3IRSA

Crystal structure of uncharacterized tim-barrel protein bb4693 from bordetella bronchiseptica
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
281
structure length
281
Chain Sequence
LKIIDFRLRPPAMGFLNARIYTRPDIRNRFTRQLGFEPAPSAEEKSLELMFEEMAAAGIEQGVCVGRNSSVLGSVSNADVAAVAKAYPDKFHPVGSIEAATRKEAMAQMQEILDLGIRIVNLEPGVWATPMHVDDRRLYPLYAFCEDNGIPVIMMTGGNAGPDITYTNPEHIDRVLGDFPDLTVVSSHGNWPWVQEIIHVAFRRPNLYLSPDMYLYNLPGHADFIQAANSFLADRMLFGTAYPMCPLKEYTEWFLTLPIKPDAMEKILHGNAERLLAQAGR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CRYSTAL STRUCTURE OF UNCHARACTERIZED HYDROLASE FROM Bordetella bronchiseptica
rcsb
source organism Bordetella bronchiseptica
molecule tags Structural genomics, unknown function
molecule keywords UNCHARACTERIZED PROTEIN BB4693
total genus 106
structure length 281
sequence length 281
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04909 Amidohydro_2 Amidohydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.140 Alpha Beta Alpha-Beta Barrel TIM Barrel Metal-dependent hydrolases 3irsA00
2E25A 1FWJC 4CQCA 2HQAA 2HPIA 3E2VA 4QTGA 3OVGA 1K70A 3UF9A 4B3ZA 4EPKA 4RDVA 4E3TA 1E9YB 3ISIX 1YBQB 4GYFA 4CEUC 4QS5A 1EJRC 2BB0A 3E38A 4ERAA 3LA4A 3E74A 4C6DA 1R9XA 1V7AA 3MVTA 4GC3A 4XAGA 3MPGA 2YXOA 4DIAA 3UR2A 4PE8A 1P6CA 3GTXA 5LXXA 4CQDA 2CZVA 2Z00A 4V1YA 3O7UA 1QW7A 1PB0A 4R85A 1VFLA 2YB4A 3EWCA 4OFCA 2VR2A 2PGFA 3A4JA 3DCPA 4H9YA 2Z27A 3T81A 3HPAA 2O4QA 4R88A 1HZYA 1ONXA 3E0LA 4KQNA 4AQLA 3LGDA 1K1DA 3IACA 3URBA 4C6BA 2A3LA 4C6EA 4C60A 3R0DA 4DZIA 1PTAA 3B0XA 1QXLA 1A5MC 4J5NA 4IG2B 3NQBA 4XAZA 4JOMA 1YNYA 3OJGA 3B0YA 2WJFA 1XWYA 3F4CA 2D2GA 3QY8A 4H01A 3S2JA 3KM8A 4LAMA 3OODA 2OB3A 4IFKB 2QS8A 3FEQA 2DVTA 1RK6A 3V7PA 4ERGA 2I5GA 4L6DA 2Y1HA 1UBPC 1XRTA 1RJRA 3B40A 2WJDA 2Z2AA 2PAJA 2ZC1A 1EF2A 3CAKA 3MDWA 2G3FA 4HA0A 2I9UA 3N2CA 3GTIA 4B92A 1M7JA 4IFRA 2IMRA 2PLMA 4R7WA 1EZ2A 4IQJA 1FWCC 4GK8A 4GOAA 3URNA 4LEFA 2HPMA 3PAOA 3WYZA 4IG2A 1KRBC 3TN4A 1RJQA 1R9YA 3E0FA 3LSCA 3GUWA 4LAOA 1V79A 1FWHC 4XD6A 3LS9A 1NDZA 5G4HC 4RDZA 1FKXA 2ICSA 1P6BA 2AMXA 3OU8A 2ANUA 2VHLA 2R1KA 4QRNA 4RDWA 3TN5A 3IJ6A 4CNUA 3JZEA 4IFKA 3GG7A 3IARA 3GU9A 1UIOA 4C6QA 2O4MA 4NI8A 4C6CA 1KCXA 3K4WA 2OGJA 4H9XA 3EWDA 4XD5A 4PBFA 1RA5A 2GSEA 3HM7A 4DYKA 4WHBA 1E9ZB 1ONWA 2ADAA 3RHGA 4V1XA 3GIPA 3T8LA 3GIQA 3OQEA 3TNBA 4NG3A 2BGNE 4GY0A 3RCMA 1RK5A 1J79A 4PBEA 2RAGA 2W9MA 3LU2A 5HMEA 5A6TC 4H9UA 1M65A 4ICMA 2UBPC 4UBPC 2R1LA 4KEZA 4RZBA 2OQLA 3FDKA 4EPEC 1O5RA 2R1MA 3ORWA 3F2CA 4BKNA 2Z7GA 2VC5A 4WVXA 4J35A 1WXYA 4C6FA 2HBVA 3RYSA 4EPBC 4GBDA 4GZ7A 1R9ZA 3URAA 1KRCC 3PANA 1GKPA 4WGXA 1M68A 3UR5A 4CEXC 3K5XA 4HK6A 4LCSA 1FWDC 3HTWA 4KF1A 1GKQA 1A4LA 1ZZMA 1S3TC 4XD4A 4B91A 3GU2A 4PCPA 4C65A 1WXZA 4RE0A 1KRAC 2WM1A 2HNHA 1KRMA 4ERIA 5AKQA 1FWBC 3URQA 4KESA 1POKA 4H00A 3F2BA 4NP7A 4PCNA 4QS6A 4QROA 3IGHX 4LALA 4G2DA 4DI9A 1PO9A 2AQOA 1FWEC 3NURA 3BE7A 4M51A 3PNUA 5CH9A 2GZXA 4IGMA 4LANA 2PUZA 3TN6A 3PBMA 4DI8A 1J5SA 1A5LC 1PSCA 3A3XA 4Z42C 4C6PA 3E3HA 4IGNA 4DLFA 1V4YA 2R1NA 1NDVA 3NEHA 2D2JA 2EG7A 4ZSTA 1FWFC 4GY7A 1NDWA 4H9ZA 4I6KA 4QSFA 2OODA 2FFIA 1FKWA 4HK7A 2FTWA 1A5NC 2D2HA 3RN6A 2PGRA 4L9XA 3UPMA 4KIRA 1DPMA 1ITQA 2Z24A 3AU2A 3K2GA 4C5YA 1EJUC 4DO7A 4G7EA 2Z25A 4BJHA 4C6OA 2DVUA 2OOFA 1NDYA 4INFA 4LFYA 3ID7A 1K6WA 4KETA 4UB9A 2FVMA 3SFWA 3MSRA 5HMDA 1BF6A 2FTYA 3ITCA 4CNSA 2Q09A 1I0BA 3QGKC 1GKRA 5FSEC 2FVKA 4CNTA 1EYWA 3IRSA 3F2DA 2QT3A 4KEUA 3DC8A 4HK5A 4H9VA 2HBXA 3UBPC 4GY1A 2EG8A 4J2MA 2Z4GA 3TN3A 4LCQA 4H9MA 4F0LA 1V77A 1YRRA 1EJVC 3PNZA 4DLMA 3MVIA 3C86A 5FSDC 3WZ0E 2GWGA 2F6KA 3T1GA 2Q01A 3IPWA 1POJA 1EJXC 1NFGA 3WMLA 1YIXA 2R1PA 4XAYA 4D8LA 1V51A 3LY0A 2UZ9A 4LCRA 4G7EB 4TQTA 1RAKA 4KERA 1YBQA 4XAFA 4RDYA 3SO7A 1RJPA 2YB1A 2Z26A 2GWNA 5E5CA 3MDUA 3OOQA 3S4TA 3D6NA 4F0SA 5HMFA 3S2NA 2WJEA 3GTFA 3GU1A 4LH8A 4F0RA 1A5OC 3EGJA 2E1WA 1UIPA 4C6IA 4XD3A 2VUNA 3CS2A 4C6LA 2QPXA 2P50A 3ICJA 1YMYA 3GRIA 4AC7C 4P5UA 2XIOA 1J6OA 1ITUA 4IH3A 2AQVA 2VM8A 3CJPA 3FDGA 4CQBA 4C5ZA 3MTWA 1FWIC 1I0DA 1A5KC 3DUGA 3AUOA 3MJMA 3LGGA 4YIWA 4KEVA 4I6VA 3GTHA 4EPDC 1A4MA 1IE7C 1EJWC 3S2LA 4C6JA 1UMLA 1O12A 4ZSUA 3LSBA 1RA0A 1P1MA 2DVXA 3QY7A 4DZHA 1EJTC 4GXWA 4GX9A 3LNPA 4HJWA 2VC7A 1FWGC 1J6PA 1W1IE 2Z28A 3S2MA 1EJSC 4C6KA 4BY3A 2QVNA 4DNMA 4MUPA 3AU6A 1JGMA 2P53A 4IF2A 3MKVA 1XRFA 3A3WA 4B90A 3F4DA 4LAKA 2GOKA 2Z2BA 4IFOA 1FWAC 1XGEA 4GX8A 3IV8A 4C6MA 3G77A 3QGAC 4EP8C 4C6NA 3O0FA 2Z29A 1ADDA 4H9TA 2YZ5A 2KAUC 3QY6A 2EG6A
chains in the Genus database with same CATH superfamily
