  3TO6 A;  3PIP F;  3E7L A;  2KHM A;  5LGT A;  4FX0 A;  1E3P A;  4KFC A;  2CUZ A;  1AA7 A;  4V19 K;  1XCB A;  2A68 F;  3RPU A;  1XDU A;  1FY7 A;  2CRG A;  4A3C J;  2WWY A;  3S8P A;  1JJ8 C;  3I59 A;  3K9T A;  4A6E A;  1FIA A;  2ZFW A;  3HL2 A;  1MSE C;  1QZY A;  3IRR A;  3OWT A;  4D1Q A;  3K2A A;  3VSL A;  1R4M B;  2X1E A;  4HAM A;  3HOU J;  2W57 A;  2Y69 H;  3OR1 C;  1G4D A;  2QZ8 A;  4IZZ A;  2VC1 A;  3OYK A;  1SFO J;  2FU4 A;  4HF0 A;  2DA7 A;  3EUH A;  3IUO A;  2ZJR F;  4L9V A;  1YG2 A;  3LSJ A;  1SD7 A;  3WE3 A;  1FEX A;  3HUG A;  1YHQ I;  1LNW A;  3LQQ A;  3LFU A;  2HI3 A;  2JA5 J;  3LA7 A;  3OOP A;  3DLA A;  1EF4 A;  2DOE A;  3S3O A;  4BEH B;  2Y0S N;  2L9V A;  2LY9 A;  4N4N B;  5KCM A;  3WGI A;  4C2M J;  1W5C C;  2E2I J;  4M3D A;  2EA2 A;  2HWV A;  3CLQ A;  4UV9 A;  2J5O A;  4E4H A;  4NB5 A;  4U7B A;  4LIU A;  2P7C B;  1I6X A;  1HST A;  1Y6I A;  3LSP A;  5EZH A;  4M3E A;  2GXB A;  1H8A C;  4HV5 A;  3S15 J;  4XRF A;  1J9I A;  4RS8 A;  2KP6 A;  4DZP A;  2OTJ I;  1B6A A;  4CUG A;  1KQ0 A;  1MJA A;  1A36 A;  3TW6 A;  4TV7 A;  2XGC A;  2DPD A;  2O3F A;  1GV2 A;  2K02 A;  4CCL A;  2H8W A;  2JVH A;  3HM5 A;  2BE5 F;  3MZ8 A;  4A0Z A;  1P4X A;  2WAQ A;  2XRN A;  2HYF A;  1UFM A;  3QPL A;  2CSO A;  1RR7 A;  1SD4 A;  1XPX A;  1BR2 A;  2XAU A;  1YW9 A;  2QUF A;  2D5V A;  5FKN A;  2M34 A;  4BU2 A;  1B9N A;  1IXC A;  2NOG A;  2PX9 A;  3ZQL A;  2P7V B;  1ETW A;  1G59 A;  2DYS H;  4HQM A;  3RCO A;  2ZJ2 A;  4M6Y A;  2LKP A;  3AFH A;  2ELK A;  3BG9 A;  4J01 A;  2E36 A;  4LG3 A;  3VPR A;  2FBH A;  3HGY A;  3G73 A;  1DP7 P;  2VKD A;  3BJA A;  3GTJ J;  5FO5 A;  4I99 C;  2CW0 F;  1B59 A;  2JRM A;  2E2H J;  1K6Y A;  4XIC A;  2BXY A;  1HW5 A;  3BQZ A;  2BHZ A;  2VKV A;  3A01 A;  5GPC A;  5DDG A;  3ZMS A;  4ENM A;  2EWN A;  1VQ9 I;  1E2X A;  4KMF A;  2LYC A;  2GXG A;  3IAM 2;  3DBL B;  2VXZ A;  4ZTF A;  3LL7 A;  4RB3 C;  1NH3 A;  4MGR A;  3W6V A;  2XAS A;  3WTX C;  3CDL A;  2MW8 A;  2HTS A;  1QHH D;  2QQ8 A;  3QAH A;  4BEH A;  3F23 A;  5L3E A;  3CZ6 A;  3BLY A;  2E1M B;  3OOU A;  4ESB A;  2BY3 A;  2XGX A;  3OYH A;  2CV2 A;  3GEZ A;  3RQ4 A;  4LGW A;  4ZZL A;  1VQ8 I;  2K86 A;  1XC5 A;  4RGR A;  5DCF A;  4P5O A;  3KCC A;  4YIR X;  1VQP I;  1MSF C;  2YUS A;  1LEA A;  1OMI A;  2EZK A;  4EMS A;  4GFB A;  3TL4 X;  4HRI A;  1Z7U A;  3FIW A;  4BJ5 C;  2JA8 J;  2Y9Y A;  1K61 A;  1MNM C;  2G7U A;  3WTZ A;  3MMY B;  2DDB A;  1JUP A;  4A3G J;  1O4X A;  1V3F A;  2HYG D;  1R36 A;  3K4K A;  4RLQ A;  5J8C A;  1XS9 A;  1SAN A;  5A2Q Z;  2K9N A;  2CH0 A;  1I1G A;  4PFP A;  1G8X A;  1QRY A;  2DA6 A;  3AG4 H;  3OYM A;  2KJC A;  1R00 A;  2ELJ A;  4N9H A;  1UZC A;  4WX9 A;  1K4T A;  5DD8 A;  1I5Z A;  4ZDL A;  3VDX A;  4BBS J;  2E1O A;  2LNB A;  3D5S C;  4DZJ A;  4EJO A;  4RB2 C;  5HDK A;  4JYK A;  2BW3 B;  4Y17 A;  3CUQ B;  3GYH X;  2IS1 A;  1HDP A;  1RPW A;  3CLO A;  3CCV I;  2M3A A;  3TGN A;  3WTW C;  2KDZ A;  2NS8 A;  5JHF A;  1VQ7 I;  2OD5 A;  2V1N A;  3V8J A;  4AU7 A;  3OYL A;  3EUA A;  3K70 D;  4NC6 A;  4UHT A;  2VT3 A;  2IXS A;  1K7A A;  2X51 A;  4M9X A;  3F6O A;  1JKO C;  3HXL