3IRSA

Crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
281
structure length
281
Chain Sequence
LKIIDFRLRPPAMGFLNARIYTRPDIRNRFTRQLGFEPAPSAEEKSLELMFEEMAAAGIEQGVCVGRNSSVLGSVSNADVAAVAKAYPDKFHPVGSIEAATRKEAMAQMQEILDLGIRIVNLEPGVWATPMHVDDRRLYPLYAFCEDNGIPVIMMTGGNAGPDITYTNPEHIDRVLGDFPDLTVVSSHGNWPWVQEIIHVAFRRPNLYLSPDMYLYNLPGHADFIQAANSFLADRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKILHGNAERLLAQAGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UNCHARACTERIZED PROTEIN BB4693
publication title CRYSTAL STRUCTURE OF UNCHARACTERIZED HYDROLASE FROM Bordetella bronchiseptica
rcsb
source organism Bordetella bronchiseptica
molecule tags Structural genomics, unknown function
total genus 106
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3irsA00
3ISIX 2ANUA 3EGJA 4EPDC 4D8LA 3KM8A 3PBMA 4F0SA 2WJDA 1RAKA 3OOQA 4HK7A 3RN6A 3DCPA 3QY6A 4WGXA 3E38A 1PO9A 3B0XA 4LFYA 4LANA 3GRIA 3FDKA 1KRAC 3LSCA 4B91A 1J79A 1M65A 4LAKA 1ITQA 1K70A 1GKPA 3LY0A 1RA5A 2YB4A 4C6MA 2EG7A 1FWEC 1KCXA 2R1LA 3F2DA 2PGRA 3A3XA 2VC7A 2ZC1A 4QS6A 2P53A 4ZSUA 1FWAC 4INFA 1S3TC 1EJWC 4IG2B 1EJXC 2D2JA 3PNUA 3E0LA 4H9TA 2EG6A 1WXYA 4IQJA 1O12A 1PB0A 1POKA 4KF1A 1FKWA 4HJWA 1JGMA 3O0FA 3WZ0E 4JOMA 3TN4A 4C60A 3HTWA 4J5NA 3CJPA 2Z7GA 4LEFA 4H9UA 4KIRA 3LGDA 1XRTA 3V7PA 4KQNA 4ERAA 3GU1A 2UZ9A 4HA0A 2Z00A 4GY0A 1YIXA 1KRCC 1NFGA 2D2HA 1ADDA 4DIAA 4C5ZA 3EWDA 3MVIA 1KRBC 2VM8A 3B0YA 4C6LA 1YBQA 3MSRA 3B40A 3AU6A 3MTWA 3E2VA 4IF2A 1NDVA 3NURA 1POJA 3D6NA 4GX9A 4P5UA 4C6NA 4EPEC 2IMRA 3E3HA 2OB3A 3FEQA 4GXWA 1V7AA 2GZXA 2AQOA 3RHGA 4KETA 4QRNA 3E74A 4PE8A 2YZ5A 1R9YA 5LXXA 3DUGA 1ZZMA 2D2GA 3F2BA 3RYSA 4LAOA 1XWYA 1E9YB 4IGMA 1A4MA 4QSFA 2QVNA 1FWFC 1RK6A 3MPGA 4TQTA 5CH9A 4G7EA 4GZ7A 4KEVA 3S4TA 3T8LA 2QS8A 3LGGA 1EJTC 3FDGA 3AUOA 1E9ZB 3SO7A 1A4LA 2R1NA 5FSDC 3T81A 4F0LA 2EG8A 2HNHA 1P1MA 3CAKA 2FTYA 3T1GA 1FWBC 2O4QA 4XD4A 2AQVA 3JZEA 3OJGA 4KESA 4RE0A 4CNTA 4ERGA 1A5KC 3K5XA 4QTGA 2VR2A 2QT3A 2Z29A 2R1KA 4H9YA 3DC8A 1V77A 1RA0A 1P6CA 4R7WA 4IFKA 1J6OA 4LAMA 1EYWA 2Y1HA 4C6CA 2F6KA 1YRRA 4HK5A 2Z2BA 4CEXC 1FWCC 4DI8A 1UMLA 2FVMA 4XAFA 4CQCA 1FWJC 3UR5A 4H9VA 1GKRA 1A5NC 3F4CA 2FVKA 2Q01A 2Z27A 4B92A 3IJ6A 3OU8A 4LALA 4RZBA 3S2JA 4GX8A 2GOKA 1BF6A 4J2MA 4BY3A 3TN6A 4CQDA 4RDYA 4GY7A 4LCSA 4DI9A 3IPWA 2OOFA 4B3ZA 2PLMA 1W1IE 2UBPC 3S2MA 1QW7A 4ERIA 4V1XA 5HMDA 4XD5A 1YBQB 4GK8A 4DZHA 2E25A 3N2CA 4C6FA 4QS5A 4EPBC 1GKQA 3GIQA 2PGFA 2OQLA 1XGEA 4DNMA 3OODA 1RJPA 1V51A 4NP7A 4C6EA 3CS2A 3IV8A 3RCMA 3TN5A 4YIWA 4C65A 1J6PA 4BJHA 2HBVA 4H9XA 3IGHX 4HK6A 4NI8A 4DLFA 4J35A 1PTAA 4PBEA 4G7EB 4EP8C 2GSEA 4E3TA 3E0FA 1V79A 4GYFA 3K2GA 1EJSC 2I5GA 2Q09A 4CQBA 3PNZA 3TN3A 1M7JA 1EJVC 4GOAA 4IFRA 5G4HC 4DO7A 3F2CA 3QY7A 4CNUA 2KAUC 4LCRA 4H9ZA 3WMLA 2HBXA 3NEHA 3TNBA 4GY1A 4PBFA 4B90A 2P50A 1J5SA 3O7UA 4CEUC 4BKNA 3GG7A 3LU2A 4KEZA 4F0RA 3URAA 1O5RA 1EF2A 3LS9A 1I0BA 4G2DA 1HZYA 2W9MA 3MJMA 3GUWA 2WJEA 3GU9A 3BE7A 3OQEA 4IFKB 1RK5A 4H01A 2OODA 3LNPA 1UIPA 4MUPA 4H00A 2PUZA 3ORWA 4LH8A 3K4WA 1EJRC 3PAOA 4GC3A 4C6DA 2R1PA 4C6KA 2RAGA 3ICJA 3URBA 1NDZA 5E5CA 1UIOA 4KERA 4XD3A 3GU2A 4IFOA 3MVTA 1VFLA 1K6WA 2E1WA 4DLMA 4H9MA 2BB0A 1FWGC 5HMFA 1R9ZA 4I6VA 4ZSTA 1A5MC 3GTHA 3PANA 1FWHC 4LCQA 1A5LC 1QXLA 1V4YA 3C86A 4R88A 1I0DA 4L9XA 3S2LA 2ADAA 4DZIA 2XIOA 5HMEA 2WJFA 3MDWA 1XRFA 2Z25A 1PSCA 4C6OA 2PAJA 3ITCA 4WHBA 2AMXA 3F4DA 4IH3A 1NDWA 2GWGA 3IARA 3QGAC 2CZVA 2DVUA 2YB1A 3URQA 2Z28A 2HQAA 2FFIA 1RJQA 3UPMA 4XAGA 4C6IA 2HPIA 2Z4GA 2A3LA 4Z42C 5AKQA 2Z2AA 1M68A 3LA4A 1ONWA 1YMYA 2I9UA 2OGJA 3UF9A 4GBDA 3GTIA 2DVTA 1DPMA 3LSBA 4UB9A 2GWNA 4IGNA 3GIPA 2YXOA 4C6QA 1FWIC 1IE7C 1EZ2A 2R1MA 3UBPC 2VHLA 1NDYA 4RDZA 4IG2A 2Z24A 3QGKC 4V1YA 3UR2A 2VUNA 1ONXA 2VC5A 4AC7C 2G3FA 2QPXA 2DVXA 1KRMA 3QY8A 3MDUA 1ITUA 4ICMA 3IRSA 3HPAA 4C6PA 3WYZA 4OFCA 5FSEC 3R0DA 4AQLA 3NQBA 4C5YA 3OVGA 4KEUA 2HPMA 3IACA 3GTXA 4XAYA 1FWDC 1WXZA 2Z26A 3A3WA 4NG3A 4XD6A 5A6TC 1P6BA 2WM1A 1EJUC 2O4MA 3AU2A 3SFWA 3S2NA 3HM7A 4C6JA 4XAZA 4WVXA 1K1DA 1RJRA 2BGNE 3MKVA 1FKXA 4RDWA 2FTWA 4QROA 3A4JA 4DYKA 4PCNA 4RDVA 3G77A 4I6KA 4C6BA 3URNA 2ICSA 3ID7A 4UBPC 1A5OC 3GTFA 4CNSA 4PCPA 4EPKA 4L6DA 1YNYA 1R9XA 4R85A 1UBPC 4M51A 3EWCA
chains in the Genus database with same CATH superfamily
1BYCA 5A6KA 1SZEA 1LUCA 1QWKA 1OBAA 1X1OA 4HK7A 3PWGA 1RUSA 2EPNA 1R85A 1KTBA 4CNOA 5KZMA 3RITA 4IUGA 3MP3A 3SURA 3GRIA 2VO5A 1REQB 1B54A 4F79A 1TPWA 1ITQA 1KFJA 1Q8AA 2D0GA 1EO7A 4LJ3A 1UUQA 2ZZ2A 2NQ9A 1ONRA 4S38A 4JKMA 2HRWA 3LPGA 2VC7A 3OG2A 1QK0A 2BVDA 1T6MA 4Q4PA 3V5OA 1WUFA 2JGYA 2AAAA 3AYTA 2P3EA 4HNOA 4MPKA 2VZVA 4JYFA 5BMXA 2QDDA 1MYRA 1H1YA 1KXQA 3TXVA 1YYAA 3M43A 3E0LA 3OVRA 3BOLA 1ZUAX 1BWKA 2YW3A 3GAYA 4LY4A 4AY1A 3OZOA 2YKKA 4PULA 3PWAA 4FNTA 3TN4A 4QNEA 2WMKA 3LGDA 4J3UA 3KLLA 1UZ1A 3NQCA 3HZ3A 3BAXA 3S5YA 1GGOA 1J2BA 3EEGA 4OT7A 4UOJA 3W02A 2WMHA 3TROA 3NUKA 5IFTA 1ADDA 4LNCA 4Z1DA 1KRBC 4UIOA 1GORA 3DHDA 4DJFC 3NURA 3SEPA 4JTCA 4FX6M 2AQOA 1XBYA 3RHGA 1DIOA 4P61A 4QRNA 3K8LA 2O0TA 3QKZA 3NEVA 5A8GA 5K3VA 4QDMA 2WKGA 4KEVA 5CJNA 5M17A 4HCLA 3ARYA 