3IRSA

Crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
281
structure length
281
Chain Sequence
b'LKIIDFRLRPPAMGFLNARIYTRPDIRNRFTRQLGFEPAPSAEEKSLELMFEEMAAAGIEQGVCVGRNSSVLGSVSNADVAAVAKAYPDKFHPVGSIEAATRKEAMAQMQEILDLGIRIVNLEPGVWATPMHVDDRRLYPLYAFCEDNGIPVIMMTGGNAGPDITYTNPEHIDRVLGDFPDLTVVSSHGNWPWVQEIIHVAFRRPNLYLSPDMYLYNLPGHADFIQAANSFLADRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKILHGNAERLLAQAGR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCHARACTERIZED PROTEIN BB4693
publication title CRYSTAL STRUCTURE OF UNCHARACTERIZED HYDROLASE FROM Bordetella bronchiseptica
rcsb
source organism Bordetella bronchiseptica
molecule tags Structural genomics, unknown function
total genus 106
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3irsA00
4LEFA 3WYZA 3T8LA 1FWGC 3E74A 1S3TC 4IFRA 1NFGA 1RAKA 3A4JA 4GC3A 4C6IA 5A6TC 1RJPA 4QS6A 4CQCA 2QS8A 1BF6A 3IRSA 4LFYA 1EF2A 4DIAA 3F4CA 1FWBC 4IF2A 3TN4A 2GWNA 1EJSC 2Q01A 4KF1A 1A5MC 1YMYA 1RK6A 1ADDA 4GY7A 4L9XA 4PBEA 2YB4A 4Z42C 4C6LA 4YIWA 3WMLA 3DC8A 1UIOA 3GG7A 2BGNE 4RZBA 3A3WA 4I6KA 3LA4A 4H01A 1KCXA 4E3TA 3FDKA 4G2DA 4AQLA 4PBFA 1FKXA 4GYFA 5HMEA 1RJQA 4GBDA 3IJ6A 4F0LA 3CS2A 4QSFA 1FWEC 2A3LA 3LGGA 3LY0A 4IFKB 1NDWA 4LAMA 4DO7A 2P53A 2HBXA 3MTWA 1M68A 4DYKA 1EJVC 4XAGA 1R9ZA 4UB9A 4LANA 2HQAA 4NP7A 1A5NC 1A4MA 4KEZA 3UR5A 3GRIA 2HPIA 4C60A 1V4YA 2PAJA 1NDVA 2WJEA 1FWIC 4HK5A 2P50A 1EJXC 4LCSA 4HJWA 1YIXA 3NQBA 2PUZA 1POJA 4F0SA 4XAZA 1M7JA 3ORWA 4ERGA 3EWCA 3BE7A 4C6CA 2R1KA 1POKA 3IARA 4GX8A 3PNUA 4C6KA 3TN3A 2GOKA 4QROA 3O7UA 2O4QA 1A4LA 2FFIA 1QXLA 3B40A 2Q09A 1EJRC 3DUGA 1FWJC 1EJUC 4DI9A 4DZIA 3K5XA 2QVNA 1KRAC 1WXYA 1P1MA 4D8LA 4EPKA 3K4WA 3D6NA 2Z28A 1XWYA 4DLMA 3RYSA 2Z7GA 2E1WA 4XAYA 1R9XA 3AU6A 1R9YA 4C6OA 4KERA 1W1IE 3RHGA 4DZHA 3F2DA 2I5GA 3TNBA 3FEQA 1XRTA 2AQVA 2D2JA 3QY6A 3PBMA 1O5RA 2Y1HA 1J6PA 2Z24A 4H9YA 3E3HA 4EPEC 3S2JA 1NDYA 3B0XA 3OU8A 4WHBA 1YNYA 4C6FA 2VUNA 4C5ZA 4GOAA 3LSCA 2Z26A 3F4DA 2Z00A 3E0FA 3JZEA 2FVKA 1J5SA 2YB1A 2R1LA 3QGKC 1EZ2A 4CNSA 1FKWA 1A5LC 1FWCC 4H9TA 2O4MA 3PNZA 3LU2A 3V7PA 5HMFA 2Z27A 3RN6A 1VFLA 2W9MA 4WVXA 1J79A 3DCPA 4PCPA 3CAKA 2DVTA 2GSEA 3PAOA 3RCMA 4KIRA 1ONXA 1YRRA 2CZVA 3IACA 1DPMA 5FSDC 2G3FA 3ID7A 3S2LA 4LCQA 4C6MA 1IE7C 2R1PA 2EG6A 1FWDC 4B90A 3LNPA 4DI8A 3MSRA 4GY0A 4ERIA 4WGXA 2VC5A 4AC7C 2FTYA 4IGNA 2PLMA 2IMRA 4PCNA 3HTWA 2QT3A 4INFA 4CQDA 4BKNA 4HK6A 3MVIA 2BB0A 4GXWA 3F2CA 4JOMA 4GY1A 2EG8A 4XD4A 4V1XA 3GU1A 2OB3A 1YBQA 3T1GA 4H9VA 3GUWA 4I6VA 4CEXC 3LGDA 3N2CA 3AU2A 4GZ7A 2OODA 1KRBC 3C86A 3HM7A 2YZ5A 4C6EA 1PO9A 2E25A 1XRFA 4IGMA 2VR2A 3TN6A 2ICSA 1ITUA 4BY3A 5LXXA 4NI8A 4B91A 3SFWA 1HZYA 3OOQA 3UF9A 1M65A 5CH9A 4C6QA 3UPMA 4QTGA 4C6PA 1EJTC 3GU9A 3OQEA 1KRCC 5G4HC 2HNHA 2FTWA 4C6JA 4G7EA 2D2GA 1GKPA 4V1YA 4C65A 2XIOA 2WM1A 3GIPA 4R7WA 2GWGA 3KM8A 1E9ZB 4C6NA 3UBPC 2OQLA 4J2MA 4RDZA 3FDGA 2HPMA 4P5UA 2VHLA 4IFKA 4C6BA 1QW7A 2AQOA 3IGHX 1PB0A 4LAKA 1ZZMA 5HMDA 2Z25A 4EPBC 4KQNA 1RK5A 1NDZA 3F2BA 2VM8A 1GKQA 4J35A 2DVXA 3NEHA 3E2VA 1YBQB 4CQBA 4IG2A 4LCRA 1I0DA 3GTFA 1V79A 3GIQA 2WJDA 1UBPC 4HA0A 3E0LA 1V51A 1J6OA 3ISIX 2KAUC 2Z2AA 4OFCA 4F0RA 4B92A 2Z29A 3MPGA 3NURA 3T81A 1ONWA 4QS5A 1GKRA 3LSBA 3CJPA 3PANA 4RDVA 3MVTA 3QGAC 1O12A 3B0YA 3OJGA 5E5CA 2UBPC 1I0BA 4LAOA 1RA5A 4IFOA 4C5YA 4BJHA 1UMLA 3QY8A 4RDYA 4ZSTA 1V77A 2DVUA 1JGMA 2ZC1A 3MDUA 2OGJA 3E38A 4G7EB 1ITQA 4IH3A 2D2HA 4L6DA 3WZ0E 4ERAA 4NG3A 1FWAC 2HBVA 3URQA 1WXZA 2UZ9A 2ANUA 3SO7A 1FWFC 1K70A 4ICMA 4QRNA 1K6WA 2R1MA 3EWDA 3LS9A 4IQJA 3G77A 2PGRA 2VC7A 2Z2BA 3OVGA 4ZSUA 3IV8A 4PE8A 4RDWA 3GTHA 2PGFA 1RA0A 3IPWA 2AMXA 3S2NA 4C6DA 1A5OC 5FSEC 1FWHC 1KRMA 3OODA 3ICJA 3MJMA 1EYWA 4H9UA 3HPAA 4IG2B 3GU2A 2RAGA 2I9UA 3R0DA 1UIPA 4GX9A 1XGEA 3S4TA 3UR2A 1E9YB 4XD5A 4LALA 3GTIA 4H9ZA 3TN5A 1P6BA 3URNA 4CNTA 4LH8A 2F6KA 4R85A 1EJWC 3ITCA 1V7AA 1A5KC 4XAFA 4B3ZA 4H9XA 4M51A 1PTAA 4MUPA 2YXOA 4EPDC 2EG7A 2FVMA 3K2GA 4XD3A 4EP8C 2WJFA 1RJRA 3EGJA 3A3XA 3AUOA 4CEUC 2Z4GA 4HK7A 4DLFA 2QPXA 4H00A 2ADAA 4CNUA 1PSCA 4RE0A 4XD6A 4KEVA 1K1DA 2OOFA 4KESA 3MDWA 3URBA 2GZXA 3MKVA 3URAA 4KEUA 4KETA 5AKQA 4H9MA 4J5NA 2R1NA 3S2MA 4R88A 4TQTA 3O0FA 4DNMA 3QY7A 3GTXA 1P6CA 4UBPC 4GK8A
chains in the Genus database with same CATH superfamily
3MUZ1 3AXHA 3E9AA 4ZR8A 3L4UA 3MSDA 1UP0A 2WPBA 1Z6KA 3EWUA 3H23A 2OVLA 3GHTA 1K7EA 4GY7A 3GVQA 1QPOA 4HZ8A 2W0UA 4PMQA 1YTDA 3DC8A 1UWTA 2ZUWA 3LA4A 1KCXA 4LY4A 3U9IA 1BPLB 4H19A 3H4GA 4O53A 4K37A 4PTWA 4AD1A 4PMZA 1W3HA 3IJ6A 3MUY1 2QUNA 3B05A 1EDTA 1UH4A 4UB9A 4DF1A 3AJ7A 4K8HA 4UQCA 3P67A 1LLZA 3RXZA 5JBDA 1IEXA 4IQLA 4ZVJA 3PZ9A 3QFWA 3UWWA 1J01A 5T9CE 4PZVA 3H54A 3QMTA 3RPMA 5CQ1A 4BZYA 4MADA 4AZ7A 3DFTA 4X22A 3UXIA 2GL5A 2X42A 4AU0A 3UU0A 3CL6A 1C29A 1U1HA 4J3VA 4C6KA 1H0IA 3RLGA 3O2LA 2GVJA 2HDJA 3K5XA 2IPGA 2YLLA 3SJ3A 3K8KA 1QK0A 1TVLA 3I6EA 1R30A 3U2CA 4CN1A 3CWOX 1F74A 3HBLA 1GT8A 1MNZA 3W7OA 5KETA 1PKNA 3QZ6A 4IL2A 1Y7VA 2GGIA 3GAYA 2FPVA 1UR3M 3DX5A 5CPSA 3GYCA 3QV9A 1Q63A 3HPSA 2BWGA 2QIWA 1TQXA 3FJ6A 4P61A 1WKEA 5XIMA 1J0KA 2PDCA 3HG2A 2REQA 4IIHA 