3BQ5A 4QDMA 1MVYA 5ECUA 3K46A 4WDXA 3P84A 1FWTA 2AAAA 3AUJA 4B3ZA 2CBIA 2RJHA 3W1XA 5FJPA 3ZZ1A 3OZMA 1DQXA 4JKLA 3IIZA 3THUA 1M6JA 1S5NA 4H2HA 4NAEA 1TMQA 4O1EA 2WHJA 1CXLA 2OX1A 1XHGA 1Q6FA 3UWEA 3MHGA 4GC3A 1OZQA 5I09A 4X2PA 4F2BA 5E93A 1AL7A 4NAEB 5I3IA 1QW7A 2QCNA 4R85A 3JRKA 4GUFA 1A5UA 1QATA 1GHSA 3LCXA 1D3HA 4S3JA 1CGXA 1QPOA 1MMFA 1Y5VA 3URBA 4BCEA 5D8WA 4DUXA 1NSJA 2GDUA 3IVSA 2BASA 2FZDA 2XWEA 5CPLA 4O0QA 3C0SA 4UTIA 3I3BA 1EC7A 1JJKA 2J7EA 3G1AA 1X39A 4Q4MA 1VFSA 5MF5A 2XIMA 3LOTA 4J3WA 2P0OA 2EAWA 1DORA 1V6YA 3H4XA 3WF2A 3SCNA 4PGLA 1J2BA 4N9BA 3MO7A 4NZCA 5DXYA 1TMLA 3TFCA 2PTXA 1XFCA 1X1OA 5DRIA 1YYAA 3FSUA 2EJ1A 3LS9A 3AMGA 3ZT5A 1WKFA 1SM9A 1FKXA 2GOUA 1QHOA 4URIA 4ENLA 3C6CA 3RX3A 3VINA 3DENA 2QDGA 5C9WA 2GUBA 3N34A 2CLFA 1UR4A 3N6HA 3MI6A 3ARYA 3GDMA 3WQ6A 3GQYA 3QN3A 1UIOA 2G4JA 3ABZA 4EANA 3VIMA 2EKGA 1GQJA 4PUEA 3HJZA 1RA5A 3CO4A 3RM8A 4WHBA 3R0UA 3WLQA 3M07A 2VL4A 1VBRA 4P8XA 2WBGA 3UG3A 4BWLC 4UNLA 4POCA 3TLQA 2BXYA 3DGRA 3HU7A 3VIIA 4ZO7A 4H9UA 1M65A 4KEZA 8TIMA 3DHFA 1BKHA 4OVXA 1TWZA 5CSUA 1YDYA 4BKNA 3W7KA 3TQKA 2XU2A 1T6MA 2YXGA 2WM0A 1QW9A 1WQ5A 3QSTA 3RXZA 3WNOA 2QGHA 3PPCA 3VKAA 5BYWA 2J7HA 2F2KA 4RE2A 1A4LA 3W7CA 3CZGA 1W9BM 3AHZA 2B7PA 4A3YA 4D1JA 3URQA 3EB4A 4KESA 5ABFB 3THCA 1VPQA 4EAYA 4V33A 3NURA 4LPCA 1PBGA 3TN6A 2GJPA 3DG6A 3E5BA 1UR2A 1FHUA 4GVIA 1J0ZA 3HFTA 1CGVA 3N6JA 1ELSA 2BSLA 3B8SA 3CT2A 2C0AA 3C3NA 2CYGA 3DFNA 2OO0A 3KRSA 2C7FA 2G97A 3CTLA 3L4XA 4DQWA 4AWUA 3NZ1A 3WLOA 4ACZB 4ATDA 4D9PA 2WWCA 3IUHA 1PTDA 2PGRA 1AK5A 4OT7A 1N8IA 2PTYA 4S3CA 3GIYA 3AU2A 5DCBA 3AMKA 2VEIA 4DO7A 1V6WA 1LOSA 1E1EA 3T9PA 2DVUA 1GZJA 1VHCA 4MWAA 1K7EA 4P7LA 3AHVA 4I5UA 5FIPA 3DI1A 3VD4A 1HKJA 1WA3A 4M80A 3ZSTA 3CXOA 3E5PA 4MADA 4E4UA 3UVIA 3YPIA 3NO3A 1SZEA 4H04A 4DHGA 4Q32A 3BMXA 3VNDA 2X7WA 3ARVA 2C13A 4K3ZA 2AMGA 4XO6A 2ASHA 2PLKA 1DHKA 1IXNA 5CPNA 1TYGA 4D8LA 1V51A 3ZJKA 2Q8ZA 5CQ1A 1RAKA 4Q7IA 3W2LA 3RITA 1V02A 1I2PA 2WSYA 3WUGA 1XRVA 1ZBKA 3H7VA 4F0SA 1DIEA 3CAWA 4UTTC 3SUVA 4P8UA 3NZRA 5G2WA 3PZUA 3EMQA 5H8MA 1KXVA 1PTGA 2DZAA 1BGGA 1V3KA 1CT5A 1UCWA 3UZYA 3LNMA 4W4QA 1RD6A 8XIAA 4IH3A 2YIHA 4C5ZA 4N42A 1OVDA 4JY9A 4IIEA 5REQA 2X1UA 3S6DA 1TJPA 4N0RA 1E3XA 3MSYA 3GVGA 5EGRA 1O12A 5J5RA 4R9XA 1B3WA 3LSBA 1R3VA 3DFYA 3EKZA 3IIVA 3NXLA 4DXKA 3DX5A 3ZVHA 2E0PA 1WB0A 5E6ZA 1LZOA 2B4GA 4Q8QA 2PWVA 4D6IA 1GOMA 1SW7A 5AHFA 4A4AA 4YMZA 3CHDA 2O9RA 2BVTA 2VEFA 4EX4A 1C7SA 4ADTA 4PCSA 3AXMA 2WJZA 2VO5A 3FK4A 4JYFA 1JCXA 3WD0A 1A3HA 3IK4A 1GVRA 4QJ1A 3HQNA 1D9EA 4GGHA 1HGYA 3CMJA 3CAQA 1YNQA 1YBQB 1UH4A 3GNPA 3T0DA 2VTFA 4RLIA 5K2ZA 4ZA0A 1X6LA 4QEEA 4D6GA 2E9LA 2ISVA 3XISA 4ERAA 4I9AA 4RJEA 4CN1A 5LNUA 2ISFA 3ZJ8A 3UG8A 3CZLA 1F3XA 3SN0A 1F4HA 2DH2A 2EPMX 3I3EA 4UFHA 3MANA 2CZVA 2W61A 4PTWA 1YTKA 3RRXA 1WYIA 1JFHA 4ZXOA 3PZNA 1XLHA 4JAWA 1OCJA 2V8ZA 3N1AA 2VR2A 3ZLFA 3A9BA 4PUDA 3BAIA 2BVYA 3HPAA 1US0A 2C1HA 2O4QA 3V0UA 4FEZA 4EXAA 2HDJA 3T6CA 5C2XA 4DNHA 4GJJA 5DFAA 1EEPA 2G37A 1SW0A 3M43A 4EXBA 3KOWA 2W67A 1PTAA 2C3ZA 5HNNA 4F48A 3IUDA 2Y7DA 3UEQA 1A3XA 1I2NA 2D2GA 1EF3A 3DKJA 4DJDA 4RNFA 7ODCA 1PIIA 3VVGA 1E9IA 1A0EA 3P80A 3SSZA 1OD8A 3KWSA 4CVUA 4C7FA 5BRBA 3HGSA 1PVNA 1K4HA 3LHWA 1E4NA 1EPXA 2F6XA 2ZOXA 5T9CE 5A8OA 2G3FA 3VGEA 2CZDA 3CV7A 3T08A 1G5AA 2IMRA 3C2RA 1IHIA 1ALDA 1RHCA 4GK8A 1MI3A 4E3VA 1QNRA 3FLUA 2JEPA 5F1UA 3WNMA 4DBEA 1W8GA 4AWTA 3AS2A 3ANYA 4JTAA 3GBDA 3MY9A 1R2SA 4FF7A 1J0IA 4JGDA 1V79A 2VFDA 4GFSA 4N2YA 1WZAA 4RDZA 1TWIA 3OLGA 1P4CA 5LSMA 4NRRA 1CBGA 1W32A 4IJBA 2VCAA 4K36A 5DXXA 1UWIA 3SY8A 4GIYA 1MYRA 1JDEA 3BANA 1G67A 4UQ9A 3AC0A 3UWWA 1G69A 4D1IA 1ZSXA 2GGJA 1XW8A 4FX7A 3KP0A 4N4PA 3TROA 4GHRA 3WJXA 1GOKA 1MEHA 2BXVA 4IXHA 2PRLA 2NWSA 3TNBA 1XLDA 2WMIA 5AZ1A 4MNJA 3KVMA 2D22A 1P0BA 3M0XA 1B90A 1EGVA 4UTUA 4GJ1A 3F4WA 3UERA 3MUIA 1WZMA 4EPEC 1O5RA 2ZZ2A 1VFTA 2W4XA 3ZLGA 4BWLA 1WXYA 4C6FA 3S8HA 1H5VA 3CIWA 3UESA 3EB2A 4JD4A 1WAUA 2YDRA 1R2TA 3BDKA 4P7NA 2BFGA 3CUFA 2HVMA 1KRCC 5CGMA 3AXHA 4AMCA 3VZXA 4M1BA 1H5YA 3E49A 4HK6A 3NUKA 4QE1A 3VCRA 1TPFA 1R7OA 2E6AA 3IIOA 5FJIA 1YEYA 1GG0A 1KRAC 2TSYA 1MO0A 4ERIA 1E70M 8RUCA 4JNMA 4ILSA 4NP7A 4FLRA 1WKDA 2PBOA 1O6IA 4WCJA 2OR2A 1K7XA 5FJJA 4UOQA 4DBUA 2NXHA 1XSKA 1W1ZA 2NWRA 3GG8A 3W7RA 2D0GA 5E0FA 3CUIA 1WAWA 3DDMA 3VCCA 5HWMA 1QASA 4XSMA 3WBYA 1JQXA 1IWBA 1F73A 1ZCCA 3H2FA 3GKAA 1OBAA 4JFUA 3W82A 1TPB1 3IGXA 3B8WA 4YCPA 4AW7A 4H8UA 4D6EA 1BQCA 4QG6A 3OBAA 4NILA 4MPQA 4UNIA 2CW6A 4FO4A 3MYOA 4C5YA 1EJUC 1W3LA 3WF3A 1ZCOA 3FVDA 1CX9A 4FIQA 3SAZA 4YL2A 1SO6A 3K4DA 1GZ1A 3OW1A 1MW0A 4TXEA 2YR1A 1UWTA 1KNWA 4DWSD 4XB3A 5I02A 2ZXAA 2J7BA 3IRSA 3I7RA 3QQ1A 3ZWSA 1XYBA 3BMWA 5ABTA 2QT3A 3VK5A 2XFFA 4NVTA 3OTRA 2Z4GA 3DGBA 1EJVC 3II1A 4PMXA 5GJNA 7TAAA 1RV8A 2GJRA 5I79A 1Q6QA 4MOZA 3A64A 3P14A 4NZFA 3ZR5A 3USBA 2CKRA 2VENA 1RP8A 1PZ3A 4O14A 2GJLA 1T41A 1CZ1A 3N2TA 3OGRA 4PB5A 5BOFA 1ZQ5A 3DZ1A 2NVAA 4W89A 1GONA 4Z1CA 3GFXA 3SZ8A 4IIDA 4XX6A 3DXIA 3WNPA 4CD5A 3GAYA 3NL2A 4ZFCA 4UQCA 1TQXA 1CTNA 4QDWA 3DBNA 4GUJA 2XIOA 3P6LA 1DV7A 3ITTA 2DGAA 1EA0A 2H9AA 4B4HA 5D09A 1US3A 4OUIA 3AYRA 3C8NA 2CLHA 1CGWA 1BSLA 3E0VA 1XISA 1TJ2A 3S2LA 4C6JA 3A6OA 1E6QM 4QXIA 3UXIA 5GJPA 5L6UA 2QF7A 4RW5A 2DVXA 3CZKA 1WDWA 1HJSA 4PSRA 5K9DA 2VZSA 4AUBA 1HW6A 2Y63A 4CCZA 3CQHA 3LEPA 3CUGA 3TWAA 4ZQRA 3EDJA 1HFBA 1BRLB 1YW1A 3FW6A 3TLLA 1IR1A 4C6MA 3TMQA 3W24A 1K9FA 5FJUA 1ADDA 1SMAA 2PDHA 1EIBA 2YLAA 4OJYA 1D3CA 5I06A 3IAQA 4IMEA 4CU6A 4TIMA 2DIKA 2HPIA 3TE9A 4HD5A 4H3DA 4RUBA 4A8RA 5F2IA 5A8GA 2D23A 1R47A 4N9DA 3SN4A 4XZHA 2NZLA 1AW1A 2CHOA 4WIWA 4ES4A 1ZP4A 2J25A 2A4AA 2Y5EA 4FI4A 3W4RA 1XCXA 3KLLA 2OT0A 4P2VA 2CU0A 4Q4KA 3PC0A 4YYCA 1KQYA 3V1PA 4MG4A 1KM6A 4DIAA 