4E2DA 2DU2A 1TR9A 2W0UA 1V3JA 2YCKX 1YXDA 3QOKA 2FGLA 3J7HA 3P2VA 2C14A 2WSRA 3OLGA 4OWGA 3EDDA 4UNIA 5C9WA 3LCWA 3W71A 2FJUB 3GX9A 3QYSA 3AUJA 4DEFA 1XLHA 1OF6A 2B4GA 4JIHA 1BD0A 2WCAA 2F2KA 4W8BA 3VTRA 3RM8A 1WO2A 3BAWA 1L6YA 5HNUA 2W91A 2VELA 4HMEA 3TTOA 2VX4A 5AVHA 1RQHA 1I1XA 1AZ2A 1VZWA 3KZSA 3WH9A 3TW9A 2WC4A 4CQCA 2TRSA 1C92A 5JXQA 3T7VA 3ZWSA 2GJXB 1IF2A 1IHIA 3VZZA 2BTMA 6XIAA 2X7WA 4REQA 1ELSA 2VX7A 4GJIA 2GK1A 3WD4A 2ZQ0A 1UJQA 3PJWA 1RHCA 4OHQA 3NNTA 2DZWA 3SUUA 4JHOA 4XD5A 5LIYX 4JNYA 1W2VA 4AD0A 3PPGA 1MRAA 2GUBA 3L0NA 1BWLA 4AMAA 3P7YA 3ZR5A 2ZZ1A 1FHVA 1P6WA 2DZSA 2HBVA 3LOTA 2YCLA 4O53A 1M7OA 1VRXA 2ZRUA 4H04A 3ABQA 5FKYA 2QLYA 3E0FA 3VX1A 2ZXDA 1EQPA 2WC3A 1KGUA 2E9MA 1Y0EA 1Q6EA 2J78A 3SCSA 4Q6JA 2BASA 1OFAA 4XTDA 1K77A 4YCOA 1B1YA 1PVNA 3RRXA 5E9XA 4CCZA 3H55A 3AMDA 4OUEA 1FWNA 1QRQA 5I06A 3RFAA 4F2BA 1VEOA 2I17A 2PDMA 2ISWA 2YBUA 4J2PA 5DT7A 2O92A 1F8MA 1VBRA 1QI3A 4IIBA 2ALRA 5CCZA 3H2AA 5HJLA 3BJTA 3GU9A 1ZLPA 1F2JA 3BGGA 1RK5A 3TIMA 2OWXA 2OODA 3NQVA 1F73A 1AW2A 1UIPA 2E5CA 3BOXA 3W74A 3WX7A 4BA0A 1YXCA 3FYYA 4XQ6A 4Q8NA 1NY1A 1SM9A 4KERA 5J5DA 3GU2A 4PMDA 1LL4A 2VNCA 1K9TA 3AZSA 2J7GA 1G1YA 4M80A 2X16A 4UUIA 4BEQA 3W53A 3G18A 4JTRA 5HMEA 1SFJA 5I24A 3W00A 2Z25A 3DFSA 3DENA 3M64A 3BJSA 1G7UA 3VAVA 4BI5A 1KC7A 5BXRA 4FXJA 3NVTA 3H7VA 3UPMA 1D7KA 2WCGA 3BH4A 5AKQA 3W6YA 3UF9A 2DVTA 1DPMA 3INPA 2GWNA 4DPQA 3AHZA 3O06A 1OIMA 1UR0A 3H4WA 3UXDA 4PBGA 2NT1A 4IMFA 5E70A 2VEIA 4RJEA 4HT3A 3VGFA 4TVUA 4MPQA 1KWKA 2HSAA 2CWNA 2QEZA 4QISA 1XLLA 1V3IA 3N04A 3TSBA 2VGFA 3TAKA 4KEMA 3NQBA 2HPMA 1V6WA 4ZENA 1XRVA 3A3WA 4JKLA 1RXOB 2Z1SA 1PWMA 3EPNA 4UTHA 3QW4B 1F5ZA 4H8HA 4R5EA 3TK7A 4AB4A 2V5KA 3CIWA 5A94A 2QPUA 2XIIA 1AW5A 1OY0A 5FAGA 1S38A 1U83A 3A12A 2JEPA 2Y7DA 1SPQA 4LYKA 1TFVA 4ZZ9A 3ZLHA 8XIMA 4M7SA 3UY7A 2PDIA 4HQVA 3L4WA 4V27A 1LTDA 4YHGA 4PMYA 3B0XA 3VIPA 2RGMA 3P14A 1E71M 3IJ9A 4WIWA 4B91A 1S5WA 1TMLA 4E4PA 5BOEA 3E2QA 1GKPA 3CK5A 5D05A 2CFFA 3W24A 4JQ2A 1ZHAA 2FHCA 4I9TA 4XSMA 3EWWA 1L8PA 1A0DA 5JIPA 4BQ3A 3AXKA 1S1PA 2PS2A 3NM1A 2WKLA 3VIJA 3WEZA 2CBUA 3FV9A 3RX3A 1MZRA 2W67A 3FYOA 1TO3A 2OQHA 1ZENA 1CX9A 1R3YA 1C29A 2PLKA 2GDQA 4M1RA 5IBXA 3RX4A 3ITLA 3UZJA 1AMYA 5C6MA 2PGWA 2G3NA 4NXSA 3CPRA 1LM1A 3Q67A 4H9UA 2P3ZA 3CHVA 2F2HA 3LK6A 3OYZA 1ZJAA 5XIAA 1AG1O 3KRZA 1XH2A 3N3TA 1D8WA 4W4QA 3VIIA 1EB3A 3MVIA 1WQ5A 4M7TA 2IQDA 3N12A 1Q6OA 1AQ0A 1BGAA 4GVIA 1RQEA 4MSSA 2WSPA 1U1HA 4B15A 2X2GA 3TMQA 2GZXA 2QR6A 3RILA 1VYSX 3BSGA 4PC8A 3EWYA 2YZ5A 2A21A 1B9BA 3ARWA 1D7FA 1VHCA 4WJEA 3WNKA 4GZ7A 1MEHA 3A4WA 3AISA 2OTDA 1V3KA 3FDGA 3HPSA 3QZ6A 3MW7A 4DO6A 3CTLA 4IMEA 3ATZA 1A4LA 2HS6A 3R58A 3BGAA 2ZUTA 5AHMA 1E0WA 1UP2A 3UWUA 3ABRA 3HQOA 3LZ5A 2VEMA 4EF8A 4MTVA 3M46A 4MKSA 4Z2IA 4XTIA 2YA1A 5D38A 1IT7A 4XG1A 2DZPA 1H0IA 2OX1A 2FH6A 3LHTA 1XIEA 1AL8A 5D33A 2Y0FA 4IL2A 4KCTA 2I5IA 1GNXA 5HQEA 3AFBA 4F66A 1JCTA 3ITTA 3V16A 3GXMA 4PH6A 1GOXA 5F1VA 1CBGA 3ARQA 1F05A 3PC0A 1Q66A 1V3HA 5LNRA 2XH4A 2Y1HA 3W1NA 3KVJA 2BXZA 4ZR8A 4XZNX 1QBBA 5GNZA 5D2VA 5IDIA 3L65A 1M41A 1IZCA 1GKRA 1OFOA 5EY5A 1WKFA 4Q8QA 4LALA 2ALDA 3CTTA 3GVVA 3WEMA 4RZ5A 3K8KA 1Q6QA 3DH7A 4L1WA 4J2MA 4BY3A 1MXGA 4FNRA 3TN6A 2V3DA 1ME7A 3PAJA 4DNHA 1MRQA 3GNNA 1RQBA 5FOOA 2R82A 1SZRA 1DXFA 5CC6A 1Z6KA 4WGHA 1IXQA 3W83A 5I02A 1VBJA 1S5NA 3RCNA 2PZ0A 2Z1VA 1PKMA 2HEJA 6A3HA 1JUBA 4NYYA 3GXPA 4C6EA 5EMMA 3OW1A 2IUZA 1ZY9A 1LOLA 1O7AA 5HNNA 4HB7A 2V5LA 1PTAA 1TWDA 3EOLA 4S39A 5AYXA 4AHQA 1KBLA 1XJBA 2VQUA 4KMQA 2W4XA 3L0GA 3PJXA 4B5XA 5A1AA 4GOAA 4PB5A 4DO7A 3F2CA 4QCEA 3AHVA 3UY8A 1DXEA 3SUVA 4H9ZA 1UWUA 2IPGA 5BCAA 2V6AA 3WLNA 3MZ2A 3TNBA 3CIXA 1VLIA 3L2LA 3GBEA 1JG9A 1NOWA 3IVSA 4P7NA 3KHJA 5FD0A 3U57A 4PR4A 2P1FA 2W9MA 1VH7A 4NZCA 1H5VA 3V36A 4J1OA 1LP6A 4CQ9A 3A4AA 3BE7A 5EYWA 2CXGA 3BW4A 5D2YA 2DJXA 3GNXA 2GVJA 5DRIA 2A0NA 1A3WA 4ZODA 3WEOA 5C9XA 5EKYA 4AIBA 4IISA 1UIOA 3FX4A 4XD3A 2CBIA 2QJIA 3BLDA 4IFOA 4UOQA 4XVEA 1KFBA 3WQ8A 4YYCA 3T42A 5JMUA 4L4PA 3U8GA 3KFTA 2QNEA 4UTWC 4ACYA 1B31A 3QLDA 4C7FA 4HYVA 2QUVA 3B0PA 5T9CE 2V3FA 3GZ3A 4NF7A 2RGLA 2GWGA 3IARA 3H21A 4A8NA 4FNUA 4NRSA 1JZ8A 4Z17A 1E4LA 1GYMA 2Z1WA 4XAGA 4IMCA 3U48A 1RY0A 4ACZA 1UWTA 2FZDA 3PJUA 3R89A 3M47A 3QEZA 3ENLA 1TV3A 3VOCA 4K7YA 1V0NA 3I6EA 1Q3NA 2X8RA 4CUCA 3GIPA 9CGTA 3KCLA 1IE7C 1HKWA 3Q58A 2ZX9A 3W23A 3KBVA 1JPIA 3I6RA 4YWIA 5B80A 1O5XA 3M7SA 1LWJA 2YCJA 3MDUA 5IHSA 3N9SA 3T4WA 5I2UA 1OEPA 2YPIA 3NSMA 1GK8A 2YFOA 1F74A 1US3A 5A6SA 1H11A 1PIIA 5E6ZA 5A6TC 1FOBA 5JH2A 3B04A 4ZTYA 2G3JA 4DO4A 4FXFA 2DUAA 5FEPA 4PCNA 3ZSTA 4IXXA 4I3GA 3KBMA 3G77A 5FL1A 3U0HA 4I6KA 1QOXA 1NP2A 2WHMA 3CPGA 3DYMA 4NNCA 1Z32X 1SYTA 4J3XA 4QR6A 4ORMA 5LKYA 2PP1A 2DV0A 2WZTA 1C93A 5D2WA 3UERA 1H60A 2DQWA 1IEVA 2C0AA 2EJAA 2PRHA 2OEKA 5I07A 1GT8A 3I3EA 2WO5A 4Z1CA 3WLSA 3ZQ9A 3TQVA 3P62A 2PGRA 4K68A 1O1ZA 2BS9A 3PSVA 4KFNA 2RUSA 2OEMA 2QXWA 2ZFAA 3VCNA 4AZCA 1UR8A 3QF0A 3KAOA 2CLKA 2VR5A 4LVGA 1R47A 1HL8A 1E6QM 1C8XA 3O07A 4KFPA 2A3AA 4D6JA 4NZ3A 3VMOA 4JTAA 4KF1A 1C8YA 4I7VA 3SM0A 5IFPA 4LYRA 4MKVA 5M3WA 4AZIA 4HZ7A 1ZU8A 1XRTA 3V3WA 