4NAFA 2CESA 1G67A 4HVXA 1NY1A 1UKSA 1KM2A 1O66A 1TPDA 1JULA 3PSVA 1PIIA 1JNDA 2RHGA 3NOYA 1TMQA 5REQB 3MUCA 2W5FA 4PMXA 1DPMA 2XVGA 3W83A 1U33A 3HZ3A 5D03A 4FMVA 4JKLA 1JZ8A 1XC6A 4O0QA 1TE6A 4BF5A 4RZ5A 3KTXA 5F4SA 4PCNA 5G2IA 4INFA 4UXDA 4ATWA 3IIOA 2VEIA 5BRQA 1KFEA 2OB3A 2FYMA 2VFGA 5I23A 3CM4A 5EY5A 2FDMA 4ROPA 1BKSA 3BLPX 2UV8G 5D2TA 2YZ5A 2QCGA 4MY9A 2E25A 2XN2A 3EA3A 2YCLA 1QPQA 1VEOA 3OA5A 3WH9A 3G1DA 1HGYA 1K8XA 5AZ0A 4Q6XA 1LRQA 2F8QA 5DMYA 2HTMA 3MUAA 1IIGA 3SFWA 3VD4A 4J1OA 4CNNA 2QULA 2XIMA 1EJTC 4O1DA 1R2TA 1GKPA 1MEHA 1BEUA 1AJ2A 4A8LA 3VGDA 2NQHA 4GI8A 5BCAA 2JQXA 2CLOA 1IZKA 5IHSA 3QR0A 3IGHX 4LGXA 4AXNA 2IPWA 1M3UA 3VKAA 4QLLA 2WW5A 3GXMA 1GZJA 3ZR6A 4K3ZA 3KHDA 3LGEA 1UUQA 4MMWA 2RUSA 3OO2A 1E6XM 4B5TA 4GZJA 2GQAA 2ZBTA 3HG4A 3VGGA 3TYDA 4B3LA 4A29A 1EWEA 3W6YA 3AI0A 1E73M 4FLRA 3A9IA 3Q67A 1Q6DA 2DZBA 3DEQA 4DWDA 3G24A 3WLNA 3UPBA 1YE6A 2DZVA 4PTNA 1VFHA 3EOOA 3OEXA 1FWAC 2R8WA 5BXTA 1UP3A 2PD9A 3EWBX 4Q8VA 4YTSA 2G3IA 1FWFC 2B7NA 1W3JA 1RUSA 2SFPA 3VNLA 3FOKA 1EB3A 3TXVA 3W86A 2XJ7A 1J4EA 1ECQA 2YL5A 2A85A 2PGFA 1ZL1A 2EPOA 5FAJA 3GR4A 1OADA 3OODA 5IM51 2J7CA 3ONBA 1MW0A 1OD0A 1VC4A 4C7DA 1V5XA 1J96A 5DLCA 4ZTYA 1ZBWA 1EBGA 3SSZA 2E6YA 1EKOA 3LCHA 5EFDA 3VOCA 3NQCA 4H9XA 3OLDA 3RPTA 2BOGX 1QASA 2PBOA 3TJXA 5H1WA 1W3TA 8XIMA 3E49A 1KM1A 4PH6A 4DBWA 3M41A 3W7MA 2BP1A 3MZNA 1IXQA 4JTEA 4PTDA 1MQPA 2X09A 1EA0A 4P7OA 2YL8A 1RCXB 4MZ8A 1H41A 1K9FA 3SGZA 2PC4A 4IWWA 4IJBA 2W62A 3LHVA 1JXKA 5EU9A 1FXPA 5T8GA 3HGOA 3PSWA 4F0KA 4FNTA 5EBUA 2XDFA 3O0FA 3UJSA 2BXZA 3P60A 4N9CA 1TX2A 1GQIA 5DCBA 1R46A 4IP5A 3A4JA 4H3DA 1D3GA 8RUCA 2ZWYA 3P8IA 4AZCA 6PTDA 3LG3A 3IANA 1F3WA 2D20A 2OT1A 2QJIA 1OM0A 3QKZA 1EF3A 3I6TA 1U5HA 1O5QA 2VX5A 3VDBA 4QSHA 5C9RA 3BW4A 4WY0B 3QQ1A 4HJFA 1CXFA 3P6LA 3N3TA 3LXCA 4UMAA 3ARQA 1ISVA 4LVFA 3ZSTA 1GVFA 3C5QA 4GCXA 5DXYA 3KDOA 3SRKA 4GUIA 3M44A 4JIQA 5K3VA 2ISVA 1EQCA 4EAMA 4LANA 2WSYA 5JUVA 1H5VA 4YVXA 2FPYA 3WN6A 1NEYA 3BUVA 2PAJA 3O9NA 4I5UA 1JL8A 5A6LA 1DJIA 4Y7EA 1E6PA 3VZYA 4ZO7A 1POJA 4LC8A 3H2MA 1RCOB 1XLGA 4XAZA 3NQFA 5DRCA 1E40A 3PPCA 4B9YA 1W3IA 2PGEA 1SPQA 5CLTA 4MYAA 1OT2A 2E0PA 3M5XA 3UZYA 2R1KA 3VK5A 1POKA 2BVYA 2V82A 1WBJA 3TN3A 4KFPA 5REQA 3WLQA 1A4LA 5L9FA 3TV8A 3FA4A 3PTDA 4PMNA 4FI4A 1SFTA 4EPKA 4JDYA 4BK9A 1OGSA 1XWYA 4JTJA 1GVSA 2E1WA 2XZ9A 1P7TA 1H7OA 4ECLA 1R9YA 2C7FA 4CU6A 1TPFA 2YLAA 3TNBA 1P43A 1UROA 2HROA 4JTSA 4Q8QA 3C2FA 2PS2A 4FNUA 1YW1A 1GOOA 3OP2A 1ENUA 4DXKA 2ONEA 2WKJA 1SVDA 3KL5A 3XISA 1DTUA 4C6FA 1SUXA 3KP0A 3ATYA 1IT0A 2Z00A 1I60A 2OYKA 3DI1A 2P8BA 1TWWA 3RPDA 2QCDB 1QI3A 2PZ0A 2XSBA 2Z27A 4AD5A 1S5VA 3HG3A 4X61A 2W6RA 4DJDC 1XCFA 5DCEA 4H04A 5HJLA 2FZBA 4U5IA 1HKKA 3A6OA 3TMQA 1KFWA 1YTEA 5KSWA 7PTDA 4PMVA 4XZMX 3Q2DA 1VBJA 1ZRQA 3MSRA 4GY0A 3DG3A 3HTWA 4O12A 1XYAA 1SW7A 3AYSA 4UFLA 4LUJA 1J10A 4W88A 6ALDA 3KCLA 3L23A 4O13A 1JNEA 3LRMA 4IQDA 3R43A 3M0JA 4ZXLA 3NL5A 1EXPA 3SUWA 4MPQA 1QOQA 4C6EA 1JIBA 2J62A 3OTRA 4AD0A 4B5UA 3C52A 2A6LA 4JY9A 1K9EA 3II1A 2Y0FA 1GQLA 4HOWA 3FEMA 3BGJA 4M19A 1EPXA 4UMBA 1FHUA 3KZPA 5J5RA 4HT3A 4K2SA 3W02A 2PWVA 3UY8A 3YPIA 3I7SA 3S5ZA 1CCWB 3CH9A 3GC2A 4C65A 1A47A 3KP1A 1QMLA 4UFMA 1F6KA 2A7RA 3KBVA 4HQVA 4Z2IA 3QJAA 4DUVA 2C3ZA 3C3NA 3WNOA 2JBMA 1RLDA 2IPFA 4NJHA 3W25A 1Z32X 3L0KA 3P2VA 3WF4A 1EX1A 1ZP3A 3V36A 1KWKA 2O9RA 4BR1A 1W3LA 3NEHA 1SJAA 1VIZA 2PODA 1JAKA 4O10A 1SZEA 4DVOA 2GJRA 4U33A 1HP4A 4HA0A 3BW3A 3GC5A 3ISIX 1TYGA 1ELSA 1DTNA 5DT7A 1NF7A 4XQ6A 5CJNA 1RD5A 4LAOA 4W5ZA 3P14A 5D38A 1B3WA 3S9ZA 3NM1A 1NFPA 2X1UA 3R0KA 4M6UA 4QLJA 3CTTA 3W73A 4EXAA 2XVPA 3C0SA 3VNZA 3ARXA 2OLHA 4GXPA 3QHOA 2DSZA 2P10A 3AIBA 4GNVA 4JX5A 1S2VA 3WBWA 1HNYA 2NQLA 3CLWA 5C2GA 1F07A 4MYXA 4ZSUA 3UCCA 2AL2B 4WJ8A 4HZ6A 3WD4A 4GKTA 4UQDA 3T4CA 4H9UA 3L7RA 1RP9A 3CWNA 1W9XA 3W28A 3UR2A 2PDHA 1HKJA 3CUZA 2YDRA 1GORA 4NZ3A 4S3KA 1E56A 4XAFA 4B3ZA 1XG4A 3QR1A 4WY0A 3ABRA 4L7ZA 4U2ZA 2IS7A 4UQ9A 2G5WA 3OZPA 1IHIA 1UWUA 2EG7A 1W9PA 3JR2A 6CGTA 1KKRA 4G1NA 2VZOA 2ZXQA 1YHTA 3NSNA 4JD4A 3LCWA 1WNOA 9XIAA 1W54A 4Y6GA 4GRSA 4L6HA 4EOUA 4G8TA 3WL1A 1RY8A 4TXEA 1UKOA 4PB5A 2Y62A 4KEUA 4KETA 1T99A 1S2AA 4B2DD 3O6DA 5M17A 2PTYA 4ZZ9A 4ML4A 1P6CA 4FF7A 4UBPC 2VRQA 3WCZA 4UTUA 4GGBA 3W1NA 5LZLA 3DHUA 2QS8A 4IX2A 1F4AA 3NPXA 3ARUA 4DIAA 4M6VA 1JFXA 1EC9A 1M1BA 1MFVA 4KF1A 1QCWA 1RK6A 4ZOAA 3ZLHA 1JJKA 2X1IA 4GIYA 3ZJ7A 4C6LA 1AMYA 4YIWA 4GKLA 3W7JA 5CPMA 3GBDA 1A5AA 2BS9A 4RXGA 1UD2A 1FDYA 1FRBA 4E3TA 5AHIA 2DW6A 3QVQA 2JE8A 3UW6A 1FDJA 3DFHA 2OZ3A 2NQJA 1QI5A 3BVJA 4WQ6A 3WENA 4DN1A 1Q8AA 2A3LA 3LY0A 3QN3A 1J0IA 1WDQA 4ENLA 1VH7A 3CAVA 4DYKA 3OBAA 4UTHA 3W1TA 1ADSA 2A3BA 3AICA 3EPMA 1KCZA 3STFA 1ZY9A 3GRIA 3HURA 4MAZA 4Q32A 2A5HA 1JCJA 3GO2A 3E96A 4RZ6A 2P50A 1Q6OA 3P84A 1C8QA 1RALA 3NQEA 5HNRA 3PR2A 3QHNA 3OZOA 4JHMA 3DECA 1M7JA 2QCDA 5ABEA 1FHLA 1W9UA 2ZQ0A 4C6CA 1BVZA 1XRVA 2F2HA 3MMTA 4JTLA 4JQ3A 2VUYA 3LBCA 3BQ5A 1HJQA 4MDOA 5LNWA 1QXLA 3B40A 3R4IA 4MTVA 1ML1A 1SU5A 3EDEA 4D8LA 2J7BA 1CECA 2Y8VA 1OD8A 3UXAA 5CCZA 2V5DA 2HV5A 1XHGA 4GACA 3N29A 3I6RA 5LNUA 1MZRA 1XXXA 1S2CA 2QIIA 