A;  2F5C A;  1T0F C;  5BOX A;  4G6D A;  2FOW A;  4A3E J;  2EV0 A;  3L09 A;  3WTU C;  5EF6 A;  3ABK H;  5KNL A;  1TW2 A;  2Q2E B;  1E3H A;  3Q0U A;  4IL6 C;  4XMY A;  3ZMT A;  4YEJ A;  2AXT C;  2X85 A;  3FMS A;  3P9I A;  3SZT A;  1U8R A;  5BS6 A;  2L7K A;  1QGP A;  2A5Y B;  4PGG A;  2HPM A;  3OYC A;  5M5W J;  3U2R A;  2A6E F;  1NK3 P;  2DT7 B;  2LRD A;  5FRN A;  4LK1 F;  3CO7 C;  3IHU A;  1SFK A;  1VQ5 I;  2V26 A;  2R7Z J;  4B3A A;  1FC3 A;  3DBH B;  2QKM B;  1Z9C A;  2LRE A;  5K7Z A;  2OUM A;  2EFQ A;  4ITV A;  1P6R A;  3MZH A;  4XKB A;  4L0Y B;  2W85 A;  3BR2 A;  3KP4 A;  3FXQ A;  1IV6 A;  4RMN A;  4C2U A;  2TDX A;  5F08 A;  4BE0 A;  3HGG A;  3T1B A;  2Y2Z A;  5LBQ A;  1ZAO A;  2GIZ A;  5D8K B;  1WJA A;  3GTP J;  1PJR A;  2DFH A;  3JRG A;  4Y52 J;  4RB0 A;  2LG4 A;  1LDD A;  1SD5 A;  5J4V A;  4HOB A;  1IRF A;  4KYW A;  2TRT A;  3CCE I;  1ODD A;  4AYB N;  2HEO A;  3DTK A;  3A02 A;  2G9W A;  1RES A;  1FBS A;  3I71 A;  3K0L A;  1Y1V J;  4HNV A;  1SAX A;  2CV1 A;  4V2G A;  3CC7 I;  1MBK A;  5CVV A;  3CJN A;  3KP5 A;  5J1U A;  4KIT B;  4M74 A;  2CFX A;  1DP3 A;  4UUS B;  3SZP A;  1MIJ A;  2LP0 A;  2VOO A;  1VQ4 I;  2JPC A;  5FJ8 J;  2BW3 A;  4B1R A;  1ZGJ A;  3ZQQ A;  3QRF F;  4BBR J;  2VKE A;  1ETO A;  3ROU A;  3DKY A;  2M7B A;  2YU3 A;  2YX4 A;  1VQO I;  4RAZ A;  4A5M A;  1HW2 A;  1VQM I;  2HZD A;  3JSO A;  3I0T A;  1R4N B;  3I3L A;  4EQQ A;  3V42 A;  2FNP A;  2M45 A;  3KZZ A;  3LA2 A;  4L5J A;  3GCM A;  3HSF A;  4NUB A;  2JT1 A;  4DJA A;  5B3S H;  1F4K A;  5HNH A;  4AIH A;  2HVS A;  4BJ6 C;  3ECO A;  5LHG A;  5E3L A;  1QPM A;  2Q2E A;  2WV1 A;  4JX5 A;  3LSK A;  3WGG A;  4ESF A;  4C3J J;  4NNJ A;  2CGP A;  3L2W A;  3BQY A;  4BH9 A;  2LTP A;  1FZP B;  4GRI A;  2VJ5 A;  4LIV A;  2XPV A;  4P9U A;  5FLV A;  1SVM A;  4E7I A;  3B6C A;  4KN7 X;  1E0E A;  2DN0 A;  2DBB A;  2D45 A;  5B5E C;  3GXO A;  3C3W A;  3GW2 A;  4YII A;  3BY6 A;  2K3F A;  1R23 A;  1EKE A;  1REP C;  1P2F A;  3SZG A;  1GT0 C;  4E7H A;  1IXS B;  4EJT A;  3J80 K;  3KEY A;  2CYY A;  4ZDP A;  2QKL B;  2QEN A;  2E35 A;  4CCN A;  3DU5 A;  3M8J A;  4OU0 A;  3OS2 A;  1BOB A;  2LC2 A;  2W84 A;  1XMX A;  3MD2 A;  2VJ4 A;  1IW7 F;  4XKV A;  4HLX A;  1YI2 I;  4GCV A;  1MJ9 A;  2LOO A;  2W1O A;  4AYB A;  1TBX A;  3IKT A;  3B6A A;  2Z99 A;  2IGO A;  1WCM J;  2LMD A;  2PMU A;  3L2C A;  1R58 A;  1UJ8 A;  1Y8Q B;  3ERE D;  3Q0W A;  3Q0V A;  2FML A;  4EM2 A;  1FOX A;  4JX6 A;  2PMZ N;  5GAD J;  4UUS A;  1XSV A;  3RZO J;  4M9S A;  1OCT C;  3GTG J;  1D5Y A;  3PUB A;  4W97 A;  4XON A;  2A6T A;  2BY0 A;  4FIS A;  4ZYG A;  3GUD A;  2DO7 A;  4J19 A;  2A05 A;  1DU6 A;  2DA3 A;  3ML6 A;  1T38 A;  4AVP A;  4L0Z B;  2ESH A;  4I2O A;  2QQ9 A;  4LJZ F;  1XGN A;  3KEO A;  4HLY A;  1P7I A;  4YRV A;  3HOS A;  2WY8 Q;  3ZQF A;  5HOO A;  1NG7 A;  4B8X A;  3H5N A;  1ZRE A;  3OSG A;  2DOA A;  4Y3O A;  1IAW A;  2X1C A;  4U0V A;  1WFX A;  2QYO A;  2MLG A;  1LE8 B;  4LD5 A;  2IJL A;  1U8B A;  5KAI C;  1U9O A;  2L7F P;  4LLG F;  3J7Y J;  1NTC A;  4E7Z A;  3EYY A;  3AG3 H;  1SVO A;  2JSP A;  2NYX A;  1OKR A;  1MMN A;  2PJR A;  4RDU