5LA0A 1I75A 1PAMA 3QLLA 3IIZA 1S46A 1TUXA 4ZB0A 3WH5A 3UA4A 3I3BA 2F7FA 5MF5A 4AVNA 4IIGA 2J25A 2QHAA 2XWEA 4HKPA 3WUEA 1XLCA 4FXRA 3C0LA 4NVTA 2VT0A 1OD8A 2GGHA 1O6IA 1V7AA 3AJXA 2AGKA 3NYDA 3N4EA 4KETA 5BROA 5CPLA 2QJGA 3R43A 3FEMA 4GVFA 1M9HA 3HGJA 1E43A 3C0QA 3PR2A 2GJNA 1JRBA 4PMOA 1A4MA 2PDGA 3MPGA 1OYCA 2V5JA 1KLYA 4L9ZA 4AIEA 2XN1A 2WVUA 3PTDA 1XR2A 2XM1A 2IPJA 2O7SA 3JUGA 1E9ZB 4PEKA 2ZWZA 3EX3A 4J4KA 3LDVA 1E6PA 3N73A 3PWIA 1I2PA 2E6YA 2B0MA 3M7WA 2BNJA 2FHFA 3AWOA 3OJGA 4JTJA 3AICA 2O7QA 3V18A 2JIEA 2R1KA 1GOKA 1V77A 2NVDA 1UR9A 4JAWA 1JFXA 1FHLA 3MUXA 5B7YA 3U2EA 1KBJA 3W0KA 4EWJA 2ISDA 2OO6A 3M0XA 1F3EA 2E6AA 4J40A 1I6NA 4CVUA 4Y6GA 3HG3A 3DI0A 1PKYA 3H23A 1MUWA 1JPKA 1KB3A 1BYAA 2HXUA 1S2VA 4GY7A 3SIMA 3QYQA 2PLMA 3PPCA 3CEUA 4CCCA 4C1NB 4S3EA 2D24A 3OZYA 4AC1X 3HPZA 2VFIA 3WF1A 3ZJ7A 1Z48A 1MEWA 1XIJA 1DHKA 1L6SA 3UJRA 4GI4A 2NV2A 4WDUA 4AUBA 2E28A 4PRWA 1V5XA 4QE1A 5FEXA 4PMXA 2X1UA 5DY3A 4MADA 3SRKA 3VD7A 3T0AA 1M7XA 4Z1BA 1C9WA 1TTPA 3N11A 1CYGA 1GVYA 3LCIA 1CXLA 2P50A 1UROA 3DGBA 5HULA 2QKFA 1A80A 4PRRA 1CGVA 4G2DA 3NVDA 4FLSA 2HDJA 2Y8KA 3TYZA 5TF0A 3ALGA 2EQDA 3Q45A 2XFWA 5AYZA 4NL1A 2WSQA 2INEA 3RCYA 1JZ7A 3TTSA 4ZO9A 2ODOA 2RDWA 4GC3A 2B31A 1XG3A 3BV4A 1ZBCA 3LERA 2H9AB 3G1HA 1UH3A 4H8NA 1NDZA 3OBKA 3C4UA 1OIFA 3MVTA 4CNNA 4HU8A 3A24A 1TWWA 3NSNA 4NJIA 4U28A 3QTPA 4C1LA 9XIAA 2CXEA 1A5LC 3W2MA 4GIRA 1QXLA 4ZQPA 3OTRA 1OFBA 3BG3A 2C18A 3T55A 4C90A 4B3KA 4YXGA 1B3WA 2WJFA 1TV2A 2YL5A 3B9NA 2PDCA 3IVUA 2O55A 1MZHA 5CQ1A 3WK0A 4JY8A 3QGAC 2CZVA 2YB1A 4IIDA 1QI0A 3C2YA 2F38A 3UW6A 1NM9A 4Z42C 5GNXA 2DSKA 4MNMA 1EIBA 3GTIA 4JIQA 4UB9A 1XLJA 2J7FA 4JN8A 3W7EA 2D1ZA 2ZUMA 5G4EA 3H6OA 5CC3A 2VHLA 3ATYA 1UZDA 3M0HA 1QO2A 2Z24A 4O4WA 2WHKA 4H1ZA 1KM6A 3ARRA 4BF7A 1H7XA 5AC6A 2WPGA 2PGEA 3TYAA 3WBWA 4CN1A 5I78A 2NXGA 1FH8A 1KW1A 4JQ3A 3W7NA 1UMYA 2YJQA 2ON3A 5G4WA 2RH9A 1FWDC 1GUVA 1HJQA 3E2RA 4FPSA 3OIXA 4O4VA 4QLKA 4DBUA 4UFMA 3AU2A 1HT6A 4W5UA 2QUTA 4YVXA 5HWMA 5I3KA 4AIOA 4X60A 2XZ7A 4E4FA 4C7DA 1FHDA 1DJGA 3A64A 1KD0A 3NO3A 2VXNA 1CXEA 2F6UA 2VCCA 3T2PA 1W9XA 4HPJA 5FJJA 4ZTXA 4GYJA 3VINA 1YQ2A 1JFHA 1UA3A 3AIBA 4K37A 2ANUA 4RNHA 4EK7A 3O9NA 4GC4A 4MY1A 8A3HA 3MO4A 3LPOA 1RAKA 4YNGA 2P5NA 4ZXOA 4U2ZA 5I3DA 3I7RA 3L5LA 3C8FA 4DF2A 2A85A 3DU0A 2YZRA 3W7GA 3WQPA 3CEPA 3WIJA 2ZTJA 3BSMA 4NZ1A 3OA3A 1V02E 3CH0A 1VFSA 1VBUA 3SW6A 3CLWA 5DMNA 2BXVA 3VNZA 1E0XA 3TW7A 1DJYA 5FL0A 4GIEA 2ZUNA 3S9IA 2RKXA 1JD7A 4M6QA 4INFA 2J7BA 4KGJA 4S3KA 3L4XA 3FOKA 4Y96A 5D30A 1WXYA 4L64A 3IGXA 4S23A 3CHFA 2NSXA 1M7PA 3OQ8A 1EC7A 2QCMA 3KBNA 4AMCA 1PDZA 4RR4A 3TJIA 1WYIA 5B7ZA 1BVWA 4PMUA 4GFSA 4DF1A 3POCA 4X61A 4ZL1A 3UWVA 2Z00A 4L80A 3F5LA 2GJPA 4PFMA 2DJLA 1YIXA 3M4HA 4B16A 2YDSA 3JU2A 4P7OA 2DIJA 2PLCA 3B0YA 4XAPA 4GIYA 3OG3A 3EX1A 4Y90A 3S5NA 4QCFA 1KKOA 3D6NA 4RPQA 4WJ8A 1QNSA 3EB2A 1EIXA 3R0KA 5EU9A 1ZSXA 2OB3A 4GXWA 2RDUA 1VCGA 1SJDA 1W3KA 5CSUA 4HPXA 1RV8A 4H4IA 5IBXC 2J7EA 1XDLA 3GLCA 1O95A 1KM1A 1E51A 1SR0A 3NZPA 4MKNA 3DG7A 4HIBA 4NNBA 4K3ZA 2YGYA 3M41A 4DJDA 3WFAA 4E3VA 3FXGA 3DYPA 4DWSB 2FTYA 3MWCA 3V1PA 4ZQOA 4WDWA 3BUVA 1HL9A 5DCBA 1XCFA 4ZOCA 3K5XA 3P61A 4B5WA 2F6XA 3DC8A 3I68A 3ZR4A 1TVPA 3AXMA 3BLIA 1H61A 3DERA 1V3MA 2WZIA 4AEFA 4JNMA 2QCEA 1GZ1A 1LT7A 5FEZA 3HMJG 1N8WA 7ODCA 5KEZA 1MW2A 3ZJ8A 3NQ8A 1NF0A 5KZEA 3N19B 3BMWA 4W93A 1E1EA 1DP0A 3H4GA 4W9TA 4JTHA 2POZA 4XZ9A 1V0MA 1XSJA 2J9XA 5A6BD 3RM9A 3IPWA 1I2QA 4DAIA 2GGGA 2OXNA 1WZLA 3E0IA 1M3UA 3THQA 1BXBA 1XW8A 1QO5A 4UCFA 2SFPA 3VCCA 1E70M 1XGEA 5FESA 2NWSA 1P0NA 2JGQA 1B2YA 3CQIA 4MLJA 3IWPA 4HD5A 3TN5A 2XZ9A 4Z2HA 1G94A 3W1QA 4DLFA 1MQPA 1E0VA 1S2UA 5HR6A 4Z0SA 3NQGA 3ZJ6A 4PBEA 4GH3A 3VOJA 1R87A 2HE5A 4WX2A 3K2GA 2Q8ZA 3MCMA 3WBEA 4IFRA 1FWRA 1GPFA 5BOFA 2Y5EA 4D1IA 5EB8A 3SY1A 4CNUA 3QV6A 1H09A 4J3SA 1GTHA 1YW1A 3R8RA 3Q2DA 3KZPA 4KW2A 5REQA 1H49A 1VGAA 1HKIA 4BKNA 3KHDA 3UJSA 1HZYA 2IKJA 2JIWA 2CIPA 1H3GA 3LM3A 1V93A 1JAEA 1FX6A 5I3FA 3G8EA 1OX4A 3VMPA 1Q6CA 4C6DA 2VYOA 2ZX5A 3HPXA 1TJ1A 4HPNA 2E1WA 4O0ZA 3I6TA 2YL8A 3P5YA 4JFUA 3FA3A 4JCLA 1Q4NX 3H2OA 3WNMA 3W38A 2ADAA 4HBKA 3P67A 2XIOA 1XRFA 3CUGA 2QW5A 3L5AA 3DBNA 3LXAA 4D6IA 3FJ6A 2CLIA 4ZMGA 3C5QA 3KBWA 3IIXA 3N3MA 1K7EA 1ZRQA 1R6WA 5C9RA 1TZ9A 3MSGA 2GLKA 3S0CA 4RE3A 1EP3A 3CO4A 1S5TA 2DPEA 3MHFA 3CIVA 2CBVA 2YXOA 1FWIC 4CCEA 2AL2A 3MV11 1IEIA 3REQB 1GOQA 1XIHA 3VFLA 1ZGDA 2YXGA 2CCRA 3N4AA 2HNEA 2OEJA 1Q7QA 2MANA 5CLTA 4ATWA 1PZ1A 2V63A 1TPFA 1ITUA 3SECA 4JEJA 3SUWA 2V81A 4ZOAA 3W7JA 4AQLA 3N34A 2R24A 1XG4A 5TAOA 2Z26A 5H2ZA 3K8MA 3T40A 3FS2A 4C6JA 2XPKA 4XAZA 3VE7A 4RXGA 3MKVA 3UZ5A 1JIBA 3QTGA 3A13A 1NH6A 5E0CA 3URNA 1V0LA 5M03A 2QYGA 2HVOA 4CNSA 1TR1A 3N29A 1PX4A 4KH2A 3QW3A 4GGBA 1OJXA 2D3LA 2R6OA 1L6WA 5G1MA 4O19A 3LEPA 2KX9A 3MO7A 4Q7NA 1XBXA 5EMLA 2Z2UA 2AL1A 3QM3A 4XIMA 3SI9A 3ARPA 2V5BA 4EOUA 1J12A 3QY6A 2OGYA 4U5KA 4YJ5A 2WQPA 5G2HA 4IMAA 1EWEA 2PF8A 3ZT6A 3BOFA 5E09A 2OPJA 3HG5A 1J79A 2JK2A 3GK0A 3LV5A 4Q7IA 1J0IA 3IIVA 2ACRA 4GJJA 4DN1A 1WBJA 4W8AA 3H2MA 4JTLA 1XLDA 3A3XA 3DDMA 2VR4A 4JTKA 2P53A 5D8ZA 1E56A 4ZSUA 3U2OA 