4NASA 1TMHA 3LB0A 3CHEA 2ZZ4A 4AAJA 1GOXA 1PB0A 2HS8A 4P7OA 1IR2A 3GC5A 4PMUA 4XZ9A 4KFNA 3CL8A 3M0HA 1LUCB 2J8TA 4PBGA 2PDXA 1M7PA 1ZGDA 4XVEA 1EP1A 4J9JA 3SW6A 2PLJA 1XIFA 3G1XA 3FA5A 1KCKA 1UR8A 4HOZA 2XGIA 3TA6A 5A8NA 1XV8A 4AWSA 1TIMA 4UC5A 4LAMA 1UR1A 2FTPA 4JYEA 4A3QA 3LPOA 2E8YA 1WBJA 1EF2A 3CAKA 3W87A 4FSAA 3T07A 1SZGA 4ORMA 2E6YA 3FA4A 3AFBA 2UWFA 4UTJA 1VLWA 3ARZA 1NQKA 4Q6XA 1N7KA 3FHAA 2OZ3A 4QDPA 3DFPA 1T96A 3MT1A 1ZAJA 1QVBA 3VZYA 2W6RA 1FHVA 1NDZA 3MMUA 3QLDA 5G4HC 1TUFA 1IT0A 1UP3A 1Z41A 2WZTA 4EOUA 1B3XA 3SUTA 3KBWA 4C1NB 3UVAA 4FNPA 5DT5A 1GQKA 4GNKB 1X8CA 4NL1A 3GG7A 5GNZA 4XVDA 1FBAA 2DEPA 4G56A 2O4MA 5BU6A 2DJLA 3EEGA 1CLKA 4H9XA 4LNCA 5KMYA 2JFEX 3G6LA 3LERA 1VCFA 4ZOCA 5I77A 1GT8A 2BS9A 3GTNA 3QR0A 2ZXBA 3UETA 1ZPTA 1KFJA 3ECQA 4IP7A 4A21A 2Y24A 4YJ5A 4ICMA 5FL0A 3VUPA 3PJWA 3XINA 1DE5A 4YHGA 4KBXA 2INFA 3SGZA 5FAJA 3A3HA 1EO7A 2Z7GA 4WVXA 5T91A 5CG7A 4PTVA 1BYCA 3BPWA 4E4FA 4Q8MA 1PS9A 1E4IA 1UA3A 1VYSX 3QRHA 2BY3A 3BAKA 2GK1A 2WXDM 1OADA 1BF2A 3W7EA 1VEPA 2X0YA 1GKQA 1S3TC 4B91A 2BGQA 1Y0EA 3BV4A 3HB9A 5A5WA 4KRZA 4H00A 4HIBA 3NQMA 3DYMA 2YBUA 1SJCA 4LF2A 2OEKA 3DYOA 4Y7EA 3FEMA 4G8TA 1SR9A 5B80A 3RRAA 1Z32X 3PNUA 1JQVA 4IGMA 4LANA 1OC5A 4QAWA 3TCEA 2V82A 1R8LA 4H8HA 1H7OA 2VRQA 3KUMA 4DLFA 3VABA 5KITA 1TV8A 2D2JA 3W81A 4H9ZA 2OODA 3LCFA 3SIZA 5RUBA 2G3NA 3QW3A 1YDOA 3GG0A 2D2HA 3L4TA 1ML1A 1UH3A 1TX0A 4GE8A 1HX0A 2GSHA 3K2GA 1E5JA 3TR9A 4F9DA 1JD7A 3PY2A 2I17A 4FLQA 3F5KA 3R11A 2EHHA 2Q02A 2VZUA 1HKWA 4ROPA 2OZ0A 4UB9A 3U57A 4B5VA 1FWWA 4BF7A 2C71A 5T9BG 3GNOA 1E73M 1W1YA 5CZKA 3M7WA 3T0CA 1NH6A 4X22A 1UC5A 2JQXA 4HK5A 3UBPC 1EIXA 4AVNA 3P93A 1YRRA 3ZQ9A 2QGYA 2V69A 2PSNA 3AHYA 1XLMA 5E1QA 1PUDA 2Q01A 1H1ZA 1BG9A 1IWPA 4KRUA 4JTQA 5I78A 4J3XA 1KV5A 6TAAA 1RBOB 1YBQA 2HRWA 3UG5A 2BBFA 1DTUA 4YN5A 3ARRA 4WGHA 3VFCA 3TXZA 4TTUA 5B7ZA 2V81A 3LZ3A 3S4TA 5CZSA 5TAOA 4MTVA 3GC4A 4S3AA 2YXXA 1FWNA 2F2HA 1TPC1 4FALA 2FMNA 4AC7C 2FHBA 3MU7A 3NL3A 1XLLA 3T78A 1LLWA 3MTWA 1BYBA 9XIMA 1YPFA 4RK8A 1I0DA 4M6PA 3GM8A 3AALA 4ICNA 3HV9A 1FCBA 4LGXA 1W9VA 3AYSA 3U5UA 2E67A 3GTHA 3WQCA 5KTLA 1EJWC 4F0HA 2XWDA 1QBBA 1XLEA 4IIHA 2F9RA 3C56A 4ALDA 4HNCA 4WSHA 3BURA 4CD7A 3ITVA 4DNMA 3VDHA 5XINA 1IZCA 1UOZA 1A0CA 7A3HA 2YJQA 2YW4A 1XRFA 3VGGA 3F4DA 4UZSA 4LAKA 4D6CA 1X97A 1TPEA 4TMCA 3TWBA 1XGDA 3PZGA 3QTPA 3W7DA 4CKQA 2VEGA 3G77A 1TJ1A 4HPXA 5I0DA 1J93A 1QO5A 4EP8C 5CPTA 2WHKA 1GJPA 4DO6A 1QDSA 3QGVA 1FDJA 3VGHA 3W02A 1Q66A 2ZA3A 4FNTA 3LHTA 3SCRA 2A2IA 3O06A 4PTDA 3W1TA 3WLKX 4E3TA 4O52A 2PPGA 1TPVA 9RUBA 1T0OA 2FFCA 2NQHA 4Z08A 3WEMA 1LUCA 3EWXA 6PTDA 2ZQ0A 3N15A 4K38A 2YXOA 5DN1A 1V6XA 3GXIA 3GTXA 3UXKA 1DJXA 3L2LA 2VGGA 4HMEA 1E6SM 3L12A 1XLCA 1XFBA 2XDFA 1RUSA 4JIPA 4PMDA 3TJ4A 2NLYA 1H7NA 4L9ZA 4F9JA 1KFKA 2YB4A 3IJ9A 3E96A 2BHYA 5A1AA 4DUWA 4UXDA 3FIGA 3U4FA 2QIWA 4A3UA 3V36A 3R79A 3WLMA 3MYPA 1IIGA 2OZTA 4WR3A 3T05A 3IIPA 2J74A 4NZ3A 3U2OA 4IIGA 4V2XA 4UOZA 3NVTA 2RFGA 2VZOA 3H2EA 2I5GA 1YPIA 1HJQA 3UCCA 2YL5A 4CU8A 2GL5A 1JFXA 2REQB 2A21A 2ZDRA 2PDUA 5MKGB 1EZ2A 3VOGA 1BEUA 1AQ0A 3IJ8A 5A8QA 1CXEA 1QJWA 1GPFA 1UZ1A 3L68A 4F66A 4HOXA 2FGZA 1LBMA 3PVFA 2A7NA 4EIVA 5CJMA 5H1WA 4K8EA 2XUCA 1DEDA 4S23A 3BLLA 1NOWA 4GZIA 2CNCA 3OLDA 1CGUA 3CL7A 4QRNA 3JZEA 1Y65A 2VQUA 1BTMA 2OGJA 4Y9PA 3CMGA 2J47A 3NAVA 4PYSA 1HF6A 2MANA 4UTFA 5A95A 4V1XA 3T8LA 4GIAA 4FP1A 3GIQA 3IJDA 1GQIA 3Q67A 2ZX7A 2JK2A 2WMHA 3PUDA 3MQTA 1AH4A 2WHLA 3FY1A 2DQXA 4B5SA 1RQEA 4PR4A 4JN6A 3GDKA 1DWHM 3QC3A 1N8FA 1ZB5A 4RPQA 4NYYA 1BPLB 4JTTA 1B0IA 1LT8A 1YE6A 1ICQA 1R9ZA 4U28A 4AVFA 1SVDA 3HBLA 3PANA 4FR1A 4HTBA 4NAFB 3N2BA 3NQ7A 3WH9A 1FWDC 1UKOA 4KIEA 4XD4A 4DYEA 4MUZA 3BC9A 2J78A 1V93A 1B4KA 3EDKA 2FZNA 4NNCA 1W1TA 1DWJM 5HNRA 4FXRA 5C9ZA 1KM0A 2G3MA 1UKSA 1JL8A 4AZBA 5AY7A 1ZU8A 3V3WA 4WXZA 2JIWA 1XXXA 1FWEC 1MNSA 4XZLX 3OHIA 4S39A 4O17A 1Q4NX 2EGZA 5IXEA 1SPQA 4ZQPA 3C0JA 1BTCA 1FWFC 2XGBA 3G1SA 1TE1A 2X1TA 1EHNA 2DIJA 4O50A 3IJIA 3LHZA 2V3GA 1AVAA 3WK2A 1S2TA 4QITA 4BQ5A 4PMOA 3HG2A 2X2YA 1JCLA 1UWRA 2O7QA 4HKPA 1JYWA 3E12A 2BY1A 4WJEA 1OC6A 2Z25A 3TK7A 3QZEA 4DF0A 4N9CA 2Y7FA 1PYFA 1PJ9A 3LXBA 1DJIA 4UQEA 3ID7A 2VOTA 5AYBA 3VGBA 3P5ZA 1B9BA 1Q7ZA 3QTGA 2Q09A 4CN4A 2AL2B 3KZSA 1OGSA 3NG3A 3FGCA 5EPDA 1JAKA 4AF0B 3PFRA 4DPPA 2HBXA 4KPLA 4LYRA 4GY1A 3CB8A 2ATSA 3R8GA 1QI5A 4O28A 2NSXA 4ECLA 4DLMA 2WC7A 1R87A 1QRQA 4JIEA 3EAUA 1U5VA 1PWLA 1NP0A 4LVDA 1DE6A 2WKLA 4LUSB 5G2IA 2HVOA 4M81A 3A23A 2ZX9A 4ZVJA 5A6BD 4NJHA 4J3SA 2Z26A 1R3TA 3JS3A 3IAPA 3SUSA 4ZTYA 1EGZA 1RPXA 2Y5JA 4O1CA 4CLMA 5D2XA 4OE7A 5C55A 4S3FA 1TCDA 1XD1A 4C6IA 3H2NA 3L7RA 3CS2A 5ABGA 4HPJA 1GQNA 2P50A 3ICJA 1YMYA 4XQ6A 4NZ4A 3TTYA 1XLGA 3O9NA 4QE5A 4KRTA 1WZLA 3B9AA 2WSRA 4FAMA 1YE4A 4ZOBA 3S46A 2Y62A 1QTWA 4CU7A 2VZTA 2Y4SA 3F03K 3WBWA 1ECQA 1DXEA 1CI1A 1DVJA 1H11A 1RY0A 3GYEA 1UMLA 4U3CA 4CCCA 1UD2A 2DZUA 1RA0A 4HYWA 3O3RA 3B0PA 3CUZA 1EBHA 2MNRA 5M5DA 1EDQA 2BDQA 4DZHA 2F6UA 2W3ZA 5AZ0A 4MAVA 3VDGA 2X1RA 1RR2A 5G1MA 3CWHA 1XLIA 1JGMA 3IVUA 1GVQA 3T2QA 3AS3A 3PK7A 3CT7A 3SCVA 2EQDA 3N9KA 2GOKA 2Z2BA 2J75A 1HVXA 5LA1A 3O0FA 3BLFA 1TWDA 2YX0A 5I2UA 