3PBMA 7TAAA 5AYBA 3LSCA 2WK2A 4L4LA 2Q3RA 3WD0A 4I9JA 1Q6LA 4KMQA 3OVRA 3EDFA 4M8UA 1XKJA 2EKGA 5CBBA 4KRTA 2ZX7A 4AIBA 3BG3A 5C54A 4DM2A 3RCMA 2RKXA 3IACA 1S2UA 3ZWTA 1UKQA 3L5MA 4E8DA 2G3FA 3A64A 2QCFA 4D6FA 3HPZA 3BLLA 1FA2A 3FS2A 4D8ZA 2QAFA 2ZUVA 3B8IA 4Q6JA 1R38A 1WDRA 4M5PA 3MVIA 1UOKA 3A5FA 3SCWA 4MOZA 5A5WA 3NWRA 1YE4A 2G3MA 4I6VA 4LJ3A 1TSIA 3VDGA 1H50A 3PZOA 3FFSA 3ALGA 4DF0A 1JDAA 4Z1BA 2Z6IA 4S39A 1Q6FA 4HNUA 2V5KA 3TC3A 1B4KA 4GA8A 3D3FA 1CDGA 2VGFA 6A3HA 4C6PA 3P82A 3I3BA 5G4HC 4AIUA 4IMFA 1IGWA 1OX4B 5D9MA 1NAL1 1WYIA 1LOQA 2OYLA 4LV9A 2J24A 4F66A 4WUIA 5LGZA 2PRLA 3N18A 4A8RA 3N1AA 2WLZA 1O5KA 1G9HA 1TIMA 4I9TA 1B3XA 2DIJA 2Y24A 2AQOA 4LAKA 3RCYA 2AL2A 1VFSA 4RKAA 4Q8TA 3IVUA 1J9YA 1JPIA 1KBBA 4CCZA 2ZC8A 4LS1A 5I09A 2VM8A 3BXWA 3CZJA 1NELA 4Z1AA 1TTIA 1PJ9A 3E2VA 4FX6M 2DIKA 1J0YA 4ILSA 4IPLA 6REQB 1DJGA 1I8JA 3EB3A 3WK2A 5C2XA 1OG0A 2HXUA 1G0CA 1GKRA 1SQ7A 2Z0IA 3TUUA 4J3ZA 2G50A 4I8YA 1XLHA 1PIFA 3NNTA 1ZBVA 1PWMA 1R3WA 5GJNA 3QV6A 1EDGA 4LU0A 2ZE0A 2WHMA 3K1DA 3LLFA 1WBHA 5BWFA 1SO6A 3WZ0E 2WVUA 4NG3A 1WXZA 3TCSA 1B57A 3W7RA 3I3DA 4DB7A 1RQHA 3N2OA 4DO5A 4QRNA 3IIVA 3B8SA 3C2YA 1XYMA 2Z2BA 1BHGA 1S2WA 1XFBA 1RA0A 5MF5A 3RX2A 2Y88A 1KRMA 4NRRA 2YGYA 2OYMA 3NAVA 1ODZA 1UIPA 5AYXA 1SSGA 4XD5A 1VFFA 1XLAA 4WY0F 1DXIA 1OK6A 2ACQA 4K36A 4DJFD 3NQ8A 1V7AA 3TH6A 3LNMA 4NJKA 4HU8A 4I7WA 2VDGA 4FIQA 4HMCA 3PWGA 4NNCA 5LIXX 3EMQA 3WFAA 4URIA 3PZMA 4OVXA 3W01A 2ATSA 4AD2A 1T6MA 3EGJA 3AUOA 3NR0A 3TQPA 4UIOA 1B9BA 1OBAA 3NUKA 1GONA 4JTAA 3B03A 5I07A 3AROA 1YDYA 2OZTA 5HUOA 4N6EA 2C1HA 2GZXA 4GISA 4H4IA 1XLLA 3URAA 2DUZA 3GIYA 1JVNA 2A79A 4QEHA 4OT7A 4TQTA 2NV2A 1CGVA 3VXGA 1E4LA 4D72A 1V0KA 4UCFA 1HJXA 5ECUA 4MDPA 2H90A 3WX7A 1TZZA 2CW6A 3L67A 3UP8A 4QS6A 3VFLA 1GQNA 4XZHA 5I3KA 5HWNA 4TOQA 2X7WA 4AWSA 1DQWA 2Q01A 2OFJA 1ADDA 5C55A 4ZE4A 4KCTA 1PZ1A 1XRSA 4O28A 2GQ8A 3MHGA 3QTGA 1FP8A 1V6UA 3B06A 1U2YA 3BV7A 1QRQA 5CJ5A 1TWZA 1HVXA 4GYFA 4IISA 3SCVA 1MRAA 2JEPA 5BXRA 4GO8A 3PF3A 1KLYA 1S5TA 4DO7A 1EPVA 3H2NA 3MTWA 3GVGA 1RXOB 5XIAA 1JPMA 3DIPA 1L0PA 2NQZA 3LD5A 6TIMA 4A4AA 3W1XA 2DDXA 1ZBCA 3TYUA 4MJ2A 3D46A 4Q4OA 4AEOA 1XH1A 3W7KA 1CENA 3NSXA 1TO3A 1X6UA 2Z1KA 3U4FA 1DIKA 1V6WA 1EIBA 2D23A 1S5NA 2HISA 4YYFA 1ZNNA 2YKKA 4LQ1A 1MQQA 4QROA 5A6SA 3NGFA 4AWEA 5B80A 5LKYA 2C79A 3R7MA 4GE8A 4BS0A 1ZGDA 5C8BB 2A6NA 4JGDA 3W84A 4GWEA 1LBFA 4DBUA 2IKHA 5DT5A 1F8IA 3VVGA 2NUXA 2UWFA 3W1UA 3VOHA 4KERA 3VNYA 2ABAA 2OZ8A 3JZUA 2E5DA 4XBKA 2NLYA 4WJXA 1F6PA 4ZO6A 1Y5XA 3ZT7A 1Q6GA 3UJFA 2ZKMX 3WQPA 4Q4RA 4M7SA 3S5YA 3B0XA 1X39A 4WHBA 3IGXA 3G1XA 2NVAA 3JZEA 3B9AA 3VIFA 1EOKA 1L6YA 2EPMX 1AQHA 3ANUA 1EUAA 4US5D 1WDWA 4F9DA 3GFYA 1A5LC 2G95A 5DXXA 3WD2A 1FCUA 1Y0EA 4FF5A 3T9PA 5RUBA 1E0VA 2ALRA 4H2HA 1FWWA 1MSSA 3GVWA 1HN1A 3PUOA 3W72A 3WUGA 4TV5A 4J9JA 1W3KA 4CQ8A 1GPWA 3QF0A 4J4KA 3DHPA 1NQKA 2CWNA 5G1MA 2IMRA 1C91A 1LDCA 3BAXA 4K39A 1VPQA 1LG2A 1KR0A 1W0MA 4GXWA 3F2CA 4JNZA 3O8AA 3FGCB 2XH7A 2ZWZA 1E6RA 5FL0A 4AVFA 4AD4A 4F8XA 1GHSA 2G96A 3MB9A 2GGHA 3R13A 1LWJA 3IJDA 3OLEA 1O60A 1GUVA 2GJXB 4IGMA 3HQNA 4RL3A 1OHLA 2KZHA 3UEQA 1E6SM 3OLGA 1XSJA 3KWSA 1ZLPA 4BY3A 4S3AA 1WZLA 1ICSA 3MA8A 1D7FA 3WMBA 1WAWA 5G2HA 2J77A 2CIPA 2D69A 3OQEA 7TIMA 2R24A 5HQLA 3UWQA 3SN0A 2V2CA 4U5KA 1G4PA 3T44A 4CLMA 1OFEA 3MSGA 4E4PA 1JF6A 2C13A 2ZRWA 1GVIA 2GPTA 4PMRA 5AC5A 4DELA 3KCOA 5G1TA 1JI2A 1C3FA 1LWIA 4H6RA 3LXBA 1HO4A 5AVNA 3WLTA 1AL7A 4EPBC 3MKCA 2XWEA 1CI1A 3A13A 3F2BA 1UJPA 3GM8A 3PBYA 1Q45A 1GTHA 1I0DA 4FHAA 3UWUA 3PM6A 1YYAA 4MAVA 5CAHA 4C91A 1W1ZA 3CQIA 3SEPA 2ZRYA 4EXQA 4QS5A 3W38A 1K03A 1QAPA 1AA1B 3FYPA 3G1AA 2G3NA 4V2XA 3R8GA 3M16A 1EYEA 1F5ZA 3AC0A 2NSOA 4WDWA 5G2WA 4RDYA 1V0NA 4E2DA 2QV4A 5LHFA 1QUMA 4XO7A 2I5QA 4JICA 4FP1A 3H2CA 3KRBA 5HAOA 2WBGA 2P0IA 4UNLA 1AJZA 5HPOA 5G5IA 4GQRA 3WF1A 1W1PA 2X41A 3C0LA 1ADOA 2CLHA 1CLVA 1Q5MA 2ZXBA 1BWLA 3EWDA 2W4XA 4HNLA 5H2ZA 3LCFA 1QR7A 2G37A 3VKDA 4CVUA 2WXDM 2QMJA 3U5YA 4S1FA 4Q22A 1HX0A 4WSJA 4JNYA 5E6ZA 1TJRA 1MO0A 2QCEA 3VOFA 1VCFA 4RPQA 2G4JA 3U2ZA 2G8ZA 2CPUA 3TC7A 4IG2B 4B5XA 3S4TA 4PTXA 5ABHA 3CWHA 5JIPA 3SQMA 3AHVA 2B0MA 3TN5A 3H12A 1OFAA 4LB4A 3ZJ8A 3P5ZA 2DGAA 1UR4A 2CXEA 2VO5A 3EA2A 4B2DA 4M51A 4HMNA 5A94A 4DWSD 5BMXA 3QOKA 2ZICA 4QR6A 4KBXA 4HPHA 4QDWA 1XYFA 2BLEA 1TWIA 4J7RA 3CU2A 2AGKA 2Z4GA 1V3IA 1E51A 3WLKX 4H00A 4ZEPA 3EB2A 1IXNA 1K1DA 2BY2A 3N4AA 4RZ4A 3TNOA 4B5VA 1CGTA 4WDTA 1KCKA 3URBA 3NZPA 2R1NA 3S2MA 3Q45A 1QI2A 2J13A 3V18A 1GCYA 4R88A 5BXPA 3GY1A 3ZZ1A 4ATLA 3WNLA 4BQ3A 1TX0A 2VC6A 3W7PA 1OYAA 5G1YA 3W1RA 3LUTA 3W82A 4JXCA 2X2GA 4UTWA 3W85A 2CHRA 2VX7A 3UGRA 1OZQA 3QMRA 1BF6A 2PCQA 1CB7B 3QFEA 1FWBC 5JH1A 1OSEA 3ZVHB 5JH2A 1UQYA 4NJGA 3WK3A 3QEZA 3RRAA 4NZ1A 4YWIA 4Y96A 1EA9C 1KD0A 1UIOA 7A3HA 4RZBA 3H70A 2QPSA 4H01A 4NNAA 2VFFA 3S42A 2RFGA 3BMVA 1LL7A 2VTFA 1GJUA 4QSFA 5GNXA 2PGWA 2P53A 4WOQA 2CLEA 3QPZA 3PP7A 3W2LA 1R9ZA 3P7YA 2FPTA 2O56A 1J2BA 1ZBKA 1TMLA 3R0UA 2DJXA 4NZ5A 3ARRA 4NIRA 4AZ6A 4GABA 2TRSA 1Q13A 2O9TA 1YIXA 2DY3A 5GVJA 3VNKA 1KGUA 1ZFJA 2I16A 3UZWA 2WNZA 4ERGA 4GINA 2O9PA 3RITA 3SBFA 