A;  2JJ7 A;  4RBO A;  3N97 A;  4BE2 A;  4E7J A;  3D5L A;  1ZGA A;  3H3V K;  5IP6 A;  3MKZ A;  2ZXH A;  1S9H A;  3CMM A;  1O7L A;  3BWG A;  4FE4 A;  5D5X B;  3E0J B;  3BPV A;  1O3R A;  3I9V 2;  3LNQ A;  4BHB A;  3K1P A;  1P92 A;  1W36 C;  4RM3 A;  3E6M A;  4IVN A;  2BOL A;  1MKM A;  4XRS A;  2ZXJ A;  3I64 A;  4B43 A;  3BG5 A;  2EJR A;  3RSN A;  1OR7 C;  2IGM A;  5D4R A;  1IUY A;  3IL2 A;  3SFZ A;  2KIQ A;  4UB6 C;  3TP0 A;  5GPA A;  4IRI A;  3OS0 A;  1W7P B;  2PLY A;  2XPW A;  2FQ4 A;  4KIF A;  3GF2 A;  2R7R A;  2DFF A;  5CVU A;  2Z2S B;  3K69 A;  2HQ5 A;  2VE8 A;  4AUX A;  4ESJ A;  1D0X A;  4P96 A;  3TMO A;  1WI9 A;  3S17 J;  1S3J A;  3DPL C;  2FNA A;  2CQX A;  1U2W A;  3SEQ A;  1B1B A;  1I27 A;  2PMZ A;  1HCR A;  4BNC A;  2EIK H;  5K5R A;  3L2V A;  3KFW X;  5DM7 F;  2HOA A;  4EM1 A;  1Y1W J;  4CGZ A;  2B63 J;  2V4J C;  2E7W A;  4DIQ A;  1BL0 A;  2L9R A;  3NAU A;  1ZLK A;  2WTE A;  1D1C A;  1JGG A;  3JRB A;  4BL0 B;  1FBU A;  3N05 A;  5DTD A;  2ID3 A;  4MQ9 F;  2UXX A;  1WPK A;  1YOV B;  4XKW A;  1CGP A;  3W2V A;  4L5E A;  2ESN A;  3BJ6 A;  3H3U A;  3OIP A;  4YFN F;  2FEZ A;  3F9K A;  1LE8 A;  2ZB9 A;  3HOY J;  1Z91 A;  2F4I A;  1DU0 A;  4MFE A;  4V2F A;  2MFZ A;  2KIU A;  3HZJ A;  1IUF A;  4C3I J;  3FMQ A;  1A35 A;  4DOZ A;  2ZME C;  3AG2 H;  1VTN C;  3PO3 J;  4BHP A;  1WSU A;  2BBY A;  2LFB A;  4LMY A;  2NVQ J;  5HDG A;  4BGD A;  4MNU A;  3A03 A;  3HYI A;  2DQR A;  5IYC J;  4Q4Z F;  1FX7 A;  4A3K J;  3S1R J;  3ECH A;  3WTS C;  1O7F A;  5DD4 A;  1I3Q J;  3CO6 C;  2V1X A;  2KPM A;  3ZQG A;  4MFD A;  3I53 A;  3KE2 A;  1I1S A;  3U1D A;  1M1E B;  3L9F A;  4XM3 A;  3W3C A;  1F9N A;  1X3Z B;  2IPQ X;  4XRM A;  1S7E A;  4M3B A;  4KJZ A;  2UXN A;  3HB9 A;  1ONV A;  4I01 A;  3KEQ A;  4RAF A;  3JW4 A;  1OLT A;  1X2N A;  2RNG A;  3QYF A;  2K3P A;  2XC7 A;  1W7P A;  1G3T A;  1T0F A;  3D1N I;  4M3F A;  2VBW A;  4GDF A;  4RGS A;  2KRH A;  5EG0 A;  5L3F A;  2EZL A;  3ZMZ A;  3ELK A;  3OMY A;  4A3F J;  2LF8 A;  3GLL A;  5KK1 A;  2JK3 A;  2BHY A;  1RI7 A;  1K78 B;  3SFI A;  2W82 A;  5JFR A;  4XRS G;  3QPS A;  3D5R C;  2HKO A;  4A3L J;  1WI3 A;  3ZQC A;  4N0B A;  3OYD A;  2K40 A;  4XK4 A;  5IYB J;  2W7N A;  2IW5 A;  5J6X A;  4OMY A;  4Y4R A;  1FPQ A;  3KYD B;  3HOT A;  1KYZ A;  4HEA 2;  4CCM A;  2PMH A;  4E7S A;  2CQ7 A;  1BBY A;  4NQW B;  2M0C A;  2ZNY A;  5DUI A;  5F64 A;  3WG9 A;  1XB4 A;  4XN0 A;  2CWE A;  1OYY A;  3NWS A;  3BR5 A;  1L3L A;  2FOK A;  3TO7 A;  1NG6 A;  1W4M A;  2KZV A;  1ETQ A;  1Q1V A;  4QSH A;  5DEQ A;  3PM1 A;  1O3Q A;  1QHG A;  4IJA A;  3J80 Z;  1ZG1 A;  4XR6 A;  3OL4 A;  4IHX A;  3QPT A;  3MN2 A;  3CME I;  5F0C A;  2EB7 A;  2ZKZ A;  3WOD F;  5J47 A;  4FTH A;  2I8D A;  1BR1 A;  3DPU A;  3BRO A;  1YLF A;  3CJQ B;  1W1W E;  1ETY A;  2PEX A;  1USS A;  4Q48 A;  1U5T C;  2HKX A;  3S3M A;  2HVQ A;  3CDH A;  4OIP F;  4OWR B;  1XG1 A;  3PFI A;  2NNY A;  4P55 A;  3F8B A;  3F6V A;  3G2B A;  5IT3 A;  3F72 A;  1UCR A;  2KQR A;  4U88 A;  1QZZ A;  3OYA A;  1MJB A;  1X3U A;  3GZ5 A;  4GYG A;  1RRJ A;  3ZXS A;  3OL3 A;  5HLT A;  1WJ5 A;  1B9M A;  3KP6 A;  3F0C