4PUMA 1UD3A 3WLJA 1F4AA 4Q4OA 3AXXA 3N29A 5K4XA 5I03A 5AN7A 4K6AA 4I5RA 3G3MA 3LTSA 1E9YB 1CECA 3W29A 3ATZA 4JTGA 4CEUC 1XIIA 2PU0A 3TC6A 4HZ6A 1ONRA 1U22A 4YPJA 1PV8A 1Q13A 3W6LA 3ATYA 3TOPA 1UBSA 5HR7A 4UR9A 1DWGM 2FB2A 3LA4A 3UJFA 4C6DA 3VNJA 1PZ1A 1QU4A 3UZZA 3W1MA 2PTDA 4E5TA 3O7UA 4BFAA 6XIMA 1Z6KA 2BWGA 3BOXA 2E7FA 2GFTA 2NUXA 3B9DA 1LQAA 5FA5A 5HR6A 1QOXA 3HV8A 4JHOA 4V28A 2DZBA 1QWKA 3W27A 4IZGA 1MZRA 3M0YA 4UR7A 4QSHA 3M7SA 1NF0A 2WWDA 4OU1A 3SQSA 4DF2A 3B0XA 2ATMA 2ESCA 4LTSA 2PWEA 4WXYA 1VLIA 3BSHA 4RR4A 5LA0A 2E40A 1XRTA 2VDHA 1MUCA 3EX6A 3W1UA 1OF6A 1XSJA 1ADSA 4LRSA 3RAOA 2RJGA 4J7RA 1LYXA 3ZVHB 2PLMA 2ZX8A 4LEFA 1E56A 5EU9A 1KRBC 3T55A 5IBXA 1RH9A 4AX7A 4WY0F 2HV5A 3OZOA 3GUWA 1FWHC 2C14A 1ISZA 3QXBA 3EOLA 4AXKA 3RNDA 3OVPA 1P6BA 3CH9A 4KKXA 2C91A 3DFTA 4IMGA 3FHQA 3TW9A 3L65A 2DUAA 4O10A 2XSBA 1XGZA 2X30A 1UC4A 4K1WA 2V2HA 1CB7B 1CCWB 4UMBA 3UYIA 4B3KA 4XWUA 1JF6A 3XIMA 2ZUUA 2OVLA 1GPWA 1GUVA 4ZQCA 4ZMGA 4U10A 4IP4A 1QFEA 2CHRA 1ONWA 1Z89A 3LV6A 2BOGX 3EOOA 3LXAA 1VYPX 3NSMA 1K77A 2CBJA 1TJ0A 2X2GA 3GS6A 4JEJA 4AZCB 2CLLA 3LCIA 1UG6A 3P0XA 4NHVA 2ZZ7A 2ZADA 2OQLA 2CWNA 2PWHA 3U7VA 3ITYA 4KEMA 4GD0A 2Z1BA 3DH7A 4AD2A 3VGFA 4JTDA 3KCOA 4Y2WA 1SYTA 5A94A 1HP4A 3RYSA 1XIJA 3UZJA 4Z2IA 1JG9A 3QQ0A 3RK8A 5AC4A 5A6AA 3PFMA 1UZHA 2P10A 3PTMA 3UR5A 3HGJA 4L1XA 3K1DA 3HTWA 3GVVA 4I8YA 2VJXA 3EKLA 3EB3A 2DV0A 4J4KA 3ZFHA 4D6JA 1C9DA 4WRHA 4GGBA 2B0MA 3W1AA 5GPRA 3HFYA 3VDBA 4A2SA 3GFYA 4BQ4A 1OG6A 3OHMB 3PJTA 3TNOA 4GXMA 3C5QA 4MWAC 1S1RA 2BLEA 3A3XA 4O16A 2E1DA 3VOHA 1P6WA 1V0MA 1B3OA 2NV1A 1FHLA 5CGTA 3SEPA 1A50A 3ZJ7A 3UU0A 3GVRA 2QPSA 3I7SA 1YXYA 5EA9A 1KC7A 3EA3A 2GJXB 3TX9A 2CEQA 4XG1A 3EPNA 1RLCL 3H53A 1E72M 3QW4B 4XBJA 3LDVA 1K6WA 4KETA 1U2YA 2FTYA 2V5LA 1Q2SA 1LWHA 1Q6RA 3C4UA 2FVKA 1E3ZA 2ONEA 1J18A 1EYWA 3FYYA 4H41A 3F2DA 2NV2A 4PMVA 2AKMA 4J2PA 4UUIA 3FS2A 1OFQA 2G96A 4CQAA 1VKFA 1ZJHA 1KTNA 3SBFA 1DOSA 1RVGA 4GIEA 3C86A 1HUVA 1NFPA 4RE4A 3PN8A 2PMQA 1L9WA 5M1TA 4MM1A 2W92A 1XIHA 3BTNA 3VD3A 5H91A 3BAXA 2PCEA 1S5TA 2QAPA 3VE7A 3MZNA 2PI6A 4JCMA 1EC9A 2AQVA 3ANVA 1FDZA 2QV4A 5AVNA 4YCOA 3GBEA 3W22A 4O0KA 3ARTA 3TTOA 4FXJA 4TU1A 3SQLA 4KEVA 3W86A 4PL1A 1W3IA 2B81A 1A4MA 3O6DA 3NGJA 1KKOA 4CNPA 1QK2A 4GIRA 4V27A 4UFIA 4ZOAA 1EJTC 3O07A 2IS7A 4M5PA 4D8ZA 2YSWA 4JICA 1EJSC 4BY3A 3OVQA 2NQ9A 1I45A 1QWGA 4M24A 1H0IA 3GAKA 3BCFA 1UJQA 1BXBA 3GDBA 2ZUSA 1YDNA 5HJLA 4KCUA 4KCWA 3VIOA 3WD3A 3W25A 2Z29A 3EX2A 1CIUA 4FR6A 4JX6A 4BI7A 4HPNA 1VRXA 3EWZA 3WQWA 5BW6A 4OBSA 1XF0A 2XJ7A 5D30A 3NDOA 3SSJA 3B9NA 4DAIA 4ZTXA 3Q45A 2H8ZA 1GK8A 1XLJA 5DRCA 3NL6A 1ESWA 5HA7A 4PTNA 2WKJA 5JVLA 3L9CA 1W6TA 5CLTA 3UXDA 4ATWA 2QUUA 3H8AA 3VIFA 1DIOA 5C70A 1XBXA 1SFTA 1QI2A 3W7MA 3FJNA 3AMCA 3GY1A 1R6WA 2DSUA 2X7VA 4JFVA 2XFYA 4LBRA 4HHPA 2IKGA 3PZTA 4AZCA 4WD0A 1JZ8A 4JX4A 3ABRA 1SJBA 5KSWA 5DT7A 1JULA 2PGFA 5AECA 4WOZA 4WUIA 3AWOA 1ONXA 3GE7A 1XIDA 1K1DA 2ZWYA 5BRPA 9CGTA 1GYNA 4DBSA 3BH4A 1Z3NA 3POHA 3BAWA 2V6AA 4NY2A 2PDCA 4IG2B 4Z2KA 1M9HA 3W2NA 3S2JA 3DYPA 2J6XA 2QUMA 4AZ7A 1FCVA 3MS8A 2F8QA 3IWPA 4ERGA 1GVFA 2BGSA 4OOUA 4L6DA 4JTEA 3QHMA 3G2GA 3IANA 3ZT6A 2CPUA 3ES8A 1JZ4A 2Z2AA 3ARWA 3KAOA 2CESA 3I68A 4U5IA 1ODZA 2FPYA 5M03A 3VOJA 1FWRA 2WZEA 3CYJA 2YKKA 4AD1A 4DY1A 3VNLA 1RJQA 3ZYZA 3S9ZA 3E0FA 3L4VA 1W5QA 4RX0A 4N9EA 3CGTA 1W3NA 1HKKA 2O56A 3WKZA 1O1ZA 4RL3A 4HSHA 3VZZA 1ISVA 3LQLA 3RM4A 3RIKA 1IT8A 4GMEA 1VFMA 1UD8A 2I16A 3O2LA 4AZIA 4JXCA 1TB3A 4IISA 5C9RA 3P8JA 3NNTA 4XZMX 3R12A 2X1SA 1KFWA 1FXQA 2E5DA 4XISA 1D3GA 1UKTA 3OQEA 3BLPX 3UA4A 3WJYA 1Z9AA 3KE0A 2DT2A 1G4PA 2FMOA 3EA1A 3D47A 3TTEA 3O16A 2NLIA 4UIOA 2UBPC 3WUFA 4QGCA 1ZJAA 4M7TA 2J66A 3NZQA 3HF3A 3R4IA 3W1LA 2AL1A 1ZJIA 3H54A 3CEUA 1HVQA 5D9NA 3UXLA 3N13A 3LD5A 2WPGA 3K5XA 4REQB 1P0KA 1WXZA 5DQPA 2WNQA 4EWJA 5ECVA 3RPMA 2V5KA 3UZWA 5D2WA 4HGXA 3F2BA 1V6TA 2TYSA 4Q8TA 4ZE5A 3CQJA 2RDXA 4LALA 1WKYA 2ZUTA 5C2GA 3NO5A 1TELA 4L4LA 1LL7A 1F74A 1NTHA 1Q63A 4JDBA 4MIMA 1LTDA 1BGAA 2RGLA 4OBRA 3N2MA 1EP2A 2H3DA 4W7VA 3UFYA 1EYEA 5HDRA 4DF1A 4GY7A 4I6KA 1KM5A 1HNYA 1SZRA 5F2GA 3LZ5A 3KBNA 3PBGA 1NM9A 1F5ZA 4HMDA 4L9XA 4KIRA 3B8DA 1ITQA 3COTA 1DL3A 1LP6A 3A47A 4G7EA 3DG3A 4WSJA 4OECA 3LRMA 4JS3A 1U33A 4O53A 2ZRYA 3M46A 2PGWA 1NDYA 3P0WA 2RH9A 4F8XA 3LTPA 4L1GA 3D46A 4CUCA 4GZJA 5A6BA 1GQLA 2P3EA 4Q7NA 2YA1A 2GYIA 3UGVA 3O0KA 2J13A 3TTQA 4AF0A 5JIWA 1XR2A 4H9MA 2EPLX 4L6HA 1L6WA 2YLLA 1G7UA 3UCQA 3TIMA 3G3DA 4ASTA 3WLHA 4NX5A 4QG9A 4XIAA 3DESA 3ITXA 3B8TA 3W7GA 1E5NA 4W7UA 3PBYA 4YTQA 3B8IA 3VKCA 4IJRA 1CXFA 1FCQA 4CN6A 3EDFA 1X1NA 2XVPA 4HTYA 2VX4A 3PHAA 2OWWA 4L4MA 3GTFA 4AU0A 2GK1B 2Y8KA 5D32A 2YYTA 5CSSA 3ELFA 3ARXA 3K8LA 4FNUA 2CFFA 3FN9A 1HJUA 4LVBA 4E8CA 4HU8A 2VNCA 4IM4A 2J9ZA 2NX1A 4B2DD 4JL2A 3RDKA 2DZVA 2RDUA 1OX4A 3L5AA 3F7JA 4O4WA 2V2DA 3SI9A 5FAGA 2Y88A 1K03A 3AUOA 2WBKA 4XTDA 1DHPA 3UNDA 1FP9A 1FOBA 3GHTA 4ZSUA 2VWTA 1BG4A 4GXWA 1DJYA 1QPRA 3GH4A 5CCZA 4YNGA 5CC3A 1D7FA 5BCAA 1G1YA 2TMDA 1XH1A 3AIQA 3H4GA 3OIHA 1CXKA 5FJOA 3E02A 3THDA 1Q6CA 3ME3A 5FI8A 5K3VA 2UY2A 3GLCA 2FJKA 1L8PA 3A9IA 1QW8A 3QVQA 3HPFA 2ISSA 1XDLA 2PCQA 