4L6OA 3BO9A 2GOKA 2W3ZA 5CC6A 4XZLX 1I2NA 2YFNA 3T0AA 4PRRA 4JN6A 1PBGA 4KRUA 1K8CA 3DERA 1P1MA 3PZTA 3D6NA 3E0IA 1OQFA 2C71A 2WSRA 1XLMA 3SM0A 2CLPA 1ZALA 3MS8A 3M07A 3LX9A 1PUDA 3L5AA 3W7GA 3OIHA 3G1YA 3R11A 3DHFA 1GOKA 3LB0A 1XJBA 4IPJA 1TQJA 1H4PA 3QY6A 3THUA 5M03A 4ZQNA 1WV2A 2Y1HA 3LHZA 3E3HA 2DT1A 2YYUA 1VYRA 4D6CA 3NQDA 2GJXA 1IEIA 1VLIA 2MNRA 5C9XA 4C5ZA 4GCAA 4GOAA 1DKWA 3TTSA 3W2JA 4QLKA 1J5SA 5JVLA 2E3ZA 3C0JA 4X9YA 3UZ5A 3V5OA 1BSIA 3BURA 2QDHA 4YL2A 1FWCC 2OT0A 3PNZA 1J12A 3U8GA 5EKYA 3ARSA 1BD0A 3DCPA 1C7TA 3QKEA 3MWAA 1LUCA 5CSUA 1XYCA 5EMYA 1IGSA 1B2YA 2Z6JA 2DU2A 1CB2A 4US6A 1Q85A 2R1PA 1QW9A 3SZ8A 1US0A 1FWDC 4QG8A 1F61A 1AW5A 3U4AA 4UOZA 3M47A 3ZVIA 4GQBA 3JW7A 3W1QA 3W00A 2BOFX 3C56A 2WSQA 3GXFA 3HO8A 3CBWA 4WCJA 2YA2A 4Y8FA 3R89A 1O94A 1OFRA 2HS6A 1WZKA 3QW4B 1W37A 1XW8A 2GVEA 1WOBA 1XF0A 3GYEA 3W2UA 3WBEA 5I3JA 4LRTA 3VMNA 1FWTA 1KTNA 5LIKX 1EGZA 1OJXA 2R82A 3LENA 1FCBA 3BJTA 3M0VA 4IL0A 3CUFA 2H8ZA 4XG1A 3G8RA 3TAOA 2WVTA 5E0KA 4G56A 4W93A 3GUGA 3UCQA 1DIOA 5CH9A 4CCEA 3MCOA 4PL2A 1UW9A 1K9DA 2ZUSA 3THAA 1RQEA 4WSKA 3O0KA 5FAGA 3FJNA 4GQQA 2ZXDA 3M0KA 4PULA 4QM1A 5T91A 3TA6A 1VFUA 4WX2A 2C16A 4BI7A 5F4WA 4WJEA 3FVMA 2OQLA 1KW1A 3C61A 2E8ZA 4IM4A 4ACYA 4KW2A 2A7PA 1QW7A 3H2EA 4DUWA 1EBHA 4H8VA 4HHHA 2A2IA 1EEXA 1TVPA 4NZ4A 1HVQA 5HANA 3WQ5A 1GYLA 1YBQB 4AIEA 5C5YA 3DFNA 4IG2A 3W70A 4NT0A 1A3HA 2WJDA 3QR3A 2VCAA 4PUKA 4XKYB 3VC5A 2Z29A 3HIJA 1DE5A 2D0HA 1HKMA 3MP3A 2CETA 4Q4KA 2X2YA 2XN1A 4JX6A 3OJGA 1H1YA 3EWWA 4J3UA 1D3HA 5AB3A 3UG3A 3HJZA 3W6LA 3LM7A 1JCLA 5FF3A 4Z2HA 4QFUA 5MKGB 1Q66A 4FAMA 4F9JA 2ZX5A 4V28A 5EFFA 6XIAA 1KNWA 1CLKA 5CPNA 5AHLA 3STEA 3E38A 1SMDA 3F5KA 2WZEA 3KS5A 4IH3A 3ZIZA 4A05A 1WKFA 2IUZA 1HJVA 2J8FA 4XVDA 3S1GA 5EMJA 5HBFA 4ZQOA 4DJFA 4HSOA 3TZNA 4YCPA 3RR4A 2V5JA 2R1MA 3GH4A 3O3RA 4IQJA 2RJGA 3UXKA 4LC6A 5I6SA 2GDVA 3MANA 5IHRA 3BL3A 3B3DA 1JDEA 2YX0A 2AMXA 4NYYA 2C91A 3W53A 3B8WA 4ZXOA 2C6QA 3CEUA 1LL6A 2I9UA 4GX9A 2BHUA 4HA3A 2E68A 3W71A 2NW0A 5FIPA 2ZA1A 1GHRA 1GVEA 3TA9A 2QAPA 4I3GA 3PTMA 4LAZA 5AFDA 1F05A 2OU4A 4JHOA 2CZ5A 3ES8A 4L1GA 3O07A 4ACZB 3EEZA 3K8LA 1K6AA 3VD3A 1M5WA 3QBUA 1OIMA 2QPXA 2WWCA 1L6WA 4KEMA 5H6HA 1PSCA 1OCNA 1PEZA 4XD6A 2F7FA 1QNQA 5HINA 5AKQA 1WXJA 4H9MA 2GQ9A 1PHWA 3DFSA 3G0XA 5F2LA 3TE9A 5DELA 1OFQA 2J8GA 3E0WA 1ZZMA 3ALFA 4UCGA 4DWSB 3FKRA 3CYJA 1NFGA 1JRBA 2ABBA 3BGGA 3P80A 4JL1A 3IWPA 3S1WA 4D6HA 1X6LA 3RLUA 3F4NA 3BLKA 1H7RA 1B30A 3TN4A 4EK7A 3CPGA 4G9PA 2X0HA 4YJ5A 5ENLA 4HCHA 2J7FA 3BLDA 2A3HA 1GG0A 4AUBA 3EX2A 3CV1A 3T7VA 4PB4A 3KOXA 3RF9A 3TTOA 2AL1A 4GYPA 1ONEA 3VIJA 1TWDA 4CU7A 3BJFA 1TPVA 4GGHA 4AZHA 2VR5A 2ODOA 1IXOA 1V3HA 1MDRA 1VFTA 1B4EA 4AD3A 3BPWA 3RGTA 1NDWA 1DJZA 3ABZA 4I9MA 1UYQA 5BRPA 3MUIA 4O8AA 1QPRA 3LI0A 3LQLA 4FNQA 3PJTA 5FJTA 4H6KA 4JKKA 1EJXC 3H22A 4RNHA 3VTRA 5L6UA 2CZDA 3TTEA 4JR5A 2WHLA 1GOWA 4WK9A 1WE5A 5H8MA 3CPRA 5FEXA 3TFCA 4GH3A 3TVAA 3MCNA 2YCEA 4AZGA 2E09A 3ITXA 2Y7EA 2G0WA 2VEPA 2B4GA 2FKPA 5FF2A 4EX4A 3M0HA 3B0UX 2V5LA 3AHTA 4O4WA 4YWSA 3W3OA 2IXUA 2J79A 2BVTA 3N2BA 5AC4A 4US5A 2XIIA 1UUOA 4DZHA 2ZZ1A 3WDPP 5FEWA 3M5ZA 2BFGA 4HYWA 4P8UA 1MXDA 4JYEA 4B5SA 4JPGA 5FESA 2YL6A 4FX8A 4JTQA 1M7XA 3OU8A 3WUFA 4CN4A 2FGZA 1PTDA 4P7RA 3N12A 3WK1A 2ZVRA 1S1PA 4GHRA 1WKYA 5J5DA 2G41A 1MFUA 3TCEA 4A8IA 1NJJA 2QW5A 4IGSA 4KWWA 1BRLB 4Y9MA 3NQ6A 3CAKA 4WKFA 4YVPA 1YRRA 2CZVA 4NSBA 4LV4A 1QATA 5FSDC 3S2LA 4C6MA 5FACA 3EOSA 4HOZA 2WMGA 2GGJA 4JN8A 4DI8A 3EKLA 4UNKA 2PDLA 2NWSA 4MY8A 4HNVA 4CQDA 3UR7A 2VFIA 3TYZA 4JOMA 5HR7A 1YBQA 3OB8A 1GPFA 4Z2LA 4V27A 4NF7A 4GZ7A 4PR4A 3VNDA 3EBVA 4A21A 1XC4A 4XKYA 1H1ZA 4MGGA 3T08A 2Y7GA 2DH2A 5D4YA 3S9YA 2V5CA 1AW1A 1VJZA 4DBEA 3E1F1 1W2PA 3GDKA 1AH0A 3AAMA 1FFRA 4B91A 5AY7A 5D8ZA 1G6CA 5MKGA 4OU1A 1QI0A 3FAWA 3VFCA 4JEQA 1JQXA 2HNHA 1SJBA 4MJ4A 2RDWA 4RK8A 2Q71A 1IEWA 3POHA 1UH3A 2OXNA 2ZX6A 1XIBA 4JTRA 1E70M 4MUZA 1XIEA 2GWGA 1ISXA 2WVVA 1HXJA 2DSVA 4PUUA 4LY8A 3BZGA 2X16A 2NVDA 4IFKA 5D04C 3MP5A 1N7KA 1C92A 3A4XA 2BVDA 3L4ZA 3BAIA 1UR8A 5LA2A 1PX4A 1GKQA 1LLOA 3PUEA 4LBUA 1LJYA 2CHOA 3ZLGA 4D9PA 4ZQRA 4LCRA 4HNCA 4FSAA 2GVLA 1OEPA 3SUUA 3CXOA 3MZ2A 4GNKB 3S0CA 5I03A 3LZ3A 3VZXA 1Y5VA 5BOOA 3CB3A 2PA6A 3AS3A 3PANA 5IXEA 2A7NA 3ENLA 2OQYA 3G0UA 5U7SA 5I2UA 1VHNA 3U3HA 3C0QA 4AY7A 3SY1A 2V3EA 5BOFA 2CLMA 1NIUA 3VKKA 3KHJA 3VD7A 3G6MA 4IMDA 4Q7BA 5I78A 2AKMA 3WUBA 4GUFA 5A8NA 4PN2A 3SIZA 3VCCA 3CMFA 1S2TA 4UTJA 5K4ZA 2UY5A 3PK7A 4DYJA 1SJDA 1DP0A 4NI3A 1W8GA 3P8JA 3EA1A 1VBHA 3CQ0A 1QVBA 2PGRA 4MB1A 5M3WA 2QQ6A 5HWJA 4DWSA 5D2WA 2PURA 1H7PA 1IIHA 1TRDA 4S3FA 2NUWA 1FWHC 4JTHA 4UOQA 3GVVA 4LNCA 3DBNA 1E43A 3VDHA 2NV9A 3HPAA 3LCXA 1G01A 2VZUA 5D2VA 3W24A 4JN7A 1L6FA 2OKTA 1P5BA 2NT0A 4L5ZA 3RFAA 2GUYA 4LH8A 4G6CA 3UFYA 2WCGA 1BVNP 4YTRA 3D5HA 1G7UA 2HVNA 3GX9A 4MIMA 4Z2KA 4J3WA 4LS2A 3DG7A 3A9BA 3W6MA 1KFBA 4L64A 3PHAA 2X05A 2W66A 3KBNA 1CW2A 5LNVA 3J7HA 3USBA 4OV9A 5HA7A 1SFLA 1HKVA 3S1UA 1R3TA 4XVEA 4NL1A 4XZNX 1CLXA 4UTKA 1ISYA 2EAWA 3F4VA 1H7NA 3SGGA 1JUKA 5A6TC 1RJPA 4GJIA 4UZSA 4H7CA 2QGHA 3SN1A 5A6KA 3NG3A 3UCDA 3QQ0A 