3IRXB

Crystal structure of hiv-1 reverse transcriptase (rt) in complex with the non-nucleoside rt inhibitor (e)-s-methyl 5-(1-(3,7-dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
Total Genus 102
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
102
sequence length
428
structure length
416
Chain Sequence
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLFLWMGYELHPDKWTVQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLSKLLRGTKALTEVIPLTEEAELELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTPPLVKLWYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of HIV-1 reverse transcriptase (RT) in complex with the alkenyldiarylmethane (ADAM) Non-nucleoside RT Inhibitor (E)-S-Methyl 5-(1-(3,7-Dimethyl-2-oxo-2,3-dihydrobenzo[d]oxazol-5-yl)-5-(5-methyl-1,3,4-oxadiazol-2-yl)pent-1-enyl)-2-methoxy-3-methylbenzothioate.
pubmed doi rcsb
source organism Human immunodeficiency virus type 1 bh10
molecule tags Transferase/hydrolase
molecule keywords Reverse transcriptase/ribonuclease H
total genus 102
structure length 416
sequence length 428
ec nomenclature ec 2.7.7.49: RNA-directed DNA polymerase.
pdb deposition date 2009-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase)
B PF06815 RVT_connect Reverse transcriptase connection domain
B PF06817 RVT_thumb Reverse transcriptase thumb domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.10.10 Alpha Beta Roll HIV Type 1 Reverse Transcriptase; Chain A, domain 1 HIV Type 1 Reverse Transcriptase, subunit A, domain 1 3irxB01
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxB04
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxB02
3.30.70.270 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 3irxB03
2J6SA 2I5JB 1S6QB 2JC1A 4IG3B 3KLEB 1JLGB 1HNVB 2OPQA 3N6MA 3QIPA 3PR5B 3OHBA 4ECQA 5DGAA 2UVVA 2E9RX 1S1XA 3MEDA 4H4OB 4ECXA 3T5KA 2JEFA 1JLEA 4NLOA 2JEJA 3RAXA 3I0RB 2BRKA 4ZP7A 5KFRA 4YP3A 3KLGB 3EPIA 1HPZB 4QWDA 2D41A 4QPXA 4DL3A 3UQSA 4Q8FA 2FJWA 1S1VA 1D1UA 4ICLA 3D5MA 3M8PA 2XCPA 4NLRA 2FVSA 5KFPA 4O4GB 1SH0A 1IKYA 5KFGA 2ASJA 4NLWA 3KHGA 2WHOA 2J6UA 3DM2B 1S97A 1S6PA 1IKVA 2DPIA 4QWEA 4K4WA 3V4IB 3DI6B 2ILZA 3CJ3A 4OL8A 2ZD1A 4ZPCA 4O44A 4NLTA 4JV1A 5HROB 2HMIB 3C6TB 4NLDA 1RT7A 3LAKA 4RW9A 4JUZA 4K50A 4RW6B 4JV2A 1R0AA 3QLHA 1NNDA 4TY9A 2YKNA 5KT2A 3E01A 2VA3A 4KBIA 1C0TA 3JYTB 2CJQA 2GC8A 3RB0A 5EWGA 3MEGB 4EO6A 3MFIA 1VRTB 5L1IA 1RYRA 4WZQA 1RTIB 3PW4A 1JLAA 4DL7A 4RUCA 5KFAA 2BQRA 2FLLA 2IBKA 1EP4A 3DLEA 4I2PB 4PUOB 4NRTA 5KFSA 1BQNB 1S9EB 3LP1A 3ICLA 2E9ZA 3NBPA 4RW7B 2GIRA 2R2UA 1RT3A 5J2PB 1WNEA 2VG5B 3OL9A 3UDLA 2R8KA 3KLIB 2HNYB 3IGVA 2VG6B 2YKMB 1HQUA 4B3OB 4J9RA 1KLMB 1IM4A 2B5JB 5DG9A 4J9LA 4IH5A 5DLFA 3MTKA 1J5OB 3NAHA 2C2EA 4ECTA 3KK3A 4MIBA 5KFIA 4TY8B 2DPJA 4WXWA 4DL6A 5KFJA 1ZETA 1C1BB 4NRUA 3LALA 3DOKB 4NCGB 3MECB 4ED0A 2IA6A 2R8JA 3HVTA 1UWBA 5KG1A 2RF2A 3IRXB 2VG7B 4KFBB 1C1CA 4XPEA 4ECWA 3IN5A 3RB3A 4ED2A 1RA7A 1BQMA 1REVA 2R8GA 2B43A 4RW8A 1S9FA 2YNIA 1XR5A 2HNDB 4LQ3A 3OLAA 4Q0BB 3I0SA 1DTTA 1JLCA 3VQSA 5KG0A 3DRSA 2BRLA 4O3PA 4H4MA 1XR6A 4ZVGA 3T1AA 2WONB 5KT5A 4ZVFA 2JC0A 4RW4A 2RDIA 2IC3A 2YNHA 1S1VB 3BQ0A 1TKZB 5KFBA 2YNFA 5HBMB 1JKHB 1N5YA 3DLGA 3BSAA 3N6LA 5KFLA 1S1WA 1RT4B 5CYMB 4KV8A 4KO0B 5DLGA 3MR3A 3UR0A 3PVXA 4EBEA 1RT1B 5J2NA 3QIDA 4IDKA 2FLNA 4K4ZA 4RNOA 3MR5A 2EC0A 5K14B 4F4XA 2R2SA 1IKXB 3QYYA 3LP0A 5J2QA 3GIIA 4LSNB 4NLVA 3IGNA 4ZVEA 4GC7A 1S0MA 5C25A 1T94A 4ID5B 1JLQA 1HYSA 3CDUA 1NHUA 4EYHB 4O44B 3C6UA 1IKWA 3PW0A 2XCAA 4IFYA 2HMIA 1QAJA 3HVAA 4RW9B 1S4FA 3TAMB 1K1SA 4MIAA 3KK2A 5C24B 4H54A 1EETB 3QLHB 5KT6A 2UVUA 4R5PB 1SH2A 1LWCB 4J9OA 2JLEA 3JYTA 4YR0A 5HLFB 5C42A 5KFVA 3IG1A 5L1JA 3JSMA 3DLKA 5KG3A 4WZMA 5J1EA 1FKPB 3PR4A 3PW5A 2UVWA 2WK4A 2AGOA 4MKAA 5EWEA 4I7FB 2XI3A 3GQCA 3FFIA 3GYNA 4ZPAA 4O3OA 1T3NA 1S9GB 2W8KA 4KKOB 3KJVA 3LP2A 4R8UB 1DLOB 4IG0A 1HMVB 2HNZB 4MK9A 2B6AB 1HNIB 3DOLA 3BR9A 3CVKA 1HQUB 1JX4A 4EYIB 4EEYA 3Q8SB 2BANA 5DG7A 3KK3B 4MK8A 4Y34A 4U7CA 4NLPA 1RDRA 3BSNA 2FJVA 3DRPB 3V6DA 4KSEB 3CWJA 3OL6A 2ALZA 2AX1A 1C1BA 5F8LA 5KFNA 2R8IA 3H5YA 4WXOA 3Q8PB 1TKXA 3QZ8A 4IQXA 4IFVB 3M9OB 4TXSA 5FDLB 4Y2CA 4F4YA 5KG7A 1HQEA 2ZKUA 3QO9B 2I5JA 1TQLA 3H98A 4URSA 4IG3A 3G6YA 4KAIA 3V6KA 1VRUB 4I2QB 1DTQB 1HNVA 2OPQB 2D3ZA 4NZ0A 4K4TA 3GV5B 2BQUA 1RT2B 5J2MA 1KHVA 4DL5A 1C0UA 3G6XA 4H4MB 4K4SA 4K4XA 3H5XA 3KLGA 3DMJB 4ECSA 4R0EA 5KFYA 2YNHB 5KFDA 1RTJB 4NLQA 1U09A 2WB4A 3DI6A 2CKWA 1JLBA 5F8GA 1S0OA 3TQ1A 4MFBA 4URGA 5F8HA 5HROA 1T03B 1LWFB 2V4RA 1RT7B 1W25A 3BSCA 3H4DA 5JUMA 4EO8A 1T05A 1S6PB 3E01B 2W9AA 4PWDB 3BSOA 4J9KA 3I5CA 3GV8B 3PZPA 4J9QA 3KK1A 3CJ4A 4KHRA 1FKOB 3RAQA 1JLFA 4FS2A 2F8EX 1EETA 3OSNA 2W9BA 4R5PA 4DL2A 1TL1A 3ITHB 1SUQA 2V9WA 3NAIA 3MEEB 2OPPB 1FK9B 1R0AB 2YNGA 1TP7A 4IRKA 3KNAA 1ZTWA 5F9NA 1N48A 3ISND 2HNYA 1RAJA 2D3UA 5KT3A 4B3OA 3IS9A 5I42A 2AGQA 4ZP8A 4LSLA 4K4VA 2WCXA 1SV5A 3H40A 1RTHA 4DG1B 5I3UA 4M95A 3FQLA 5JXSA 3LP2B 1QE1A 4R8UA 1S1UA 4I2PA 2HAIA 3BGRB 4ZPBA 3LP1B 1BQNA 1S9EA 3KLEA 4IH7A 2FVQA 1JLGA 5KFWA 5KG2A 5DG8A 2XGQA 1RTDA 4RZRA 4Q8EA 3GIMA 3SFGA 4RNFA 4TQSA 2W8LA 1Z4UA 3KHLA 4F50A 2B5JA 4EBCA 3GIJA 3DRPA 