2BLEA 4F9DA 2QV4A 2BGSA 2PDLA 1EBHA 2AMGA 3ZXWA 4XZIA 1KFLA 3AMLA 5G2IA 2OCZA 4PSRA 4KWVA 2W79A 2FIQA 1TRIA 1F7BA 4URIA 3G1AA 3LLDA 4F2UA 4S3BA 3LRKA 1AZ1A 2BVYA 4O15A 2XGIA 2NUWA 1TPC1 4GY0A 2OU4A 1X97A 4K38A 2VCAA 3ABXA 2QV5A 4H8UA 1LRNA 2NV1A 1UC5A 1A5AA 1PWLA 3P80A 2D69A 1QASA 2V3EA 3MSRA 3E2VA 5EFDA 1K9EA 3QHOA 5A2BA 4HNVA 3CH9A 3FEQA 5LZLA 3OVPA 1J96A 1CXKA 1I9CB 1YTDA 3IEBA 1PIGA 1QOQA 2OSWA 4HN8A 1GW9A 4JXCA 1TX2A 5EA9A 5CGTA 4G7EA 1HG3A 4UTTA 1ZAHA 1XCWA 3LGGA 3RNDA 1TPEA 3EWUA 3GR4A 1BGGA 5KSWA 4W7WA 3ZMRA 3PFRA 1QNQA 2CW6A 3C52A 1CXFA 2Y85A 4PMNA 3VD4A 4D6CA 3EX2A 3MUY1 4RE4A 3F5JA 4AD1A 4LQ1A 4UMAA 3DESA 3AYVA 3KBSA 1OCBA 7REQA 4AEEA 2QUMA 4DO5A 2D22A 1W37A 3KOWA 2ASHA 1YE6A 3PZUA 2CPUA 4DI8A 3E12A 2CWXA 2BBFA 3WMSA 5A6JA 3BLFA 5TD4A 1QNVA 1F9CA 5DMYA 3GXFA 2BVWA 2G4FA 4LS2A 2VI0A 1E0TA 3JVAA 4DZHA 2ZXQA 5CPQA 3NXLA 1IXPA 4QS5A 5CLWA 1XBVA 3W7IA 2FDMA 2PP0A 4CU7A 1WE5A 1SUXA 2P76A 2Y89A 4GVHA 1NARA 1QBAA 3T08A 4HK6A 4NI8A 1XUZA 3TOYA 1HFBA 1GTEA 1UQZA 4GZJA 1ODUA 4QFUA 4OOUA 1FWWA 4WQ6A 2GSEA 1DJWA 1MMFA 2H3BA 2QCNA 1GONA 4CQBA 3WQVA 3TN3A 3A5VA 1ZFJA 4W84A 2WJZA 1GHSA 3NPVA 4DJED 1E1CB 4ES4A 2X1RA 2E77A 3QV9A 4XKMA 1AA1B 2ZRZA 3NSXA 2PF0A 4CEUC 4F0RA 1UC4A 1Q65A 3W2UA 3G1XA 1QPRA 4IWWA 3FJLA 2WKJA 3WBYA 3W25A 3L12A 1H7NA 5FF3A 4H01A 2VFDA 3S6OA 3PZGA 4IGSA 3ARZA 1TWZA 1SO4A 1JCXA 3K13A 1SMAA 2R1PA 3K1DA 3ITOA 4HU4A 4R33A 2PP3A 1XYMA 4QJ3B 1OFPA 2Y62A 4DQWA 4NSBA 4DLMA 3W27A 2WYSA 4HNCA 2DSVA 3WLHA 5J8LA 2A1YA 1MWOA 1IXOA 4DZ5A 1LOSA 3PBWA 3GXIA 2REQB 4MGGA 1L2UA 3DHPA 3WQ5A 3CWOX 4UTFA 2VEGA 3ABZA 4IH3A 1SU5A 2DVUA 5I03A 4Q22A 4XZWA 1NIUA 4LYPA 1R8LA 1X1ZA 1W9VA 5CG7A 3WK3A 2HPIA 2Z4GA 3A4XA 3APGA 3IAPA 2QGYA 1X6LA 5CZTA 4DHGA 4FK9A 5EBUA 1EZ2A 3LQLA 5D9MA 1NDYA 4IG2A 4V28A 1BPLB 2G8ZA 5LIXX 3QGKC 5BU9A 1KFKA 4I9JA 1OYBA 3UGVA 1Z41A 1KRMA 3PZNA 4OTKA 5C0QA 4MB4A 3PVFA 3U7VA 2BZNA 4WY0A 2ZOXA 4HSOA 4FI4A 1XYLA 4ZGYA 3GFXA 1VB9A 1CI1A 2QMJA 4CGTA 1AH0A 3LRLA 4NZ4A 1OGGA 2QJMA 3GW3A 3G6MA 4J27A 1WXZA 4ML4A 3UU0A 1AFSA 3ANUA 4XD6A 4M0XA 2WM1A 1EJUC 3A22A 3HM7A 1DBTA 1JJKA 3FVDA 1CGWA 4WVXA 3UJFA 1HGWA 2ZA1A 2V82A 3A4JA 4RDVA 1QCWA 1EEXA 4ZCWA 1SGJA 3WCZA 3KRBA 1JDEA 1ME8A 3KOYA 3IJIA 1VLWA 4IMDA 5C2GA 3C2VA 4Q6XA 4N9DA 5K9CA 4F0HA 3GBDA 3EWCA 2X0SA 1A3XA 3KDNA 4G8TA 1V6TA 1CXHA 4L61A 4O14A 3OOQA 1E4IA 3SB0A 1PO9A 1GQNA 3DOPA 4K8EA 2OVLA 4BS0A 3MJYA 2OKTA 3R8GA 4YPJA 3N9RA 4CCDA 2YDQA 1QPKA 3ABSA 2YLAA 5AFDA 1FP9A 3QKEA 5IHRA 5CZKA 5AC5A 1FWAC 1D3CA 4W7VA 3S5ZA 5CPOA 1QPQA 3CUIA 2WNZA 4H9TA 3PHAA 1OC6A 4HOZA 4J3TA 1PB0A 1D3GA 1FUYA 1PZ2A 3WNPA 2PDBA 5BRBA 3O0FA 3PP7A 3AIEA 4D71A 2VEFA 3EOOA 1EX5A 4FX8A 5U4NA 1RVKA 2XDFA 1J4EA 4JN7A 3VA8A 3MUIA 5G2WA 1KO0A 3CPUA 3CM4A 3N25A 3NOYA 1VEMA 1QHOA 5EMYA 1H0GA 1TV8A 1NDVA 1POJA 5DF0A 1QW9A 4P5UA 4UXDA 4EPEC 5FF2A 4XZMX 3WQFA 1NP0A 2ESCA 1T8QA 3STCA 3E74A 1UP3A 1F3WA 1VBHA 1PJ9A 1R9YA 2VZSA 1OZQA 3U4FA 1BAGA 5I3HA 2ZX6A 3WNLA 4GMEA 3AJ7A 5ECVA 1FWFC 1RK6A 4R9OA 6ENLA 1LJYA 5F1UA 2WMIA 3BCFA 1EJTC 5DBTA 3VFCA 4Q33A 1XLKA 1OHLA 4P2VA 2PE4A 1XRSA 4EXBA 1A5BA 1Q2SA 4GCAA 1SSGA 2ATMA 2Z1BA 4HMDA 1FWBC 1EOMA 1DWHM 2J74A 1US0A 3QPZA 4JIRA 2BODX 1C90A 1MNSA 3HGOA 1YPFA 2D2OA 3RRAA 4BQ4A 4A3RA 4AD5A 3M5YA 4KCWA 1EC9A 1YRRA 2YW4A 4CEXC 3EDFA 3OA5A 4ZFCA 3H53A 1KR0A 2JKPA 3QR3A 4NRRA 2ZZ7A 4PSPA 3UR5A 4UOZA 2AGTA 1UWRA 4ZOBA 2E40A 3EXSA 4B92A 1SZGA 3C8NA 1A0CA 2J75A 1OX5A 2OX4A 4DJDC 4YTTA 3M5XA 4WUIA 1W1IE 2PWGA 3DX5A 3VNYA 2VX5A 1ITCA 2V5DA 3G1RA 3B9OA 2E3ZA 3DZ1A 5CGQA 4X0VA 4EPBC 2VL4A 4LRTA 2GGJA 4AEOA 3VO0A 2CLFA 1B3VA 4C65A 5A2CA 1J6PA 4Q3MA 3T05A 1Q85A 2VC9A 3VGBA 7PTDA 4B4HA 4LBRA 1HKKA 3QMSA 3B8WA 2TPSA 1EJVC 5G4HC 3RUBL 3GXTA 4TUFA 3W7RA 3CXOA 3WJZA 3VE9A 4FX7A 4R27A 1BRLB 1Y65A 2BOFX 3KWXA 3GC2A 5I7GA 4FZIA 1V0KA 2X1TA 2IXVA 5F7UA 5DMMA 3EA1A 1KR1A 5EL1A 3SZ8A 3ZVHB 1R7AA 3OHIA 1YNPA 3HF3A 3NZGA 3EXTA 3RJYA 1UBSA 1Q5MA 1QDSA 1HVXA 3ZFHA 1M01A 3K4WA 1OX6A 5GPRA 3TTQA 5CG0A 3GNDA 4C6KA 4QDPA 3PBUA 1HO1A 1NQ6A 3ZOAA 2GQ9A 2DT0A 2QULA 1K6WA 3TWBA 2BB0A 3SY8A 4NU7A 3TH6A 5IRPA 3PUOA 3L0KA 1XLEA 4P8XA 3IV3A 4FNPA 4EIVA 4X2RA 4L4OA 5C9ZA 1PEZA 1K4HA 1NWSA 4CKQA 2DT3A 3S83A 2PAJA 1FXQA 2PSNA 2VMFA 3LHYA 4FOKA 3WF2A 2GFTA 4J3ZA 1CZ1A 1MI3A 1Q8JA 3CL7A 3W7QA 5CZSA 3MZNA 3O6DA 3DIPA 3W7KA 3U2CA 1RPKA 2OELA 3Q65A 1CNVA 1UD2A 6TAAA 1YTKA 2WLYA 5FAJA 3M0MA 4HZ6A 1FY6A 6REQA 2QZRA 4L5ZA 5DRCA 3EMZA 2L5HA 3QSRA 4O0KA 3F1QA 3EEZA 4KFOA 3D0CA 1E0UA 1MNZA 5T91A 3R1ZA 3S9ZA 3GSMA 1AJ0A 4TXEA 1G01A 5BNKA 5FSEC 4RNJA 4HZ8A 1VAHA 4C5YA 1ESWA 3LX9A 2E6DA 3HOJA 4KCUA 4JTIA 5HBFA 2CZFA 3R2GA 1V6YA 2EKGA 2PEVA 3BW3A 4WEVX 2P0IA 3OHMB 1HXJA 2I57A 3RM4A 3E0WA 4MM1A 5DANA 2ZIDA 4UZSA 4Y9MA 3EZ4A 1BQGA 2CHRA 3UNDA 1SO6A 5K7JA 2PODA 4JTDA 4ZB2A 3ALFA 4XBSA 3THAA 2YBTA 4LVBA 3WY1A 1H7OA 4LS0A 1B3OA 3ZLGA 1RBAA 4D8LA 1FDZA 3W75A 4GQBA 3PPHA 3LXBA 1DJHA 3E38A 4NAFA 3KL5A 3NQ2A 1JYWA 3FVMA 4LANA 3QR1A 3KOXA 4V33A 4PUMA 2DSZA 1KRAC 3LSCA 3KL0A 1M65A 3C6CA 3FGCA 3R10A 4I5RA 1K9DA 1E4MM 1UYQA 1XLFA 3P60A 4H19A 1GOOA 5CPSA 3OIHA 4QJ5B 2PRMA 4NZFA 