A;  2HVR A;  4PSW A;  5LHH A;  2HQN A;  2UWM A;  4AWX B;  3S1M J;  2AS5 F;  2HR3 A;  1O57 A;  4HX7 A;  1YS7 A;  2PG4 A;  3FXK A;  4RLF A;  1XD7 A;  3JRI A;  4M3G A;  4A3D J;  2C6Y A;  5FFX A;  2M4G A;  3WHC A;  2ELH A;  2RC4 A;  3HOW J;  4II3 A;  1X2M A;  1HKQ A;  2WC2 A;  2P5V A;  1K78 A;  1RUO A;  1ZRF A;  4IQJ A;  2R7T A;  1U9N A;  1IN7 A;  2DA5 A;  3J81 Z;  4XKC A;  2E2J J;  2LVS A;  2WB1 A;  2DA4 A;  4LB5 A;  4U87 A;  3NRV A;  2F4O B;  2LY2 A;  1C0W A;  1UHM A;  4M6V A;  3AKZ A;  1LPQ A;  4NQW A;  2K9M A;  2RDP A;  5K5O A;  2VON A;  4C9Y A;  1YTY A;  1BW6 A;  3FXR A;  1ITY A;  1Z1D A;  2XF6 A;  2VQC A;  3DTE A;  4JP0 A;  3OSF A;  3T8R A;  1QA6 A;  1H0M A;  4IEJ A;  5C3E J;  2KZG A;  2NS0 A;  3LST A;  1JUM A;  2ISY A;  4B4C A;  5IPA A;  4EGY A;  2DMT A;  2VN2 A;  2R5Y B;  2VBY A;  1S6L A;  2IEK A;  4MQV A;  2ISZ A;  5GAG J;  2OQR A;  2EQR A;  3M1E A;  1DQU A;  4I02 A;  3SEZ A;  3G4S I;  2HOT A;  4A3I J;  3KZY A;  2VL8 A;  1TT5 B;  5IT9 Z;  3LMM A;  3FXO A;  4BE1 A;  1N78 A;  1U6G A;  2X4H A;  4FET A;  1FWZ A;  2QCO A;  4K2E A;  5JVT A;  1BW5 A;  4A6D A;  1FYL A;  2HDW A;  3OYB A;  2X6O A;  1BM9 A;  1V4R A;  4EV0 A;  2V6C A;  1TL8 A;  2XDV A;  2EIN H;  2VBZ A;  1FP1 D;  2ZBK A;  3F8F A;  1KU9 A;  4XLN F;  1HLV A;  3M9A A;  3OS1 A;  3KET A;  4FQG A;  3UKG A;  4M71 A;  2W4S A;  1HW1 A;  3M8E A;  3GTL J;  1B8I B;  3MCZ A;  3MKY B;  9ANT A;  2DLL A;  5F6F A;  3S3N A;  2QF7 A;  2IA1 A;  5ILS A;  2MSY A;  4XLH A;  4F93 B;  2XRO A;  1SVL A;  2IBD A;  2ZME B;  2R7S A;  3WTV C;  3E97 A;  3QOD A;  3X2Q H;  2KIM A;  2VI6 A;  1BI0 A;  2P5K A;  2JUG A;  3IKV A;  1ZG3 A;  2M30 A;  2HTJ A;  2H1K A;  2VOD A;  1SAU A;  3JR9 A;  1Y8R B;  2Y30 A;  4KN4 X;  4HF2 A;  3P5J A;  4QTR A;  4E70 A;  1QPI A;  1JKR C;  2BZT A;  3KP3 A;  1W36 D;  3CMA I;  5JVG F;  5B1B H;  1Y56 A;  1R5I D;  2K27 A;  3ABU A;  4LG0 B;  1YIT I;  1FSH A;  2ZFU A;  3CJT B;  5CKT A;  1PP8 F;  1IN4 A;  2ZC2 A;  2R4G A;  1I39 A;  4F55 A;  1HOM A;  1FBQ A;  2XGD A;  3SJM A;  3H1C A;  1EH6 A;  4AD9 A;  3DQV C;  2OCE A;  2W24 A;  4C30 A;  5LEK A;  1N25 A;  2L7M P;  3LSG A;  1FMV A;  3UNG C;  3W6J B;  3ZR8 X;  2Z9O A;  2E7X A;  1FIP A;  2OAZ A;  5J1Y A;  1R7J A;  1ZTR A;  5HOD A;  3H9G A;  3KPH A;  4D9J A;  1VQL I;  5GTH C;  3AL0 C;  2Y0S A;  3E1S A;  2NNN A;  4WF2 A;  4HQE A;  2DJI A;  1JE8 A;  1ZKG A;  3CCU I;  1KQ8 A;  2OJE D;  3CP8 A; 
#chains in the Genus database with same CATH homology
 1S29 A;  3E5Q A;  3RDI A;  1GVJ A;  3JAM K;  1B4A A;  1BJA A;  4M72 A;  2M8E A;  3DFG A;  4KDP A;  3FZV A;  4A0Y A;  3RYR A;  5JHU A;  1TTY A;  2RVC A;  5LLQ A;  1E17 A;  2P5L C;  2OZ6 A;  1BI2 A;  4UV8 A;  4ASN A;  4AIK A;  1ZRD A;  4ZYH A;  4OOI A;  3ZQ7 A;  4M73 A;  2STW A;  5HLH A;  3FMR A;  4LG0 A;  1MDM B;  4RGX A;  3EET A;  3B02 A;  2HZT A;  2M1B A;  1ON1 A;  1XMA A;  1D3Y A;  2HGC A;  3IRQ A;  1YFH A;  1Y0U A;  1PDN C;  1O3S A;  3BZ6 A;  4KIC A;  2P8T A;  1R1V A;  2FF4 A;  1RIO H;  2STT A;  1ZYR F;  2OBP A;  1J2X A;  3RJP A;  3DPT A;  1HKT A;  3IC7 A;  4UXN A;  4HBL A;  5E1W A;  1IN8 A;  4RAY A;  1BC8 C;  