3V6DB 4ED7A 2JEIA 1HARA 4NLSA 4ECZA 3V6JA 4Q44A 4RW8B 3KLFA 3QIPB 4ZP6A 4IFVA 5DQIA 4PQUA 4RNHA 2ATLA 5F8MA 3M8PB 2BQ3A 4NLUA 4H4OA 5DGBA 2OPSB 2OH2A 2AX0A 3I0RA 2VG7A 4ECRA 4IRCA 5F8IA 5KG6A 3MR2A 3DM2A 1LWEA 3KLHA 4ZHRB 3M8QA 3T5HA 3T5JA 2HWHA 1JKHA 2ZD1B 5EWFA 4KV8B 4DL4A 2YNIB 3KMSA 3I0SB 5J2NB 4ECUA 3DMJA 3OSPA 4QWCA 4J9SA 3DRSB 3OL7A 1IKYB 3PJWA 5HP1B 1S1TB 4MH8A 4LSNA 4Y3CA 3DYAA 1JLBB 4O3NA 3MR6A 2W9CA 2AWZA 5C25B 2FLPA 2IM0A 4ID5A 1HYSB 1TKTA 4WE1B 3Q8QB 3BQ2A 5KT7A 1IKWB 1N5YB 1N6QA 4RNMA 1RTIA 1RT1A 4QW8A 2ZE2B 1NHVA 3QGGA 1EP4B 3DLEB 1LWCA 1TVRB 5C42B 4TQRA 1ZTTA 5KT4A 2V4QA 2YKNB 5J2PA 3FQKA 4Q45A 3JSMB 2OPRB 3H2LA 1JLQB 1C0TB 4G3IA 3KLIA 3BQ1A 2O5DA 4IFYB 2IM1A 3BREA 3H5SA 5D3GA 3DRRA 2OPPA 1JLAB 2UUTA 2WOMB 3KK2B 1S9GA 4ZP9A 3FSIA 2YNGB 1S6QA 1QAIA 3GV7B 4NLGA 3CJ2A 2B6AA 1YVFA 1S0NA 4NLYA 4LSLB 1S48A 1SV5B 5EDWA 1JLEB 4HKQA 1UWBB 1LW0A 4G1QA 1KLMA 2RF2B 1OS5A 3EZUA 4IOBA 5KFUA 5KG4A 4WYLA 5KG5A 3GIKA 1RT5B 1S49A 4XPCA 4IRDA 3V81B 4ED3A 3QGIA 5CYQB 1HPZA 4U6PA 2JEGA 1C1CB 2IAJB 3Q8RB 2ILYA 2VA2A 1DLOA 4WFZA 2QE5A 5C5JA 1HMVA 2HNZA 1BQMB 2FVRA 1HNIA 2R2TA 5KFEA 4X2BA 1JIHA 2HNDA 1CSJA 4Q0BA 4URQU 5KFTA 5FDLA 1S1XB 3MEDB 4MKBA 4IH6A 4QW9A 2J6TA 5T14A 2GIQA 4O4GA 2AQ4A 3IRXA 4KFBA 4F4ZA 4I2QA 4O4RA 2BE2B 2QV6A 1REVB 1S1WB 1RT6A 1RT2A 5J2MB 1C0UB 5KFHA 2IM2A 1MU2B 1KHWA 4YR2A 4ICLB 1JLCB 4FS1A 3PJXA 1IKXA 1LW2B 3M8QB 3KOAA 3QO9A 3HKWA 4TLRA 5KFFA 1VRUA 1IKVB 1DTQA 2IC3B 1TL3B 1TKZA 3C6UB 3V4IA 4O3RA 4RU9A 4NLXA 1RT4A 3HVWA 1LWFA 4Q43A 4GC6A 4ZMMA 4ZVHA 5L9XA 3QZ7A 3DYAB 2W9CB 3T5LA 4MK7A 4PUOA 3FDSA 1TKTB 4WE1A 2R8HA 3E51A 3LP0B 3OHAA 2ASDA 3H5UA 3LANA 3SFUA 5DQGA 1N6QB 3GILA 2VG5A 4WFXA 2R2RA 3TVKA 3MEGA 3KLVA 4I7FA 4J9MA 4O3SA 1TL1B 1SUQB 5L1KA 3TAMA 1TV6A 5EUHA 1FK9A 2IMWP 3LAMA 2XGPA 3D28A 2RKIB 1T05B 3QGHA 4WFYA 2XC9A 3EPGA 4EBDA 4FBUA 2UUWA 1FKOA 3RB6A 3DRRB 5J1EB 3HVTB 1RTHB 2VG6A 2YKMA 4DG1A 5I3UB 5F9LA 4QWAA 3ITHA 3BGRA 2W7PA 3FFIB 5F8JA 3KHRA 1J5OA 3M9MB 4DEZA 3KJVB 3CIZA 4TY8A 3CJ5A 4K4YA 4RUAA 4ED6A 1MMLA 1LW0B 4G1QB 3RBDA 1K1QA 3DOKA 1DTTB 4NCGA 5KFZA 3MECA 1RT5A 2BANB 3NMAA 3V81A 3I5AA 4YQWA 1HQEB 3HHKA 2IAJA 2RDJA 1S1UB 4KB7A 5KFMA 4HYKA 3OL8A 5KFXA 4TYBA 4RW4B 4QWBA 3KLFB 1N4LA 3PHEA 4ZPDA 2YNFB 5HBMA 4PQUB 3MFHA 3DLGB 4TN2A 4Y2AA 1N56A 2OPSA 4KO0A 4ECYA 4JV0A 4IDKB 4M94A 1C2PA 2V0NA 4K4UA 5K14A 2WRMA 3I5BA 2WONA 5J2QB 3CO9A 3OLBA 3MF5A 2BE2A 1QUVA 2IM3A 4RNNA 1RT6B 3KHHA 1RA6A 3DDKA 3T19A 3PW7A 2AU0A 2XI2A 4IR1A 3H59A 1MU2A 4WYWA 3RB4A 4FBTA 2FJXA 2D7SA 2I1RA 5CYMA 5KFQA 1D0EA 1LW2A 3CDWA 5KFKA 3BJYA 4IR9A 5HP1A 5DQHA 4ED8A 3PW2A 1JXLA 3KMQA 3ISNC 3C6TA 1LWEB 3KLHB 2IJNA 3UPFA 4ZHRA 2FVPA 4PWDA 1TL3A 1RTJA 4TYAA 4RW6A 2C22A 4IKAA 3NKYA 3IG1B 3DLKB 4MFBB 1RYSA 4LQ9A 4KHMA 1S10A 2HWIA 2W7OA 2C2RA 2AGPA 2W9BB 1VRTA 2XWYA 1T03A 4YMEA 2C28A 1TVRA 4ECVA 4YR3A 1S1TA 1SH3A 5C24A 4KKOA 1I6JA 5L1LA 2BR0A 4IG0B 2OPRA 5F8NA 2WTFA 3NBPB 4RW7A 5HLFA 3DOLB 2IJFA 3KK1B 1RT3B 2UVRA 3FRZA 1GX6A 1JLFB 3V6HA 3SI8A 1TV6B 1FKPA 2ZE2A 1XR7A 3G6VA 4F4WA 2FVCA 1QE1B 2ASLA 2RKIA 4J9NA 3MEEA 4ED1A 1GX5A 3M9NB 3H4BA 3G86A 4J9PA 1RTDB 2E9TA 3N6NA 4XO0A 5KFCA 2C2DA 1TKXB 3IS9B 5I42B 3CDEA 3NGDA 5D3GB 4NYZA 3NL0A 5KFOA 3CJ0A 2WOMA 5CYQA 4KE5A 3RBEA 4O3QA
chains in the Genus database with same CATH superfamily
2H65B 1OY9A 2J6SA 3RZAA 2DVIA 4IG3B 5BR8F 1HNXJ 1KQKA 4PG8A 5DGAA 1LWXA 3QIPA 3OHBA 3EYZA 2N3OA 1S1XA 2BZ2A 1WC1A 2VDHA 2F9JA 1PJ6A 2K1RB 4YHHF 2JEJA 3RAXA 2CXEA 2VD3A 4RKUC 3TVYA 1RSCA 1ROFA 1TUGB 5ETSA 3BPSP 3EPIA 3BF4A 1PJ5A 2BM1A 4QWDA 4F0MA 2D41A 3RGIA 4CCHA 3IM9A 2MZJA 4PKDB 5HJXA 2X1AA 4LF4J 2HBQB 4HEA9 5G4DA 3GYXB 3R7SB 3ZNJ1 2MZRA 3W2WB 4ICLA 3D5MA 2HQFA 2OEMA 2XCPA 1SKUB 2FVSA 3W2VA 2XYHB 3LUYA 1VK3A 2ASJA 1P8GA 4Q5VA 2VKRA 4LR8A 4USKA 3J7ZT 5CABA 3RU0A 1UA0A 4K4WA 2LA6A 3V4IB 1HW8A 2C42A 2JOQA 3CJ3A 3DGPA 3FCVA 1R6VA 3Q83A 3VHQA 4OV6A 2MY8A 3TZXA 4O44A 4B17A 3RR8A 3L4BC 3CCRS 3EXYA 2HMIB 3C6TB 3BN7A 4A47A 4RW9A 2F3JA 2KVQE 2HKEA 4C98A 4X65J 4JI3J 4K50A 5HVFA 2DNGA 2QL9B 2NYIA 3QLHA 1XNRJ 3PX4A 4FKXA 5H9FK 2CJQA 3M1VA 4ZVPB 4ERDA 3CB4A 4W4MA 1KR4A 2K7KA 5L8RC 2M2BA 4WZQA 1RTIB 2ZDOA 3T41A 2B9WA 3PW4A 4UOHA 4NXNF 3EWGA 2LQ8A 2FLLA 2MB0B 1U2FA 3G2XA 4NMXA 5KFSA 1YJ9S 2E9ZA 3ICLA 2ACMA 3NCPA 3NBPA 2GIRA 4IRDA 1MMNA 4MYUA 3C46A 1X5TA 2DBBA 1WNEA 2J7KA 3GWCA 2WAQD 1CLFA 5ETMA 3UDLA 3KLIB 4OZ2A 3IGVA 3VAHA 4B3OB 3ZZUA 1KLMB 1BC6A 3I9ZA 5AXNA 2FPHX 4LF6F 3LH2S 3NAHA 5LM7E 3IR5B 3KXDA 4ECTA 5KFIA 5B0CA 1FDDA 2DEJA 2C2OB 2J7WA 2Z0GA 1GXTA 3VQTA 3NNCA 1C1BB 1U1PA 3LALA 4M5LA 1NHKL 3MECB 2GJIA 2RQ4A 3CD7A 2GVZB 2OGUA 4OYXA 1U8WA 2ZBIA 4P7TA 3H7HB 2FJBB 3ZTRA 1VBYA 3IRXB 1SB6A 1WC4A 4OZ0A 3W61A 3KKFA 3FZ2A 4M5DB 3A12A 3TNVA 5D6GA 5DM6Q 3HP6A 2DR7A 3MTJA 4LBPA 2M8DB 3IN5A 5IOLA 1RA7A 2DGWA 2J7UA 2QEXS 4QYRA 4RW8A 3HF5A 3I4HX 3GSIA 3OVBA 2YNIA 4LQ3A 1RHJB 3MUTP 3W8GA 3ZTPA 1V3SA 2XMWA 4O3PA 4DPTA 2WW4A 2OAUA 4ZVGA 4EMDA 1YZ6A 1CJUB 1MW7A 1VLOA 3VZIA 2RDIA 4RW4A 5A6PA 5D0GA 2VA3A 4OI0A 4K4ZA 2OSRA 5I3PA 3N6LA 5E3QA 4YS2A 5K8OA 4LMZA 1XBWA 4KV8A 1B0PA 4KO0B 5DLGA 3PVXA 1RT1B 2B0GA 3G71S 3AOBA 4RNOA 2IFXA 1RK8A 4WU2A 5K14B 2EPIA 4F4XA 2MZSA 2EC0A 1IKXB 2GW8A 3QYYA 3CNQP 