5A8PA 4UQCA 3U3HA 3CNYA 3T6CA 2DZTA 1TA3A 3W87A 1E73M 2D2JA 4P8WA 3VD9A 4QG9A 4UFIA 4LS1A 1JPMA 4QIUA 2CLPA 4US5D 4BR1A 2MNRA 1ISVA 1KWGA 1R3WA 3PK7A 2J62A 1PUDA 3HTWA 4JTQA 2Z7GA 1GJUA 4HTBA 1V6VA 2OFJA 1QNRA 4KQNA 3CAVA 2YR1A 3STFA 1DVJA 4CLMA 3F4VA 4M6UA 4FNSA 2XSAA 1ECQA 1UG6A 3CB3A 1GG0A 5C2CA 4FSAA 4AZ6A 2FZ8A 4FR6A 1KCZA 4IF2A 4OJYA 4OGZA 5I3IA 5D8WA 4U5IA 4C6NA 1BSLA 1B30A 1GVRA 4PCSA 4F4RA 1NVMA 2G5WA 2QCDA 4ZE5A 1LG2A 2FDSA 3TU9A 2I1OA 2VDHA 4TV5A 3DUGA 4ENLA 5H8MA 2WBKA 4B2DD 1CEOA 1P7TB 1QPNA 5G1TA 1H50A 2XH7A 5KINA 1ZCOA 3FSUA 3MKKA 3KCJA 3IJLA 2ZUWA 6ALDA 1WZKA 1J0YA 3DFYA 3N2TA 2GJRA 1JUEA 4K8HA 5ECUA 4UTUA 3UR7A 3L4VA 2P8BA 1GQJA 3FW6A 3LI0A 5L9FA 3H4XA 4HHLA 3VDCA 1QNPA 2V30A 1FFRA 1X7IA 1W1TA 3R11A 4NX0A 1DV7A 2ZUUA 3WNOA 4M29A 4GQRA 3W70A 1EF3A 1SQ7A 4I5UA 4H6RA 1OFQA 3WBAA 3UP8A 3QBUA 4UTTC 1FWJC 3B0UX 2GVYA 2WMFA 2O56A 1A5NC 3WUBA 4PB3A 1UCWA 2FVKA 4OECA 4MHBA 4DX3A 3U5UA 1NQKA 3L9CA 4GUFA 2GOKA 1DWAM 2GSJA 4RDYA 2ZUVA 2WHJA 1Q7ZA 4TMBA 3SRFA 1V7YA 5FJRA 3L2MA 2UBPC 1UWQA 3B06A 3WLKX 1GVIA 1XLMA 3MMWA 4AISA 2PPGA 3UD6A 1TQXA 2OQLA 4DNMA 1BLIA 1RJPA 1EQCA 1CGUA 1PHQA 3C56A 3S1XA 4HPGA 1EL3A 4O16A 4QG8A 3WLTA 1MO0A 2B7OA 3C2OA 4Z2JA 4HGXA 5F2GA 3DFQA 4RCXA 2IKGA 5I77A 1I2RA 1GQKA 4DXKA 3TNOA 2EKCA 1EP1A 1M7JA 1U33A 3SY5A 3TFCA 2OQYA 3H70A 3UESA 3WQ6A 1UOKA 3LLFA 4XV0A 4AWTA 4GH1A 2HBXA 1DYSA 2TODA 4GY1A 4OUIA 2ZICA 2OLAA 3O7UA 1JI1A 3FAWA 3TLLA 1L8NA 4LVAA 4KS0A 1CLKA 4OZOA 3DHFA 3LHUA 3GD6A 2WNQA 2VZUA 2EF9A 2GQ8A 3MMUA 3O1NA 2GGIA 3B8TA 4MY9A 1JDCA 2FPVA 3O63A 4LNYA 4P7LA 3W1XA 3P81A 5AHFA 1RCQA 3LHZA 4NJKA 2VUYA 3M0JA 3MQTA 3URBA 2F61A 1VP5A 3CAWA 2YIHA 4FP1A 3CHDA 4D2JA 2PDKA 1P0KA 1ICPA 3F03K 4ADSA 1EUNA 4MNKA 1Q6LA 3DI1A 5TQLA 1NFBA 4WOQA 1VC4A 1VFMA 1X8CA 3EWBX 1GVSA 4WOZA 1ADSA 3PFMA 1KTNA 4UMBA 1DE6A 4U10A 2WOQA 3URQA 1O60A 1QPOA 3C0JA 4I90A 2DZAA 3PM6A 2BSLA 5JU6A 2YX0A 1UWIA 4AXKA 4D8ZA 5HR7A 5HXMA 5HJXA 4O18A 2XN0A 3A47A 4JKKA 4Y9OA 2TSYA 4AG0A 3AHXA 1WV2A 3HQPA 4DWSD 5CC7A 3CL8A 4ZOEA 2GL5A 3TZNA 5I23A 5F4WA 1K03A 1A53A 4PA8A 2DW7A 3ZZ1A 1JZ6A 3PZQA 9RUBA 3E49A 2YDAA 3IRSA 1E1FA 3OBAA 2VRQA 3WYZA 1Z9AA 1NJJA 4AWUA 3V1HA 2CLOA 4GZEA 2VJXA 4U3CA 5BMWA 4ZO7A 4RPPA 1HP5A 2BMBA 1SZNA 2EO7A 3R6IA 3CMFA 2PDXA 2QUNA 1RP8A 2Z0IA 2PU0A 4HNUA 2ACQA 3GWQA 4DVOA 2FZNA 3IJ7A 1XINA 3S1VA 4YHEA 2PTDA 3EMQA 4X3ZA 3FKKA 4V2XA 3HU7A 1HX0A 3NDYA 1WAWA 1S1RA 1YNYA 1UD4A 1JNDA 1PYFA 1FH9A 3CT7A 2HWGA 5G1YA 1E6RA 1B0IA 3PBMA 1DL3A 4F0KA 4UMCA 1RALA 1S5MA 1SJCA 4PTNA 4WGXA 4HNTA 5ABGA 4E5TA 5CPTA 1IEWA 1QTWA 4LAKA 3GC5A 1A3HA 4HHHA 2PCQA 1K70A 4K1WA 5GJMA 2YLLA 2J6XA 3UVIA 4GA8A 2ZC1A 4W85A 3W1RA 3ZLFA 2GSHA 2X42A 4FALA 4ICCX 2ATSA 4OKDA 3W2KA 3KEHA 2VD8A 1PCWA 1UASA 4DXVA 3ITYA 1W9BM 1XD1A 1FA2A 3VUSA 4RW5A 2WLZA 1H51A 4HMNA 1QNOA 3QVQA 3WQGA 5D4YA 2PZNA 3MBDA 4R34A 3LTYA 5L6UA 1KNWA 2E8YA 3M1ZA 1SFLA 2NT0A 4I8YA 4PMJA 4JN6A 1E5JA 3ZVIA 4C5ZA 3QQ1A 4HN4A 2E68A 2HV5A 3MY9A 4PCTA 1SJAA 2V38A 1FCUA 1YBQA 1VIZA 3TQ0A 4GWEA 1GYNA 1D9EA 2V0TA 2Q3OA 2ZBTA 3M07A 2IMRA 4DBEA 4UFLA 2HXTA 3GS6A 4J28A 4UQ9A 1UD6A 5EBAA 2QJHA 4E6MA 1GJWA 2PDYA 4IGMA 1XX1A 1TX0A 2HTMA 4XUGA 2QS8A 1DWGM 1J11A 2A3HA 1M6JA 1SJBA 1KQYA 4YN5A 3TC6A 2V68A 1UR2A 3ES8A 2DFAA 4POCA 1P7TA 1RH9A 4GNKB 1H4PA 3GO2A 3GYEA 1R3SA 1F07A 5TIMA 3GH5A 2ZA3A 2ZVRA 3RJXA 1PZ3A 2C1GA 3TOPA 4BI7A 4RLIA 3QSTA 3FN9A 4Q8TA 4IFKA 5CEWA 4NI3A 1R2SA 4NAEA 2LLEA 3ANYA 4JCMA 2PI6A 5DMLA 3L2IA 3N4FA 2I9EA 2VFFA 1FWCC 4EE9A 4DPPA 4Q4QA 3MUAA 3GKAA 4QG6A 1JXJA 4S2BA 3FFSA 3TXZA 3RF9A 3S2JA 3EKZA 4I9MA 1MW0A 2VOTA 3HPFA 2E7FA 1WBHA 4NJGA 4H41A 2J79A 3RLVA 3QMTA 3VKBA 3VDAA 5XINA 1A47A 1VS1A 3OLIA 3N2XA 2E25A 4C6FA 1VCVA 3HO8A 4FB7A 4B3LA 4GRSA 2XVLA 2HE8A 3ZIZA 2E67A 3OODA 1WZAA 3KRUA 1OT1A 1V08A 3VNJA 3L4UA 4S3JA 2NUYA 4AVOA 4H9XA 4MFEA 2WWCA 4FIQA 2CERA 2OZ3A 4A2SA 4HYWA 4O1DA 5AB3A 5C54A 4E3TA 4WJXA 2OT0A 4NHVA 3NG3A 5C55A 3ARUA 4W8LA 4GYPC 2Z6IA 2W27A 4NILA 1GOWA 3VC5A 3W2LA 1YEYA 1FCQA 2JE8A 2I16A 3VM5A 3IRDA 3B8DA 4M5PA 2KZHA 3NEHA 4PBFA 3WH6A 1J5SA 3PTKA 2DSUA 2XVNA 5DEZA 3SBFA 3GUWA 1KBIA 4UQDA 4Q8PA 4WXZA 1G4TA 3ZT5A 3LCFA 4J9JA 3UWZA 1I4NA 3C61A 2WMJA 4MUPA 4JEQA 2PWFA 3LRMA 5A6BA 3HQNA 5ENLA 2H8XA 1HIZA 4UTLA 3GDMA 3H2FA 4IQLA 3NPUA 1Z69A 1A5MC 2OOGA 3F4WA 1FWHC 3LHWA 1IV8A 3C86A 2QJJA 1VR6A 4HNLA 4GD0A 3S2LA 1XM3A 1P0EA 2XN2A 1Z89A 3SCUA 4FIRA 5IM51 4C6OA 3N6QA 2IS7A 2O9RA 1TYGA 4JBRA 3BLOA 3VC6A 1REQA 3M0LA 4Q8VA 5HQLA 3KUMA 1SW7A 1TV4A 2FFIA 1TPH1 5D03A 2BHYA 3U2ZA 3N18A 2ZKMX 2E9BA 2XHYA 4JYDA 3A6OA 4K2SA 4Q8WA 1R5YA 2GOUA 1EC8A 3ELFA 3GTNA 4BQ2A 3CAQA 3KWSA 2XYLA 2R1MA 2XFFA 4DUVA 4RXFA 4U4MA 5C7VA 2FZBA 4JFWA 1SZFA 4IXHA 2VEKA 3AC0A 3GIYA 2VUNA 2VC5A 1OINA 3MI6A 5FJUA 2BOEX 5DX7A 3RLGA 3QY8A 3O8AA 2CLMA 3CASA 3EDKA 3KTXA 1VPYA 2XSXA 1PX8A 4UTIA 3BJFA 3WLRA 5FA5A 2DZBA 2CHOA 1C8VA 1DORA 1LBMA 3QV7A 4QAIA 1HKJA 2ONEA 4AFYA 5D9PA 2E9LA 3UQNA 4IZGA 2O4MA 3SFWA 5C8BB 2X0YA 1T5AA 2ZXAA 3VX0A 3UR8A 3TCEA 2ZX8A 3R13A 1TV7A 2R9RA 2G3IA 1WKEA 3BLKA 3XISA 5DT5A 1U1JA 3GTFA 2FPTA 2WNNA 3MI3A 4KRUA 3IGSA 1UBPC 