4UVB A;  3P9C A;  3WU0 A;  3I58 A;  3P9K A;  3T8T A;  1TW3 A;  4Z2Y A;  1OYW A;  2GWR A;  4PGH A;  3KLN A;  2F5E A;  4FHT A;  1FNN A;  5LHI A;  2FA5 A;  4QWQ A;  2ZO4 A;  4ZZD A;  3B73 A;  4R79 A;  3CUQ A;  1DUX C;  2OA4 A;  2VC0 A;  2IVM A;  1XGO A;  5J8F A;  3E6B A;  1FYM A;  4H0E A;  4HX4 A;  3V7S A;  1TQM A;  5BPD A;  4JQF A;  4M6X A;  4BAY A;  4Q47 A;  2FSW A;  1MDM A;  2O8X A;  1XMK A;  3C18 A;  4A12 A;  1DDN A;  2K4B A;  3W6K B;  4I7H A;  5CVJ A;  5ILV A;  1S8N A;  5DCM B;  3TO9 A;  2Q0O A;  2R7D A;  2W25 A;  2L54 A;  2QQB A;  3K1N A;  1R5G A;  2QLZ A;  2HQR A;  2A61 A;  3TOA A;  2OZU A;  1RNL A;  5TJJ A;  2A6H F;  2VT2 A;  5ICE A;  1T98 A;  2D2W A;  4I09 A;  5CVI A;  3VOE A;  4A5N A;  3BDD A;  2Z33 A;  2P4W A;  3FWE A;  5LGU A;  3NEU A;  1T39 A;  4IRH A;  5BMZ A;  3HRM A;  2XAJ A;  3F8C A;  2QWW A;  2P6S A;  4MEY F;  1U3E M;  5FGM A;  5ICG A;  3IWF A;  1SFU A;  4HYE A;  4U0Y A;  1NHA A;  4WWC A;  1MD0 A;  1QBJ A;  3I54 A;  2HFH A;  1YYV A;  2HOE A;  4UNO A;  5D8L B;  2DQL A;  5ILU A;  4R8H A;  4DNC A;  2GQQ A;  2B0L A;  5HDN A;  2GZW A;  3RPQ A;  3DF8 A;  3VFZ A;  4IHT A;  3MQ0 A;  5CLS A;  3JAM Z;  2V79 A;  4MTD A;  5CVR A;  2DT5 A;  2H09 A;  1FLI A;  2LDU A;  5LRS A;  5KVR A;  2GAU A;  4M9Z A;  1WQ2 A;  3WTT C;  5D5V B;  1BIB A;  4EJV A;  1IZ1 A;  3T0Y A;  2YPR A;  4NHJ A;  3V4G A;  3MEX A;  5D4S A;  2UZK A;  3DP7 A;  1KU3 A;  1SD6 A;  1FYK A;  2PBI A;  4L9J A;  3SQN A;  1FSE A;  1H9T A;  5FLX K;  1FT9 A;  3TOB A;  3C7J A;  2DK8 A;  4ENK A;  3V8L A;  3FM3 A;  3GVA A;  1Z6T A;  4OMZ A;  1LB2 A;  5E18 F;  2GA1 A;  3ZMD A;  3O6B B;  2XV4 S;  4B09 A;  3REO A;  1PUE E;  2KIF A;  5ED4 A;  4KMU X;  2EV6 A;  2DK5 A;  2HS5 A;  3COA C;  2MD5 A;  3ZMV A;  2Z3Y A;  2KJB A;  2QQA A;  3DKW A;  1IN6 A;  4WXC A;  2XAH A;  2IA2 A;  4G6Q A;  1WRJ A;  3HRU A;  2ZCW A;  2A69 F;  2BGC A;  2M87 A;  2FRH A;  2EK5 A;  5BQT A;  3TKY A;  2H27 A;  5EEH A;  2DFI A;  1LQ1 A;  4HZF A;  3VOD A;  3K1M A;  4HW0 A;  4KIG A;  5D6E A;  5JI6 A;  4D0P A;  5E8I A;  3ISP A;  5DUK A;  2A3S A;  4FX4 A;  3R4K A;  1EH8 A;  4L9T A;  3RIR A;  1KA8 A;  1HXD A;  2RKH A;  3FM5 A;  2XHK A;  3HTU A;  2P6T A;  3WGH A;  4UVA A;  1GXQ A;  4UUV A;  4DQ2 A;  3O3K A;  3K2Z A;  3HRT A;  4MHG A;  1XGS A;  3I59 B;  1KU7 A;  3Q5F A;  4IF4 A;  2ETH A;  1YIO A;  3VB2 A;  2FBI A;  3JTG A;  2V1U A;  1FOK A;  3V7C A;  4EGZ A;  1J0R A;  2J5P A;  2VOP A;  3R61 A;  1S7O A;  3E5X A;  4EJW A;  5D5W B;  5HVQ C;  2EA4 A;  2DAO A;  2QM3 A;  2MH9 A;  2H94 A;  2ADU A;  5TRD A;  2G7H A;  3KP7 A;  3E5U A;  5K5Q A;  4EJU A;  6PAX A;  3BOQ A;  4I0B A;  2IRF G;  1WWX A;  2L4M A;  2MLK A;  1CF7 B;  5CYV A;  3GZ6 A;  4ZYE A;  1KGS A;  3FF5 A;  2XKP A;  1SFE A;  4LFU A;  5E17 F;  1JGS A;  5HLG A;  4HA8 A;  1D5V A;  4KUM A;  4G94 A;  1K6O A;  1JHF A;  4L18 B;  3SHF A;  1F5T A;  1Q1H A;  1XCV A;  4KT5 C;  5ICC A;  4S05 A;  1S7A A;  1SMY F;  2F5F A;  3E6D A;  3QU3 A;  2RGV A;  1LDK B;  1IN5 A;  3QPH A;  1ZRC A;  4BQA A;  4EVI A;  3J7A O;  1GHC A;  1D8J A;  2CQK A;  1JXS A;  1EH7 A;  3ZMU A;  2H6C A;  3TDZ C;  2GA2 A;  2D1V A;  