3LP0A 1CC7A 5J2QA 3NS7B 4HI2A 4NLVA 3IGNA 1S0MA 3QQCD 5C25A 3TARA 1T94A 2PGCA 1JLQA 2CQ0A 3OPKA 1NHUA 4ZDNA 3HFKA 2NQPA 1H73A 4IFYA 2AKWB 3VAMA 4LFCJ 2HMIA 1QAJA 3PRVA 4DDFA 1S4FA 2BJDA 4RLEA 5D0HA 4H54A 1F3FA 1EETB 3QLHB 2EFOA 1WKKA 4PABA 1SH2A 5GMDA 5A8KB 5CYJA 3HK2A 4J9OA 2JLEA 1OWXA 2C2KB 4HHJA 5KFVA 3A13A 4LIWA 1AW0A 3FBEA 4F2RA 3H90A 2RVJA 3JSMA 4HI1A 1N5VA 2HQDA 3GYGA 5J1EA 4OX9J 2XSFA 3TUIC 3EUNA 5DJBA 4I7FB 3T6JA 3UNYA 2VPYB 4O3OA 4KKOB 3LP2A 4OX8A 4R8UB 4IG0A 1HBOB 2F63A 3DLJA 1BHNA 4MK9A 2B6AB 4JI6J 3CVKA 1HQUB 3MI7X 4EEYA 4C8ZA 2GO9A 2UUCF 1LFPA 3RAMA 4LREA 3BH6B 4F3QA 4J91A 3PV8A 1YGYA 1PYOB 2IVYA 3HD1A 3IWXA 1HNZJ 1WHYA 3DRPB 3W5ZA 3OL6A 1NDKA 3JB9k 1C1BA 4ANDA 4RO0A 5IC4B 3AQOA 1U1NA 1VCTA 3TEHB 3GIKA 3SDEA 2CQGA 1GMUA 1PBAA 3HI9A 1RQ0A 2XM3A 3QZ8A 4PXCA 4IQXA 1KOOA 3ET6A 1LEOA 3SCKE 1RLCL 4Y2CA 2XYGB 4WP8A 2YKQA 4F4YA 2HBYB 4EZ9A 4IUFA 2DRDA 5A8WB 1APSA 1NLKL 2ZKUA 3TOQA 2Z4PA 3K5LA 1CJKB 2RQKA 1IM6A 4U9RA 3N5FA 4F3OA 4I2QB 1FI4A 2MDAA 4DV2F 1YRTA 5HI7A 2B4OA 2FJEB 1FRMA 3GV5B 1KHVA 2BQUA 4OJGA 1W2IA 2UXDF 3ZZRA 2BW2A 2OMOA 4U67Q 4ECSA 5KFYA 3C66A 4KH0B 4WFAQ 4RR5A 1JQGA 1U09A 2WB4A 3VWSA 3DI6A 2CJAA 2U1AA 3BGUA 3JSYA 5IC6B 5A2QU 1KN6A 1SKSA 4LF9J 3D9BA 4X4OA 2GX8A 5F8HA 1X4HA 1WTBA 2DGXA 1IBMJ 5IT0A 2EBEA 2WBRA 4OX7A 4EO8A 1NB7A 1IN0A 1S6PB 3OQ2A 4ZVRB 4FF3A 2R4FA 5M2RA 1M1HA 1FNXH 4OLPA 1WELA 1R89A 3C16A 3TQEA 3PZPA 2PI5A 3QJJA 4FXDA 3CJ4A 4KHRA 5LJ3Y 4QR2A 3BO4A 4FS2A 4U7UD 1EZZB 1RXOB 2W9BA 1R0CB 4DL2A 2UUBJ 4YY3J 1SUQA 4XDCA 2V9WA 4DR6J 1KVIA 1UCNA 4ZN3A 1D9FA 2CQ4A 2F7VA 3KDNA 4IOAQ 2ZHAA 4R25A 1V9OA 5F9NA 1NJWA 1IR1A 3ISND 1NSPA 2D3UA 2QMUB 3LF0A 5L38A 3IS9A 5KT3A 3CUNA 4ZP8A 1O51A 1JJ2R 2YX7A 4DN9A 1B70B 4CO1A 2WCXA 1NK0A 1P1LA 1Y10A 1RTHA 5I3UA 2JFKA 5KG4A 5JXSA 3LP2B 4R8UA 2DISA 1S1UA 3N4WA 4ZPBA 3BGRB 5KFGA 1BQNA 3GIRA 1IXKA 1XTZA 4PCQA 3A8IA 1X4DA 3W8PA 5B0FA 4N77A 4LF2A 3VGTA 2ADCA 2DNMA 1PAEX 1RTDA 2AEMA 3ISZA 3WX8A 3CJ8A 4L75A 1PGZA 4RNFA 2A2CA 1Z4UA 1ZH5A 4JI4F 3T1HF 4RL1A 4XTTA 4EBCA 1WD6A 4FF2A 3GIJA 2Z2LA 3M2UB 5K8PA 2A2DA 2HFVA 3SIPB 4Q44A 3SDEB 5CQGA 3V6JA 1UVJA 4F8RA 4IFVA 2V8DA 4PQUA 2ATLA 3POTB 5DGBA 3CMAS 4DUZF 2AX0A 3I0RA 2UUAF 2DRAA 2DO4A 1QM9A 5KG6A 3G82B 2DR9A 1LWEA 2GVDB 3ZZZA 5LMNJ 4NPOA 1W7WA 1R31A 3W9JA 3HMJG 3T5HA 1OPIA 3EVOA 4EWTA 1SIWB 5AE2A 4ZPWR 4Y6IA 3W62A 5K5MA 3J7AN 2YWHA 5E3PA 4J9VA 3KMSA 5J2NB 3DMJA 3OSPA 1K0TA 4J9SA 2R7TA 2ZH1A 3DRSB 1X8DA 1YK9A 3PX6A 2E5LJ 1WC5A 1H2UX 2KKHA 4FNIA 5T41A 3U02A 4CLTA 3DYAA 4WFNQ 1H98A 3M8YA 2XO6A 2XYPB 1XNQJ 2IM0A 1HYSB 2R7WA 4WE1B 3CC7S 3J7A1 3BQ2A 1IKWB 5C2CA 1N5YB 1XC9A 2QL5B 2AJQA 1JXVA 1N6QA 1RGVA 2M7SA 1RTIA 4GVBA 1NO8A 3CJKB 1CULA 1M5HA 1NHVA 1U24A 2U2FA 2HHVA 4DL0C 1LWCA 1K44A 5BYQA 5IQ6A 2XMTA 3I82A 4B9MA 3D1HA 2GZOA 2ZZMA 4DV5F 3H8YA 2XULA 4OYWA 5KT4A 2YKNB 5J2PA 2HGMA 3FQKA 3R5DA 2OPRB 1JLQB 4USVA 1XEZA 5JVGQ 1K9MT 1H38A 3KYLA 2UXBJ 4P72A 2HYIB 2W4PA 3H5SA 2GS8A 4JI3F 4JI2F 1C4AA 3DRRA 1RWMB 4R0JA 3O2IA 4M1KA 3CJTA 4ZP9A 3TZWA 3J7YI 3HPOA 3SQGB 2V2KA 2K8GA 2YNGB 3EXCX 3MPWA 1S6QA 4DBQA 4ZVSB 3OXFA 3TZYA 4NLGA 4DS4A 3BDEA 1FFGB 2F8HA 1VISA 3OUYB 2CDQA 1FJGJ 1S48A 5EDWA 3DLHA 4ED4A 2BOPA 5KFUA 3BYPA 2LDIA 4XPCA 3CE8A 3V81B 1TMJA 4ED3A 4JI8J 1HPZA 1C1CB 3Q8RB 3LOUA 1IBKJ 5C5JA 1NPRA 2QE5A 2WZ1A 2SXLA 4DX8H 2FJAB 3AD8C 3DCAA 2DXEA 1CSJA 3US5A 5FDLA 1S1XB 2HIQA 4MKBA 1VQNS 2KFNA 3Q8YA 5T14A 2DY1A 1FVQA 2FLOA 3MUVP 4KFBA 1NB2A 3U1NA 2DGOA 2L9DA 3G87A 1YTYA 3EGZA 2QFIA 3AHPA 3HCXA 4F04B 3LWLA 2IRUA 3QFHA 1KSPA 1F2HA 1FD8A 1MNEA 2G0IA 1KHWA 2HWTA 5DDQC 4CO2A 4YR2A 3W3SA 2XLJA 2V69A 2AYBA 3C15B 4HTIA 2M3DA 3JQJA 3R8YA 2CG8A 1LW2B 4DHVA 2ZH9A 2W4DA 1X9WA 3QO9A 1WOOA 3KOAA 4PAAA 3RYLA 2DHSA 2E1MC 3PX0A 2IC3B 1SKWA 2JJ4D 4C9DA 1TKZA 5I4MA 2HFUA 1T9XA 4DV6F 4O3RA 1JWWA 4RU9A 2N82B 3Q22A 1RT4A 3AODA 3JAMY 2F4FA 4UF4A 2W9CB 1IJEB 4DCOB 1WC0A 4OHVA 1WHXA 4PUOA 2R7UA 1TKTB 1YX2A 4OJ3A 3E51A 1TFYA 1HD0A 4C3LA 3N01A 5T7LB 2P9EA 2VG5A 1VMBA 2ZOGA 1SC6A 3S01A 2R3VA 4Q7AA 3JS9A 2ZH5A 1LK7A 1N33J 1ACMB 3TVKA 3GJSB 4PYAA 4I7FA 1A7GE 2KB2A 3W60A 5MLCV 2VASA 1Q81T 5L1KA 5IT4A 5EUHA 4XAKA 3NNHA 4K0KJ 1WHWA 2XGPA 2YWKA 2E5LF 3QGHA 1RBAA 2HHXA 2AJ0A 3I56S 4KGVB 4OYOA 3C16B 4X4SA 2UUWA 1H3DA 2HAFA 3DGVA 2BE9B 5DZ6A 3DRRB 4A8FA 3MM7A 4DG1A 2YKMA 1U1OA 5F9LA 1VQ6S 2ZH2A 1HKAA 4X4TA 1CJVB 3I6PA 2W7PA 3FFIB 3BKFA 3HHLD 5B09A 4IOCQ 1VQ9S 4J9UE 2Y1IA 3PO5A 2FIUA 3TUZC 3CJRA 4K4YA 4GVLA 4USHA 2QA2A 2P5VA 3AA8A 1WF2A 1T95A 2YKAA 1QTNB 4H4KA 4OI6A 3CCES 1K1QA 2Y3YA 3DOKA 1DTTB 3AD9C 3BR8A 3MECA 4QQBA 5KFZA 1DARA 5LXYA 2R9LA 2P8IA 3A3NB 2IAJA 2I6WA 2AYGA 3R2CJ 1WG4A 4LF7F 5CHCB 3TP2A 5KFMA 2X3DA 3TA2A 3J81j 3K0JA 3CGIA 3HJVA 3R5CA 4TYBA 5K8MA 2CQ1A 1S4EA 1Y3JA 2MY7A 4OHZA 1X4EA 3GPAA 5FIIA 3DLGB 4Y2AA 4N7TA 2OPSA 3NCQA 2CPXA 5E41A 4C0HA 1TELA 4ECYA 4FYDA 1D9AA 2H9ZA 3IXQA 3VVUA 4IDKB 4K4UA 1SL2A 3UCGA 1RBOB 3MAQA 2J0WA 1FRLA 3ILLA 2LYVA 3PFOA 3T9NA 4DQQA 4GKKF 4NZ7A 1PG5B 1QUVA 2IM3A 2FZKB 4FDFA 2R7XA 5THWA 4N76A 1H74A 1MU2A 2VBXA 1DQ8A 2FJXA 1RLDA 2D7SA 2GGPB 4KC5A 3PFEA 5A0YB 3VAKA 2H5EA 2ERRA 2N7YA 1LW2A 4I4BA 4ZPTR 3OR1B 4ALZA 3BJYA 4DSJA 2H5IB 2FB0A 3K17A 3R1LA 2G1HA 3TX0A 2CNLB 1LWEB 3K5NA 