1AH3A 3KHDA 4RDVA 1D7KA 2A1YA 2X41A 4BHYA 2FB3A 4QS5A 1CLVA 4XZNX 2VC9A 3O6AA 1P0EA 2GLKA 3QEZA 3R7MA 2ACRA 4B15A 2RKXA 4I9MA 4DB7A 3BGGA 4V1YA 4D72A 3N11A 1TA3A 1XQLA 3SCUA 3PTDA 1IV8A 2P8CA 5LHEA 4WY0A 4R27A 3QHOA 6REQB 1JNEA 2PDGA 2Q71A 5AHIA 2ZRZA 5CC7A 4Z0JA 3CL6A 4GBUA 4FOJA 3E0LA 3Q65A 4PULA 4KQNA 4G1KA 1VIZA 2ZRVA 3MCOA 3HMJG 2A3LA 1UWAA 3WH7A 3K8MA 3ABSA 5E9AA 2KZHA 4X3ZA 3QYQA 3GVWA 2C18A 3AROA 1V3JA 1Q5MA 1E6RA 4CNNA 4PB4A 2Y0FA 1BKSA 4LVAA 1VH7A 4R53A 4IL2A 3PZIA 1W5NA 4FNSA 4S2BA 2H90A 2PAJA 1JZ2A 1OFAA 3GTIA 3JUGA 4R7WA 1LOQA 1VFFA 3NXFA 3T4WA 4IQJA 2Z1WA 3A4WA 3NO1A 5JU6A 2D24A 3TSDA 1UB3A 3F5JA 4A35A 3VNMA 3PBUA 3PWAA 4UZUA 1E51A 5F4XA 1G01A 1Q2RA 1XX1A 3HQ1A 2YCJA 3M0IA 2YBVA 3GH7A 2G0WA 1S5WA 1KWGA 2VRKA 1LBFA 3A22A 4JTFA 4MF4A 2ICSA 2BOEX 4AIOA 1W2VA 3LMYA 5E0KA 1YQ2A 4M56A 3G1RA 3P60A 1K8YA 3QZ6A 3L4YA 1KA9F 3UGRA 3C2FA 1KCXA 1IWAA 2CXGA 5AFDA 2IKJA 2JKAA 4PBFA 2XHYA 3W2KA 3MMTA 1JDFA 1BFNA 1LL4A 3N12A 4GKTA 4QX4A 1GYMA 5JUVA 5C6MA 6REQA 1XUZA 1E0TA 1MW3A 2QPUA 1OT2A 1TVNA 4JHZA 5HQEA 7PTDA 1Q7QA 5A6TC 2R94A 2E9BA 5AHLA 2X09A 4GG9A 1ZLPA 2AOSA 3SM0A 1KM2A 4UTMA 3GFZA 5E0CA 1BYAA 4H6RA 4QLLA 4ACYA 4I7VA 3HGOA 4Y8FA 4AZ6A 4GZ7A 5BZAA 1VENA 4NNAA 4J3VA 1TZZA 4TTGA 3GDTA 1M68A 5KZEA 2XVNA 3M0VA 5EMMA 1SO5A 4BF5A 4YTUA 3R0KA 3N6QA 1FWSA 1EWEA 3CZ8A 4L5ZA 3NTYA 4NQ1A 3UT0A 3V35A 2DIEA 4LQ1A 1JPDX 1NQ6A 1IF2A 4S1FA 5HWJA 3PB2A 1ISYA 3B05A 3W1NA 3LYEA 4DI9A 4YVPA 2AQOA 1AZ1A 3BE7A 3TYAA 5BMWA 3APTA 1THFD 3AO0A 3RLUA 4PMNA 1J5SA 1GW1A 4LW7A 4B5WA 4Z42C 2HE8A 3R8HA 2D2OA 3FKKA 3TFXA 5A2CA 1L6GA 4L9YA 3GSMA 4YXGA 3G0SA 1PKLA 1JZ7A 1UUMA 1F3EA 1WDQA 1RVKA 3IRDA 2C1GA 1WPCA 3VD9A 1V3LA 1N55A 3WD1A 4H8NA 2FZBA 4BJHA 4C6OA 3W7QA 4GI6A 4DJFC 3CZJA 1AA1B 5J04A 3F4NA 3AIUA 4LFYA 1OB0A 5JH1A 2YA0A 3VX0A 3RF9A 1WV2A 2SFPA 1HP5A 1K8ZA 5CPMA 4HNNA 3QC0A 4KEUA 3WLTA 2XVGA 3BW2A 2WC4A 1TRIA 5XIMA 3RU8X 3PNZA 3W00A 2A7RA 3CUJA 2I1OA 1YLVA 4AHOA 1LRQA 1XC6A 2XIJA 3WMBA 5GNYA 4AY8A 1W5MA 2GGHA 1UZDA 4I8DA 5E9XA 1DTNA 1PDZA 2G95A 4Z2GA 1GWJA 4FOUA 1QT1A 1S38A 4G6CA 4ZR8A 2GWNA 4GXPA 5D2YA 3MDUA 1XG3A 2AGTA 4P8WA 2EPNA 3WFAA 2B7NA 3D6NA 5HMFA 5LKYA 2ZVRA 5AVHA 3HQOA 2W79A 2DW6A 2VGIA 4JPGA 3WQ5A 4CNOA 4CCDA 2V3FA 1EUAA 1VFOA 1EA9C 1V0LA 1XLFA 3HIJA 1UWQA 3P74A 4CQBA 2VM8A 1NJJA 3ZWTA 3W2UA 5JBDA 5DMLA 1QK0A 1XI3A 2VR5A 4QP0A 2QMJA 4YIWA 1XICA 1SR0A 3D5HA 1XSIA 3OZPA 3FKRA 5L9FA 2NW0A 4CQ8A 5IDIA 3B4YA 1G7VA 1JD9A 3T0AA 2WMIB 1WO2A 3QY7A 5D9PA 5DLCA 1W1IE 2HS6A 2Z28A 3G6MA 1J9YA 3S2MA 2G3IA 1BWLA 3UY8A 4LX4A 4L7ZA 2P53A 3NOEA 1ODUA 4HNLA 3S1WA 1JZ5A 1XBYA 3VILA 3KP1A 2RHGA 1A53A 5G1TA 3FCPA 1FWAC 1XGEA 2WCSA 4LUJA 4GX8A 1MDRA 1T8QA 1U1UA 4M3PA 3GR8A 2A0NA 1M53A 4TV5A 2Y6ZA 3W6MA 2KAUC 1CXHA 4F0KA 4WJ8A 4CQCA 1VEOA 3USZA 3NYZA 5BOEA 5LNVA 3NZPA 4EPKA 2A85A 1JPHA 3CK5A 3P62A 1IYXA 2X05A 5BWFA 3S1VA 3I4KA 4WSKA 3A12A 2CIPA 2ZX6A 3EOSA 4I7WA 5LXXA 3N9RA 2ZKMX 4HU4A 1Q65A 3GX9A 2Q6ZA 3RO8A 1UR9A 2Q8XA 1JUBA 4E2VA 1JGIA 4RXFA 4A8IA 1I60A 3WFZA 2OPJA 3F1QA 1YX1A 3IACA 2Q8LA 4C6BA 5LNWA 3M41A 4B5NA 3N14A 2QJIA 1K4GA 4QBXA 1TPUA 3EKGA 4PC8A 3BK0A 3WQ8A 5F2LA 1YNYA 4XKYA 2WZHA 3APGA 3RLHA 3OODA 2OB3A 3FV9A 1RK6A 4N6FA 3V7PA 1L0PA 5HPOA 1BWVA 4Y6GA 4M29A 4JEQA 3M6DA 3MKKA 2XH7A 2FHFA 4Q8NA 4F0MA 4EWND 2X42A 2D69A 2ZE3A 3RMJA 1PCKA 5D03A 1WKEA 4QAIA 2VP8A 1F7BA 2NX9A 1XD0A 3WYZA 2QMKA 1CYGA 4U4MA 1F61A 3UJRA 1R9YA 5G4WA 1XYZA 3KOZA 1OINA 4F79A 4AEEA 4CGTA 3S9IA 1JNDA 1HKVA 3P67A 1OQFA 4D2JA 4GISA 4Z1BA 4AC1X 3U6WA 3B9EA 4HNTA 5I07A 2R1KA 4CNUA 3KOFA 4AB4A 4H7CA 2WSKA 1ISWA 3R13A 1E71M 5J5DA 3W0KA 4GUIA 3GU9A 1DWIM 3LM3A 1R85A 3SUUA 4GLEA 1EUNA 1BWKA 3NPWA 3PZQA 5JBEA 2PFHA 4BQ2A 5TF0A 1EQPA 2ZRUA 3ONBA 4KMQA 4S3KA 3WJSA 3S9YA 2OCZA 4IQLA 5T8GA 5AC7A 1OK4A 4MYXA 3PP7A 1EFZA 3KL5A 3L2IA 4DWSA 1QHPA 2B7QA 5EMYA 2ZTJA 4J40A 1QCWA 3HURA 4JFWA 3IEBA 2GQ8A 4JDYA 3B9OA 3F2CA 2E77A 2OKOA 2V5CA 3GNNA 3PR2A 3T2OA 3OVRA 4LJ3A 1TRDA 2F38A 4AVOA 3LCGA 4Q33A 4GBDA 4MB1A 1U1JA 3VC5A 1A5CA 3R8RA 3DFQA 5CKSA 4IMDA 1MRQA 3PPHA 4W7WA 5FESA 3GU2A 4Q4RA 1F05A 2PC8A 1L6SA 3KRZA 1HO1A 4QFUA 2C8NA 4MFEA 2POZA 1LJYA 2CLPA 5AOUA 1KWKA 5CPOA 5C71A 8XIMA 2F7FA 1SO3A 4QROA 3I6TA 4REQA 1HQTA 2PGEA 3LI1A 1MW1A 4LWWA 3ENLA 3SDOA 1J8VA 3W83A 1NU5A 4JYDA 4LB3A 3S83A 2DZPA 1PSCA 4IGNA 3EPOA 2P1FA 1XINA 1WE5A 1R38A 1YXDA 3CAVA 4QSFA 1JCJA 1OM0A 4D8AA 1FDYA 3TSBA 3ZOAA 1XRSA 4XV0A 3G1YA 1A5NC 3QQWA 5EMLA 5DCDA 4CVWA 3AZRA 2WZMA 2V38A 4B2DA 1M7XA 2GQAA 2DUZA 2DY3A 1GTHA 1M04A 3WLPA 4FF5A 4C1LA 2B7OA 1LCOA 1AZ2A 3OBEA 1XDJA 2OEMA 1VZWA 2ISWA 1YDVA 1NWTA 4E6MA 2J7FA 5HMDA 3R58A 3GC2A 3W6YA 3JU2A 3GXNA 3CV6A 1UQZA 2OG9A 3N73A 2G4FA 1KQZA 1W3KA 1MXGA 3DHDA 4J2MA 2R82A 4HZ7A 3W01A 1H50A 3EA2A 3WF0A 1DQWA 2YFOA 3VD5A 4UTKA 3EOEA 4MNMA 5B7YA 4AIBA 3WZ0E 2IPJA 4F2TA 2AAMA 4LUTA 1QR7A 1SGJA 1O68A 3NQ6A 1VEMA 3SJNA 4KERA 1DBTA 3P7YA 3JVAA 1A0DA 6A3HA 3OOQA 3T0BA 2OKTA 1X6NA 3DG7A 4LEQA 1KW1A 1UIPA 2WQPA 5AC5A 4P7QA 5IBXC 1GOIA 4MJZA 2QPXA 4RXGA 1Y8BA 3ZMRA 1VQTA 5AHMA 4P5UA 1P1XA 5IFTA 4JN7A 1ITUA 2WSPA 1PHWA 1IQ8A 2VZVA 1BHGA 4PB3A 4NF7A 2GJXA 4U2ZA 2XIIA 