3C0SA 1BVZA 3ISIX 1W5MA 3BARA 2V2CA 3BDKA 4S3CA 3VI2A 4M8UA 4CD6A 1XKYA 1XIFA 5JIWA 3W81A 1W9UA 3BL3A 3AO0A 5HWJA 3M6DA 4M3PA 4G9PA 3ERPA 2ZRXA 5GJPA 3IJDA 3NAVA 3O6YX 4AVFA 3T07A 4N9EA 1YDOA 4XUYA 3D46A 4XKYB 3MSDA 3WFLA 5HJYA 4JQAA 2CETA 4D6HA 4RE2A 3GFYA 1B5TA 4W5ZA 4LB3A 2QPSA 1UD8A 6PTDA 2NX1A 3W29A 4Y9NA 4Q4KA 3N2MA 2EPKX 4L7ZA 2B7QA 4GI9A 4C60A 3LTPA 3CJPA 2J13A 1NSJA 2GJXA 2W62A 3EXRA 4PTWA 1MUMA 1LLOA 4ICNA 5DN1A 3UFYA 3C2EA 2QDEA 2VGGA 1VEPA 3KDOA 3V5CA 1HJWA 1ICSA 1M5WA 1B57A 1J8VA 3JR2A 3OB8A 4JTGA 3LMYA 1OK4A 2NUXA 1QFEA 3S6DA 3UCCA 3CMGA 5ABFB 3VUPA 4BK9A 1TPB1 1BYDA 2GQ3A 1D8CA 3EKGA 1JDFA 2DY3A 4E38A 3VIFA 1XDMA 1SFTA 1RY8A 1G4PA 1MW1A 1XSIA 3O6AA 1ZAJA 3PZVA 3EB4A 3WH8A 3BQ6A 3B8IA 4DRSA 5AY7A 1V02A 1TWSA 4TTGA 4D6FA 1GZJA 2D2GA 1JCJA 4AF0B 5HPOA 1LUCB 5FF0A 3GHTA 2IKHA 3T0TA 3EKLA 1NOUA 2D3NA 2QDGA 1E72M 2JEQA 1OB0A 1WDWA 2YA2A 4YCPA 3TVAA 2DT2A 2R1NA 5FSDC 4Q7BA 3N13A 3T81A 3VDHA 5K4XA 4B5VA 1EDTA 3W7HA 3NFUA 3M9YA 4IICA 1RLDA 1WAUA 1OT2A 3L67A 1I2NA 3G6LA 1XYCA 1G69A 4MB1A 3I7SA 3UXKA 1K8ZA 4H9YA 1OM0A 1XIDA 3EOEA 4P8VA 1FHUA 2OYMA 4WXYA 1J6OA 4R7JA 2PDNA 3S5SA 1S2WA 1XIBA 3GE7A 5BWAA 4DJDD 2IQ0A 3F4CA 5C5YA 2PWUA 2VGBA 2BHUA 5LXEA 4WDTA 3CV1A 2RDXA 4G1NA 4HOXA 4H7ZA 1WPCA 4AU0A 4GJ1A 1F6KA 5LNVA 3S2MA 2PDFA 4MF4A 3RXZA 1W1ZA 1A5UA 4MWAC 3CV2A 4DY1A 3N17A 4BJHA 1F3TA 3IGHX 3QPEA 4O17A 4XISA 4A8RA 2ZRVA 3SQLA 2DW6A 4QM1A 5HPCA 1EO5A 3QQWA 1EFZA 1G67A 5CBJA 4MJMA 1UPPA 1SVDA 3QHNA 3HA1A 1ZQ5A 3GNRA 3CWNA 5GNYA 3QY7A 2Y2WA 3NL3A 4QE4A 2RJGA 4J3VA 3FHAA 2PWEA 2Q71A 4TVDA 3WK1A 2AOSA 1F4HA 4XZHA 4H3DA 4B90A 3LGEA 4L4MA 4Z0JA 8TIMA 4HA3A 1LOQA 1LLWA 2C6QA 5I5RA 1VENA 2QJNA 5AOUA 3W1LA 1H63A 1W1B1 2EAWA 2IXUA 3TFXA 3E1F1 4A29A 2J7HA 2ZZ4A 1Z8AA 1OABA 4R7OA 1BKSA 4AWEA 2Y63A 3PAOA 3IANA 2CHNA 3FA4A 2A5HA 3QC0A 4BFAA 1WOAA 1LT8A 1MFUA 3CBWA 4LAZA 3P0XA 4REQB 3DECA 1RVGA 5A6MA 3DXIA 4ZSTA 2GK1B 3GTHA 3PZOA 3WFZA 4JQ4A 4W86A 1VFHA 5I79A 3UT0A 1H5YA 1W56A 3G24A 1SW3A 3JZUA 1UWAA 4W89A 1GCYA 1VPQA 2DH2A 2DP3A 2PDQA 2NQJA 4GUHA 1MDRA 3RK8A 2UY3A 3OP2A 3FKRA 3UZZA 5F4XA 3HG2A 2NVCA 4Q4RA 1SSDA 2Z28A 3MBFA 3ZSSA 3EB3A 3BAYA 1FVPA 1T40A 3FJNA 2YCLB 4DJEA 1QI5A 3UPBA 4JHMA 2ZCGA 4NJJA 2OGJA 4B5TA 5GVJA 1XFBA 1KFEA 1UKQA 3HG4A 1RZMA 1GPWA 1M53A 2X40A 3W07A 1A5CA 2BP1A 3S6TA 3UBPC 4O57A 3FYPA 1XUUA 2EXOA 1WNOA 4GXPA 3M44A 1XI3A 4KIEA 5C70A 1E15A 3U9IA 3CZLA 1EPXA 3G1DA 2W5FA 1ME9A 3HPAA 1XLAA 4FHAA 3TONA 1A50A 4AX6A 5GQBA 3B4UA 2Z7KA 1JULA 4NG3A 1JYXA 1E4NA 4K36A 1WDQA 4XSLA 1M03A 5CJMA 3WG6A 4QNWA 2E09A 1PTDA 3VNDA 3WLQA 3QGVA 3WQWA 1XXXA 1MDLA 2ICSA 3ID7A 5HQMA 1A5OC 3RPTA 1HUVA 2ZUSA 1UR3M 4O50A 1SO3A 4LW7A 2H3DA 3WJSA 4M51A 4PZVA 2JBMA 2FMOA 1K02A 3MYOA 1PX3A 2VGIA 1JZ5A 1N55A 3G3DA 3TWAA 2HMCA 3AZRA 4M82A 4NX5A 2J9YA 2IPWA 1XGZA 3RPDA 2C16A 1LZOA 4X0NA 3FDKA 5HUPA 1PXGA 5K4ZA 2VRJA 1F61A 2ZZ5A 1OCJA 4TX6A 4PGLA 2QIWA 1XV8A 1FWEC 1KCXA 1CT5A 5BU6A 1XFCA 1HGYA 4XVDA 4IIFA 1KFCA 2C7FA 5M5DA 3W9ZA 1GVEA 2BWGA 1U1UA 4V15A 5JUVA 5LHFA 4ATLA 4ZA0A 3GHSA 3F4NA 3PNUA 4EVZA 4JIEA 3N9KA 1EA0A 4IIEA 2OZTA 1UZ4A 4TOQA 4A05A 3DHUA 1OD0A 2NWRA 3LLXA 2ABAA 4JTTA 4NT0A 3SADA 3THDA 3Q37A 4KRTA 3PUEA 4RNFA 3GU1A 1JQVA 2P88A 4AZ5A 3QXBA 1TE1A 1O68A 4O12A 1EA9C 5I3JA 1OZMA 3L21A 4PUEA 2UWFA 4PUNA 5CPMA 3SCQA 4DIAA 1JF5A 5A95A 4JL2A 1TJRA 2Q3RA 4AX7A 5E0KA 1S2AA 2OMAA 3CV6A 2J7DA 4ZO8A 3CQ0A 8XIAA 1E6SM 5ABEA 4LUIA 2CLHA 3BG9A 4Z1AA 3I4KA 5BXSA 1KKRA 4OE7A 4IUOA 2ZTKA 5HANA 2QF7A 4ILSA 2VVNA 1ZZMA 3RYSA 3MKCA 2PDHA 3H8AA 4WKHA 3ZS4A 2QVNA 1LWIA 5BYWA 3R5EA 3E6EA 4A4AA 3OPSA 3TQPA 3VNIA 4GCXA 4AF0A 4JGDA 1EWDA 3KW3A 2HNHA 3DFNA 4DAFA 3MA8A 2X30A 1YDYA 2RJHA 3T1GA 3CUJA 4FS9A 5EFFA 2AQVA 3JZEA 1K7XA 3KLKA 3RLUA 1IEXA 4RK8A 1A5KC 2J6VA 4FO4A 3W86A 2FPYA 4DBSA 4UTMA 3MSYA 4YTUA 3LBOA 1WDSA 1UZHA 4JIPA 3UXLA 1RA0A 1P6CA 1A49A 1N82A 3CLMA 2NZLA 5T9BG 4LAMA 1EYWA 3UXIA 2F6KA 2TYSA 1P48A 3EDEA 4PCFA 1UP0A 2F84A 4QITA 2EEXA 2W92A 2J24A 3PB0A 3AIWA 1J9YA 4F48A 3A23A 3IK2A 1BF6A 2PWHA 4FF5A 1WCGA 3XINA 3VILA 5E1QA 4CU8A 1EDGA 1MVYA 1LDCA 2ZDSA 3PG8A 1E6ZA 2PBOA 4V1XA 5HMDA 1RBOB 3PPFA 2JFEX 1AW1A 1JRCA 4YYFA 4GABA 2IKIA 2HZGA 2PGFA 3MHUA 1NWTA 4JIIX 1VHNA 4O13A 2P10A 4HSNA 4NP7A 1KM2A 3RCMA 1AD1A 4YIWA 2WHLA 3DEQA 4HHPA 3HJZA 1EZWA 3UZYA 2PDWA 5EMJA 4IOTA 4EP8C 3WUFA 1V79A 3CYVA 4H7CA 4AD4A 3PNZA 3HN3A 3T78A 4I5XA 3LHVA 1HVQA 2VFGA 3EBVA 4HU0A 4OBRA 1TQJA 4X63A 3W6LA 1KBKA 3VYLA 3AHYA 2OKOA 2HS8A 1FFQA 2D0FA 1K8XA 3LU2A 1O5RA 3W7CA 4X9YA 2DH3A 3NPWA 5AHLA 3PBGA 1E3ZA 1C7TA 2VURA 1G0CA 3U6WA 3JS3A 3PY2A 1W5OA 1XYBA 2ZRYA 4JX4A 2XVGA 4BWLA 3HB9A 2CLLA 4H00A 3WSUA 1HNYA 3KCOA 5LGXA 3ZWTA 3VOHA 3GR7A 5CZJA 1E9LA 2C13A 2XUCA 4CD5A 1CENA 4QLJA 1Z7AA 2XISA 1DJQA 3P8IA 3WUGA 2EPMX 4GZIA 4D72A 3NQ6A 3PANA 2VZTA 7XIMA 3QHMA 4WR3A 3W7DA 1B3XA 2PDUA 5BWFA 4DZIA 4M6PA 5CZ0A 1GOMA 1Z3NA 1PTGA 3DFHA 1OK6A 3GH4A 3I3DA 4D1JA 3DN5A 4MLRA 3ONCA 4WD0A 2ZZ6A 3VK5A 3THCA 3TYUA 1LCOA 4WF7A 3SGGA 1AH3A 1E6XM 3NZRA 1H7WA 1RPXA 3N2BA 3QN3A 1JR1A 4TVCA 3CGTA 2Z2AA 3LA4A 3CUXA 4O1EA 4JDBA 4IGNA 1GZGA 3CZEA 