4I56A 1N32J 3LGHA 2KRBA 4PWDA 1TL3A 1G7CB 2RRBA 4RW6A 4NA3A 2A3JA 1ZPWX 1UVNA 3CO0P 3H20A 4CYUA 4ZK7M 5KTQA 5C2GA 4UT4A 4KHMA 2Y1RI 2HWIA 2C2RA 1GMWD 4YMEA 1KP6A 2UUCJ 1IBLJ 3D4JA 3IP0A 3D0HE 2C2MB 2CQBA 3L09A 4A4JA 1S1TA 4I6AA 1I6JA 2V8GA 1IJFB 3HSJA 1QSSA 3CF5Q 1QAYA 1EKSA 1RAFB 2FYXA 4A8OA 3TUJC 3KK1B 3OTCA 4B9SA 2CPJA 4QIWD 1GX6A 2N4DA 5HL7Q 1JLFB 3QPIA 5DO2A 1XR7A 1RWUA 3IWNC 4ZA1A 1MWQA 2ASLA 4QJVA 2KXFA 4P2MA 4J9NA 3MEEA 3B4DA 4ED1A 4DFKA 4GMKA 3KJFB 3VV2B 3CJQA 3H4BA 5GAEI 4FPRA 4PPZA 3VAJA 2E9TA 1XQIA 2C2DA 4YDDB 1TKXB 4M8LA 5I42B 3HHDA 4ZVOB 2ZH7A 3NGDA 2GMHA 2YKPA 2ZDPA 4NYZA 3BKTA 1R7IA 3CJ0A 2DHXA 1FWKA 1KWMA 3SSRA 4C11B 2ZH4A 2PD1A 3CIMA 4NOHA 5IQQA 3UNGC 1UFWA 3RBEA 1S6QB 3I32A 1P9QC 2JC1A 2B9EA 2CJXB 4C8YA 4Y2IA 1JLGB 1VRQC 2CWXA 3PYGA 4LJMA 1HNVB 2OPQA 1VGYA 2XHCA 2YWWA 3PR5B 1HBNA 1ZM9A 4YFUA 2JEFA 2QC3A 1WOSA 4ZP7A 4JI0F 6AT1B 3L7PA 1TMMA 3GE9A 1RWPB 2XS2A 2HW3A 4LF1A 4OJ1A 1CJKA 2NSBA 2RNEA 1Y7PA 4QPXA 2NS1B 4DL3A 3UQSA 4Q8FA 1S77D 3NGRA 2XNQA 1NH7A 2CJKA 1U2RA 3AFGA 2C1EB 5AXMA 2E7VA 1GT8A 3J7Z5 3M8PA 1WKJA 1JMTA 3MMAA 3VVTA 4DV7J 1X9SA 3K7RA 5ETLA 2ZHOA 3GR1A 3KHGA 2K7JA 1S97A 4X4QA 1IKVA 4JI1J 4K8RA 1S79A 2PMZD 3I55S 2DPIA 3WHIA 3CJSA 2K06A 3G4SS 4WJBA 4Y2KA 3R6LB 2UXDJ 3C14A 3AJ2A 3VGSA 1Q1KA 2LEPA 4CTAB 1RT7A 3HSZA 4RW6B 2B4PA 1FEEA 1X5SA 3ZTOA 5B0AA 1NNDA 1UJ5A 1O0PA 2DNZA 3EX7B 2VH7A 1KD1T 1M5KC 3QSIA 2FUG9 5B08A 3AB4B 1VRTB 3IM8A 3GR0A 5IZHA 4K59A 2NXJA 5L1IA 1RYRA 1R3NA 1O8BA 1JLAA 2WVEA 4DL7A 2IY5B 2OKQA 2VFRA 4F2SA 4DV0J 3DLEA 1BE4A 1SVDA 4PUOB 2GQQA 3AB2B 3OT9A 4NRTA 3WIVA 1NK7A 1WG5A 4RW7B 3B78A 3OVSA 4JV5F 2HS0A 4ZCLA 1NJZA 2AZ1A 5H9EJ 4KR0B 3QT8A 4YEAA 2XBPA 4NCAA 9ATCB 2LXUA 2J9DA 2R8KA 5LT5A 4X4PA 2MJNA 2VG6B 3M2RA 3TA1A 4OYZA 3MM8B 1R8HA 2BYCA 5DG9A 1IVZA 5DLFA 5HAOA 1VBZA 3P49B 3EE3A 2Z8QA 3F56A 1MROA 4TY8B 2W1BA 4CLFA 2DPJA 3RRKA 3IAS9 1URNA 4CM2A 4ELVA 4AL7A 1UA1A 1KDNA 1NKCA 4NCGB 3NS6A 4HTJA 1UFKA 4A48A 4K2JA 4O0IA 1UWBA 3CTRA 2V4JB 5IFMA 2RF2A 4P71A 2VG7B 3MUMP 1N36F 1UEKA 2W24A 1YBAA 4E0DA 4KFBB 3JTPA 1M1KT 4UUWA 1U4BA 4ECWA 2MLYA 4ED2A 1BQMA 1REVA 5K9FA 3W63A 2B43A 4DV3F 2ZWPA 4DOZA 3MOJB 2X3GA 2HNDB 5IV3A 3ELHA 4Q0BB 4DS5A 4DR1J 3DOMB 4P10A 1T0TV 3CCLS 3C15A 1AROP 2G0JA 2BKNA 5KG0A 2BRLA 3VQSA 1XERA 4X66J 4H4MA 1UVLA 3K57A 2WONB 1UVKA 2EKNA 5KT5A 1X4CA 2JC0A 3GFHA 3TWZA 3FJ2A 1S1VB 4DZ6A 1TKZB 4ZLPA 3TZZA 2PT0A 3BSAA 3OTEA 5KFBA 1A0OB 3FUYA 1S1WA 1X4GA 4PYDA 1TK0A 5G0RB 4Z37A 3UR0A 4EBEA 2AZ3A 2A10A 3QIDA 4V1Ak 2FLNA 2VOPA 2PO4A 3HFZB 2XB2D 2Y0SD 5ETRA 2L9NA 3P5TL 2ROPA 2XMKA 4ZVEA 3GIIA 2NZ4A 4GC7A 3WQPA 4ID5B 3CDUA 1WJ9A 2VV5A 1FXLA 1VK8A 3C6UA 1IKWA 4K5SA 3W9IA 2CQPA 2V34A 4P52A 2L9WA 3BDPA 1WORA 1VHFA 3DHXA 1CULB 5HATA 2ZUGA 2YTCA 3ADAC 2UVUA 1LK5A 1LWCB 3BKUA 1VBXA 4NMLA 4ZVTB 3HT3A 2FTRA 4U8VA 1Y0HA 1TZ0A 2VF3A 4PG7A 5A8RB 3DLKA 4WZMA 1Q78A 1UJ6A 1FKPB 3MGJA 2E1CA 5B0GA 4EU0A 4ANCA 3GQCA 4X84A 3FFIA 3GYNA 1S9GB 2W8KA 2W2MP 2B7CB 2JRSA 2XHWA 3E8OA 1OPZA 3R97A 1HMVB 1N0UA 2IDEA 2G2ZA 3MM6A 2B56A 3BR9A 1XMOF 1JX4A 1G1XA 1FNOA 1M1GA 5B7WA 2V2VA 3B82A 1ZA1B 4ZN1A 2N4CA 1B64A 2PFFB 2PMHA 3KJNB 2F1FA 2CQ2A 3V6DA 1NPKA 3CWJA 2ALZA 5F8LA 5KFNA 1AT1B 2PDAA 3Q86A 3R9LA 4E2FB 3H5YA 1DAXA 4WXOA 1GTEA 1TKXA 2F4VJ 1XN9A 3HLUA 2V4JA 2B4UA 4A8KA 3PG9A 3UN2A 1X0FA 2BM0A 3CD5A 4J90A 4LBHA 3R27A 1I94J 2HK3A 3BH7B 3GILA 1HQEA 1DQ9A 2Z2ZA 3MAAB 4CO3A 2VICA 1TQLA 2I5JA 1SC4B 1T02A 2DH8A 1RZMA 2V2QA 2V67A 3F41A 3PYEA 4KAIA 5FD1A 1VRUB 2P6SA 1NK8A 4MT1A 3AQPA 1HNVA 2OPQB 1HBNB 1TUWA 1ZOTA 2YWEA 3CSKA 2NPFA 4DLGA 1R8AA 5J2MA 4BWMA 1YHQS 3G6XA 4H4MB 3M05A 2KJVA 3HFVA 2HVHA 4CNYA 2VBZA 4B3TF 3JAMU 1AFIA 2HFNA 2JHEA 5KFDA 2DR6A 5DZ7A 2HZAA 4CI0B 5F8GA 4N56A 1S0OA 5FLXU 4W98A 3UD4P 2GFFA 4QOTA 4LF8J 2ATCB 3NMRA 2HVEA 1H0HB 5HROA 1T03B 2JVRA 4HDGA 1G2EA 4NI2A 2PE8A 4X66F 1ZYQA 4NE9C 3HZEA 4PZVA 4ZS6A 2C2NA 2KHDA 1T9VA 3E01B 1FX2A 3TW0A 4X64F 2M5YA 3I5CA 4PG4A 4F36A 1VQYA 3KK1A 2ZEJA 3Q89A 4DX6A 4DSIA 4A8QA 3MM5A 1FKOB 1KFDA 3RAQA 1LFWA 3X1LB 4NXNJ 3GFYA 3C14B 1HBMB 1R8CA 4R5PA 1H2TZ 4CTAA 4M5GA 2PEBA 3MEEB 3BEGB 3NGTA 3I4PA 5J1PA 2HQCA 1O5JA 2KM8C 5IM0B 4FXVA 4IRKA 1ZTWA 3B54A 1S99A 3MMCA 1KC8T 2VPXB 3FZBA 2HHQA 5I42A 2AGQA 4JYAJ 4UY8T 1AUSL 1MSWD 2BMBA 2V8PA 3H40A 3CULA 4DG1B 4M95A 2H48B 2CPHA 5AJ3J 2MHNA 1QE1A 1CJTB 3H42A 4I2PA 2HAIA 5I3QA 1RU2A 4G65A 2FVQA 3M6XA 4OX6A 4CWBA 2C3MA 2CPIA 5DG8A 1R0BG 2BBEA 2QTWA 3UW1A 1MN7A 4RZRA 4WF9Q 1EHWA 2AF6A 1HA1A 3LO3A 2RQCA 1ELOA 2B5JA 3H25A 3V6DB 2JEIA 2HK2A 3Q8UA 4NLSA 4NASA 4CP5A 4BC9A 2HIYA 2VQEF 3ZNUA 1FO1A 1JB0C 2OFGX 4ANEA 3QIPB 3DLLQ 3THPA 5CCLA 3M8PB 4NLUA 4C3MA 3PHTA 2XNRA 4PPDA 2B7BB 2QLXA 3LPYA 2GIFA 5ETKA 4AE5A 2OH2A 5CH7B 2VG7A 3GSDA 4FYXB 4ECRA 3AOAA 1M90T 3KLHA 4FVCA 3VF0B 4AT1B 4ZHRB 2M0GB 5HO4A 3EMTA 2HWHA 1FT8A 3W5XA 2KM8B 4DX5A 2ZD1B 2Z57B 4DL4A 2E1RA 1RACB 3DDNA 3OTDA 2WW8A 1RADB 4YB6A 3NOCA 5AE3A 4X4VA 2KTQA 4QWCA 1KBRA 4HR2A 1WSVA 2WVFA 1FJEB 4O3NA 4MH8A 4Y3CA 1NJIT 4K0KF 2HRYA 8RUCA 5C25B 4ELUA 3QMQA 3S8SA 5KT7A 4QYZK 1ITPA 1S7IA 3VAIA 4KPYA 1TFWA 3I9V9 1JJCB 2BJ9A 2Y8WA 5DM7Q 1VC5A 3IBWA 2ZE2B 4DPYA 5A8KA 2ZJQQ 2D3OR 2XMMA 1RISA 1FD2A 3UDVA 5C42B 1KQFB 4RJVA 2MQOA 2J0SD 2KZMA 