3HG4A 4K7VA 1HGWA 3I6RA 2VR4A 2GSJA 3CPUA 1P1MA 5FF0A 2W0UA 4HJWA 3STCA 4S3GA 3W2JA 1FWGC 1J6PA 1HJWA 3H55A 1PZ2A 3NQCA 3WLRA 4JTJA 3PB0A 3P5YA 4Q4QA 3AU6A 4TR9A 5AHEA 1TO3A 4L64A 2XVLA 1XYCA 3A5FA 1VJZA 4ADUA 2PTZA 3H24A 2V3EA 2OYLA 5IOBA 4ZEPA 2HJPA 3Q58A 3RMEA 3W85A 5BXSA 1HG3A 2HCVA 3WQPA 4IL0A 3LMZA 1DJZA 1UHVA 4BF9A 3PG8A 2NQ5A 1WDRA 1VFUA 2R8WA 3DFHA 1SZNA 2QCFA 3WELA 1NY1A 1XIEA 3T4CA 4I9TA 1QNPA 3DHUA 3AICA 3RG6A 4KS0A 4A3RA 1KXHA 3VUSA 3WNNA 1OABA 3WX7A 3BWWA 4HOWA 3TMLA 3CLWA 3WLIA 2HK1A 1RQBA 1VJIA 4HN8A 4L80A 1LBLA 4GVGA 3U4AA 3MMDA 3CHCA 4QCEA 4PL2A 3TC3A 1EX1A 1VD6A 1PIFA 2OYMA 1S46A 3B8UA 1R3RA 4HCLA 3LCLA 4KGJA 3AMDA 1K02A 3BCJA 4OFCA 4H9YA 2EBNA 1JDDA 4GZEA 5C8BB 3LGDA 4XUYA 1V7YA 3R0DA 1L6YA 3N9SA 2FPTA 1A5MC 3NQBA 1PXGA 2GVGA 3EX3A 3SFKA 4RV3A 3AAMA 2A3HA 3KM8A 3BZJA 5TQLA 4FMVA 2QS8A 3FEQA 1DJHA 2O9PA 4GQRA 2XPKA 4IP5A 3C52A 1B5TA 1JDCA 1GTEA 2VI0A 3RCYA 4H6QA 1M7JA 4HYVA 1TTJA 2PDBA 1Q7MA 3KCJA 1R2RA 4PTXA 3URNA 4HNUA 3C8FA 2HPMA 5AYXA 3ZIZA 4WLCA 1VAHA 1W0MA 4W88A 1NVMA 3N3TA 4BK9A 2X0SA 1O7AA 1HN1A 3PUEA 3NR0A 5D37A 2BHZA 2BVDA 2OFJA 3IV3A 1KD0A 3EDEA 1O95A 2DZWA 2VX6A 3OU8A 3AIBA 3ARPA 1IXQA 3TN5A 5HJYA 1GEQA 1VHNA 5HK4A 1REQA 5FF7A 1OK6A 3RUBL 4H83A 3BG5A 1D8CA 3AOFA 3WLSA 3EWDA 1KR0A 2QJNA 2CITA 3V16A 3QMSA 3MUZ1 4FX6M 2YOCA 4MJ2A 2VGFA 1HT6A 4NG3A 4HCHA 2BV9A 4NNBA 1I8JA 4UTLA 3VE9A 1LWIA 5EMJA 3SGGA 3N04A 3TYDA 1GCYA 2ZE0A 1MZHA 5CXPA 4PFHA 1UA7A 3OBKA 4KWUA 3W53A 1J0HA 2HWGA 3R10A 5BNKA 3L0GA 5G2HA 1AODA 4IPJA 2POTA 4WEVX 1TZ7A 3IUIA 3H70A 4QLKA 1TV3A 5EL1A 5I6SA 2ZZ5A 2E9MA 8A3HA 3GUGA 3PULA 4LCSA 2XZ7A 4LYPA 1E40A 2C0HA 4B5UA 2A6LA 1IT7A 3MV11 5ENLA 3LTYA 4LNYA 5D05A 5LA2A 4W9TA 4IGSA 4AEOA 1JAEA 4L4PA 1XBVA 1JCMP 3LBOA 4HPHA 1D2KA 2CCRA 3QPYA 1POKA 1E6PA 2A3BA 3KS6A 3GKFA 4RKAA 1KGWA 3W7OA 2NXGA 5K7JA 1PO9A 4CD8A 5CC6A 3TXVA 3KVKA 1KFCA 4P7RA 2GZXA 1QI4A 4IWWA 1AQHA 3STEA 3PBMA 3MP4A 3G5EA 3BARA 2P3ZA 1W54A 2QR6A 3LPGA 3NEHA 3MBFA 3M44A 4S3BA 1B3VA 4PCTA 4ZFMA 3G22A 5CSRA 1AQFA 3EMZA 1XIBA 4GA8A 5HNTA 1RCXB 1K8CA 1DPMA 1OFDA 4ROQA 3PSWA 5HATA 3CHVA 2QCEA 1FH9A 4DJFD 4QHRA 1EEXA 4K39A 5CGQA 4PFMA 4I3GA 1TE6A 2Z6IA 2Z1XA 5D04C 4EF8A 1GKRA 5KINA 4CNTA 3ITGA 4GI8A 5C7HA 1J96A 1NELA 3MP5A 3VIHA 4HNVA 3VOFA 1KV8A 2EG8A 5D38A 5BXTA 2C15A 4TX6A 3PBVA 4F0LA 3CPRA 2OWCA 3W74A 3M47A 5BWAA 3E0WA 1AQMA 4NX0A 2R14A 3I10A 4H8VA 3IPWA 1EJXC 4TX8A 3EX4A 4PMJA 3GR4A 3LY0A 3PUOA 3WL1A 4G7EB 3UJSA 2FZ9A 2PZNA 1RJPA 2YCEA 2FJUB 2Y7GA 3S5YA 2PF0A 1TV7A 5BMXA 2JF7A 1A5OC 2GQ9A 5TIMA 3H6OA 2C16A 3FAWA 4M1RA 2EPOA 3KBSA 4O4VA 4MY8A 1J6OA 2FDSA 1R3QA 3R1ZA 4WKFA 5IHRA 3RU6A 1KKRA 3GWQA 3GG1A 5IM51 1AG1O 1HTIA 2ZYFA 3P82A 2YCLB 4YU1A 4QIUA 4ZQMA 3ZSSA 3QPEA 5F7UA 1OGBA 3VMOA 4ACZA 4Q8UA 4AH7A 3AIEA 3B4UA 4F4RA 3H2AA 4C6KA 2OYKA 4AZGA 4LBUA 3SCPA 3A3WA 3EBVA 3TJXA 3AISA 4UQDA 4M0XA 3WQVA 1Q6OA 4R5EA 1MUWA 4O57A 1SFJA 3SY1A 3RILA 2GVJA 2C79A 3TTSA 5LIXX 3SCQA 3FJ4A 1J11A 3NEVA 1E6NA 3VI2A 3WDRA 4JKMA 1W2PA 3NQFA 2LLEA 2DSKA 3H21A 3PSVA 2WMJA 2NQJA 4Y9AA 3NSXA 1EGMA 1UJPA 4QTGA 1K70A 3LBMA 2PWDA 3ITOA 1AJ0A 1PWMA 3E0IA 3QBUA 1PE1A 2XM1A 4TV6A 1E6XM 1X8FA 1PAMA 1DQUA 1KTCA 4HQVA 5FCZA 3GNDA 3H7UA 1W3HA 4JHMA 3LLDA 2VCBA 3BAJA 1SFLA 3VNYA 1R3SA 2DT0A 1FFRA 2CETA 3MUXA 3CH0A 1V7AA 4NJJA 1P7TA 1O5XA 5EMUA 3R25A 4EF9A 2QDEA 3GZAA 1MXSA 3ITLA 4ZB2A 3L4WA 3KL0A 1WUEA 5CLWA 3EWCA 3CASA 1B3ZA 3QMRA 1LT7A 3EMCA 1TCMA 1HJXA 1PX4A 3A4JA 1WDSA 5EB8A 1HZYA 4HHLA 4AQLA 2Z1KA 2GQ3A 2DZXA 2ZC8A 3VMNA 2CLKA 4JTKA 3W7JA 3S5NA 3CC1A 1QXLA 2PBGA 2WJFA 2E5CA 1TFVA 3U2EA 5HANA 3HG5A 1PEZA 1SJDA 4US6A 5CG0A 3AXKA 3UPBA 1F07A 5HQLA 1C8XA 3QH2A 3SRFA 1O5KA 4LC6A 1QNSA 2NT1A 3PTQA 4MNLA 1OFBA 1LWJA 5KZ6A 2OXNA 4EK7A 4IG2A 2V67A 4HU3A 3BGAA 3MWCA 3WD4A 1MWOA 3KRUA 2PDMA 3LSCA 4BEUA 2RGMA 3I6EA 5MKGA 4PRTA 1H2JA 4UQBA 4PMRA 3GXFA 4AZ5A 4YYFA 1OT1A 2CLMA 3QV8A 3B0UX 2NQZA 1FTXA 1FRBA 3FOKA 4RZ4A 1NEYA 1R30A 1GVEA 1UR0A 4DBDA 1XCFA 1LLZA 3KBVA 3MJYA 3GZ3A 1TG7A 3DIPA 2VUYA 4QCFA 2DH3A 2DW7A 2XN0A 3N2XA 2X16A 2QIIA 5FEWA 1C9WA 4B16A 4UMCA 2YDQA 2ZVIA 3HJEA 3M0LA 3BICA 1JVNA 4ZO8A 1W9UA 3WQGA 2QCDA 3LV5A 2VGBA 2H9AB 3TZNA 3BL3A 4LXFA 1TQJA 3U0HA 3TJIA 3BLKA 5A8PA 4QE4A 3LG3A 1W1VA 3W3OA 2INEA 1BVNP 2Z6JA 4TMBA 4PA8A 5A2AA 3M0ZA 1S2VA 1GKPA 1C91A 1US2A 4WGXA 4OKDA 1QBAA 1XLAA 4AG0A 2Y85A 3M64A 3HGRA 1ZZMA 2VMFA 3SCWA 1OYCA 4DBWA 1Q6EA 3KDNA 5D9MA 4M7SA 1IIHA 4PMQA 1G4TA 3WQDA 1G9HA 3T44A 2EKCA 3QYSA 2PDFA 3FSTA 3RFAA 4QS6A 4H7VA 1H4PA 2X40A 1AFSA 4Z2LA 5CH9A 3STPA 1Q6DA 3CHFA 4R33A 2Z0IA 1JI2A 2PUZA 3JW7A 3RLGA 1A5LC 2XSXA 1CW2A 4DJEA 3WQ4A 3NQ2A 5C2CA 5D4YA 2DSZA 1FVPA 4LAUA 3CYVA 2RDWA 4AD3A 2VX5A 3NWRA 5KZDA 4PRRA 1GJUA 3EXRA 4OGZA 1PPIA 4P61A 2OOFA 4XZBA 3VTRA 1YPXA 1AUSL 2VT0A 1ME9A 4PN2A 1L8NA 5CZTA 3L67A 2FVMA 1SSDA 4ATLA 1K9EA 4YTSA 4EACA 4K7YA 4M6UA 4ZCWA 3G1DA 2AGKA 4WKHA 2C19A 5FJRA 4NAFA 1NIUA 3N17A 4AWEA 1OFRA 2CKSA 4ZGYA 2OMAA 4GI4A 1WDPA 3TN3A 4ZE4A 2UV8G 3W37A 1IZJA 2Y70A 4A05A 5FSDC 2V0TA 3T1GA 1XLBA 4M8UA 2QJHA 2XZ9A 1NFGA 2Y61A 2R1PA 2HVNA 3BAYA 1GOWA 1W56A 2PTWA 1DJWA 3N19B 1S2CA 1NWSA 6XIAA 3HA1A 1H7RA 