3OZYA 3TLQA 3H2AA 2HK0A 3DESA 3U0HA 2DEPA 4QQ3A 4LYPA 4EACA 2YB4A 5HNTA 5MHBA 1GJPA 3SCQA 3CB8A 4QIUA 3HN3A 3FDKA 3W76A 3BAWA 1T8QA 2QKFA 4S3EA 3A3HA 1KM4A 2VMFA 3FX4A 4RCXA 4GBDA 1M9HA 3I65A 3EX1A 1YLVA 2PDQA 1N55A 2BY3A 3CQKA 1W32A 5C7HA 3TSMA 3UR5A 1AJ0A 5CGQA 4CD6A 4TMBA 2O92A 4HSHA 5KZDA 2C0AA 4WXZA 3EWZA 1B0IA 3ZXWA 2A21A 2PUZA 2Y8UA 2PWGA 1JYNA 2VQUA 3NPVA 5BWAA 3BARA 4M7TA 1J0JA 3E5PA 4UFJA 1BRLA 1UC5A 4GX8A 1WB0A 4D6IA 3BSGA 4PL1A 1HL8A 2GVYA 2PD5A 2PDYA 2OO0A 4DRSA 3N14A 4KPLA 1FWJC 1K4HA 2VEKA 1O7AA 2HJPA 4MNJA 2QVNA 3OQ8A 2WKLA 1RBLA 1EZWA 1DYSA 1CGWA 1BQCA 4B5WA 2Z28A 3AWNA 2NXHA 2DFAA 4XAYA 1O68A 1R9XA 1X7IA 4C6OA 1B3ZA 3QV7A 2XIBA 4PUMA 4GVGA 5HOSA 1GQKA 2EJ1A 2I5GA 2Z1XA 1XUZA 2AKZA 2Z1BA 4XSMA 3H8AA 3WBXA 1OC5A 1QT1A 3CEPA 3WQVA 4TV6A 3CUJA 3EX4A 3GWQA 1R85A 4H6EA 3AIEA 3KLLA 1ZP4A 1REQB 3F4DA 4AXKA 2J25A 4OBTA 3BK0A 2BY0A 3GH7A 3KL0A 3WJXA 1E5JA 1EC7A 2ZUNA 3GNXA 2QR6A 3W7DA 4D6EA 1FBAA 1G94A 2DSKA 3RK8A 2V5BA 5E70A 5J8LA 3D0CA 3NVTA 1E1FA 4Q4MA 1FUYA 1T5AA 2CZFA 2E9MA 1S3HA 2INFA 3BCJA 3N6HA 4K8EA 4ERIA 3CC1A 4AC7C 2OJPA 2PLMA 4XIMA 3S1VA 3TYCA 2VL4A 2HNEA 4HK6A 3UYIA 1X1ZA 6TAAA 5HJXA 4GY1A 1S39A 1TWSA 2PU0A 3NDZA 2EQDA 3BMXA 4CKQA 2J8TA 1VEPA 2V3FA 3F5JA 4JIHA 4L80A 2AQWA 4MM1A 5EGRA 2PDBA 2YBVA 4OV4A 5D9OA 1F3EA 3N2CA 4UMCA 4KGLA 2PWUA 4LNYA 3S5OA 1F3XA 1PZ0A 2YBTA 3MQTA 5DMNA 2DT2A 1Z42A 1DJQA 3GG1A 1B90A 1X1NA 1YXCA 5LIUX 2WHKA 3LXAA 2P3EA 3CO4A 5CJMA 1X38A 4A3HA 4FPSA 3W88A 1E1CA 3BMWA 4BQ4A 3GU9A 3FIGA 1OABA 4YN5A 1KC7A 1XDMA 4WSHA 4NILA 2EHHA 2X1TA 3MHFA 3RRXA 4D1JA 4R7WA 4O0ZA 2F2KA 3I10A 5CGMA 3NL6A 2R6OA 3WKZA 1YDVA 2A3EA 3THCA 1XLDA 4QG6A 3WQEA 3NPWA 4AG0A 1C8VA 1SFJA 3DXIA 5AC6A 3GDRA 1UR9A 1XLFA 3VUPA 2QCCA 3I68A 1JEZA 4HHMA 3GTFA 4RUBA 2CERA 4GFIA 3FSTA 3GH5A 4Z1CA 3OGSA 1XDLA 1FFQA 5JQ9A 5IFPA 3SRHA 3CHVA 3M0XA 4O4VA 4B15A 1V8EA 1RBAA 4ZO8A 4Q3MA 3PS7A 5E0FA 4S3DA 2YXGA 4Q7NA 3EDDA 1I2OA 3LLXA 3KZSA 3XINA 2Y7DA 4MG4A 4ERAA 3MP4A 4IX0A 1L8NA 1VJIA 5FL1A 3P3BA 5GNYA 1OX6A 4ICMA 4KKXA 2V68A 3KBJA 1XIJA 3OVGA 1ME9A 3H24A 1K8ZA 1XFCA 3KOFA 1A5OC 2CYGA 3WQGA 1C9DA 3WJYA 3HGJA 3MBDA 2VD9A 4GVFA 5CZJA 2ZUTA 3GU2A 3TWAA 3WH6A 3UWYA 3H4XA 3I7QA 1KWGA 1EJWC 4HYVA 3WLRA 1AZ1A 4GH1A 1JFHA 3CIXA 1X7FA 1V03A 3G2GA 1DJWA 4CU8A 3VIGA 5EA9A 1WDDA 1L2UA 3KVJA 5H91A 2V3GA 2Y61A 5LIYX 1KBKA 3G8EA 5G4WA 4QNEA 1SYTA 3GDTA 1FH7A 3AMLA 4IP7A 1A5BA 3TX9A 3EEGA 3H4WA 2ZRZA 1BGGA 1J2WA 4BEQA 3MCMA 3F4WA 1E6NA 2RDUA 1TV7A 5A2BA 4YTQA 3OYXA 2VX6A 4H8HA 4AY8A 3FVDA 1ZAIA 1XLIA 4RNJA 5HUPA 3V3WA 2JF6A 4YNGA 4OOUA 1OWQA 4GO9A 4CQAA 2WC3A 1V3JA 4DEFA 1NOWA 1BYDA 5I3GA 4W86A 3GXDA 3W7IA 1CXIA 2BBFA 2FZDA 4E0CA 1V6XA 1H3GA 2XPKA 1HUVA 3DHDA 2ACRA 3WQWA 2QF8A 5AECA 1M01A 1GVYA 3LPGA 1FKXA 1R47A 3GDBA 2UY2A 2WANA 3KBSA 1HGWA 3CS2A 5IOBA 5AZ1A 1CYGA 4Q8MA 4DJFC 1R3QA 1M68A 1UD8A 2X7VA 3BV4A 4DXVA 3EAUA 4RE3A 1OINA 3OHMB 2OSWA 3A4WA 1NDVA 1T96A 3THQA 2ISSA 2ZUUA 3NXLA 1REQA 1FWNA 4HJWA 4P7QA 2ACSA 4PGLA 2W63A 2B7OA 5A8PA 4RW5A 3H2OA 5SWUA 2XU2A 3EWCA 1R5YA 4LF1A 1JZ7A 1C9WA 1PZ3A 3PNUA 1TCDA 1O1ZA 3O7UA 3QTPA 3GR7A 5TAOA 2IPJA 4S2BA 1RZMA 3DUGA 4CGTA 1W5OA 3LHYA 2DT0A 3S47A 5CC5A 1MZHA 1NWUA 1K8YA 3ARPA 5KITA 3T2PA 1R7OA 2PP3A 2D0GA 4M29A 2YIHA 4QJ1A 1R3SA 3QLDA 1A0DA 2XIQA 1Q7QA 4JIIX 4LVGA 1V6TA 5JMUA 3S6TA 1OCQA 1GOIA 3NDYA 2I57A 3TK7A 1ZPTA 1KGWA 3IGSA 1XX1A 3HU7A 2ALDA 4HA1A 4A3YA 1ZSXA 2X30A 3W23A 4PRTA 2WMIB 1L2QA 1HL9A 3S2JA 4N6FA 5CPTA 1VCGA 3SRFA 1Y5WA 2LLEA 2CEQA 2J7HA 4WXYA 4KWSA 2BODX 4JS3A 4U31A 2BGQA 3TEVA 4QAWA 4M6QA 1KM6A 1A80A 1EWDA 3BQ6A 1FKWA 2WAGA 2O4MA 1FTXA 3BLIA 2PB1A 3EYPA 5CC7A 2WZMA 4DAFA 4IT1A 3T07A 1QPNA 2OG9A 5CPOA 4ZFCA 4PMYA 4HIBA 1JCMP 4LF2A 4B90A 2PLKA 3WMSA 1JZ5A 4MPKA 1D9EA 8CGTA 5JIWA 4AHPA 1KM5A 1VIWA 4M1BA 2BGSA 5DY3A 2EG8A 4DZ5A 1AG1O 3IAQA 3GU1A 3MV11 4DM1A 4KS0A 2PWDA 2XUCA 2V2DA 2XSAA 3HB9A 5BOEA 1ME8A 4QDMA 1QOPA 3HPXA 1IZJA 4GLEA 3S6DA 3H53A 3VYLA 2WBKA 1JCTA 2PTWA 3O6AA 4P7LA 4IZGA 2VR2A 3SADA 4RNIA 4IPPA 3UGVA 1AQFA 4XZWA 3PTKA 3HQPA 3LZ5A 4NNBA 5LXXA 1SGJA 1ECEA 1UPMB 2FQIA 3UF9A 1I75A 3ELFA 1UD5A 1SZGA 4C6QA 3N13A 1OK4A 1AQMA 1BWVA 2YW4A 3PWIA 2WOQA 3M0LA 4Y9PA 4WLCA 3KWXA 1E6ZA 3AMKA 4Y8EA 2XIOA 4ICCX 3KOZA 1OIFA 5A6MA 3RM8A 3GIPA 4W8LA 3U57A 4YHEA 1P0DA 4N9DA 2EPLX 4FZIA 1DWFM 2F38A 4C90A 4S3BA 2XM2A 2E6AA 1OFPA 1U1JA 2GJLA 2QLYA 3TP4A 4P8WA 1UWRA 2XM1A 6ENLA 5DEZA 4W7UA 4DO6A 3AZRA 4DYEA 1UWQA 4J35A 1L6GA 4NZCA 4CQBA 3DFPA 1WKDA 2HE5A 1GZGA 4K8GA 1UKPA 2F61A 3IJIA 3T05A 2ZX8A 3ZJKA 2E7FA 4WD0A 3NQ7A 3VCNA 5ABTA 3LPFA 4LUTB 1O12A 3B0YA 3WUEA 2J74A 2UBPC 4Q8OA 4FXSA 2B81A 2QJNA 4P8VA 1XIDA 1NARA 4REQB 4O1AA 2DVUA 3CQJA 3SJNA 2ZC1A 2BOEX 1E6QM 4AEFA 5HMSA 1H61A 2XFRA 1E55A 1R3YA 4GC4A 2QJGA 5LA1A 1XLBA 2NVCA 5C70A 2UZ9A 3G3MA 5CC3A 1NOUA 3OG2A 1MW1A 1SW3A 1V93A 2EEXA 3LV6A 1FQ0A 2NLIA 3IIXA 3W29A 4FOUA 4RDWA 4P2VA 2Y5SA 2E9LA 3O1NA 3IV3A 3VAVA 2NWRA 5FD0A 2VZSA 3DOPA 1RY0A 5BRBA 1OGGA 5AYYA 3VGFA 2P76A 1GW9A 3NVDA 3CZKA 1VBRA 3N4FA 4LALA 3GTIA 2OPJA 2F6KA 2Q8LA 4Z2JA 4GBUA 4E6MA 4Z08A 4F40A 3EOEA 3L0GA 2Z7KA 