2KH9A 2CPDA 5D0RA 3UN5A 3R5JB 3MPVA 4QIEA 1C0TB 4ES2A 3Q0AA 2C3PA 1YJVA 4USTA 1ICEB 2FC8A 2KYXA 2MTLA 3M8RA 4OYAA 1U25A 3BREA 3BQ1A 5D3GA 2QRRA 2PI4A 4M5KA 4DUYF 4I64A 3QGPA 1ZM3A 3DDIA 4L74A 3ZZPA 2ZKTA 3RW6A 1H2VZ 3D1QA 3FBBA 4QR0A 3GZ7A 1TAUA 1S0NA 1FERA 2BE7D 1SBRA 2GJFA 1WEXA 3RUBL 4NYPA 4DPUA 4RUHA 2MSSA 2K1RA 1FJCA 4HKQA 1UWBB 4G1QA 1OS5A 1HIYA 2IIHA 1CS4B 2KO1A 2OLWA 3EZUA 3FGVA 3GG1A 3H2UB 2QJ3A 1RT5B 1S49A 3LA0A 2HLUA 4FZVA 1YLXA 2GA7A 2X1BA 4DR3J 4A8XA 4U6PA 4DFMA 2JEGA 2ILYA 1DLOA 4WFZA 1HMVA 2X1GA 1BQMB 1Q53A 1NU4A 1PILA 1T9UA 2IBOA 2XZTB 3IBFB 3QAEA 4GRSA 2JNJA 4HDHA 2NREA 4X2BA 2EFNA 5KFTA 4Q0BA 4URQU 4QW9A 4FYWB 1LNQA 2NXNA 3ZXWA 2GIQA 4O4GA 3VCDA 3K5PA 2CPFA 2HHTA 3IRXA 1B4SA 5AJ3F 3QWPA 4M5DA 3VAFA 4F4ZA 2WVCA 2BJ7A 2WSFC 4O4RA 2QV6A 2UXCJ 2ZC4A 1RT2A 3ENQA 2CJYB 2J9EA 1U7LA 5KFHA 1RWWB 5A76A 2UU9F 4OHYA 2MKSA 1WG1A 5ETPA 4KQZA 3M6VA 2KDOA 2Z58B 4XIUA 1VQ7S 1WI8A 2HGLA 2R7QA 3HKWA 1HR0J 2EG1A 4OX9F 5H9EK 5EN1A 5KFFA 2ZBCA 1VRUA 1NSAA 1IKVB 1IBCB 1VHIA 2HS3A 4Y0FA 1EQ0A 2VFSA 2DRBA 3C6UB 5IWAF 3D67A 1FNMA 4X62F 1CQNA 4ZMMA 2Y1JA 3QZ7A 1WWHA 3T5LA 1BWVA 1YRXA 3BV8A 2RH3A 1RJJA 3OHAA 3LP0B 1N5QA 4NA2A 1VI7A 2ZHBA 3CCQS 4WFXA 1RE1B 1HHQA 2Q43A 2MLXA 4OZNA 5DDRC 3BZQA 2VFTA 1TL1B 2JDJA 3GFXA 3QT5A 1SUQB 4F02A 1DBDA 3B8HA 3J80Y 1VIXA 3LAMA 2B8QA 2I38A 1T05B 4WFYA 3UDCA 3EPGA 1Z2LA 3IRWP 4EBDA 3G8QA 1DZ5A 4OHXA 1KEKA 4FBUA 4PXBA 1JK9B 2XSJA 4TVAB 3G8TA 4AL6A 2FY8A 2LA4A 3RB6A 5J1EB 2GVZA 2RJZA 1RTHB 2VG6A 5I3UB 1MN9A 1NCLA 2POKA 3ILOA 2E5IA 3AXKA 3MM8A 3R5BA 3ITHA 3BGRA 4JV5J 1DURA 1P6TA 2EFGA 2DGQA 3F73A 1V5IB 1ZZNA 3KJVB 4U96A 3U1LA 2RRAA 2DNHA 4WTOB 4OI2A 4ED6A 1X5OA 1LW0B 2AEFA 1D8ZA 1J5EF 1CS4A 2N3LA 4NCGA 3A1YG 4JP8A 2AD9A 2Q3PA 3SV3A 2DGSA 3I5AA 1HQEB 3HHKA 2X7IA 3MAAA 4X4NA 2YY3A 4KB7A 2DHGA 4ES3A 4LF9F 4BBYA 4HYKA 2DR5A 3A3OB 4YDXA 3AOCA 2RUGA 2F65A 4EUVA 1UP1A 4B02A 2YNFB 5HBMA 4PQUB 1X5PA 4CNZA 2W2NP 4BWJA 1UL3A 4MAKA 1Z1ZA 1E6YB 4LF7J 4DPXA 4KO0A 4DUZJ 2HHHJ 4CQ1A 2JWNA 1RWXB 1C2PA 1MMDA 1BMQB 5K14A 2PFDA 2WRMA 4OFZA 4LFAF 2RDDA 2Z56B 2XMJA 3EZ5A 3C2PA 2WONA 1N88A 3MF5A 2BE2A 2DD8S 3QBCA 1SJQA 3KHHA 2BDPA 1RA6A 1W26A 4ILMA 1NUEA 4IR1A 3DGPB 4QWBA 1VS3A 2HFSA 2I1RA 5KFQA 4NXMJ 5G0RA 3LGMA 5KFKA 1LKZA 1NKBA 3ZO7A 4CT9A 3IA0A 4ED8A 3KMQA 1VOMA 4P2FA 3I87A 3C6TA 4ZHRA 2CNOB 1F1BB 1VLYA 2PN6A 1RTJA 2RSQA 2JFDA 1KQGB 5SUHA 3R1HA 3NKYA 4C8MA 4C97A 1Q7YT 1REGX 2OD4A 3N9UC 3PJ9A 2DNQA 2IVFB 5HJYA 1W2BR 4YB1P 4MFBB 4B3TJ 1J2VA 3Q8VA 1PIEA 4P73A 1YKWA 1DHMA 2JX2A 3AD7C 3GTYX 1FDBA 1LXJA 5E3RA 4ER8A 3K2YA 5M2PA 1SH3A 5C24A 4KKOA 2LU1A 1IQZA 2BR0A 1QVFR 4IG0B 1HR0F 2OPRA 2ZBQA 5F8NA 1PKUA 3CCVS 2FHJA 5HLFA 3DOLB 1AA1B 1UPPA 3MMJA 3J80U 3CXCR 1RT3B 1FKAF 1OYDA 3FRZA 2G13A 1OY6A 2DNOA 2ASYA 3GCXP 3V6HA 4L6V3 1CQMA 4JI2J 2ZE2A 3TR5A 1RHMB 2FVCA 2RKIA 3ILIA 5ETQA 4A8MP 3CCMS 2W25A 2LQBA 1YBUA 2A18A 3D6FB 3D6TB 2NXEA 5B0DA 4U7UK 3SZ2A 2J5AA 1SL1A 2VFUA 5KOWA 4LIRA 4XO0A 5KFCA 4C8LA 1X0PA 3IS9B 3CDEA 3C19A 3AT1B 2M70A 5D3GB 3ET6B 4LR7A 2WOMA 1OQ6A 3ZZOA 1N0VC 1BY9A 4O3QA 3TANA 1BXNA 2AHOB 2XMVA 1PAUB 5H9FJ 4D3GA 4B9TA 2NXCA 2OHDA 1SQGA 4NA1A 2I2YA 2HVZA 3D68A 4X65F 1VQMS 2E9RX 4ECQA 1WF0A 1UW4A 2ABYA 3MEDA 1UPMB 2GNKA 4ZCIA 4NLOA 5FJ4A 4YP3A 3HHLB 1UWAA 3KLGB 1OY8A 2QA4S 3BO3A 3DC2A 1VIOA 5J1NA 1K47A 4WU3A 2XZWA 1B3TA 1RAOA 1UFLA 2LCWA 3JXOA 2B3TB 2DGUA 1CJUA 2DEIA 2FJWA 1RP5A 2HHUA 4ZIVA 5LJ5Y 1BLUA 3MPYA 1D1UA 2BX6A 4UOCA 1U1LA 4B3SF 2I9SA 3DKDA 4NLRA 4KGZB 1TL4A 3PIOQ 3NP5A 4O4GB 1SH0A 2M4MA 2NSCA 4D3HA 1SJFA 4WCEQ 4AUKA 2WHOA 3H2VE 2J6UA 1VQ4S 1S6PA 4F67A 3GFZA 4LF6J 4QWEA 2RT3A 3UVJB 1B0TA 3K5OA 2ILZA 1TK5A 2HG4A 4ZPCA 1T9TA 5K8NA 2FHKA 4IO9Q 3M6UA 1U49A 1Q5YA 1GMVA 2EK6A 5HROB 1M5SA 2FJDB 2VC0A 3CCZA 3NCRA 3TRGA 3UDEA 4JI7F 3U7JA 4NI2B 3LAKA 5GMEA 4JUZA 3SEOA 3AY0A 3C3LA 5F3TA 4LFAJ 1R0AA 3HJFA 5L46A 3D6MB 2KZZA 3E01A 4QWAA 1C0TA 3JYTB 2GC8A 5BXIA 3RB0A 4YHHJ 2CNKB 4KTQA 4BS2A 4EO6A 1SIZA 4A8YA 1Y00A 2H1YA 1IBKF 3CJKA 2A6MA 1VDHA 4F4KA 1U6FA 3D3CJ 4RUCA 2UV8G 4FP9A 3OXGA 9RUBA 2IBKA 1EP4A 2DIUA 1U47A 1BQNB 1S6OA 3FSXA 4KGKA 4IO1A 4G1PA 5F3ZA 2DXDA 2M88A 1RT3A 5J2PB 2F8MA 4UW2A 1RAGB 3ETOA 3P96A 2DH7A 2KT2A 2HVIA 3V5RA 2YKMB 1MG7A 1HQUA 1GXUA 4GVBB 2XMAA 1SPBP 1LXNA 4NCBA 3OD2A 4IH5A 3SCJE 4AXJA 2KJWA 2Q6CA 3RRHA 4WXWA 1U1MA 3M2VA 1NBEB 3THTA 4NRUA 3EGVA 4ES1A 3DOKB 2CAJA 2ZOFA 4LRDA 4WTYA 5F0WA 2IA6A 3EDRB 1FE4A 2EVZA 2JLGA 3HVTA 1JNRB 2J8SA 2QIFA 2R8JA 2CPZA 5KG1A 3R2DJ 3PEJA 1WKLA 5LSLA 4W90B 5DETA 3CMQA 5GADU 1N5SA 2GVDA 3M4XA 2ZJPQ 1C1CA 1WC6A 3E3XA 4M63A 3J81U 2RHSB 2EI5A 4DCJB 4IQMA 1ZAXA 5RUBA 1XR5A 1SXLA 2GAGC 3SXLA 2XQCA 2ZZNA 3SBMA 2ACYA 3DRSA 3DU5A 2RB7A 3KNGA 1XR6A 2DCLA 3HSGA 3OXLA 3T1AA 4B3RF 1SJ1A 2NUUG 3AJDA 4YY3F 2GO8A 5CZVA 2EG2A 2ZVSA 3H0PA 5KG5A 2YNHA 2H51B 3BQ0A 2YNFA 5HBMB 5KFLA 1N5YA 2L48A 1YZ7A 3BBCA 1RB0A 4DR4J 5CYMB 3NRBA 2KFYA 1WUUA 2C3OA 1FWLA 1ZAVA 2DNYA 2B51A 2OO4A 5L9NA 1X4FA 3W64A 3BGOP 2R2SA 2KFZA 1RKIA 2YKOA 5BR8J 1HNXF 2V94A 2W01A 4OZJA 4LSNB 4PQAA 4ELTA 5DDPC 4EYHB 4O44B 1B7YB 5DS7A 3IWLA 2XCAA 2AYMA 3PW0A 1KRPA 4DR2J 1ZM2A 4RW9B 3TAMB 5GAHU 3T1HJ 3ILJA 2LXIA 3A8KA 3B6BA 3GG0A 3O8WA 5KT6A 2A1BA 4X4UA 2HSEB 4DN0A 2MJUA 