2IPFA 4QE5A 1H62A 4WLCA 4DJFD 4RNIA 3UR2A 5F2IA 4IP4A 2G3FA 1X96A 1Y8BA 5E9AA 1L0PA 4C6PA 4N4PA 3I10A 3R0DA 4KEUA 4MJ2A 4XAYA 3QV8A 3VMNA 4KGLA 5EPDA 1P6BA 3SFKA 3SCNA 4H6EA 3G0XA 4EXQA 3TUUA 1KXTA 4PMZA 4BCEA 3P8JA 2BGNE 3VKJA 3QPYA 1T7LA 1VCFA 1S3HA 4R53A 4FOUA 1BKHA 1OYAA 3M5ZA 3GHUA 1IGWA 3S2CA 1QT1A 2NQ5A 4LF2A 4UBPC 2FQIA 1QW8A 2YFNA 1W9DM 5BRQA 1L6FA 4JFVA 4F8XA 2J9ZA 5E93A 4G7FA 1JD9A 3VGDA 4PN2A 2Q02A 5MKGB 2PTWA 5FJIA 3BZGA 1R3VA 4UQAA 3DCPA 2WPBA 1ISWA 1QU4A 1ZP3A 3G5EA 4R9XA 2PDJA 4HA4A 3GDLA 4E4UA 2H6RA 3IIPA 2DZVA 1AQMA 1J18A 1CGXA 4XK2A 3LY0A 2JQXA 3NQAA 4C6MA 1JZ3A 4ACZB 5AYYA 3N1AA 4W87A 5DXYA 4KPLA 5E0FA 3MMDA 2XU2A 1C91A 2EPOA 1GVOA 2J47A 3VPLA 1ADOA 2O9OA 4C1KA 7TIMA 4ZB5A 3AYRA 1ZAIA 2ZA2A 1S3TC 4ZFMA 4JY9A 4MUZA 2PU1A 3OGVA 4PL2A 5F2LA 4FA3A 3MB9A 1PPIA 3H7UA 3TMLA 1QR7A 4GKTA 1TTIA 2J8GA 3G1SA 1AL7A 1J0KA 2VCBA 2HCVA 2Y88A 4H2HA 2OO0A 2XIMA 3AAMA 3BVJA 4C1NA 1ZBVA 4OBTA 1Y5WA 3EYPA 2B7PA 3B40A 1YX1A 4HU3A 3AYSA 3MANA 4ZXLA 4BQ5A 2OG9A 1N2VA 3MC5A 3W88A 4IPIA 1H1ZA 1U5JA 5K2ZA 3S9YA 5I3GA 1W8SA 2A4AA 4ADTA 4QBXA 1XC6A 3M6YA 2CZDA 1SR9A 3LZ3A 1F6PA 3W73A 4Q8UA 4AZHA 2ACSA 4FLOA 4GO9A 1TWIA 3SO7A 3BICA 3GM8A 4WKAA 3TQKA 2QIIA 1NU5A 3WDPP 5FI8A 4DB7A 2J8FA 5LNWA 3K4DA 1ZBWA 3DC0A 3T4CA 4C7GA 3A3HA 2E5BA 3ONBA 3F7JA 4XBKA 2PURA 1ONEA 4US5A 1GEHA 4D6EA 5JQ9A 3VNLA 4CNTA 3ZM8A 3UGRA 3D47A 4AZCB 4QTGA 2NSOA 4IGHA 4CQAA 2ISSA 4NZJA 1DJNA 5AYBA 3TAOA 3M0ZA 1VIWA 4PMQA 4JYEA 4LXFA 6TIMA 1X6NA 3VKDA 1AD4A 4TU1A 2HVNA 1B3YA 4HK5A 1FBAA 3TDFA 3G1FA 2VDIA 5KETA 2H9AA 1IYXA 4PEEA 3B3DA 1FDJA 4YLWA 1QUMA 2Q01A 3KTSA 3NQMA 4S1FA 3BW2A 1GQIA 3GB6A 3IJ6A 3NQ7A 3OU8A 1BSIA 4RZBA 4UNKA 5D04C 3GXNA 4L1GA 4JZ5A 4LCSA 1TTJA 3WKZA 3P93A 2OOFA 4E8DA 3WF0A 2QF8A 3I7QA 2EGZA 1QW7A 4MWAE 1JGIA 3ES7A 4D8AA 2XJ7A 1TUFA 1XLBA 1WP6A 3ECQA 1ZTVA 4B2DA 1GKQA 4B5NA 3DKLA 3G1YA 3B9AA 4XZLX 5DLCA 1DEDA 1T0OA 3NYZA 2ZYFA 4WKFA 3O16A 1FCBA 3IV8A 2FZ9A 1ITXA 1EX1A 3FIGA 2Y8UA 3W01A 3VGGA 3UJEA 3KS6A 3TYCA 3WL1A 5D02A 3HQ1A 1EJSC 2VZOA 2Y61A 3HFYA 4MOZA 1O94A 1PHWA 3ITGA 3CZGA 3USBA 2D73A 5AHEA 5D32A 1NELA 2EHHA 1JL8A 4HVXA 2PDPA 4W88A 3WMLA 3PUGA 4LV9A 3BLLA 5EMUA 3M0IA 3BXWA 3I4EA 4Q4OA 3SGZA 4ZEPA 1XICA 1X7FA 1QWGA 4LVFA 4EAMA 2PTXA 2FMNA 3T9PA 5J5RA 3EMCA 2DDXA 3HGRA 4LWWA 4N9BA 3UEQA 4JTEA 3ORWA 4LH8A 2R14A 1MUCA 5HNTA 2A7RA 4BI6A 1G7VA 5E5CA 2QCCA 3C3NA 3IVTA 4YVPA 3TYBA 2XGBA 3QC3A 2HJPA 2POTA 5RUBA 4GXMA 3WJYA 4H6KA 4FEZA 5JH1A 1V4YA 4R88A 4AYGA 3WLOA 5BXTA 5D2XA 3STEA 2PMQA 2AMXA 3W76A 1CPUA 1ODZA 3GVRA 3O15A 4NYUA 1JCYA 4NZ5A 2FGZA 2C0HA 4LT9A 3V0UA 3LNMA 1V6XA 1JPDX 2A3LA 3SCPA 4PUUA 5D2TA 2DZUA 3V4BA 1ONWA 2PD9A 1RSCA 2WW5A 3CMJA 4D6DA 1L2QA 4KCVA 4Y9AA 2H90A 4C6QA 2WZEA 3TYDA 4N2YA 1XBZA 1R30A 1TMQA 3AIQA 4LSBA 4RDZA 3SR7A 3N15A 5LSMA 2CKSA 3GNOA 5KZDA 3EX4A 1H7PA 4ICMA 1W9PA 3MHGA 4OFCA 2MUCA 7ENLA 3M0YA 3MUZ1 4H7VA 3OVGA 4IPPA 2J4GA 3RR1A 3WENA 4U3AA 3GXDA 2YL9A 3PZTA 1M1BA 3KXQA 2ZE0A 3BZJA 1RJRA 3FNDA 4DJEC 1WX0A 1J2WA 3W2JA 3NDZA 4C6BA 2ZVIA 5AYIA 1RLCL 3WK2A 1XISA 3VIHA 4EPKA 2FHBA 2FFCA 3POHA 3DYOA 2NVAA 1QHZA 2Y5JA 3RU6A 3BCDA 1ZALA 1X98A 1ALDA 3KOZA 3VKCA 4EPDC 1J5TA 2EPHA 5TNVA 1P5BA 1J0ZA 1XDJA 2OT1A 3RN6A 4QQUA 3BMXA 4LFYA 1BXNA 3PULA 2BY1A 4XO6A 2BDQA 2ISVA 4JHZA 4US6A 3K1GA 3AIUA 5MKGA 2C15A 1BTCA 2X1SA 2G97A 3F2DA 2R1LA 4DWSA 1EHAA 1ZL1A 4PODA 4M81A 5BOOA 3USZA 3KX6A 1KM3A 3VU2A 3JRKA 2G41A 4LRSA 1M04A 2PCEA 2EG6A 2W6RA 5I00A 1IWPA 3WD3A 4IQJA 1EH9A 1VFOA 1W1PA 1MQQA 2DIEA 2NQHA 3P5ZA 4JOMA 3CUHA 3E9AA 5GJNA 4J5NA 5CBIA 3WLIA 1XCXA 3BLPX 1TTQA 1AQFA 3EA3A 4DF0A 2BX7A 5CAHA 3NO5A 1L9WA 1IIGA 4RUBA 1X8FA 1YXYA 1NFGA 2D2HA 4J3WA 5HMSA 1RCOB 3EWDA 2CU0A 4S3DA 7TAAA 4C6LA 3CUZA 3MTWA 5LIWX 1DIKA 3L23A 3W1TA 2CITA 4AYSA 3TR9A 2Y70A 4O0QA 4O52A 1W3LA 1UKPA 4IP7A 1YKWA 1QHPA 1RP9A 4E2BA 4PE8A 1ENUA 4M19A 2BFGA 4TQTA 2G3MA 4QSFA 1YPXA 3RMEA 1W1VA 1ICQA 4E8CA 1EYEA 3T8LA 3GNPA 1E55A 1LYXA 1UOZA 1WOBA 1YADA 1CGYA 2YCEA 2GGEA 3O2LA 4AY8A 4LF1A 4L4LA 3QMRA 2PWDA 3P6LA 3CWHA 3BV7A 4PTVA 5EGRA 3RPMA 4A2RA 3AXIA 3CAKA 4XWUA 2VP8A 1OCNA 3TTYA 4CN6A 4RE0A 2OWWA 4ERGA 3W6MA 2V9DA 4PMRA 2C71A 1OVDA 3R79A 2O9TA 1QK2A 2VQTA 5AN7A 4R7WA 3KS5A 1OADA 2OZ0A 2Z2BA 4YS1A 1UMLA 4O8AA 3DAQA 1VFFA 4EWND 3G8RA 2JKAA 3WDHA 3N6HA 4GX8A 3TJ4A 1DJXA 3MCOA 4MWAD 4EKJA 5CBBA 4CD4A 2JKEA 2NLYA 5D9OA 4QSHA 4RV8A 4ERIA 3FK4A 1P1XA 4GUIA 4YL2A 3GYCA 2QDHA 3JW7A 2NV9A 3V0SA 3WQ4A 1NTHA 3NGJA 4HZMA 1V03A 4FNQA 3M5VA 3TTEA 3VOGA 3VNKA 2PLJA 4IPNB 2A6LA 1LBLA 5KZ6A 2OLSA 2QQ6A 4GYFA 3WQEA 4MB3A 3PZIA 3BTNA 1UKSA 3REQA 2INFA 3G1VA 3UG3A 3MS8A 1S5VA 2JF7A 3NOEA 2D23A 4HPHA 4Y7EA 2KAUC 5H6HA 1KLZA 1BQCA 1XKJA 3OYXA 5HNRA 1XYFA 3VDGA 3HV9A 1R46A 3AI0A 3WD2A 2FGBA 3BQ5A 1EF2A 1GOIA 4JFSA 4PUKA 1Q6DA 2H8ZA 1Q45A 4MFDA 1VRDA 2WJEA 4Y8EA 5FIPA 1P0DA 3WH7A 3R7MA 4E2VA 3L5MA 3PS7A 3XIMA 1K8CA 3APYA 1EJRC 1UR4A 1G4EA 4IM4A 1UJPA 3V5FA 4CU6A 4IQEA 3CL6A 3NR0A 1OWQA 1VD6A 3UWWA 3QFWA 1QVBA 1FWGC 3L4YA 2XG9A 3BCJA 1TJPA 5J04A 5K9DA 3T0BA 1PS9A 3GG8A 4HYRA 1I0DA 4YVVA 3CQKA 3KVKA 1HKMA 2VENA 4DM1A 3HIJA 1Q6RA 