2EFP A;  4G7Z F;  3RYP A;  5AIQ A;  1Z05 A;  4EM0 B;  2XUB A;  1QNT A;  3L7W A;  1ZLJ A;  1IXR C;  1W5T A;  2GIV A;  3HRS A;  4LK0 F;  5FLX Z;  2CG4 A;  4U0W A;  4BYY A;  4QLC U;  4A2U A;  3M8F A;  4HF1 A;  1RZ4 A;  4IPA A;  4S04 A;  4JBA A;  4G7H F;  3R60 A;  2K4J A;  4XSX F;  2D1H A;  2O0Y A;  5L3G A;  3R0J A;  3GFJ A;  3JSP A;  1CF7 A;  1FP2 A;  3F22 A;  4F7Z A;  4U7D A;  5H6R A;  3PQJ A;  2RQP A;  2QBY B;  1R5H A;  4CHU A;  4GGG A;  3V7R A;  1OR7 A;  2X0L A;  2E1N A;  4G7O F;  2XAF A;  1UB9 A;  4FT8 A;  1YW7 A;  1U78 A;  4JK1 X;  4WK8 F;  1STZ A;  3KP2 A;  2EFW A;  3O2P E;  1HKS A;  5FD5 A;  2XIG A;  3R6S A;  2L02 A;  2PFB A;  3HTS B;  5AON A;  3LFK A;  3MZY A;  1OPC A;  4MTE A;  3EDP A;  1YW8 A;  3SXY A;  1J75 A;  2EFN A;  2PI0 A;  1BIA A;  4OIN F;  2NAZ A;  3VEP A;  2ZME A;  4ENN A;  1P4A A;  5E8G A;  5JR3 A;  3QOP A;  3GX4 X;  1U5T B;  1HBX G;  3S2W A;  4CXF A;  2Y0M A;  3HHG A;  2RN7 A;  1W5S A;  3ZN0 A;  1SFX A;  4L9N A;  4YFK F;  2RV8 A;  1WKM A;  5DV5 A;  3Q9V A;  3RKY A;  2QBY A;  4IRG A;  4CO8 A;  2FE3 A;  3KLO A;  4A0X A;  3CTA A;  2XVC A;  1K79 A;  1D8K A;  2NRA C;  3DXJ F;  1ULY A;  1ZAR A;  1XGM A;  3H92 A;  1TNT A;  1TQI A;  1R1T A;  4CZZ A;  4KIB A;  3RTR A;  2Q8K A;  2MBF A;  2F5D A;  2F2E A;  3G3Z A;  4PCQ A;  4UVC A;  3F8M A;  3D0S A;  2DTR A;  3DV8 A;  1BC7 C;  5E1Z B;  2Z5U A;  2CO5 A;  3LAP A;  5E1X A;  3RKW A;  2VE9 A;  4CDG A;  2BV6 A;  5D6F A;  2COM A;  3RKX A;  3MWM A;  3GFI A;  2IA0 A;  2MA3 A;  4OIR F;  2XAG A;  5ERI A;  3R0A A;  2DPU A;  4OIO F;  3GWZ A;  2WV0 A;  5FFZ A;  4HDV A;  1QO0 D;  1U5T A;  1YO5 C;  3HIF A;  3F21 A;  1SMT A;  4ON0 A;  2LF7 A;  1YS6 A;  3H3Z A;  2JSC A;  3V8K A;  1TQP A;  1XDS A;  2M5W A;  3BP8 A;  1UHW A;  2O61 A;  3GLX A;  4KNY A;  3HHH A;  2IP2 A;  4IHS A;  4HV6 A;  3JTH A;  2QVO A;  3HSE A;  1BN5 A;  4WCG A;  2LSO A;  3GFM A;  1UST A;  2KKO A;  1XN7 A;  1DPU A;  4CIC A;  2H6B A;  2RNJ A;  2FQ3 A;  3LWF A;  2ACJ A;  4ZH4 F;  4XBF A;  1TLH B;  2Y75 A;  1Z6R A;  3LA3 A;  4CYD A;  1IF1 A;  5HS8 A;  3QP6 A;  1L0O C;  1LEB A;  1T6S A;  1H9G A;  1KQ9 A;  2MC3 A;  3EQL F;  3BPX A;  1J7K A;  1ZG5 A;  1LVA A;  2L3D A;  5F1R A;  4G8X A;  2YX7 A;  3MFK A;  3U9G A;  4ZYD A;  4YFX F;  1AWC A;  2HDC A;  4ETS A;  4BXU A;  2EV5 A;  1BI1 A;  4Y13 A;  1EV7 A;  4OIQ F;  5L3D A;  5DCM A;  2FMY A;  4I0A A;  4RB1 A;  4O5V A;  3Q9S A;  4R1H A;  3J81 K;  1O3T A;  4O3M A;  5DYM A;  2FBK A;  3IWZ A;  4GYI A;  2PN6 A;  3DEU A;  3WE2 A;  2OQG A;  4GO1 A;  4G9Y A;  2JZY A;  4HDU A;  4PZJ A;  5L3C A;  5H6Q A;  3GFL A;  5LRR A;  4LB6 B;  2R3S A;  3L00 A;  3GO5 A;  3BJO A;  1LJ9 A;  2XKO A;  1ZHF A;  4I98 B;  1HQC A;  4RGU A;  1GXP A;  5IT9 K;  2O03 A;  3CUO A;  1A04 A;  4XSZ F;  1KYW A;  4WXH A;  2KRF A;  4N9I A;  1AOY A;  5HS9 A;  5D5U B;  2ZNZ A;  3MAJ A;  4LLL A;  1OYI A;  2A07 F;  1ZH5 A;  1R1U A;  1P4W A;  1G3Y A;  4XLP F;  3E6C C;  4P9F A;  3ZPL A;  3M7G A;  3HSR A;  2E1C A;  5AIP A;  5L3B A;  5H20 A;  3P7N A;  3WTY C;  3I4P A;  3QP5 A;  3TQN A;  4BHC A;  2MH2 A;  4Y15 A;  3ULQ B;  1BI3 A;  3LAJ A;  4WXD A;  5ICF A;  