3JYTA 2L3MA 3VALA 5C42A 1YI2S 2D1CA 2XSJB 3BN4A 4EI2A 4DR7F 4TU8A 3M30A 2UVWA 2G1DA 3PW5A 2WK4A 4DI6A 4MKAA 2RU9A 2QFJA 1PO6A 1T11A 5CAAA 4NZ6A 3RTVA 4ZPAA 2BA9A 2ZOMA 1YRUA 1T3NA 4QIGA 2B4VA 3PDNA 3KJVA 3NGSA 4WPAA 1UAWA 3HT0A 4OZLA 2NUHA 4N8NA 1P1TA 2ALYB 2YQ3A 1HNIB 3DOLA 4NEZA 1F60B 1KS2A 5HVGA 3UCUP 2CDRB 4EYIB 2CZ9A 3Q8SB 2Y9HA 1O6XA 4EZ6A 4DV4F 3MM7B 5DG7A 3CW2C 4C11A 1XMBA 4UOGA 1U1RA 4OI1A 4K7QA 4Y34A 2CZ4A 4NLPA 1RDRA 2MQNA 3BSNA 3PTWA 2FJVA 1HW9A 3HDSA 3LGNA 3M2VB 1IBMF 4KSEB 4USJC 3M2UA 2L41A 2LECA 4OIXA 5CD4H 4QIVA 4QZVB 1E6YA 1PYSB 1Y11A 1FCAA 4IFVB 1SCJB 4TXSA 4J37A 4KY3A 3GJQB 1KQSR 1Y5NB 3DXBA 5KG7A 3L3CA 1X4BA 1TK8A 4CLSA 1VYAA 3QO9B 1B99A 3H98A 4FNHA 4URSA 4IG3A 4CLKA 3G6YA 3G82A 3V6KA 1S59A 3Q2SC 4BHQA 1DTQB 1VQOS 3HSDA 3LW5C 2D3ZA 3OJSA 4MYTA 4NZ0A 2OEKA 2DITA 1UKUA 4J7CA 1YJTA 1RT2B 2OFHX 4DL5A 1C0UA 4C3KA 4B9NA 5D4OA 1IR2A 4K4XA 3H5XA 4K4SA 3KLGA 3DMJB 4R0EA 1P9YA 3JSBA 3MM9B 4KPCA 1L5UA 2CZVC 2YNHB 3QT6A 1RTJB 2PC6A 2OELA 3BGFA 3WBZA 3ZZYA 2CKWA 1JLBA 3D1OA 1AXQA 4LR9A 4WBFA 4MFBA 3W2WA 5CCMA 4URGA 3QSYB 1GK8A 4QPTA 1LWFB 3WC2A 1RT7B 2MQQA 5GADI 1EARA 3IR6B 1W25A 2DB1A 4B3RJ 7AT1B 5LXRA 5JUMA 1FESA 3MD3A 3D7SB 4CIOA 4YOEA 2LFVA 2W9AA 4PWDB 3MOZA 5AE1A 4YUDA 2OI2A 1Y5IB 1QSYA 5D15A 3CCTA 4J9QA 1SL0A 2G0CA 4X4RA 3WZ0A 3OFGA 4DSFA 1EAYC 2KRRA 3ENVA 3PEHA 1EETA 3FSYA 1QUPA 1WACA 2VQFF 1TL1A 1F5BA 2FGCA 3CC2S 1I1GA 3NAIA 2IDLA 4NWBA 3M32B 4USWA 1R0AB 3FVYA 2XY5A 2DNRA 2YNGA 2HFZA 1L3KA 4FN5A 1VC6A 3CC4S 2CUYA 2ZNYA 1VFJA 3SCIE 1N48A 1RAJA 2HNYA 4DFJA 1UVMA 2QYCA 3M2RB 4WIQA 1ZM4A 2V2ZA 2HPUA 1SJ4P 3KG4A 5A6WA 4K4VA 4DR2F 4Y2MA 1QLNA 3FQLA 2KI2A 4RBVA 1LV5A 2DXFA 4Q43A 5E2QA 4IH7A 5KFWA 1QD1A 5D8HB 1ZBTA 4CLLA 5HVHA 4CO0A 3P3DA 3HO1A 1FRJA 4HLBA 4O23A 1V6HA 3MPUB 4LUBA 4EFAC 4Q8EA 4DV6J 2JL9A 4F50A 4WKRA 3TUPA 2IA0A 2J0QD 4L3KA 3DRPA 4DU7A 4ED7A 5K20B 2AJFE 1DY3A 1DQAA 1H7XA 1QDUB 4WK3A 4DQRA 3RBZA 4P75A 4ECZA 1N34J 3PO4A 4FF4A 4I68A 3HHEA 4F25A 4Y65A 3GU0A 2LXFA 3KLFA 1NK9A 1HWKA 2FZGB 3NOGA 1E6VB 3DOMA 5F8MA 4H4OA 1RAHB 3W2VB 4DV4J 1AUDA 2YPZA 5F8IA 2D3O1 2FHJD 3MR2A 2Q66A 2W7AA 1FE0A 3DN9A 4WFBQ 2VL1A 4B9VA 1WEYA 1JKHA 2QL7B 5EX0A 4FVMA 4DR5F 2BACA 2MKHA 5EWFA 4L3NA 2YNIB 4F26A 5AT1B 1ZA2B 3HKZD 4P6QA 3MMAB 3CEDA 4C0BA 3OL7A 4AXIA 4LVNP 1IKYB 3PJWA 1NSKL 1S1TB 1Q7LB 2W9CA 1JLBB 1RI7A 2YPYA 3JQMA 1KTVA 2AWZA 3O1LA 3ETMA 4ID5A 1TKTA 2HHPA 4JI8F 3NLCA 4JI4J 3DRXA 1DFDA 4C8KA 5T7LA 4RNMA 1SKRA 4FKYA 2K3IA 1RT1A 2CQDA 2DY9A 1U48A 2OD6A 1EP4B 5EX3A 1TVRB 2ZWOA 3HVRA 3PCOB 1BWEA 3P5BP 2BJ3A 3ZFVA 2V4QA 2MMYA 3NS5A 1N36J 3BGLA 4G3IA 3UO0A 4QU6A 3BPDA 2JH3A 5CA5A 3KLIA 2PSZA 2O01C 4JI7J 4IFYB 2IM1A 2CQIA 3MURP 2W2PP 4I6WA 4PR6A 5LMNF 1UMJA 2G9OA 1JLAB 3RJMB 1S9GA 1F9HA 3FSIA 3MPDA 1NKEA 3QT7A 4KGXB 1F0XA 1D3WA 4HVZA 1M0SA 1U2CA 3U1MA 3CJ2A 2V8VA 1YVFA 1EKRA 3L95X 2J9DE 4G1IA 3NNAA 1M5VC 3TVZA 3RBXA 4DQIA 1JLEB 4DMZA 5GVQA 1HHSA 2EXUA 3LTOA 5HQLA 2H4WB 4ZVUB 4DPOA 3D6HB 5CYQB 3QGIA 4ZVQB 6FD1A 2J0XA 2IAJB 1HL6A 4NYOA 4PRFA 2BJ1A 2FY1A 1HBOA 1AZSA 2X51A 7FDRA 4KHPF 1HNIA 2R2TA 1GMWA 1JIHA 2QN6B 3M8SA 1VQPS 2ZBRA 3EICA 3MEDB 2E5GA 2MKYA 3IMQJ 4IH6A 2B8PA 2GJ2A 4M5JA 4KHPJ 1L3SA 2HEKA 1AFJA 2AQ4A 1I94F 1VQLS 5CXTA 4B9LA 2K3KA 4LT6A 1EIYB 2F5GA 1UVIA 2E7XA 1VQ8S 3GMGA 1WTFA 4ZITA 1C4CA 1U8SA 1TAQA 4C0OC 2XY6A 3ZTSA 4B3MJ 1REVB 1NDCA 1RWNB 2YH1A 5J2MB 3TJAA 4DXLA 1OO0B 4ZJQA 5BYRA 2IM2A 1MU2B 4DLEA 4ICLB 4ZOSA 1RWOB 2RU3A 1JLCB 2G2OA 4FS1A 1FX4A 2KN4A 2XTJP 3PJXA 1HD1A 1IKXA 3FBCA 2EEYA 4TLRA 1N34F 2FHMA 1DTQA 4USMA 1TL3B 2DNPA 4B3SJ 3V4IA 3K8VA 4NLXA 4E98A 1KVKA 1RWKB 3GJTB 2BABA 4MIWA 4DJBA 1HI0P 2DNNA 2WVDA 2EC2A 3DYAB 1Q8BA 2GQ2A 2W2OP 4MK7A 3FDSA 1RABB 5FLXY 2Q6BA 4WE1A 4ZJLA 1BUXA 3H5UA 3LANA 3SFUA 5GAGU 5DQGA 1N6QB 4TU9A 2QA4G 3QATA 3MM5B 4ED5A 2QMWA 5ETTA 4FYVB 3Q24A 2MQLA 3FEXB 2QG9B 1HBMA 2DTJA 4ILLA 3ENAA 3EDQB 4LFBJ 4I6YA 1FK9A 1NZ8A 1QSLA 4QU7A 2P6TA 4KT0C 1TL5A 1UJ4A 2QYGA 3DRYA 3NGKA 4WIIA 1CG2A 4ZKAA 2XEXA 3G6ES 5IT9U 2HS4A 4ETXA 1H72C 1HBUB 2DH9A 5GAEU 3ZTQA 4BC7A 3MCNA 1HWJA 1YDLA 4QCLA 1XJWB 3OR2B 5HMZA 1NK4A 2M52A 1S0VA 1HWIA 3NXZA 5CD4A 5F8JA 4F3MA 3KHRA 1K73T 1HI8A 1FWPA 1N52B 2VDIA 3FKBA 1Q8IA 4Y00A 3R7NB 3UI3A 3CIZA 4DEZA 1U0HA 3CJ5A 1X7VA 1RAIB 4QYZJ 4JI1F 2KG1A 4P2XA 4RUAA 1YIJS 1MMLA 1ULRA 1A6LA 1HQ2A 3QNWB 2COLA 3HXMA 3V2UC 2YX1A 2BANB 3OJUA 3V81A 4I1TA 4TLQA 4YQWA 1M5PC 2B9XA 4Y28C 1S1UB 4U95A 1FXDA 1A9NB 4XK8C 1FEHA 1IBLF 3OL8A 4EGLA 4ZCKA 1N4LA 2OP5A 1KLNA 4W92B 2YWFA 3MR7A 3MAHA 3UR3C 1YJNS 4TN2A 1WHVA 2RRNA 5E3CA 3I96A 3TJ8A 1N56A 1YJ7A 1F6TA 2ZH6A 4M94A 2V0NA 2PMWA 2RUSA 3PRBA 4BDPA 3S6EA 2EBGA 2V68A 3OW2R 2LDYA 3I5BA 2YQ1A 3CO9A 3OLBA 5LMUF 3PW7A 3DDKA 3T19A 5CZXA 2XI2A 3GCWP 4FBTA 4WYWA 3RB4A 1IR0A 4LRCA 4OZ1A 2E1PA 3QWUA 2BKPA 5CYMA 2IJRA 5LL6d 1D0EA 5GMKa 4CM0A 3CDWA 2MZTA 4IR9A 5HP1A 5DQHA 1JXLA 3DNCA 3PW2A 1P27B 2YQ0A 2K2PA 2GAHC 3UPFA 1H7WA 3I31A 3RW7A 1Y3KA 4TYAA 2AYEA 4OJHA 3PKYA 4P2SA 2CVEA 2QA1A 4E8UA 2QLJB 3IG1B 1DRZA 4B3MF 4DSKA 3DLKB 2ZFHA 3EVMA 5D4PA 5ADZA 1S10A 1RYSA 2VODA 2W7OA 4C8OA 3LPEA 2W9BB 1VRTA 2XWYA 1T03A 3GLJA 2C28A 4ECVA 1GTHA 2DCUB 2ZZTA 4YR3A 3CCJS 2G4BA 1FHTA 3FCWA 1VQ5S 4Z2XA 1EQMA 2XS5A 3R5AA 