1MWOA 1V6VA 2BSLA 3PBUA 2XG9A 3A24A 1I1WA 5AC7A 2CC0A 3VABA 1QOXA 1BYCA 4S23A 4GFSA 5F1UA 1V3LA 5GNZA 3HQ1A 1E4NA 5K9DA 2GK1B 4PC8A 3CPUA 4AB4A 2ISFA 3R6IA 4JTCA 4UTLA 2FDSA 1VFMA 3B0PA 4CCDA 3R2GA 3CAWA 4H41A 1F2JA 4ORMA 4KCWA 3GG0A 1TTJA 1UZ4A 4CCCA 4E4FA 4JFWA 3RJXA 1LWHA 1F3TA 3C2EA 3F4CA 1JYXA 4CVWA 2FZNA 5E09A 4L9XA 1GOMA 4AC1X 3BLFA 1OT1A 2E5CA 1UB3A 4Z0JA 3E6EA 3V4BA 2B7QA 1TTQA 4NRSA 3MYPA 3LV5A 7ODCA 3STCA 2V6AA 2JGYA 3S2CA 4HBKA 1XG3A 2E1DA 3FCPA 4TUFA 5AHMA 3V5CA 3OVQA 3AYTA 3BOXA 2POZA 2HBXA 4I9AA 1EJVC 4GQ0A 4AMCA 1TVNA 3DU0A 4FXJA 1Q2RA 3TZFA 4MLJA 2PFHA 4DWSC 1JPDX 2FB3A 5C2CA 4OWGA 4PUEA 3NQBA 2VRJA 3MUXA 1PXGA 1YXDA 1X97A 4BWLC 2OEJA 1D7KA 4RLIA 3TSBA 1P4CA 2QCHA 4E8GA 3V0SA 5FJJA 1J18A 3A21A 4TR9A 3U2EA 1W1A1 3BJSA 1HKIA 4MSSA 1J8VA 2O4QA 4R9OA 4DI9A 4W5UA 3BANA 1ZUAX 2PDXA 1V3MA 4IIFA 5M2FX 5FJUA 1T0OA 2FHBA 4U10A 1MUWA 4DLMA 1PYFA 3P0XA 3M7SA 1JUBA 4O54A 1DIDA 1A3WA 3AU6A 1FOBA 1HO1A 4HKPA 3RHGA 1UC4A 1IWAA 3REQB 3EXSA 1YTKA 1JG9A 3QYSA 3E5BA 3KDNA 1SR0A 3H21A 1O5RA 3WFLA 4XUYA 4H9YA 1DJHA 1E5NA 4XZIA 2XSXA 2WB5A 4X63A 1QHZA 3AZTA 3O15A 2BV9A 3LRKA 4W7VA 4W87A 4DQWA 4MZ1A 1ZS2A 2QHAA 1KGXA 3L12A 1RP8A 4DJDA 4BF9A 3WD3A 1C8XA 2WM0A 1ZCCA 3VIIA 1CGYA 2Z1SA 2DIEA 1Q6QA 1MUMA 1XIHA 1H49A 1ONXA 4W85A 4OUIA 2NZLA 4FLSA 4LCQA 3NYDA 1E15A 3UESA 4B4FA 1EP2A 3QGVA 3PJUA 2QEZA 1V02E 2H9AB 4N4QA 3GC4A 1T41A 4JDBA 4V1XA 1IYXA 4XAPA 3L4TA 1PHQA 4IJCA 1H60A 3A12A 4TMCA 5BW6A 3E2SA 3GUWA 3UZZA 1BLIA 4E38A 3LGDA 3NZGA 5E93A 1QNOA 2YR1A 4GUGA 2OSXA 4I8DA 2DZTA 2VURA 1B1YA 1TV3A 2VEFA 1BTCA 4MNLA 1JCXA 2Z1WA 3BSMA 3ARYA 3OZMA 3ME3A 1NQ6A 1LORA 1HZYA 3DYMA 3B04A 2OO6A 1BVWA 1I2RA 3UNDA 4QE4A 2FTWA 4C6JA 3R94A 3M6YA 5E9AA 2DV0A 4QNWA 4QCEA 3QPYA 3QZEA 4LRSA 2OWXA 3B9OA 3WNMA 3VMPA 3ABXA 4BCEA 4L56A 4RDZA 1OX5A 4UR8A 3V1PA 1LRTA 3WQFA 4P5UA 3VIHA 2I5IA 2QCLA 4KWUA 1Z3NA 1JI1A 3KBWA 1PB0A 2WQDA 3O05A 1YX1A 2I7GA 2XGZA 5HMDA 1XQKA 3DFYA 1DHKA 2DVXA 1T40A 3ANVA 1JDCA 1V79A 4LEQA 1GK8A 1DWJM 3GK0A 3HA1A 2P88A 3FN9A 5CGTA 2PF0A 3LSBA 2ZZ7A 3RJYA 1MRQA 1MDLA 3QC0A 2OLSA 3AIUA 3MU7A 1DWGM 4BJHA 1RV8A 4G5DA 1XSIA 3NL2A 2GDQA 3OVPA 2BZNA 5D8WA 4FXRA 1JGMA 5E1QA 2TODA 1W1YA 2A3AA 4W8AA 1LZOA 4MJZA 4QGCA 2CHNA 3DGRA 3R1ZA 1SFSA 4E2BA 3SAZA 3SO7A 1EH9A 3F7JA 2PU1A 5D02A 5EMLA 1BAGA 4XB3A 4C1LA 5LIWX 3SI9A 4E2OA 1W9DM 4KIEA 4S3CA 5EMUA 4DJED 3K13A 1QWKA 2VDIA 2PTDA 2CBJA 3MJMA 1VBGA 1EYWA 2PRMA 2Z1VA 3VC6A 1A5SA 4MNMA 4CNPA 2XVLA 3KS6A 4F2TA 2YYTA 4H9ZA 1O1HA 3ITYA 2D22A 3K1GA 4LWWA 1XIGA 3WK0A 2J4GA 1QNSA 1KFLA 1TPWA 2W91A 3EMZA 1KV8A 4GZIA 3AIQA 2ZFAA 3R79A 1MUCA 3UG4A 2YA0A 1U1UA 3VILA 4NJIA 3BZJA 3AQUA 3VX1A 5FOOA 1KBJA 2C14A 3QHMA 3T4WA 1W8SA 1H7WA 1KM3A 3PZQA 1RLCL 4CNUA 3H7UA 4PEEA 4ZGYA 3GKAA 2O7SA 2C19A 3C3UA 1M04A 2TAAA 3BG5A 5TD4A 1KO0A 3B8TA 2BASA 3VU2A 4PMJA 1Q2SA 1PZ2A 4LYKA 4A3UA 2FH8A 1LM1A 3WYZA 4R53A 3STGA 3W37A 4F4RA 3CL8A 1O4UA 3E74A 3AHXA 4PRWA 5ABGA 1RAKA 2DZAA 1Q6CA 4R7JA 4EAYA 2YCLB 4JZ5A 5A6JA 3N34A 5I0DA 2XFFA 2WMJA 5CAKA 3W7EA 3M43A 4OBSA 4ADTA 5AYIA 4UFIA 5A69A 5AYZA 5IDIA 1VYPX 4HN8A 3TW7A 1DWAM 5CBJA 8TIMA 4I90A 3CK5A 3N4EA 4TIMA 1TRIA 4O16A 3TQ0A 2BGNE 5AHNA 4L4PA 3B9EA 2DP3A 4JY8A 4XSLA 4G2DA 2PSNA 1GEQA 4DBSA 2W27A 1P48A 3INPA 4O1EA 1FWEC 1XH0A 3LGGA 1TUXA 2W61A 1ME7A 1PIGA 1XBVA 5IRPA 1KXHA 4RW3A 4AYGA 4GG9A 4NP7A 4KEZA 4U4MA 2PLJA 2HPIA 4R27A 5U4NA 4GIEA 4PUNA 4FK9A 3L2LA 3DKJA 1CX9A 3KAOA 3WBYA 1GYMA 4F0SA 4A2SA 4IUGA 2VDHA 5KZ6A 4TTGA 4YYCA 2X0YA 5BU9A 5HK4A 4LOCA 2ZZ3A 1OY0A 1P0EA 4R33A 1Q8JA 3LMZA 2V3DA 3QRHA 4YLWA 3BCDA 4GQGA 1AFSA 4L9ZA 4DZIA 3LYEA 3MWCA 4H8NA 1KRAC 1E0TA 1CXHA 1K77A 4O1FA 2JK2A 5I77A 1OZMA 2DJLA 3R58A 4H7ZA 1UJQA 4TX8A 1EGMA 2QVHA 3APGA 3AMCA 2OOGA 2XINA 3CUXA 3ABSA 2H9AA 1OVDA 1AW2A 3LLDA 4ZENA 5D30A 2D2OA 1QNPA 5I79A 4JQ4A 3VOIA 1L9WA 1J6PA 2FVLA 2JALA 3ECQA 3MC5A 1UWIA 1EO5A 3AMDA 3MBFA 4J28A 1M41A 4JHZA 1LLWA 3W81A 5LNRA 1XISA 4ICNA 5C7VA 1KA9F 2Q8ZA 3T55A 2YB1A 4UTMA 3L4XA 5A8MA 3LMYA 1GOQA 1XM3A 3LM3A 3N2XA 1QW8A 5CZKA 5E0CA 1UR2A 5HMFA 4Z17A 4PMUA 4WVXA 1B3OA 1JZ4A 2CKSA 4HN4A 1WQ5A 1JRCA 3CHCA 4S3GA 3WL0A 2HE8A 4UQAA 2ZIDA 1BWKA 3NQMA 3VNJA 4LYRA 4IUOA 4XX6A 4JFTA 4WKAA 1KFJA 3AWOA 3C2VA 2ZA3A 1UG6A 5CSYA 3UXLA 2VC5A 4MVAA 2XH0A 4GVIA 1M7PA 1GVQA 3AIWA 1JD7A 3TTQA 3R5EA 1XBZA 5C71A 3WF3A 1K3UA 4JYDA 1PDZA 1AL8A 1B3YA 3A4AA 4RXFA 3OPSA 3WLIA 1O5XA 3CHFA 1KRBC 4HPGA 1BYAA 1PKYA 4EWND 4AZCB 3VCRA 2CITA 4DZAA 4AZ5A 4MWAE 3UNTA 4QXIA 2PDPA 4AIOA 1KR1A 1TZ7A 3H55A 4UWMA 4QTGA 4RJEA 2Y85A 3PUDA 3E0VA 1GWJA 2J6XA 4Q4PA 4PSPA 3C2OA 2DT3A 3VIMA 3SFKA 4WRHA 3UJRA 4EVZA 2ACUA 4AZBA 3LTSA 3N2TA 1XGZA 5CZ0A 3KM8A 1CGXA 2V2HA 2YXXA 4M81A 4IICA 3SSJA 1WZMA 8A3HA 3CT2A 1QO5A 2FJUB 4U3CA 3T6CA 1B5TA 2Z25A 4TVUA 3T0TA 1JYVA 1F8MA 2EJAA 2WCAA 1UBPC 1E3ZA 5FJIA 5A8OA 3MMUA 3DBPA 2PC8A 2G4FA 3T81A 2PF8A 3C8FA 3W0KA 2OWCA 1DQUA 4NYUA 3QGAC 2NV1A 1XP3A 5DX7A 2VWSA 2NQ5A 3ITTA 1NF0A 2GQ3A 5D09A 3VA8A 4B4HA 4CN6A 2QUTA 4GUJA 3AO0A 3HQOA 1E71M 3LHUA 3WNKA 1R87A 3PUGA 1P7TB 3WF2A 4O17A 1W31A 2HBVA 4WDXA 2FMOA 1FH9A 4GNJA 2CLFA 3L9CA 