1CW2A 2WANA 1U5HA 2A3EA 3KL3A 4H8VA 1PZ0A 4YWSA 4MDOA 1RJQA 1WZMA 4O8RA 3BK0A 4BWLC 3WDRA 5DXXA 3VDBA 1HO4A 2I7GA 4A3UA 1DTNA 2XH0A 3V35A 3QOMA 2BY0A 4GBDA 4IL0A 1EDQA 3AALA 3UYIA 3TP4A 3BC9A 5KTLA 3Q4DA 1J93A 2P0OA 1WXJA 3EX6A 4XBJA 1I2OA 3W4RA 1EPVA 4I7WA 1JDDA 2FH8A 2DVXA 3VIMA 1OG6A 3UWQA 5REQB 4E2OA 2E8ZA 4JPGA 1IT0A 3NWRA 3AS2A 1F4AA 3VNMA 1AK5A 4IJBA 4UR8A 5FF7A 4A21A 1QI4A 4GINA 4U33A 4TO8A 2NX3A 3VKAA 2PBGA 1OX4B 3KOFA 5HA7A 4DYKA 2VFEA 3AWNA 1LRTA 4N42A 3U4AA 1TIMA 3LPPA 1LL6A 1R86A 1P0BA 3LG3A 4RW3A 3ITXA 1R9XA 2X09A 4NXKA 1LWHA 4YTSA 2XM2A 1XIGA 3BWWA 3PSWA 1FQ0A 1H41A 4WK9A 2G95A 3KM8A 2CNCA 3OGSA 4WSHA 4UZUA 1PCKA 1TVLA 1R38A 1Y7VA 1TVNA 2Q8LA 1D3HA 5CKSA 4JS3A 4FMVA 3ZYZA 4GVGA 2XSBA 3PZMA 3L7RA 2NX9A 1KM0A 2BY3A 4AZ7A 1JPHA 4KBXA 4DYEA 2YB4A 3VZXA 5LA2A 1IWAA 2GJLA 1TZ7A 4ADUA 3AIRA 4LUTB 1W3HA 3MP4A 2R91A 4M1BA 3LCXA 2Q6ZA 1XSKA 5ABTA 4A3QA 2C79A 4JQ1A 2AL2B 3RLHA 2YDRA 3TV8A 5DCEA 3DKJA 3OZMA 3FXYA 1KM5A 3HURA 3CHCA 1W3IA 3TJXA 2X1IA 2NQLA 1Z42A 3S8HA 2PC8A 4BHYA 5BRPA 1T99A 2FKPA 2GDUA 1JCNA 1LQ0A 4LUSB 2Y7EA 2GDVA 3O6CA 2G50A 1KRCC 3W22A 2XIBA 1C3FA 4HMCA 1GW1A 4GUJA 1F76A 5ABHA 2YYUA 5BXPA 3H7RA 4OIFA 1J0JA 1HJXA 2QMKA 3RX2A 3E3HA 2V2DA 1IQ8A 2YYTA 5H8UA 3H12A 4LY8A 3BO9A 1UD3A 4DUXA 1L6GA 4RZ6A 4LAOA 5DY2A 1E9YB 3A9IA 3WD0A 4GI8A 5LYRA 4OBSA 3SAZA 3AUOA 3TX9A 1NEYA 3WF4A 4ROPA 1E1CA 3QH2A 1O5QA 4I7UA 1QOPA 1HN1A 3TYEA 4WSKA 1TJ2A 3HMCA 1XYAA 2FB2A 1AUSL 3S47A 3CYJA 5FEWA 4UR9A 2OYKA 3GUGA 4O1CA 3AHTA 1YDVA 2Q8XA 3MUCA 2OYLA 1EUAA 3W37A 1K8YA 2VR2A 2VWTA 2NQZA 3UWEA 5KMYA 3PJTA 1OG0A 2Y24A 4A3HA 2NLIA 3TEVA 1R3TA 2VD9A 5A3HA 1A0EA 4MJZA 3BAJA 4ZQRA 1WUEA 3G2GA 3U5YA 1MSSA 4IPJA 2BOGX 1VFTA 1QAPA 3EPOA 1J01A 1JZ4A 3B8UA 3T8QA 1ZP4A 1RCXB 2VRKA 4J7RA 3D5HA 4ALDA 1HJUA 1B9ZA 3A9BA 4B3ZA 4F0MA 2V67A 3T44A 1GJPA 2V2HA 1W17A 2REQA 5AC4A 3TA9A 4GK8A 4GIAA 1R0MA 4NASA 1BF2A 3MWAA 4JFTA 1V51A 4FR1A 1BFNA 2BG5A 2ISFA 2VEPA 3OLEA 4J35A 3DFOA 2D0HA 4G7EB 2OLHA 5H1WA 4GUGA 1VJZA 3NJ3A 2EBNA 2Z6JA 5AC7A 4BF5A 5AZ0A 5IOBA 4IX2A 3P3BA 1IZKA 1GVQA 4CVWA 4GPNA 2XFRA 3PB2A 3CV7A 3GFZA 4UCGA 3IJQA 3TC3A 5JVLA 1F6YA 2I56A 2WXDM 3LCHA 4O1BA 2OWCA 3R8HA 1IR2A 4DZAA 9XIMA 1UH2A 2CESA 3GH7A 4ZQCA 2J66A 4FAMA 4RL3A 1MXDA 5F2MA 7REQB 2DZXA 3SUTA 3MJMA 4B9YA 1MQRA 3R25A 3SGUA 3IAQA 1PL9A 2NXHA 4DXXA 1UB3A 2P8CA 1EXBA 1JUKA 3FY1A 4U2YA 1KM4A 3QFEA 5HWNA 4I8DA 1LF1A 3PTMA 1G4SA 2CYGA 3T2OA 3T0CA 1CGTA 1MFVA 1Y5VA 3NZ1A 3IK4A 2F9RA 4AHOA 3ICJA 1VF8A 2PWVA 2BXYA 2A7PA 1VFLA 4BZYA 4YMZA 2DIKA 5HMFA 3K4AA 1UD5A 3GDTA 4GI6A 3LMZA 4MNLA 4PUJA 4QJ4B 3MT1A 3STPA 4AW7A 5D9NA 3SJ3A 3MDWA 3G0UA 5LHEA 4JD4A 2J77A 4QP0A 4GKLA 5TBOA 1JQXA 3WF3A 2RHGA 1X6UA 1FWTA 2HK0A 4MZ8A 4HNNA 4L6OA 3IUHA 3L4ZA 4KRZA 3BLEA 3FA5A 3WDIA 2C1IA 4L6HA 4MYAA 4MVAA 3W1PA 1V8EA 1ZJBA 1CECA 5BW6A 4LUJA 2X41A 4F9JA 4LBUA 1N8IA 4LVDA 4O28A 2DUZA 1CLXA 1EGVA 1W31A 1R2RA 4N4QA 3H26A 3H54A 1TMHA 4AC7C 3DG6A 1US2A 1DWJM 4PRTA 2UY4A 4LB4A 4Z2KA 1PKNA 5FF4A 3VD5A 3GAKA 1W6TA 4H2CA 3IACA 1JYVA 4GISA 3ARVA 1KBBA 1TB3A 5CPNA 1FKXA 4RDWA 3TZFA 3MMTA 3TLQA 1AQHA 2V3GA 3GW0A 1O5KA 1HP4A 3KVLA 3SSZA 4MY8A 2ZE3A 4GG9A 4NIRA 1O4UA 3RGTA 1ZBKA 1Z44A 3ZR6A 4L6DA 2IQTA 3W7OA 1VYRA 3SCTA 4B9ZA 3DGRA 3AS3A 3LYEA 4O1FA 2WVVB 4K6AA 4Z08A 2Y7FA 4JR5A 3E5BA 4RX0A 2WJDA 1XF0A 3TKFA 1B4EA 1FTXA 1EBGA 1O66A 5H91A 3PTQA 1JF6A 3UG5A 1IXNA 2VWSA 2YOCA 3BAIA 1DHPA 3W26A 3OZPA 2I14A 2XH2A 3TSDA 3VVGA 3R0UA 3P74A 1BYBA 4LAUA 1W3NA 2ACUA 1VQTA 4TX9A 4K1GA 1TPUA 4DWDA 1ISYA 4ZVJA 3LI1A 2QCGA 3S1UA 2FB3A 4QGCA 4QQ3A 3COTA 4W7UA 4QS6A 1EHNA 2UY2A 4MJ4A 5DCDA 1PYMA 3EOSA 1U22A 4HHMA 1LRQA 1UQYA 2J27A 4IG2B 4QEEA 4GBUA 1EJXC 3IGUA 1JVNA 4HA1A 1FCVA 1R2TA 2A3BA 4GYKA 1O12A 2DEPA 1IIHA 1FKWA 4LUTA 4S3FA 3SCRA 4PUDA 3FHQA 1ZS2A 3WZ0E 4I9AA 5IXEA 3HGSA 4WY0B 4LEFA 1BVNP 1DQUA 2UZ9A 4N0RA 2CLEA 1K9FA 3IUIA 1HF6A 1VJIA 4IHCA 3S42A 2W66A 1IT8A 1F3XA 1SO5A 2NXIA 3HBLA 4AZBA 2GQAA 1XLIA 3F5KA 1E9IA 4DWSC 1Q6FA 5LGZA 4MB5A 3ABOA 3LBCA 1FP8A 4LUSA 4A35A 4JL1A 4JX6A 4MZYA 2FTPA 3RR4A 3UG4A 1W91A 1IGSA 3GR8A 4GX9A 5M1TA 1OFDA 3UA3A 4WSJA 5A8QA 2CZEA 2XFYA 5JBFA 3SCWA 5DQPA 5HOSA 3S4TA 2YBVA 2A79A 4N6EA 1LROA 3BSHA 2D20A 1OC7A 5HDRA 3S46A 1XD0A 4PTMA 3CZKA 2JF6A 1P43A 3L66A 1EP2A 3GG1A 3APTA 3NL6A 1DIDA 4X9SA 2VOMA 2DSWA 5T26A 5SWUA 1X1NA 4RZ4A 2EG8A 1BRLA 4LTSA 1P1MA 5XIMA 4QHRA 1DWIM 1W5QA 1QJWA 3AS0A 4XD4A 3VIKA 5A8OA 4MDPA 1FDYA 4GQ0A 5HK4A 4GNJA 1TREA 3CC1A 3ZVHA 2XIJA 2QT3A 4RKAA 3WJWA 3OBEA 4IP5A 1OFEA 5M2FX 4L65A 3H2CA 4MYXA 3EPMA 1Q6GA 4KKXA 1W1YA 4JNZA 4LV4A 4PFHA 2WM0A 1GVFA 3UETA 3QZEA 4HTYA 4FF7A 5LNUA 3EWZA 1XIMA 3UPWA 4D9PA 4H9VA 4IQDA 5IDZA 1NOFA 3NL2A 4AWSA 2XWDA 3CUFA 3RG6A 3SCVA 4DI9A 3KE0A 3I65A 7A3HA 2GPTA 2AKZA 3NZQA 1W5NA 3N2CA 3WQDA 3EOUA 1JDAA 4ZO6A 4C91A 3SQSA 1CIUA 2OSYA 2XIQA 4YU1A 3RU8X 1KQZA 1KTCA 4BEUA 1CB7B 4GACA 3UJ2A 3AZTA 3W1MA 1ISXA 1XH0A 1XQLA 1PIFA 3N6JA 4ZE4A 1UHVA 4LPCA 2DGAA 2WMIB 3V75A 3O05A 3K30A 2I5GA 1PV8A 4RV3A 1TG7A 4M6VA 4ATDA 1Y5XA 4TIMA 3DG3A 1XHGA 3M16A 1BHGA 3IS4A 4MG4A 4QLLA 3LUTA 3GG7A 4KEZA 1JCLA 3S1WA