3WU1 B;  4GXO A;  1G6N A;  1PP7 U;  1DPR A;  1G3S A;  4L5I A;  5CJ9 A;  5FD6 A;  1BOA A;  2YSR A;  1XSD A;  4KA4 A;  1KU2 A;  3T5X A;  1JHH A;  3EYI A;  2IT0 A;  2VBX A;  4AIJ A;  2XAQ A;  5LGN A;  2L4A A;  1XSX A;  5HS7 A;  2K7L A;  3N4M A;  3ZN1 A;  1W7P D;  4YIF A;  1G3W A;  4MEX F;  1MGT A;  4YG2 F;  4PDK A;  2PQ8 A;  2AXL A;  2BEO A;  2EFO A;  1RUN A;  1T2K A;  3NQO A;  1LDJ A;  3AAF A;  2O6G E;  5LEJ A;  2PJP A;  3FHZ A;  3OV8 A;  1HSJ A;  3F3X A;  2V1D A;  2Y48 A;  3FXU A;  2R7F A;  5EEG A;  5A2Q K;  3F8N A;  2DW4 A;  2BYV E;  3TDU C;  3ABT A;  1YQA A;  1J59 A;  4LLN A;  2L01 A;  4ENJ A;  2YR2 A;  3ZP5 A;  2FXA A;  5HLI A;  2JTV A;  3PQK A;  4HX8 A;  5BPI A;  2JRT A;  2V9V A;  1ON2 A;  3CUQ C;  2DI3 A;  5FB2 A;  5E20 A;  3E3V A;  1MZB A;  3C1D A;  1IRG A;  3LQR A;  1QQI A;  2DU9 A;  5K1Y A;  1ZN2 A;  4IXA A;  4O6J A;  1TNS A;  2JPB A;  3FX3 A;  2OU2 A;  4Q5S F;  3QU6 A;  1R22 A;  3I5U A;  1F1Z A;  1J5Y A;  3RI4 A;  3TO6 A;  5LGT A;  4FX0 A;  4KFC A;  1XCB A;  2A68 F;  3RPU A;  1XDU A;  1FY7 A;  2WWY A;  3I59 A;  4A6E A;  3K9T A;  2ZFW A;  1QZY A;  3IRR A;  4HAM A;  2W57 A;  1G4D A;  2QZ8 A;  2VC1 A;  2FU4 A;  4HF0 A;  3EUH A;  4L9V A;  1YG2 A;  1SD7 A;  3WE3 A;  3HUG A;  1LNW A;  3LQQ A;  3LA7 A;  3OOP A;  3WGI A;  2EA2 A;  2HWV A;  4UV9 A;  2J5O A;  4NB5 A;  4U7B A;  2P7C B;  1I6X A;  1HST A;  2GXB A;  4HV5 A;  4XRF A;  1J9I A;  4RS8 A;  1B6A A;  1KQ0 A;  1MJA A;  4TV7 A;  2DPD A;  2O3F A;  2K02 A;  2BE5 F;  4A0Z A;  1P4X A;  2XRN A;  2HYF A;  1UFM A;  2CSO A;  1SD4 A;  1YW9 A;  2QUF A;  1B9N A;  1IXC A;  2P7V B;  4HQM A;  2ZJ2 A;  4M6Y A;  2LKP A;  3G73 A;  2FBH A;  1DP7 P;  3BJA A;  5FO5 A;  2CW0 F;  1B59 A;  1HW5 A;  5DDG A;  3ZMS A;  4ENM A;  2EWN A;  1E2X A;  4KMF A;  2GXG A;  2VXZ A;  4RB3 C;  4MGR A;  2XAS A;  3WTX C;  2HTS A;  3QAH A;  3F23 A;  5L3E A;  4ESB A;  2XGX A;  3GEZ A;  4LGW A;  4ZZL A;  2K86 A;  4RGR A;  5DCF A;  4P5O A;  3KCC A;  1LEA A;  1OMI A;  4EMS A;  1Z7U A;  2G7U A;  3WTZ A;  1V3F A;  2HYG D;  1R36 A;  5J8C A;  5A2Q Z;  1I1G A;  2KJC A;  1R00 A;  4N9H A;  4WX9 A;  5DD8 A;  1I5Z A;  2LNB A;  4RB2 C;  4EJO A;  5HDK A;  4Y17 A;  3CUQ B;  3GYH X;  3CLO A;  3TGN A;  3WTW C;  2OD5 A;  3V8J A;  4UHT A;  2VT3 A;  1K7A A;  4M9X A;  3F6O A;  2F5C A;  5BOX A;  4G6D A;  2EV0 A;  3L09 A;  3WTU C;  1TW2 A;  3ZMT A;  3FMS A;  3P9I A;  3SZT A;  1U8R A;  5BS6 A;  1QGP A;  2A5Y B;  4PGG A;  3U2R A;  2A6E F;  4LK1 F;  3CO7 C;  3IHU A;  1FC3 A;  1Z9C A;  2EFQ A;  1P6R A;  3MZH A;  4L0Y B;  2W85 A;  3KP4 A;  3FXQ A;  2TDX A;  3T1B A;  5LBQ A;  1ZAO A;  5D8K B;  4RB0 A;  1LDD A;  1SD5 A;  4HOB A;  1IRF A;  4KYW A;  1ODD A;  2HEO A;  2G9W A;  1FBS A;  3I71 A;  3K0L A;  1SAX A;  5CVV A;  3CJN A;  3KP5 A;  4M74 A;  2CFX A;  3SZP A;  2VOO A;  2JPC A;  1ZGJ A;  3QRF F;  3ROU A;  2YX4 A;  2YU3 A;  4RAZ A;  4A5M A;  1HW2 A;  3JSO A;  3I0T A;  4EQQ A;  2FNP A;  2M45 A;  3KZZ A;  3LA2 A;  4L5J A;  3HSF A;  1F4K A;  2JT1 A;  4AIH A;  3ECO A;  5LHG A;  1QPM A;  2Q2E A;  4ESF A;  3WGG A;  2CGP A;  4BH9 A;  1FZP B;  4P9U A;  4KN7 X;  2DBB A;  2D45 