4NKCA 4GXMA 4S3JA 3PPHA 3G1FA 4JCLA 3PBVA 4H7VA 3G77A 3SURA 4GJJA 1FDZA 3N17A 1X8FA 5TNVA 5C9WA 1XLEA 4QISA 1PDYA 3VM5A 2QJMA 4U28A 2IKGA 1XCWA 5A6BD 2PPGA 2IXVA 3R0DA 1XGEA 5HQMA 1TPUA 1WO2A 3GXNA 2ZZ5A 2QDGA 1P6BA 1FCVA 5B7ZA 1E4IA 1UUMA 1E9LA 3FSUA 3UERA 3PZGA 2PMQA 3BDKA 2QDEA 4FB7A 3USZA 1V02A 3PTQA 1VPYA 2YXOA 4IIBA 1Z8AA 4XD3A 2JGQA 1W5QA 3RU8X 3ZMRA 2WNNA 1WZAA 1UD3A 4DLFA 4NHVA 1SR9A 1TR9A 3VIOA 3FA5A 4ZE5A 4DUOA 3CTLA 4KESA 3S8HA 4HPJA 4MKNA 2EBNA 2RGLA 1RD6A 1N2VA 2Y5JA 4N9EA 5C9UA 3TJLA 2YA1A 5I5RA 3WY1A 3F1QA 1OYBA 4NZJA 2F9RA 4HNNA 4C1NB 1FWGC 1LQ0A 3V5FA 5CG7A 3CH0A 1U5VA 3AUJA 2E28A 4W9TA 1VKFA 3EDJA 1VEMA 4UR9A 3A23A 3UXDA 4YTUA 2GWNA 3RDKA 1U83A 4XIAA 2YBUA 3G1SA 1U5JA 3HG5A 2DUXA 1X1OA 1E72M 4ZMGA 3HGSA 5I02A 1OX4A 1JF5A 4XZBA 4RE2A 1LBMA 2XVNA 3W9ZA 2YZRA 3DGBA 3LBOA 4PBGA 1XPYA 4J2PA 2VKZG 4A2RA 4DAIA 2ZVIA 5ECVA 3AIVA 4BA0A 1XPGA 1RVKA 3ZLFA 1A49A 1S46A 4KH2A 1G1YA 1OFDA 2J9XA 2J88A 1SZFA 1IT8A 1KXQA 4MWAB 4Q8PA 3NO1A 4JQ2A 5K4XA 3GSMA 1TPEA 3R12A 2WJEA 1WCGA 1FWIC 4OGZA 3DKLA 2DUAA 3WJZA 1R3RA 6REQA 3RX4A 1F9CA 2DW7A 3ORWA 1GVRA 3EKGA 4KGJA 1SZRA 3FV9A 4OUEA 3TW9A 4D6JA 3GHRA 3IUIA 1PPIA 1XQLA 4L65A 3N73A 1W56A 2V30A 4GIRA 1ICPA 4N4PA 2OWWA 3IJLA 1CTNA 3NO5A 1V7YA 1CXEA 5D2YA 3KVKA 4DPQA 3ZM8A 2V9DA 3TYEA 3SY5A 3O63A 2I1OA 5I7GA 4PCTA 1EP1A 3WQ4A 4X0VA 2D24A 3KL3A 1NFBA 1KXTA 4IMCA 1IWBA 2ESCA 1XRTA 1K02A 2AQVA 1XSKA 3OG3A 1JPHA 5LGXA 4GPNA 3VKBA 4EPEC 3NQAA 1PKMA 3CL7A 1AH3A 4OJYA 3U6WA 1OB0A 1YADA 1BKHA 4I7VA 3M5YA 2Z2UA 2WV8A 3LDVA 2Z26A 4KWVA 5CZTA 3E0FA 5K9XA 3P93A 2G3JA 3H6OA 3M64A 3N04A 3ZFHA 3AZSA 4CNSA 4OQVA 5CEWA 4WIWA 1MW2A 1XBXA 1AMKA 4J3SA 2WMFA 2CLKA 3WLSA 4HNTA 2HMCA 5PTDA 1NH6A 3PAOA 3NA8A 3M9YA 1PWLA 4PFHA 5CG0A 1XYLA 3RMEA 4WDUA 4HCDA 3HGRA 3WF0A 2OZ0A 1KQYA 4R9XA 4R3UA 3EWXA 3SUVA 3PVFA 3VM7A 1C93A 3N2MA 4XUGA 4HYRA 1EXBA 1VFOA 5K7JA 2PP1A 4I5RA 5F4XA 3IJ8A 2PDJA 1JZ3A 3HFTA 2QJHA 3W1MA 3FY1A 4W8BA 4PUDA 4GMEA 4QBXA 2WJZA 3EPOA 1ITUA 3SUSA 2IQTA 4HSNA 1M7OA 1LYXA 4Y2WA 4JEJA 5FEPA 1XV8A 5FJRA 3T09A 4QJ5B 3D3AA 4W84A 5LNSA 3MJYA 1ICQA 3LCLA 4MFEA 3PULA 1QO2A 1TR1A 5DCDA 3MV01 3SCTA 1DWIM 2WKGA 3CUGA 4Q8NA 2BMBA 4D6DA 1IWPA 3WDHA 2H6RA 4Q8WA 1QNRA 2HPMA 2RJHA 3DFQA 4TVCA 4FXFA 3T0BA 1MXGA 4PB3A 3GW3A 3W07A 1KBIA 1W5NA 4N42A 2PDKA 1GGOA 3KCJA 3LN3A 2D0FA 3SCNA 4MLRA 3RMJA 1GVOA 3GLCA 2KAUC 1OCJA 1D3CA 3GZAA 4F0RA 2GLKA 4B92A 1MQRA 5TIMA 1I1XA 1UBSA 3T2QA 2I17A 2PDIA 3WDQA 3P61A 1UZ1A 4BI6A 3B9DA 4C5YA 1WOAA 4AEEA 1RPXA 3LERA 1VB9A 3L21A 4JIPA 3EXRA 4DJEA 1EJ7L 2Y89A 3T78A 2DSWA 4ONVA 4AW7A 5BNKA 2BHZA 1ITQA 4G7EB 2HVOA 3APYA 4L1WA 5I24A 1VF8A 3PJWA 3W2NA 1HP5A 4N0RA 1KTCA 3URQA 4FLQA 5F1VA 2ANUA 3FYYA 3WDIA 1UR0A 1GW1A 4WZHA 3ZYZA 1NM9A 1UQZA 4YU1A 5IFTA 3D47A 4LVAA 3E2RA 1NWSA 4C1NA 4MZYA 4ORIA 1W9BM 1SO3A 3TOPA 1ISWA 3PB0A 3IIZA 1NU5A 4FLOA 3UVIA 3GFZA 3WIJA 2J78A 5LYRA 4O52A 3TW6A 3THDA 1UWSA 4XKMA 1NP2A 3SQSA 2TYSA 3URNA 2PZNA 3UD6A 1A5KC 1KBLA 2Y8KA 3GTNA 3LTYA 1PTAA 3IUDA 2EPKX 1ZJAA 3WEZA 4EPDC 2EPHA 2WJFA 1TPB1 4J27A 5AVHA 5LXEA 4W4QA 3ANYA 4JFSA 3VD9A 5DBUA 2NX3A 2P5NA 4BQ2A 3HV8A 3W1LA 3GNNA 4KEVA 3UPWA 2O0TA 3W7NA 2R94A 4MWAA 3CIWA 5BXSA 4JAWA 3FGCA 4GK8A 1QWGA 3BOFA 4UFHA 1NSJA 1B31A 3MT1A 2V38A 1OCBA 5I3FA 4LFYA 2BX7A 3M5VA 4AY1A 4EWJA 4V33A 4G1KA 2GYIA 1A5MC 1YMYA 2GUBA 3WQ8A 4GD0A 4PBEA 5JBFA 3GQYA 2VGIA 2WLYA 7REQB 4MF4A 1OFBA 1ZB5A 3HF3A 5FJOA 1HJWA 3GZ3A 1UP2A 1XICA 1KV5A 3SDOA 5DF0A 2ZA2A 4AQLA 1TELA 1H63A 4JTGA 4HOXA 3DDMA 3IJ9A 3UVAA 4OECA 2QDDA 5HPCA 4XO6A 3G1VA 2F84A 5GPRA 2WZIA 5TF0A 4LUIA 3G1RA 4DPPA 3ZJ6A 2WWDA 2ZYFA 3PB2A 3CUIA 4J3XA 4LVDA 3S5SA 3OBEA 1TJ0A 3PFRA 2ZRUA 1YPXA 3W4RA 1VCVA 1TFVA 2ZOXA 2Y5EA 5LA0A 3Q37A 3TIMA 4RV3A 1HJSA 2PBGA 4HK5A 3P5YA 2XVKA 5IBXA 3GAKA 3ZR4A 3L4YA 4ML9A 4QJ4B 1XUUA 3GHUA 1Q4WA 1Q3NA 4O0KA 4ZFMA 1I6NA 5FA5A 3CO8A 2DZXA 3K46A 1EX5A 1DBTA 2PDWA 4FIRA 3BOLA 3HV9A 2HRWA 2PLCA 1K7XA 3U48A 3N6QA 3RX3A 1TKKA 4UTTA 3WELA 2OSYA 3RG6A 5DO8A 3I3EA 3N9KA 2EXOA 1WXYA 2VX4A 2VOTA 4RE4A 3R8HA 1W3NA 1E9IA 4DXXA 1VRXA 5D33A 3RYSA 3NJ3A 3Q94A 3FJ4A 3EOUA 4HU3A 3B8UA 3KX6A 4JQ1A 2YCKX 2ZDSA 2O9OA 3AXKA 5G4EA 4O15A 4JTIA 4CD4A 4ZTXA 2QCMA 1C90A 3VUSA 2D2JA 4DUXA 2C0HA 3CV2A 3CQHA 3GNRA 3FA3A 3CHDA 2Z24A 1PYMA 1RSCA 3UZJA 1ZENA 2PWFA 2BXVA 3DYOA 2QGYA 1IR2A 3ZS4A 3PBGA 1G5AA 4CNOA 1ZQ5A 1EZ2A 3FK4A 3WEOA 1SZNA 3BH4A 5KTLA 4NUWA 3B8VA 4WR3A 5I06A 4QX4A 4J40A 1VFLA 1J79A 1CWYA 1A0CA 2H8XA 5K9CA 3XIMA 3M46A 4ZQCA 4E4UA 1FY6A 3W74A 2E6DA 4NQ1A 3IAPA 2VENA 3IK2A 1YNPA 2EG6A 3S5NA 2YL9A 3FW6A 4WGXA 2J9YA 4ASTA 2C1IA 2NX1A 2Y63A 2FJKA 3S9IA 1U22A 2WSKA 3UG8A 2J66A 4W7WA 3KOWA 4LXFA 2BTMA 3NZQA 1W1VA 4P8XA 3IUHA 1VJSA 2CBIA 3V0TA 1VR6A 3C86A 3HM7A 1IR1A 4RR4A 3IIPA 5CSSA 2FTPA 5HNUA 4LUSB 1LTDA 2V69A 2ICSA 3FLUA 3GXIA 4DY1A 3WO8A 3VZZA 3ZVHA 1Z41A 3FHAA 3NM3A 2TSYA 4KCVA 2AAAA 1OGBA 2BY1A 1NTHA 3PN8A 2VD8A 5CBIA 1GOXA 2L5HA 4G7EA 5DRIA 1WX0A 2WM1A 1D2KA 2ZRVA 4IIDA 1EUNA 4M24A 5CSRA 4NXKA 1F4HA 1E9ZB 3TC6A 1C7SA 1CBGA 2GJPA 2CXGA 4IOTA 3W27A 1AD1A 3TR9A 4A22A 3FXGA 1ODUA 1BF2A 1QDSA 5HQEA 