2HLTA 2FD2A 8AT1B 1TTHB 1I51B 4RW7A 2RS8A 3N5BA 2MHEA 4MKYA 2WBMA 3EGNA 2DK2A 4DV1J 4I67A 3OFHA 4DUYJ 1HLWA 1N54B 3M30B 3G6VA 4DR1F 1WSRA 4F4WA 1JNZB 4JI5F 4PWUA 2ZM6J 4DV7F 2ROEA 1RCXB 3ONQA 3UWTA 1GX5A 4I0WA 3A3PB 3SYZA 1RKJA 1G4CA 2MYFA 2AT1B 3G86A 3SCLE 2G2YA 1FXRA 1RTDB 3FK4A 4J9PA 2BJ8A 3N6NA 2VQFJ 4AQYF 2V6AA 1NSQA 2QLWA 4F0HA 3NWRA 1Q4RA 1URRA 2F9DA 5D4NA 2CPYA 3MXHP 3MMBB 3S7RA 5KFOA 1L3VA 1ZZFA 1R27B 4MKVA 1HHTP 4LFBF 2I5JB 3P8BB 1S6UA 2HVDA 2MPUA 3KLEB 3P45B 5EGYA 1BGXT 1ZS6A 4FPIA 3N6MA 2VJUA 2UVVA 2DNLA 1F5AA 2DHAA 2WSCC 4H4OB 1NRKA 4ECXA 3T5KA 2R7SA 4GKJF 1JLEA 3MHYA 3I0RB 2BRKA 2VPZB 5KFRA 3P6YC 2D74B 1R43A 1HPZB 1Q8LA 1RAEB 3IO1A 4WP9A 3L7OA 4HL9A 1CBKA 2EFPA 2O67A 3B4MA 4OMFG 4Z7CA 4PG6A 2O66A 2UXCF 4OYPA 2MKCA 2MSTA 1S1VA 4LSZB 2JVOA 1JXEA 1B7FA 5DDOC 2LMIA 1OIAA 1SC1B 3L7UA 1CPZA 5KFPA 4LRFA 1X9MA 1IKYA 3LQVA 2D69A 4LBIA 3W5YA 4ZCMA 2X1FA 1S5ZA 4NLWA 2PIIA 2VB6A 3DM2B 3MM9A 5AXKA 3BBFA 1M5OC 2BV3A 2KXHA 1OYEA 1FRKA 4J5OA 2YH0A 3DI6B 2BKOA 4C8NA 1N5TA 2XG8A 4OL8A 2ZD1A 1RAAB 5A0YA 2KYZA 2KL8A 2RE1A 3CDAA 3EVWA 3HD2A 3OR1A 1GFWB 4NLTA 1XNRF 1FTCA 2CQ3A 2OSQA 1Y4ZB 1VR6A 2OUGA 4BLGA 4JV1A 3CD0A 3EGWB 4NLDA 1SJ3P 4CH1A 1HFEL 4JV2A 1XK8A 1Q95G 4TY9A 5KT2A 2YKNA 2MZQA 5GAGI 5LMUJ 3SV4A 2HHWA 4KBIA 3OVAA 2XMUA 4JBCA 3QJLA 1NDLA 3TJ9A 1XIQA 4Q2LA 5EWGA 3MEGB 2ROGA 5B0BA 1U26A 3MFIA 4JI0J 3AAWB 1L3UA 4LF5J 1F2GA 2HBZB 1KKHA 2MLZA 4DQSA 1GQEA 3PNIA 5KFAA 3SQGA 4ZLLA 2I0XA 3FMWA 2BQRA 4I2PB 1S9EB 3LP1A 2EWHA 1ZAWA 3OTBA 2R2UA 3GONA 1YQHA 1RHKB 4OLOA 4B9UA 4RWXA 2VG5B 3SMZA 2V9KA 3FRYA 3OL9A 3Q2TC 2HNYB 2VUGA 4M5NA 4MMOA 3NG8A 3MCOA 1G3OA 2ZJRQ 4J9RA 5C7PA 1IM4A 1NH8A 2EW9A 2B5JB 5IS2A 1RHQB 3V4MA 1VC0A 1KNZA 1GNKA 4J9LA 3MTKA 1J5OB 1YJUA 3IC1A 1N32F 1FTRA 3W9HA 3KK3A 3UD3P 4MIBA 2CQCA 3MWBA 1FRIA 4GO5X 2C2EA 2LVWA 3WIUA 4CLWA 1AZSB 2R7VA 4DL6A 5KFJA 3RRGA 1VJWA 2EFQA 3AH6A 2H3EB 2VOOA 3BO2A 4U8YA 1HBUA 2H5JB 4MJKA 4ED0A 1R8BA 3MMBA 3TO8A 3ZZTA 1D9DA 3OR2A 5H1SV 4HHUA 3RG6A 3K8WA 1MWYA 3K5MA 2GCFA 4DV1F 1CJVA 1U0SA 5DRKA 3N28A 5L39A 1MWZA 4XPEA 3RB3A 4WP3A 1U0HB 5LSRA 2FDNA 5EHHA 2R8GA 3Q23A 1S9FA 1IQTA 4CDIA 2VONA 1T7PA 3OLAA 5JMNA 3I0SA 1DTTA 2Y1LB 2CVIA 3POTA 5E0OA 1JLCA 1XMQJ 1S7HA 2E7WA 2UUAJ 4UZBA 1T9WA 4USIA 2N7CA 4YB5A 4ZVFA 3D3BJ 3T6BA 6FDRA 1JJ4A 1HWUA 3PY8A 2GHWA 5GAHI 2IC3A 2VKZG 2AV5A 2J8AA 2XLKA 5E5NA 2KU7A 1JKHB 1FA0A 3DLGA 3GP9A 5IXUA 1JJHA 2HHSA 1RT4B 3TAQA 4HH1A 3MR3A 3K59A 4DFPA 4GKJJ 4OHWA 1F9FA 3D0GE 4Z7YA 5J2NA 4IDKA 2UP1A 3MR5A 2UZAA 4KYZA 4CLYA 4HT7A 3SQOP 2DIVA 4K2XA 4B08A 3NY0A 2ZVIA 3F0NA 2LEAA 3HHNB 5ETNA 1HYSA 1PJ7A 1LQ9A 3FNNA 3ULHA 2H4YB 2E5JA 2MQ8A 3WX4A 1FFSB 1UETA 4MTPA 4ZJOA 3WC0A 3CPWR 4OYBA 3HVAA 1NM2A 1K1SA 1Q79A 4L76A 4MIAA 1IWAA 3KK2A 1NPPA 5C24B 2E44A 1YWXA 4NX9A 3MZIA 4WK1A 4R5PB 4ENOA 1TR0A 2CWKA 1UW9A 2NLWA 2OEJA 3JSRA 2YWGA 4RBTA 5HLFB 3K58A 1FRHA 4LRBA 4NL5A 5IM0A 2F4VF 3IG1A 2NCKL 5L1JA 2GHVC 2M8HA 1Q8KA 1V3RA 2NPIA 2VC1A 2ZNZA 3KWMA 4KGMA 5KG3A 4F4AA 4ID8A 1AYEA 3PR4A 2IYGA 2AGOA 1X4AA 5HK4A 4BCAA 5EWEA 2XI3A 1RCOB 4DR7J 4LFCF 2AW0A 3NEKA 5E3AA 5IV4A 2E29A 3KUHA 1DLOB 2HHHF 1CEZA 2HNZB 1U02A 2O3DA 2PA3A 3ZZ0A 3KTQA 2MQMA 5B0EA 1S76D 2LP4A 3M7VA 1B0VA 1U45A 5HMYA 4ZLNA 4LF5F 2BANA 4ILRA 1MLAA 3DFEA 3KK3B 1VJQA 2HFOA 2HZCA 2QO3A 2BW7A 4MK8A 4U7CA 1N33F 4QIFA 1WDDA 2NZCA 1PC4A 1F9EB 2HRUA 2YXLA 1NJYA 2AX1A 2CNNB 3TI0A 3O5TB 2H54B 2OMLA 3C8YA 4DX7A 2Z2YB 3D2WA 2R8IA 4NXMF 4RBUA 4PXEA 2F40A 3Q8PB 4X64J 5KOXA 5IT9Y 2VPWB 3QAUA 2ZBPA 5FDLB 2NYHA 4S0MA 3M9OB 4ITSA 3T1YF 4DV0F 2EFVA 1LOUA 3OTOJ 3PIPQ 2AJ2A 2Q1LA 3OFEA 1T9YA 1RTZA 2E66A 3FEZA 3W1YC 2ZH8A 4UY85 4HACB 1YJRA 2QLFB 1AB8A 1DJ0A 2QZ8A 4OYMA 3W7BA 2JZ5A 4TNOA 2DGVA 1V5VA 2W8LA 4K4TA 2GGPA 1RUSA 4ZLJA 4QBUA 1VQSA 4KIAA 2HRTA 4NLQA 1XMOJ 2HZVA 1OQ3A 5M2UA 3F44A 4CYUB 2FGOA 1NZAA 2D9PA 1NEEA 4I69A 3TQ1A 1TKDA 3CMES 3CD6S 3P4UB 3GV7B 3N0VA 1FVSA 2GHPA 3PYDA 3R3TA 3TEGA 1KONA 3TX8A 3ZC4A 2DKOB 2V4RA 2DHHA 2XS7A 3BSCA 1QAXA 3H4DA 2V50A 4YN3B 3AA9A 1T05A 3NWGA 3VR1A 3D0IE 4F0KA 3BSOA 4J9KA 1FRXA 2IVMA 3DXSX 3GV8B 2CG4A 4OZ3A 3QFWA 1NK6A 4JI6F 1JLFA 2CQHA 3KG1A 2R7RA 4KRWA 2F8EX 1UEVA 4UTGA 3OSNA 2HBRB 3ITHB 1J27A 2VBWA 4FF1A 2OPPB 1FK9B 2R42A 3MEKA 3VZHA 1TP7A 3KNAA 4IYQA 2GMLA 2IHR1 1F3VA 4B3OA 1ZPVA 2YBVA 5D77A 4LSLA 3CDBA 3PYFA 1TU0B 5HANA 4CLZA 1SV5A 4O0NA 4N47A 4CT8A 5HQ8A 2RMLA 2QSFA 1Q86T 4YR0A 5KAKA 3JTOA 3LP1B 1S9EA 3KLEA 2VJVA 5KG2A 1ZETA 1JLGA 1NDPA 1WF1A 4LVOP 1UEUA 3E2EA 1YG0A 2XGQA 2AJ1A 2KT3A 3IR7B 4WKYA 1R8PA 2RAQA 2J9CA 4OI4A 3GIMA 3SFGA 2ZM6F 4TQSA 5HQMA 1KTQA 5IWAJ 4UUXA 3KHLA 1WI6A 3SSSA 1PBUA 2V5HG 5AXLA 2IPOB 2MGZA 1PC5A 2P9CA 1UZDA 1HARA 1QJHA 1OSDA 3ENWA 2MQPA 5F0UA 4FXWA 2VHGA 1RBLA 2CA9A 3MCMA 4DUTA 4RW8B 3BS9A 2QLBB 1G6BA 1BQXA 5MAOA 4ZP6A 5HMWA 5DQIA 2BQ3A 4RNHA 2ZC3A 2OTLS 2OIHA 2OPSB 2A0FB 3SSQA 5BYSA 4IRCA 3DU6A 3O3LA 3DM2A 3QJPA 4A8WA 1X31C 3M8QA 2BVZA 3T5JA 4JYAF 4AFFA 2DGTA 2EKYA 3UD5A 4KV8B 2AIRB 5ETVA 4AD6A 4HT5A 3I0SB 1UTAA 4ECUA 3WDOA 2V63A 2WVBA 2O1PA 5ITHA 5HP1B 1OSCA 1XWLA 4LSNA 3KUEA 3OBIA 3HHLC 4WWSA 3UFCX 3MR6A 4L73A 1D8YA 2FLPA 1U6BA 2UV8A 4DR3F 2LLZA 3Q8QB 2LKZA 4USUA 2HQ3A 1GAOA 5LOQA 3O44A 1D09B 3FCHA 3KG0A 2RS2A 