A;  3GXO A;  3C3W A;  3GW2 A;  4YII A;  3BY6 A;  1R23 A;  1REP C;  1P2F A;  4EJT A;  1IXS B;  3J80 K;  2CYY A;  2QEN A;  4OU0 A;  2W84 A;  1IW7 F;  4HLX A;  4GCV A;  1MJ9 A;  1TBX A;  3IKT A;  2Z99 A;  2PMU A;  3L2C A;  1R58 A;  3ERE D;  4EM2 A;  2FML A;  1XSV A;  4M9S A;  4ZYG A;  3GUD A;  2DO7 A;  3ML6 A;  1T38 A;  4AVP A;  4L0Z B;  2ESH A;  4I2O A;  2QQ9 A;  4LJZ F;  1XGN A;  3KEO A;  4HLY A;  3HOS A;  5HOO A;  4B8X A;  1ZRE A;  1IAW A;  4U0V A;  2QYO A;  2MLG A;  4LD5 A;  2IJL A;  4LLG F;  3EYY A;  2NYX A;  1OKR A;  3N97 A;  3D5L A;  1ZGA A;  1O7L A;  3BWG A;  5D5X B;  3BPV A;  1O3R A;  4BHB A;  3K1P A;  1P92 A;  3E6M A;  4IVN A;  1MKM A;  2ZXJ A;  3I64 A;  1IUY A;  2EJR A;  5D4R A;  3IL2 A;  3SFZ A;  4IRI A;  1W7P B;  2PLY A;  4KIF A;  3GF2 A;  5CVU A;  3K69 A;  2VE8 A;  4ESJ A;  4P96 A;  1WI9 A;  1S3J A;  3DPL C;  2FNA A;  1U2W A;  1B1B A;  1I27 A;  4BNC A;  5K5R A;  3KFW X;  4EM1 A;  4CGZ A;  2E7W A;  1ZLK A;  2WTE A;  1FBU A;  4MQ9 F;  2UXX A;  1CGP A;  2ESN A;  3BJ6 A;  3H3U A;  4YFN F;  2FEZ A;  1Z91 A;  2KIU A;  3FMQ A;  1VTN C;  4BHP A;  1WSU A;  2BBY A;  4LMY A;  5HDG A;  4MNU A;  3HYI A;  2DQR A;  4Q4Z F;  1FX7 A;  3ECH A;  3WTS C;  1O7F A;  5DD4 A;  3CO6 C;  2V1X A;  3I53 A;  3KE2 A;  1I1S A;  3U1D A;  3L9F A;  1F9N A;  2IPQ X;  2UXN A;  1ONV A;  4I01 A;  3KEQ A;  3JW4 A;  1W7P A;  1G3T A;  1T0F A;  2VBW A;  4RGS A;  5L3F A;  3ZMZ A;  3ELK A;  2LF8 A;  5KK1 A;  1RI7 A;  1K78 B;  5JFR A;  2HKO A;  4N0B A;  2IW5 A;  5J6X A;  4OMY A;  1FPQ A;  3HOT A;  1KYZ A;  2PMH A;  1BBY A;  5DUI A;  2ZNY A;  5F64 A;  3WG9 A;  1XB4 A;  2CWE A;  1OYY A;  1L3L A;  2FOK A;  3TO7 A;  1W4M A;  5DEQ A;  1O3Q A;  4IJA A;  3J80 Z;  1ZG1 A;  3QPT A;  2EB7 A;  2ZKZ A;  3WOD F;  3BRO A;  1YLF A;  2PEX A;  1USS A;  4Q48 A;  1U5T C;  2HKX A;  3CDH A;  4OIP F;  3PFI A;  2NNY A;  4P55 A;  3F8B A;  3F6V A;  5IT3 A;  3F72 A;  1UCR A;  4U88 A;  1QZZ A;  1MJB A;  1X3U A;  3GZ5 A;  4GYG A;  1B9M A;  3KP6 A;  5LHH A;  2HQN A;  2UWM A;  4AWX B;  2AS5 F;  2HR3 A;  1O57 A;  4HX7 A;  1YS7 A;  2PG4 A;  1XD7 A;  2C6Y A;  5FFX A;  2ELH A;  2RC4 A;  1HKQ A;  2WC2 A;  2P5V A;  1K78 A;  1RUO A;  1ZRF A;  1IN7 A;  3J81 Z;  4LB5 A;  3NRV A;  1C0W A;  1UHM A;  4NQW A;  2RDP A;  5K5O A;  2VON A;  1YTY A;  3FXR A;  1Z1D A;  3T8R A;  1H0M A;  2NS0 A;  3LST A;  2ISY A;  4EGY A;  2VN2 A;  2VBY A;  1S6L A;  4MQV A;  2ISZ A;  2OQR A;  3M1E A;  4I02 A;  3KZY A;  5IT9 Z;  1U6G A;  2X4H A;  1FWZ A;  4K2E A;  5JVT A;  4A6D A;  1FYL A;  1BM9 A;  1V4R A;  4EV0 A;  2V6C A;  2VBZ A;  1FP1 D;  2ZBK A;  3F8F A;  1KU9 A;  4XLN F;  3M9A A;  3KET A;  4M71 A;  1HW1 A;  3M8E A;  3MCZ A;  2DLL A;  5F6F A;  2IA1 A;  5ILS A;  2XRO A;  2ZME B;  3WTV C;  3E97 A;  2KIM A;  1BI0 A;  2P5K A;  3IKV A;  1ZG3 A;  2M30 A;  2HTJ A;  2VOD A;  4KN4 X;  4HF2 A;  4E70 A;  3KP3 A;  3ABU A;  2K27 A;  4LG0 B;  1FSH A;  1PP8 F;  1IN4 A;  1FBQ A;  1EH6 A;  4AD9 A;  3DQV C;  2W24 A;  5LEK A;  3W6J B;  2Z9O A;  2E7X A;  2OAZ A;  1R7J A;  2NNN A;  4WF2 A;  4HQE A;  1JE8 A;  1KQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...