5HWMA 4L61A 1HQTA 1XLKA 2PEVA 4GYJA 4KQNA 4QG9A 1RK5A 2PDNA 4E3VA 1SMAA 4IMAA 2J9ZA 3TYAA 1BFNA 5BZAA 5I3DA 1J6OA 4TVDA 2OLAA 1YQ2A 4D71A 4YCOA 3MPGA 3NURA 1VD6A 1JPKA 4L4MA 3WNPA 4MKSA 3VE7A 1DV7A 5E5CA 5FKYA 1XD0A 1K4GA 4A3QA 4ZO9A 4UZUA 3LTPA 1BGAA 4ZSTA 2JKPA 4YPJA 3AJXA 1UPPA 2PCEA 1F6YA 5ABFB 1Q65A 1C8YA 5TBOA 4GYKA 2VR4A 4QDPA 5A6BA 4LTSA 4Y9NA 4I5XA 4QE1A 1JCYA 1EHAA 4MFDA 4PSRA 3VKJA 3NTYA 3UG5A 2ZZ2A 1XYBA 4XBSA 4D6GA 2Y6ZA 4IXXA 1PAMA 3KEHA 1YKWA 4PE8A 3KW3A 4LVBA 4PTMA 3S2NA 1G7VA 3N11A 1LG1A 2HZGA 5D05A 3BW2A 3S83A 4XZ9A 2DORA 3RO6A 5FEZA 3UA3A 4FNRA 4YS1A 3S6OA 2RAGA 1VLWA 1VAHA 2P8CA 3CZEA 2FHFA 3QSTA 1RQBA 3BWWA 1KTBA 5EL1A 1X6NA 2VELA 2CNCA 3VDCA 1UZDA 4F2UA 7REQA 3T42A 1OYCA 2MANA 3T0DA 2E5BA 4H1ZA 3TROA 3UWVA 1XLJA 4ZCWA 4MUPA 4M0XA 2YDSA 3EWYA 1IQ8A 2WPGA 5BYWA 4UC5A 2NQ9A 1RJRA 2E4TA 1VRDA 3A3XA 3S46A 4H6QA 2GOUA 1H2JA 4HU0A 1LOLA 4PFMA 2FFCA 5CXPA 4NAEB 3MMWA 4Z1DA 4UQBA 4WEVX 5I3HA 4GZEA 1TCMA 4UQEA 4EF9A 4LEFA 3V35A 3T8LA 1RCQA 4L1XA 2FIQA 4K68A 3QZAA 4IIGA 3STPA 1BSLA 4XISA 4QE5A 3VOGA 4KWOA 3P0WA 3R8RA 1AZ2A 1EF2A 3BG9A 2ZADA 3RIKA 3NPUA 1H11A 3VNIA 1W2VA 3EKZA 2QUVA 1AH4A 3TAKA 1A5UA 3P74A 1THFD 4BF7A 4R7OA 5E9XA 4YHGA 3BAYA 3AS0A 3N9SA 2GGEA 2VFHA 1MXSA 1WDSA 5GQBA 2DPEA 1W5MA 2RDTA 3FJLA 3M6DA 1OFOA 3VI2A 2ZCGA 4F0HA 3QH2A 3LK6A 4Q4SA 5C6MA 5HULA 3VD5A 1XIIA 2CKRA 2B7PA 2WVSA 2ZRXA 1FVPA 4PUJA 1UR1A 3DI0A 3EPNA 5CLWA 1ZJHA 2FZ8A 2XGBA 3KE0A 1H51A 4IPNB 2QCNA 2A4AA 2DZSA 2HSAA 3G5EA 2I56A 1KKOA 4TO8A 3BE7A 3AXMA 2Y2WA 5CKSA 4OHQA 4OKDA 1JDFA 2XGIA 4FR1A 4HHPA 1R2RA 4DF2A 4LBSA 1EJUC 1MYRA 1WDPA 5A1AA 1JUEA 4Z0SA 4AAJA 2X0SA 3AISA 1W1TA 1CZ1A 4X9SA 1WUEA 4RNFA 3ITVA 1UHVA 3NZRA 5AHFA 3TQKA 4YXGA 3QM3A 4ZQPA 3H26A 1W9VA 3F2DA 2GSJA 2PE4A 3FEQA 3EX6A 5JU6A 1TIWA 4K6AA 3W2MA 4PMOA 5C0QA 5A95A 4BFAA 4UFKA 2WHJA 2XIJA 1VPXA 3B8DA 4LUSA 3UYCA 3LI1A 3KUMA 4GJ1A 2DQWA 1GJWA 3QGKC 1FWRA 2VXNA 3KFTA 3MKKA 4UR7A 3VX0A 1S1RA 4OBRA 3RCNA 4PCPA 2RGMA 1TA3B 1UKTA 3NOEA 3T40A 4DBDA 1BQGA 3SB0A 4B5NA 3GXPA 3ID7A 2XH2A 3AHZA 4DO4A 4YMZA 4ACZA 1QU4A 4PODA 3ZT6A 1MI3A 2UY3A 4HA4A 3WH8A 3EOLA 1SO5A 3EMCA 1Y8BA 2DH3A 3VNMA 4XD4A 2R14A 1HG3A 3FAXA 3PPGA 3DC0A 2G97A 4CEXC 3CZLA 3BCFA 3RLVA 3V1HA 3NFUA 1V3KA 3JVAA 2OMAA 1PO9A 3NXFA 2QV5A 4N2YA 3BC9A 4Z1YA 3SCPA 3L4WA 1RHCA 4CQ9A 4MHBA 4FX7A 3NO3A 4QHRA 3VIKA 1LCOA 1GEHA 2ON3A 2FZ9A 1KXVA 2XTKA 3FXYA 1ZTVA 1PL9A 3BAJA 3CT7A 5ABFA 3KBMA 3I4KA 5A3HA 3CV7A 1HKWA 4X3ZA 2PTZA 3W7QA 3DH7A 4HP5A 3RAOA 2XFYA 4U2YA 3W7HA 2DZWA 1JR1A 2A3CA 2QZRA 4C6BA 1I4NA 1YDNA 4TTUA 3PC0A 1Z69A 2BG5A 1I2QA 3ITGA 1UMYA 2E77A 3MHUA 3WDJA 4GUHA 2Q6ZA 4TX6A 4B9ZA 1V51A 2ZE3A 3AYRA 3OYZA 1I9CB 4FA3A 1A53A 2VCBA 1DXFA 3GD6A 2Z2AA 2PDGA 4YVVA 3H7RA 3N3MA 3KRSA 3ATZA 4UOJA 4F2BA 3GHSA 4FO4A 4NU7A 1HJUA 1I0BA 1BXBA 1P0BA 4IFOA 2J75A 1E0UA 2YPIA 4DHGA 2J7DA 3W2KA 2WZHA 2PI6A 1T8XA 2AAMA 4PUWA 2QXWA 4L9YA 2J6VA 3LEPA 4AX6A 1UASA 4DNHA 3DAQA 1X98A 3L4VA 1VS1A 3ARTA 1QFEA 3TSDA 4L6DA 4ZB2A 3H2FA 4G7FA 4HMEA 4JBRA 4NAEA 3U7VA 2VJXA 2VFDA 3IV8A 1BG4A 3TXZA 4KFOA 1FWSA 1F73A 1QTWA 3IPWA 4AVOA 4C6DA 3SCRA 1VGAA 2X40A 3ONCA 4LBRA 3N6JA 5XINA 3CZGA 1W1B1 3BGAA 1DJYA 1WUFA 2BHYA 3CMJA 4AHOA 4HTBA 4ADSA 5F2GA 3GXTA 5AC8A 3ITCA 4IQEA 1LUCB 3LCGA 4PCFA 3MI2A 3TOYA 1AODA 3Q4DA 5JBEA 2ZZ4A 5DMMA 3K2GA 3IGUA 4JTTA 2NXGA 7CGTA 4GI6A 1PE1A 2D73A 4QITA 2WC7A 3GW0A 2CBVA 1VQTA 4LX4A 2BDQA 3L65A 1OF8A 4BI5A 4A8NA 2DSUA 3KXQA 2Q8XA 4RE0A 3R10A 3VGBA 5JXQA 5FJPA 1HFBA 1OG6A 3MDWA 2V67A 3SQLA 2OTDA 2EKCA 3GNPA 5HDRA 2HEJA 4ZOBA 1Q7ZA 2INZA 5I00A 3PZUA 4H2CA 4Z2GA 2NUYA 4DNMA 3GTXA 1F7BA 5AN7A 5KINA 1S3TC 2POTA 4IFRA 3S3GA 4C6IA 2ISDA 3SRDA 2P0OA 1RR2A 1US2A 3B4UA 3WQCA 3PZNA 5FCZA 2PDUA 3LQGA 4WF7A 2E9BA 4IF2A 4UTWC 3VDAA 2XH4A 1DXEA 1US3A 4EIVA 4C7FA 2JKAA 3CIVA 1GG1A 1E3XA 4Z42C 1PVNA 3WMLA 4JIEA 3IK4A 5DY2A 4CUCA 3QSRA 1IXPA 4DJEC 1OF6A 2D3LA 4PBFA 3PJXA 3NL3A 5HMEA 1RJQA 2WMKA 4F0LA 1TPC1 3U7BA 3QV8A 2WSPA 4OE7A 4DJDD 1XCXA 3UT0A 1W5PA 3VO0A 1FXQA 2C15A 1J5TA 4C60A 1V4YA 2GJNA 4FR6A 4LCSA 1M6JA 4W89A 4RX0A 4EKJA 3AALA 4HZMA 2ASHA 1NVMA 1XINA 2WMHA 3PG8A 3NGJA 2W67A 3WQDA 3OA3A 2PP0A 4O50A 3O16A 4IXHA 1TA3A 2KX9A 1KCLA 4JIRA 1DQXA 1EJRC 1TV2A 1VP5A 1GYNA 5J04A 4Q33A 5EPDA 3RR1A 1QK2A 4JL2A 3QOMA 3HOJA 4Q8UA 2V8ZA 1IZCA 3RO8A 1YDOA 2Q02A 3OGVA 5H8UA 1W1IE 1QHOA 3L68A 1DE6A 1E0XA 1J0ZA 4AX7A 3GDMA 2OR2A 1IV8A 1XIMA 4MWAC 4OTKA 5EBAA 1NDYA 3DFOA 1TV8A 1YNYA 5D9PA 3RUBL 1J11A 1FX6A 2FVKA 1A5CA 5K2ZA 3UA4A 1HIZA 4HD5A 4H9TA 3UWZA 4GI9A 2OKOA 5IDZA 3RN6A 4LS0A 1Q4NX 1W6TA 2ZUMA 3CNYA 4LAUA 1LT8A 4DX3A 3QYQA 1SJCA 3KTSA 2VWTA 4N02A 1NOFA 1H7XA 3LNPA 4AVNA 3G18A 4JQAA 3WFZA 3N9RA 4O1CA 1V0MA 2HS8A 2VOMA 3N25A 1H5YA 2BB0A 1ZJBA 4AYSA 1T7LA 5F2MA 3G6LA 4I7UA 3OGRA 1W17A 1ZAJA 5BMWA 1P6WA 3T1GA 3PZIA 2VZVA 1L6SA 3LOTA 5AOUA 3M0ZA 1XRFA 3GDLA 4NZFA 3UWEA 5IBXC 4EANA 3TN6A 3IRDA 2ZDRA 3WJWA 5BU6A 4HPNA 3LRLA 1LP6A 2GGGA 4B3KA 3VGHA 4GI4A 1DJNA 2DZPA 1MW3A 1DVJA 1ZJIA 3OOQA 2HWGA 3WDRA 1WPCA 4CD5A 2IQDA 2AMGA 2QNEA 1Q7MA 3ZSSA 2R9RA 5BROA 4UTTC 4V1YA 1SSDA 1YPIA 3K4AA 5FF7A