4QW8A 1NAQA 4DV5J 2CPEA 3QGGA 2C3YA 2RILA 3DLEB 1Q5VA 1WC3A 2VZ9A 4JB8B 2GQCA 5JJBA 2VQEJ 3HM9A 2CYYA 3D66A 3PM9A 4TQRA 1ZTTA 2W2QP 4XDDA 1KOHA 4DCPB 4Q45A 3JSMB 3H2LA 4G6VB 1PCAA 3FC9A 2O5DA 3KDOA 1U1KA 1WOPA 3U27A 1TL7A 2ZH3A 2ADBA 1FF2A 2RQMA 3BM7A 3M6WA 2OPPA 2UUTA 2WB1D 2WOMB 3KK2B 1EX8A 4HH0A 2QT7A 2NR0A 2R7OA 1MROB 1HI1A 2LQ5A 4CLUA 1QAIA 1IWGA 2BUNA 3FBFA 4FYYB 4RWWA 3MMCB 2B6AA 1HNZF 3KUGA 4NLYA 4C48A 3THVA 4LF8F 4LSLB 1OJ4A 2BOAA 1YBTA 2LQJA 2RHQB 3PACA 2IYIA 5A8RA 1SV5B 4C7QA 1T8EA 2KT5A 1LW0A 2LU2A 1KLMA 2RF2B 2HGNA 4IOBA 4UZCA 2MEWA 5E7OB 4P7VA 2QSWA 4WYLA 3PRDA 1NMEB 1K0VA 4DSLA 2VA2A 1S57A 4DR4F 2XLIA 2HNZA 4DWIA 4ZPVR 4DU8A 2FVRA 2AP6A 3AXMA 5D78A 2XWXA 5KFEA 1GH8A 2HNDA 3M8ZA 3T3FA 4KH1B 3VTIA 2CFXA 1L3TA 4DV2J 2CJBA 2E1AA 1Q82T 2J6TA 3R5GA 3G8SA 4CZCA 1RU1A 4RPFA 1CC8A 4ETZA 3S1TA 2GMJA 1SJRA 4A8SA 1SQFA 4I2QA 3HZGA 4N8OA 3EZOA 3PKMA 3UVJA 3EM1A 2DR8A 3QRQA 2BE2B 2CIMA 1S1WB 1RT6A 5LSOA 4V19J 1C0UB 1RHRB 3R6GB 4PEOA 2NXUA 4CO5A 1N8RT 5E33A 1RWVB 1FDNA 2ZITA 2MZ1A 3M8QB 3K89A 3D54A 2LEBA 3A8JA 1HNWJ 4HACA 4GO7X 3CCSS 4CH7A 3MDFA 2FC9A 2V8HA 1SC3B 2HURA 3GB0A 2XO7A 2AMCB 2YVSA 3FEYB 4L72B 4OI3A 3HVWA 1LWFA 4TKTA 2PEHA 1FJGF 3QRPA 1U6ZA 4DV3J 4GC6A 4ZVHA 1YITS 5L9XA 1J5EJ 1X60A 1HWLA 2CRLA 2APOA 3PXGa 1TUVA 3EJMA 3JQKA 3M8WA 4CRJA 4RUBA 3AJ1A 4F7VA 1BD6A 5A2QY 2R8HA 2UUBF 2Y8YA 4DR6F 2ASDA 1F5CA 1Y5LB 3HULA 3BBBA 2QX0A 2R2RA 4AL5A 4ZIWA 3MEGA 1KVJA 3KLVA 4J9MA 4O3SA 3UE2A 2KHCA 5HMXA 4DZDA 2IRXA 2MXYA 3TAMA 4Q2MA 1TV6A 2Z2MA 3M32A 5D0EA 2XY7A 2A6OA 2LQ9A 2IMWP 4V19X 5HSPA 3D28A 2RKIB 2XC9A 4CH0S 2HQGA 8ATCB 2FQQB 2XZDB 3HX9A 3MM6B 3CT9A 5JVHQ 2BJEA 3G9CA 1WDTA 7FD1A 3CCUS 4AYBD 1Y9OA 1H6KX 5ETOA 1FKOA 2KXNB 3N79A 3VGUA 3HVTB 4DSEA 1U1QA 4PXDA 4RX6A 5SZTA 1NK5A 4KJIA 2C3UA 3O6QA 3TA0A 1NXIA 2DJWA 2M9KA 4CO4A 2VU5A 1J5OA 4H4KC 3TYTA 3M9MB 1S12A 2KVIA 1EB0A 2HQIA 2B9YA 2VBYA 3CCWA 4LF4F 4TY8A 2VFVA 2FZCB 3A8EA 1VQKS 1NJXA 2UXBF 1R6YA 2Q79A 3MCSA 1WEZA 2PA8D 4G1QB 4UOFA 3X3UA 4X62J 4P9SA 3RBDA 1CVJA 4M5HA 1RT5A 3NMAA 2MKIA 4PG5A 4C6AA 2IRYA 3T9ZA 4N41A 2C2ZB 3HHLA 2RDJA 2IMOA 4A46A 1KFSA 1I3OB 5KFXA 3RR7A 4RW4B 5D4LA 3KLFB 3JTNA 3PHEA 3KJQB 2DO0A 2BXJA 1V3ZA 3NGUA 1E6VA 4OYIA 4ZPDA 3MFHA 1IUJA 3L9ZA 2CADA 2KG0A 2MGZB 1K8AT 4JV0A 3VGVA 4GKKJ 4M5IA 1YJWS 2DT9A 3QRRA 4DF8A 1SI9A 1T3OA 4DQPA 4DPWA 5J2QB 3R7BB 2RD5C 1YSJA 2JSXA 1RT6B 4RNNA 2MKJA 4YB7A 3IAM9 3T1YJ 2DNKA 4P74A 2AU0A 3UN3A 3H59A 1XNQF 1QVGR 3OTOF 2D9OA 2EK1A 1XMQF 3BYRA 3IBCB 4M5MA 4QR1A 1PYTA 1UZHA 2P9GA 5BJRA 1QY7A 3ISNC 1Z2ZA 3KLHB 2IJNA 1SQEA 4CLPA 4C2MA 3KFWX 2FVPA 3DHWC 2QMXA 2VIHA 2C22A 2QGFB 2P2CB 1QTMA 4IKAA 4TU7A 1FJ7A 2J76E 3W65A 3M1VB 4LQ9A 3IFEA 2AGPA 4JOUA 4NEYA 4OQJA 3J81Y 2W4CA 4DF4A 4HHHA 2UU9J 2OTJS 1Q0NA 1TVRA 1EJ7L 4OZ5A 5L1LA 1GXLA 3LWMA 3TAPA 1FDAA 2Z30B 2Y0BB 3VAGA 2OJ3A 1HNWF 2FHOB 4C4WA 4RU2A 2WTFA 3NBPB 1GEHA 1Q16B 4PWWA 2L08A 2AJ4A 1VBKA 2IJFA 3MD1A 5F41A 4UQGA 4ATNA 2UVRA 2E5HA 1OMSA 3BB5A 4EK2A 2MKKA 4UQTA 3SI8A 3W66A 1TV6B 3J7YU 1FKPA 2RIJA 2WSEC 2ZUAA 1S72S 1QE1B 1CJTA 2JLFA 1RHUB 2DYAA 4N5SA 4OV1A 4K5RA 2BEFA 3M9NB 3FMBA 5U47A 3OFFA 2CJ9A 3OV7A 3DLBA 3OUYA 4JI5J 1PSDA 5HN0A 3G96A 1FFWB 1I5OB 4LRAA 3GJRB 1TL7B 2I8EA 2YX4A 2GV1A 3NL0A 3A4TA 4AQYJ 5CYQA 4KE5A 5A8WA 4DR5J 2AEJA 3UCZP
chains in the Genus database with same CATH topology
2J6SA 3RZAA 2DVIA 4IG3B 5BR8F 1KQKA 4PG8A 3QIPA 3OHBA 3EYZA 2N3OA 1S1XA 2BZ2A 2F9JA 2K1RB 4YHHF 2JEJA 3RAXA 2VD3A 3TVYA 4RKUC 1ROFA 3EPIA 3BF4A 2BM1A 4QWDA 2D41A 4CCHA 2MZJA 4PKDB 2X1AA 4HEA9 5G4DA 3GYXB 2MZRA 3W2WB 4ICLA 3D5MA 2XCPA 2FVSA 3W2VA 3LUYA 1VK3A 2ASJA 1P8GA 4Q5VA 2VKRA 3J7ZT 3RU0A 1UA0A 4K4WA 2LA6A 3V4IB 1HW8A 2C42A 2JOQA 3CJ3A 3DGPA 2MY8A 4O44A 4B17A 3RR8A 3CCRS 3EXYA 2HMIB 3C6TB 3BN7A 4A47A 4RW9A 2F3JA 4C98A 4K50A 2DNGA 2NYIA 3QLHA 3PX4A 2CJQA 3M1VA 3CB4A 1KR4A 2K7KA 5L8RC 2M2BA 4WZQA 1RTIB 2ZDOA 4NXNF 2B9WA 3PW4A 2FLLA 2MB0B 1U2FA 5KFSA 1YJ9S 2E9ZA 3ICLA 3NCPA 3NBPA 2GIRA 1MMNA 4MYUA 3C46A 1X5TA 2DBBA 1WNEA 2J7KA 3GWCA 2WAQD 1CLFA 3UDLA 3KLIB 3IGVA 3VAHA 4B3OB 3ZZUA 1KLMB 1BC6A 3I9ZA 5AXNA 2FPHX 4LF6F 3LH2S 3NAHA 3IR5B 4ECTA 5KFIA 5B0CA 1FDDA 2J7WA 2Z0GA 1GXTA 3VQTA 3NNCA 1C1BB 1U1PA 3LALA 3MECB 2GJIA 2RQ4A 3CD7A 4P7TA 2ZBIA 1VBYA 2FJBB 3IRXB 1SB6A 4OZ0A 3KKFA 3FZ2A 4M5DB 3TNVA 5D6GA 5DM6Q 3HP6A 2DR7A 3MTJA 2M8DB 3IN5A 1RA7A 2DGWA 2J7UA 2QEXS 4QYRA 4RW8A 3HF5A 3I4HX 3OVBA 2YNIA 4LQ3A 3MUTP 1V3SA 2XMWA 4O3PA 2OAUA 4ZVGA 1MW7A 3VZIA 5A6PA 2RDIA 4RW4A 2VA3A 4OI0A 4K4ZA 2OSRA 5I3PA 3N6LA 5E3QA 5K8OA 4LMZA 1XBWA 4KV8A 1B0PA 4KO0B 5DLGA 3PVXA 1RT1B 2B0GA 3G71S 4RNOA 1G1XA 2IFXA 1RK8A 4WU2A 5K14B 2EPIA 4F4XA 2MZSA 2EC0A 1IKXB 2GW8A 3QYYA 3LP0A 1CC7A 5J2QA 4HI2A 4NLVA 3IGNA 1S0MA 5C25A 3TARA 1T94A 2PGCA 1JLQA 2CQ0A 3OPKA 1NHUA 4ZDNA 3HFKA 2NQPA 4IFYA 3VAMA 2HMIA 1QAJA 4DDFA 1S4FA 2BJDA 4RLEA 4H54A 2EFOA 1EETB 3QLHB 5A8KB 5IZHA 3HK2A 1SH2A 5CYJA 4J9OA 2JLEA 1OWXA 4HHJA 5KFVA 4LIWA 1AW0A 4F2RA 2RVJA 3JSMA 4HI1A 1N5VA 5J1EA 2XSFA 3TUIC 3EUNA 5DJBA 4I7FB 3T6JA 2VPYB 4O3OA 4KKOB 3LP2A 4OX8A 4R8UB 4IG0A 1HBOB 3DLJA 4MK9A 2B6AB 3CVKA 1HQUB 3MI7X 4EEYA 4C8ZA 2GO9A 1LFPA 3RAMA 4F3QA 3PV8A 1YGYA 2IVYA 3IWXA 1WHYA 3DRPB 3OL6A 3JB9k 1C1BA <