4LC8A 1FA2A 1V6UA 5JIPA 3GU1A 3VM5A 4B9ZA 1ZAHA 4R34A 4W8BA 2E1WA 3ZM8A 4XD3A 1S2WA 2WVVA 5I23A 3W88A 3ZR6A 3W84A 1Q8JA 1UUOA 3IVTA 3CJPA 3U2ZA 1B2YA 2YBTA 4JIHA 4RNIA 2TAAA 4HHMA 3S0CA 4FX8A 2QVHA 2BP1A 3EWYA 3M6YA 4O1FA 4UWMA 2VURA 3W73A 2EEXA 1U83A 4IPNB 4WDWA 1WP6A 4E38A 3GHUA 4E8GA 5FEPA 2XIBA 3D3FA 1Q85A 2MUCA 1RXOB 1OYBA 4HA3A 4IF2A 5CBJA 2E3ZA 3TV8A 2XVKA 3NDZA 3CB3A 1DP0A 4PH6A 2A79A 1TV2A 3O6YX 2ZXDA 1HXJA 3KHJA 1EHAA 2XYLA 2FHCA 4IJCA 1H60A 3GXMA 4Z1DA 3OGSA 5JXQA 1AW5A 2VEMA 2E25A 4HP5A 5I24A 2WNZA 3IS4A 4Y9MA 3E2VA 4JTIA 1MDLA 3OVGA 3OO2A 1UQYA 2VWSA 2Z1SA 4TVCA 3BSGA 2Q3OA 2OJPA 1TA3B 3ISIX 2G8ZA 4C91A 3CBWA 2WW5A 4H7ZA 2YZRA 3WJZA 1ZFJA 1W1A1 2OOGA 3E74A 1KCLA 1ISXA 3G8RA 3OLIA 1MRAA 5BXRA 1V08A 1OEPA 4PE8A 3MBDA 1E4LA 3UW6A 2Z2UA 4Q8OA 5LHFA 3K8KA 3PM6A 4JIIX 3BLEA 3W28A 2CBUA 3NM1A 1JXJA 1RBLA 2H3BA 2BMBA 3ONCA 2O9TA 3NGFA 4UFJA 1JPIA 4CD4A 3H7RA 4O11A 2V3DA 3PPFA 2W66A 4JTCA 3C0QA 2FPVA 4W93A 2WLZA 1IXOA 3BSMA 1XDMA 2WPBA 2CC0A 5D9OA 3EXTA 4H01A 4JNYA 3BG3A 2QXWA 4AXNA 3QJAA 2BG5A 4ZQOA 4NKCA 4MJ4A 1TWWA 5CPQA 1JIBA 3OLEA 3BV7A 3BW4A 4B92A 4NJIA 3TDFA 4IFRA 2E28A 4KGLA 1W9PA 1EO5A 1ZHAA 2DQWA 2CLIA 4JX5A 2IW0A 1NWRA 1MUMA 3DN5A 1KB3A 2H8XA 1BXCA 3ZVIA 3VNZA 4XD6A 1TX2A 2DSWA 1JR1A 4X61A 4PUWA 3MZ2A 4S3DA 5HNUA 3TJLA 1BD0A 3E2QA 2PU1A 4RDWA 3AJ7A 1B57A 1UD6A 2ZTKA 2QNEA 2UY3A 3M5YA 3W9ZA 3UWZA 4MWAE 2GGIA 3HM7A 4UNKA 4E2BA 3RHGA 4L6OA 1OGGA 2P5NA 3WMSA 4UMAA 3HPXA 1H63A 4GACA 4EXQA 3SRDA 2YA2A 3M9YA 1B30A 1KO0A 1J79A 1S2UA 2GJNA 1O66A 1GOOA 3N2OA 1JCNA 4Q4SA 2YCLA 4QG8A 3V0SA 5A3HA 3EDDA 1K9DA 1EB3A 4JY8A 1MFVA 5REQB 5HUPA 1AMKA 3FDKA 4RZBA 5JMUA 2J7DA 4MZYA 5C7VA 1UOKA 1UPMB 1J01A 2VC5A 1TZ9A 3MB9A 4DWDA 2PDIA 3W72A 5IHSA 4LVFA 1DXIA 3WEZA 1Q8AA 3VKDA 4OQVA 4DXVA 4KF1A 1KBBA 1LDCA 1EZWA 4WZHA 4YVVA 5F4SA 1H0GA 2P76A 2FZMA 1LM1A 3BW3A 3K30A 3C3UA 3VNKA 1K7FA 4U2YA 3GW3A 5CJ5A 1FWBC 4R3UA 4RNJA 5I7GA 4DYJA 1E4MM 1A47A 1I75A 5CBIA 3PWGA 4L4OA 1DWFM 3QR3A 3O1NA 3NQDA 1OFPA 4J1OA 1FXPA 4Z0SA 1WNOA 4LV9A 2ZZ1A 4Q3MA 2F84A 4MB3A 3WLNA 2IKHA 3W1QA 3E3HA 1IEXA 3DAQA 5EY5A 1YTEA 3TONA 1PKMA 2Y7EA 5M2FX 2OU4A 2UY4A 3S1UA 2INZA 2OWXA 4MZ1A 4ZXLA 1U5HA 2PDKA 5DBUA 3WG6A 5KZMA 3KXQA 2D0FA 1H09A 4AHQA 1GVSA 3QHNA 4INFA 4FS9A 4ZENA 1HJVA 4NT0A 1ITXA 3OYXA 3H2CA 3VMPA 3FXGA 3RM9A 3PG9A 2PDYA 3LUTA 1KTBA 2NQLA 5AB3A 4PMYA 3VOCA 4RW3A 2OSXA 3DC8A 4YLWA 3FGCB 1MEWA 4NZ5A 2BX7A 1O4UA 1M1BA 2CBVA 5JH2A 2WV8A 3M5XA 1E1FA 4X0VA 2YL6A 1RSCA 4W86A 5HWNA 5HQMA 3QKEA 3ALFA 1ONEA 2G41A 5G4EA 3TP4A 1A5AA 2EJAA 3S5OA 4K37A 1SMDA 3W70A 2V5JA 1NAL1 1P48A 3ANUA 1W5PA 4F0RA 4S38A 1VPYA 3VNIA 2J77A 3TA9A 4KT2A 1XS2A 4EKJA 3NQ8A 1UKPA 1GGOA 2P8BA 2QJGA 4FOKA 3TKFA 3RR4A 3W2MA 4DVOA 3S1GA 3MJMA 4KCVA 4AIEA 2YPIA 1A5SA 2VRJA 1O60A 4MY9A 3SECA 2YFNA 5HMSA 1TTPA 1F2JA 4W5ZA 2J7GA 3BG9A 1JPKA 3DHPA 5F2MA 2VC7A 1AW2A 5A8MA 2XTKA 3TH6A 5DY2A 3Q4DA 3M4HA 2ALRA 3MKVA 4H4IA 4X63A 2ZXQA 3N4FA 2WVUA 4PUUA 3KEHA 1R3YA 3HPZA 3W7LA 1BVZA 3LBCA 4JQAA 3KTSA 1PCWA 4Q7BA 3L2MA 1W8SA 1Q45A 1CGYA 2X1IA 1A49A 5DANA 1I2RA 3QOMA 3WNKA 4B5XA 4DRSA 2JKEA 3ARQA 7REQA 1VB9A 3CIVA 2YZ5A 3BQ6A 3W07A 1ZBWA 1HIZA 1W1PA 2BTMA 2ABBA 3U3HA 1PIGA 4FZIA 2W63A 2GUUA 4A29A 1UASA 1HL2A 2JF6A 3OEXA 1KGUA 4GYFA 2FIQA 4LF1A 3QMTA 3EEZA 3AMLA 2BB0A 2VC6A 1PDYA 2JBMA 1XYMA 3E38A 4U33A 5CZJA 3UCDA 3W38A 4B5TA 1R9XA 2VVNA 4XAGA 3BUVA 4QNEA 2VQTA 3J7HA 2D73A 7XIMA 2Z00A 1XJBA 1E1CB 3QKZA 3BGJA 2OEJA 5E09A 1JCYA 1ENUA 1MFUA 3KBMA 1XC4A 4MKNA 1S39A 2PA6A 4RPPA 3T81A 1NARA 4LUSA 2ISDA 1JUKA 2QDHA 4Z1YA 1CNVA 4MWAB 1TTIA 3R2GA 4C60A 1Y5WA 3PUGA 3VX1A 4J5NA 5M17A 4KCTA 3QY8A 4MWAD 4GQGA 4N7QA 2REQA 2XFRA 4MYAA 4RNHA 2FQIA 4IGHA 5BROA 2V63A 5A2BA 3AYTA 1DIDA 4LU0A 2HXTA 4HA0A 3KTXA 2I9UA 3L4ZA 4O54A 4IIBA 1FWCC 3VIJA 5IFPA 3WENA 1OX6A 1V3HA 3TU9A 1KM4A 2YYUA 4HVXA 2FH8A 3NQAA 1H7XA 1EQCA 2WOQA 4FXSA 1XIGA 3CNYA 3LCHA 4Z1AA 4G9PA 2GDVA 3VKJA 4DJDD 1A5BA 5LXEA 4QISA 3SADA 1W91A 4LYKA 2VFGA 4W8AA 3F4VA 1XUUA 2YDSA 1TR9A 4LSBA 4IFKA 3IARA 1JI1A 3QLLA 4FNQA 5D02A 2I5IA 2NUYA 2QUTA 1LLOA 1C29A 3K4WA 2WKGA 4XD5A 3WUBA 3BVJA 4DYKA 4NIRA 2O7SA 3OG2A 3BJTA 3PAJA 1AH0A 4BZYA 4LUIA 2I14A 2TRSA 3GIPA 3UWVA 4GNVA 4MY1A 1O1HA 4PZVA 1F6YA 1Q6GA 4ORIA 3C61A 4XUGA 1M7OA 3K13A 2PDQA 1CWYA 4WY0B 4RZ5A 2IXVA 3PJUA 3D3AA 3S2CA 2O0TA 4UBPC 4AISA 4U31A 3S47A 4ICCX 3U8GA 3G24A 4LS2A 3B8VA 2E8ZA 1OD0A 3JZUA 2HBVA 3KX6A 1HL8A 1DYSA 4OTKA 3VGDA 2EO7A 4TOQA 3TYEA 2HISA 3VDCA 4Y9NA 4LOCA 2HROA 3MC5A 1ZJBA 4Q8PA 5I3HA 1REQB 3QOKA 3V4BA 4C65A 4W8LA 1SW3A 3STFA 2ZA1A 3FNDA 5IDZA 1OCBA 1OCQA 1EPVA 2BVWA 1R86A 1RCQA 4DELA 1DWAM 2VX7A 1EXBA 1RLDA 4G2DA 2OSWA 1VBUA 1LQ0A 3RLVA 6ALDA 1OSEA 1OX4B 3LLFA 1K8XA 4HA1A 3T0TA 1X98A 4BS0A 3ABQA 3IK2A 5CAHA 1QOQA 4O1DA 1HO4A 3OB8A 1FKWA 5LGZA 2I7GA 2CHNA 3RN6A 1ZENA 3UPMA 3T42A 3KZPA 2DFAA 4US5D 4L1WA 1RPKA 3VM7A 1ZL1A 1V03A 2FLIA 4GYPA 3FXYA 2OZ8A 4AY7A 4GI9A 2RUSA 3L66A 4H6KA 3GXTA 2G50A 3MSRA 2FGLA 4KH2A 1GYLA 5EBAA 1G6CA 1GJWA 3BJFA 5FSEC 1KFLA 4J3TA 2QUVA 1RP9A 3P8IA 2QCDB 2DZTA 3O15A 5A6LA 1SUXA 3TAOA 1UZ4A 1J4EA 1KGXA 5LYRA 2QCMA 3ABOA 3M0KA 2C6QA 1JYXA 1FY6A 1EKOA 3R5EA 1K6AA 2V5BA 1T40A 2AQWA 4ZQNA 2DJXA 3PZVA 4L61A 2BXZA 4GVHA 3LCWA 1W37A 1WCGA 2UZ9A 4MHBA 3BLDA 3KVJA 3W26A 4E2DA 1H1YA 4XAFA 4Z17A 3SO7A 2CLOA 1VGAA 2QCHA 3ABXA 4UOJA 4H6EA 5HJXA 4GRSA 3EGJA 5EMKA 2XH4A 4HBKA 1UP0A 2PLCA 4W5UA 1QNOA 5TNVA 4AYSA 4IOTA 2WVSA 4EVZA 1BVWA 2GVLA 4Q8VA 2PC4A 3CQIA 4PUKA 4LAZA 4JZ5A 4OV9A 3U9IA 3PZOA 4EPDC 2GVEA 4AD5A 1UROA 1PX3A 4WQ6A 2CZEA 1VBJA 4GX9A 3M1ZA 2VFIA 1RBAA 2TPSA 2QF8A 2QEZA 3DEQA 3DKLA 4J28A 3E1F1 2QHAA 2I9EA 3PF3A 3WNLA 1FUYA 4B90A 3CQKA 1CLXA 1Z44A 3VXGA 5D2VA 1XPGA 3B06A 2D20A 2OLAA 2VYOA 1W9XA 3MSDA 1P0NA 3QGAC 5TD4A 4IIFA 8CGTA 2I5QA 1H51A 3WSUA 1F8IA 5AC8A 2ZUNA 3WK1A 3QY6A 2EG6A 3B03A 1FWJC 2NX3A 3NVDA 2PRMA 1UP2A 1X38A 3Q94A 1LRTA 4HMNA 5HBFA 3INPA 4K8GA 3MWAA 1EDTA 4M82A 4ZB0A 3SIMA 3UWQA 4DAFA 4QJ4B 2HSAA 2ZA2A 1AD4A 2R6OA 1I1WA 1E0UA 1NOFA 4MKVA 4IHCA 2ZDSA 4CQDA 2UY5A 2NVCA 4KWWA 2BOFX 3Q37A 1P7TB 3PWIA 3LHYA 1F8MA 5XIAA 3HN3A 2VEPA 1JUEA 2W62A 2HNEA 2OT1A 3WDPP 3FJLA 2J6VA 1FH8A 3ZO9A 3TUUA 1KXQA 3EYPA 2PE4A 4FLOA 3B0YA 3OJGA 1WUFA 4G7FA 2PWFA 1IGWA 4TO8A 1E55A 2DVTA 4OUEA 3DECA 2OELA 4D71A 4LY8A 3IJQA 3B0VC 4NJGA 5M3WA 5HINA 1TREA 4C7GA 1H3GA 1MSSA 3TOYA 4AZHA 3TVAA 1IEWA 2J4GA 2BY2A 3VC6A 2V30A 5IRPA 3HPSA 3NQEA 4LBSA 3OZYA 1XLKA 4MJMA 1LROA 4XZWA 4ZB5A 3VOIA 4QNWA 1UD4A 4DZ5A 3E2SA 2A3EA 3H23A 4GVFA 1ZALA 2VOMA 1G4EA 5DEZA 4RV8A 4OV4A 3R89A 3W71A 2J27A 1X96A 3S5ZA 4N6EA 3BOLA 1B3YA 4A2RA 1H41A 1ZS2A 3NJ3A 3MP3A 3PTKA 1SFSA 2QJJA 1CXIA 2QV5A 4MNKA 4IX2A 3RPTA 1MNZA 1E9ZB 2R9RA 3A13A 3RR1A 3KWXA 3EX1A 3CO8A 1RY8A 5MHBA 3G0UA 1TV5A 2O9OA 2RAGA 1C92A 3H26A 4HJFA 3WDIA 4J3UA 4Z2JA 1WDDA 2R24A 1CENA 2ZWZA 5CC5A 3SCTA 3NYDA 2D3LA 2PEVA 2NSOA 3AQUA 1H62A 5DMNA 4J35A 4AD0A 3I4EA 5I3FA 1OY0A 3TSMA 2PDWA 2QQ6A 2R91A 1S1PA 3FYPA 5LIYX 4R7OA 5FJTA 1IEIA 1KCZA 2V5DA 2C1IA 1O94A 2W5FA 2J9XA 3W7IA 2ZZ6A 4KWOA 1JPMA 7TIMA 1R5YA 1I1XA 3MCNA 4PUNA 3M5VA 1EDGA 2WM1A 1J12A 3WK0A 2VVSA 4TX9A 1W17A 4JTLA 3A4AA 5DO8A 3UZ5A 4HHHA 3AZSA 3FFSA 4PCNA 2WSQA 3ZLHA 1UWSA 3IGHX 3M0MA 1S3HA 4D6HA 4XTIA 1GW9A 3ALGA 5D8ZA 3ZXWA 3RCNA 2E09A 4WF7A 2ACSA 4WOQA 5CBBA 2VFFA 1Y5XA 2BHUA 1J10A 3S42A 3KLKA 3L4UA 3NCOA 2YL8A 2IQDA 4HK7A 1OG0A 5I3DA 3LRLA 4MLJA 1F3TA 2Z24A 4EE9A 1VIWA 5I00A 4WJXA 3W7NA 4C1KA 1VPXA 1ZTVA 2W91A 3VKKA 2WQDA 2Q3RA 1JYNA 3V5CA 2IPWA 3ITCA 4QJ3B 1LRNA 1V5XA 4CNSA 2VD9A 1I0BA 3QGKC 5ABHA 3MHFA 3WMCA 3FA3A 1N82A 4DUVA 5H8PA 1VJSA 1W5OA 1J5TA 3UA3A 4LCQA 2PODA 4QQUA 3TC7A 4DUOA 2YCKX 4CD6A 3VCNA 1MQQA 2ACQA 4F3HA 1ITCA 1DKWA 2F6KA 1YTDA 5D2TA 2WK2A 5AC6A 3NM3A 1UR3M 2PD5A 4XAYA 3BOFA 4LCRA 4O12A 2J88A 5EBUA 4RDYA 3GH5A 3N4EA 4Y96A 1X7IA 3KW3A 3UG4A 2VFEA 3FAXA 1B4EA 4FIRA 4DJFA 2VUNA 4MLRA 2JGYA 4GWEA 2Y8UA 3TEVA 1ICPA 4LS0A 3MI2A 1H7PA 3NQVA 3W7PA 3NPUA 4DO5A 2JE8A 4H2CA 3LLXA 5HULA 3O8AA 1DJNA 3GYCA 4KWVA 4IQEA 4AEFA 5BXPA 1IE7C 4TVUA 1YNPA 1V02E 5AYYA 4OBTA 3GXPA 1BAGA 3TYZA 4JQ1A 3NL5A 3LNPA 1JEZA 5F4WA 3R94A 4YWSA 1L2UA 1U5JA 1V0NA 1K9TA 1UD5A 4BQ3A 5G1YA 4AHPA 3DERA 1TPDA 4MFDA 2ON3A 1MEIA 4MVAA 4JCLA 4P8VA 4IFOA 3SQMA 2J7CA 4I7UA 3GNXA 3QV7A 1LG2A 1TVPA 5GQBA 1T5AA 5U7SA 3PPGA 3BJSA 4GQQA 3P3BA 3UR8A 2HEJA 1J0YA 3CMFA 4UFMA 4E8DA 3QFWA 2HQAA 4XIMA 3UF9A 3RO6A 4XAPA 3M0JA 1ADOA 3C2EA 1AMYA 1Z69A 3BO9A 1M41A 4XSLA 4F2UA 4J27A 4O18A 1R3WA 1FCUA 3W7HA 3LQGA 2PURA 4HZMA 3L5LA 4GYJA 3I65A 4JFSA 3RX2A 4NXSA 2DU2A 1B54A 3U7BA 3K4AA 4DO4A 5I3GA 4GC4A 1BYDA 3UXAA 4FXFA 3LN3A 2RDTA 2L5HA 2Z7KA 3LPPA 4DJDC 4DWSB 1L2QA 1SSGA 3SUWA 1N8WA 3N4AA 4IPPA 2FDMA 4BI6A 3SB0A 2NXIA 2PS2A 1TTQA 1NFBA 3OQ8A 1WOBA 5SWUA 4NSBA 2ZICA 4I9JA 3W23A 3IJ7A 4DM2A 4XK2A 4JOMA 4S3EA 3OGVA 4AIUA 3CQ0A 1XKJA 4MB5A 7CGTA 4UFLA 1XM3A 3B3DA 4ADSA 1UWUA 3LENA 3H12A 3A4XA 3MUCA 4V15A 2CLEA 1EX5A 4JKKA 2JKPA 2FYMA 4US5A 4JN8A 2HTMA 5CSYA 5FF2A 1EOMA 3A5VA 2XSAA 1GVYA 4A6GA 4UTTA 4GOAA 1TVLA 5PTDA 3U48A 2CWXA 4MZ8A 5H8UA 3T8QA 3U2CA 1W9DM 4DX3A 1T7LA 3HMCA 4LUTB 1OFEA 2ODOA 1RCOB 5HUOA 4OWGA 2NUWA 4K1GA 4YHEA 2AMXA 4QQ3A 2ANUA 2VHLA 3BLOA 4G1NA 2JIEA 3IIXA 3WQOA 2XIQA 2BZNA 4PTMA 4Z2HA 3AWNA 3GR7A 4XZIA 3KOXA 3V1HA 1H7WA 1A3WA 2J8GA 2GGEA 4H1ZA 1MW2A 1LORA 4Y90A 1TWSA 4GKLA 1E0VA 1ZBVA 5FOOA 1EJ7L 4GY0A 3WO8A 4X2RA 3I7QA 1E9LA 3MKCA 4PBEA 4Q8WA 3MUAA 3LU2A 5HMEA 1LOLA 3GDLA 1R7AA 4M6VA 1WXJA 2IPGA 2ACUA 4WK9A 1TR1A 4YTTA 3ORWA 3WEOA 3GW0A 2OGYA 3K1GA 5FF4A 4LB4A 3T7VA 2Y8VA 4GFIA 3I3DA 3L0KA 3B04A 3URAA 3W75A 4GINA 3UP8A 3UJEA 1WZKA 3BZGA 4CEXC 3MMWA 2WO5A 3VIGA 3V5FA 4PCPA 4IX0A 2VFHA 4EAMA 1KBJA 3N25A 5AKQA 1NWUA 2G3JA 2OSYA 4MGGA 2V2CA 4CQ9A 2IQTA 4ONVA 1CGTA 1OF8A 2G5WA 4M51A 3LM7A 3T09A 2IUZA 2NT0A 3UR7A 1C90A 3H2OA 1V4YA 1NDVA 2EG7A 1NDWA 4PODA 4MAZA 3SY5A 4LYQA 3SURA 3CWOX 1QOPA 2GDQA 1XP3A 1JCTA 3WLLA 2X8RA 5LNRA 2E5BA 1GG1A 2ZIDA 5FD0A 1EP3A 4DJED 1NF7A 4O15A 2OLSA 1BSIA 4FPSA 1U1HA 5FKYA 3CU2A 1E43A 3GD6A 1UH2A 4MKSA 1XYAA 3TZFA 4ZL1A 1P43A 3CUXA 4QEHA 4PEKA 2QZRA 3VDAA 2QLYA 1S5MA 1E1CA 1EBGA 3W1PA 2XG9A 4BR1A 1V77A 2PB1A 1XCWA 1OFOA 4O13A 3WF4A 3DC0A 1N2VA 3MVIA 1EC8A 1XH2A 2WYSA 3KFTA 2OLHA 1F76A 2GWGA 1BQGA 2ALDA 1ZY9A 2DZSA 2OO6A 4I90A 2WZIA 3WMLA <